4JE1A

Crystal structure of thiol peroxidase from burkholderia cenocepacia j2315
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
174
structure length
174
Chain Sequence
AHHHHHHMSKVTLGGNPIDLAGTFPAVGAQAADFKLVGKDLADLSLASFAGKRKVLNIVPSLDTPTCATSTRKFNEAASSLDNTVVIVVSADLPFAATRFCTTEGLANVVTASTFRTGRAFANAYGVDVTSGPLNGLTARAVVVLDAQDKVIHAELVGEIKDEPNYDAALAALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable thiol peroxidase
publication title Crystal structure of thiol peroxidase from BURKHOLDERIA CENOCEPACIA J2315
rcsb
source organism Burkholderia cenocepacia
molecule tags Oxidoreductase
total genus 53
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature ec 1.11.1.-:
pdb deposition date 2013-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4je1A00
4ISDA 1Z7RA 5JCUA 1SKSB 3QOUA 4WR4A 16GSA 3H1NA 1GTUA 5J5NA 3BOAA 1ERVA 1SK2A 3QFBC 5AISA 5IOWA 3TKPA 2YP6A 3Q18A 3FZ9A 1GUMA 3IC4A 4JRRA 2RUEA 1OC3A 3F63A 2LRCA 1WE0A 4JR6A 2EIOA 1PX7A 1OC9A 2PVOC 1Y25A 4PQHA 1JLVA 2XBQA 2NVLA 3WD6A 1AQVA 3BCKA 2E7PA 3VPQA 2VL2C 4F03A 1M9BA 1A0FA 3FR6A 2IFQB 2JACA 3U6VA 1KEBA 3LYPA 2C1YA 1V57A 4JU5A 2P5QA 4RI7A 2VCWA 5G31A 1GSUA 4MF5A 2LUSA 12GSA 4EF0A 3WYWA 2GSTA 5IMVA 4FIWA 3Q6OA 3UBLA 3M8NA 2CVBA 1EEJA 4AJ7A 1XWBA 1K0OA 4ID0A 2QSIA 1GSDA 2XPDA 4DSRA 4MZWA 3SBCA 4V2NA 1UN2A 3F4RA 2A2SA 1JFUA 4GSSA 1MTCA 2R2JA 2QKEA 1FB0A 5J3RA 3S9FA 4PX1A 3W8JA 4YH2A 5ECQB 2Z9SA 2C3QA 2JL4A 3GUSA 2FGXA 3VFIA 3C71A 1GTIA 3ERFA 2PWJA 4RQRA 2DMLA 3I69A 4IKHA 1XPVA 4HDEA 4GWRA 3TJFA 2PN8A 3M0FA 2VL2A 5ELGA 2FWEA 2O7KA 1BG5A 3GYKA 3O6TA 4KGIA 1EOGA 2LJAA 4J2FA 4MZBA 4F9ZA 2YPMA 3LXZA 1T8EB 2R3XA 1BQ7A 3FZ5A 4HZ4A 3KM6A 3GH9A 3VWUA 4PURA 4K0GA 2C3TA 2WFCA 4XS6A 4HUAA 4KDXA 1AXDA 5F8BA 1TK5B 1Q98A 1A2LA 3FRCA 1EWXA 1C72A 4HEA2 1K0BA 3WT1A 4GTUA 2IMFA 1A0RP 2JZTA 3DXBA 4NXIA 2IIYA 1YDKA 4DSSB 2YOIA 2PERA 2F3MA 2ZNMA 5EVOA 2TIRA 1FHEA 1PKWA 4LLRA 3WGDA 5H5QA 2JSZA 4LL4B 4ACSA 2WZ9A 3DYRA 1O6JA 1YZXA 3MAKA 4PXOA 2HSHA 3KXOA 2LQOA 3I9V2 4K0NA 2EIRA 5CNWA 2H1DA 5FWGA 5GSSA 4NV5A 3HHVA 3BD2A 4YQMA 2E2MA 2GSQA 4OCFA 1WOUA 1M0UA 3TGZA 4WBJA 5A4WA 2WS2A 1GTAA 4AJ6A 3ZTLA 2FUG2 1JZWA 3TKSE 14GSA 2MMOA 2CX3A 1J08A 5ECHB 3EU3A 3ZITA 4NPBA 4Q5NA 5DJLA 2LRTA 1FVKA 5C00A 1XZOA 4KB3A 5GAPD 2VIMA 4V1Ap 3J7Yk 2HXKA 4L5LA 2F9SA 4EC0A 3P2AA 5E59A 1F2EA 4TN8A 2IJYA 1SJZA 1MDKA 5G1LA 4MPFA 3GKKA 1UVZA 1XFLA 2IMIA 1VF4A 1YY7A 3QAGA 4MJBA 3LGCA 1ZZYA 4G10A 4EVMA 1XWCA 5G5FA 5FT3A 4E8HA 1SENA 2R5GA 4TR4A 4FO5A 2GLRA 1U6TA 3LYKA 2NPBA 1Z3EA 2GTUA 3VI7A 1U3IA 2VCXA 1MEKA 2H6ZA 1SL0B 5DDLA 3FZAA 1PA3A 1JHBA 3G7IA 4GCIA 4HQZA 2GVPA 1HYUA 2V1MA 2C80A 2CZ2A 5EPFA 5A4VA 2V6KA 3R2QA 2RLIA 3KJYA 4EUYA 2JZRA 9GSSA 2FD3A 3C7MA 4O92A 4Z7XA 1W4VA 3TRPA 4L0WA 1GSEA 3KD0A 2H0GA 3NZNA 3FYGA 2V2GA 4JEDA 4MH2A 2H6XA 2DIYA 4JBBA 4HU9A 5AIXA 1J0FA 3DVWA 4WF4A 2JU5A 5EY6A 4WETA 2KOKA 3CSHA 5KN0A 2HYXA 4OWYA 3CTFA 4YAPA 2K6VA 3UL3A 4YAVA 4K1FA 3FR3A 3IR4A 5F06A 1X9MB 5G30A 1M2AA 4TR0A 1G6YA 4G9HA 1QFNA 4GXZA 1MDJA 2A2RA 3H93A 2CAQA 3C73A 3OR5A 1TDIA 1TOFA 4BVYA 4PQIA 2VM1A 5IMAA 1PMTA 4CW9A 3F3QA 2WGRA 3DRNA 2ZUPA 5D93A 1T7PB 4MJCA 4I2TA 1JZRA 3E3EA 4Q5RA 1YF1A 1K0DA 3P8WA 3I43A 2F51A 4IJIA 2XPEA 3GKNA 1GTBA 2H0HA 3F8UA 3QAVA 2OBIA 5DCGA 3GSSA 1WRYA 2LQQA 3QFAC 4TXOA 3D0ZA 6GSUA 1I9DA 4NHWA 3DMLA 3HJMA 1WP0A 5HR0A 2FWHA 4WKWA 2I1UA 3QMXA 1Q4JA 1OC9B 2VCZA 2GZPA 3EVIA 3LEFA 4POMA 5HR1A 3F0IA 1DE1A 4IJ3A 2I4AA 3L9SA 3GMFA 1XWKA 4TW5A 1SL1B 2MMNA 1TRUA 20GSA 3IV4A 1JZOA 2A4VA 3RDWA 4X43A 4KW6A 5DQYA 2HT9A 1T3BA 3H4KA 2OBKA 3A2XA 3EE2A 2GT6A 4XCSA 2E0QA 1WJKA 1V9WA 2CVKA 2HRNA 3DEXA 3W6GA 4ZBDA 2CT6A 4LA1A 5INYA 1PRXA 1E2YA 3RHBA 1EGRA 2HI7A 3M9KA 4OMVA 2H66A 3GHAA 2GQKA 2K8VA 1YEPA 4HJ2A 2HZEA 3FW2A 3TOTA 1GSFA 4MLYA 3LORA 2YWNA 3IDVA 1BAYA 4TR3A 1F3AA 5COHA 4IQ1A 5E4WA 1GSYA 2NDOA 4JR4A 1CQHA 1SK0A 1NSWA 4IVFA 3LFLA 5DAKA 2B5EA 2WB9A 3EU4A 1VGLA 4MABA 5D73A 1NHOA 1TW9A 2DLXA 3A5WA 4XS1A 5B8BA 4EKZA 1T4YA 3KZQA 3GL5A 1OYJA 3HY2A 2DJ3A 4K8MA 4TR1B 3L78A 3MNGA 4N11A 1YKAA 3DGQA 1ZGNA 2WRTA 2YN1A 3EURA 6GSVA 3FK8A 3L9UA 2H6YA 4NWYA 4XHMA 2GSSA 4IQAA 1GNEA 4KCEA 3VURA 2X8GA 1E6BA 2N5FA 4OFTA 1R5PA 2H1BA 1F37A 4ZL7A 1SL2B 1FO5A 2F8FA 4N10A 5KN3A 5JCGA 2OKAA 3VWXA 3C1RA 3GFKA 4NAXA 5ID2A 5CRDA 1TK0B 13GSA 4H86A 3QD9A 5IM9A 2C4JA 1EZKA 2REMA 4WEYA 2K9FA 5CO3A 4DEJA 2MBTA 4DSQA 4EDYA 4FYCA 3TRXA 1ML6A 1X5CA 17GSA 4WXTA 1X0RA 3D21A 1B9YC 3EMXA 1R26A 2O89A 3ZMKA 1XW9A 4LMWA 3ZRDA 4GRFA 5CAXA 1M2DA 4KSMA 4JZQA 18GSA 1HD2A 2AJQB 1PSQA 4PGTA 5ECIB 3KIJA 2QC7A 4BL7A 3TJJA 2GGTA 2LKUA 2ALBA 2YCDA 3IAS2 1EP7A 1XOAA 4ZB8A 3US3A 2ES7A 2OE1A 3DIEA 4QQ7A 5HFIA 4IELA 3TJGA 4ZBAA 1WPIA 2M72A 3HJOA 3D4TA 3TUEA 3ZL5A 1PX6A 1TP9A 3FHKA 3HVSA 2H8LA 3ED3A 3G7YA 5LNKe 4L8EA 2LTKA 1TJDA 1UA5A 1SKRB 2MBSA 3RHCA 5J9BA 1ABAA 2VCTA 5J4UA 3KGKA 5IMDA 2DJ0A 1Z6NA 4MJAA 1PL1A 2R6KA 4XIHA 5G1KA 5IPHA 1WWJA 3FEUA 1FVJA 2MZCA 3E9JB 2VCQA 3GIXA 3HDCA 1LBKA 2GZYA 4K7IA 2LSTA 2IWTA 1ZL9A 5ELAA 2K18A 1IYIA 3LSZA 5JWQB 3KH7A 1A23A 2H19A 1MDIA 2I3YA 4O7HA 5GZZB 5EL8A 4LMVA 1BJXA 4KUNA 5DALA 2ZCTA 2VUPA 4F0CA 1TXXA 4ECJA 1UC7A 3ME7A 1K3OA 3KP9A 4I97A 1N2AA 2I9HA 4HJMA 1NHYA 3C8EA 4TVEA 4O5RA 4HU7A 2L4CA 1SK1A 1U3AA 3U5RE 1ZYQB 4HI7A 1BX9A 1V40A 1QGVA 3HZ4A 4GSNA 6GSTA 1BEDA 1PKZA 4KAEA 5ECKB 3LQ7A 3HA9A 3IK9A 2VM2A 5D9XA 3KP8A 3IAM2 3IK7A 4BWQA 2C0GA 3TJBA 8GSSA 1U88A 4NV2A 2G0FA 1B48A 3N9JA 4KCAA 2KUCA 1T1VA 3J7Yb 1HNAA 1R7HA 2P31A 3QPMA 1SU9A 3ERWA 5GAND 5CRWA 3QDNA 1VF1A 4KA0A 2L57A 4TXOB 5IMCA 4E8EA 1EV4A 3LWAA 2H73A 3APQA 3KCMA 1EEMA 4TOPA 1FW1A 4POKA 1THXA 1I5GA 3UMAA 1RQMA 1GH2A 2B7JA 4KSOA 3PR8A 3HZ8A 3ZREA 2FNOA 3IE3A 2FLSA 3VLNA 2LS5A 3RAZA 2HZFA 1FOVA 2ON5A 3ZMLA 5D9WA 3KH9A 1TU8A 3ZZXA 2HRFA 4I8BA 1O85A 1OE7A 2XBIA 1GSQA 5F07A 3NOFA 3CSIA 3N5OA 4XRDA 3JCML 2CA8A 5IOXA 5A5KA 2CX4A 2VO4A 1RK4A 1H4OA 5J9CA 4ULXA 1ACVA 3F9UA 1AIUA 4XS4A 3D6IA 3MWHA 1GP1A 4N30A 1LU4A 1J9BA 2IL3A 2GQLA 4POLA 2AHEA 1HNCA 1TRVA 1LJRA 2HZEB 3UJ1A 1AQWA 4ZL8A 3HKRA 4ZL9A 1A2JA 2DBCA 3VI5A 2C3NA 1GL8A 4IS0A 4OFMA 3F3RA 2DIZA 3Q74A 3HYPA 2PMTA 5DAKB 4MJEA 2OJLA 4V2LA 4JE1A 4P3YB 1TKDB 1R5AA 5HR2A 1PQNA 5KN1A 3EYTA 2CVDA 4FH8A 4EL1A 2AYTA 4ZB6A 1YJ6A 4YQVA 5F05A 5L71A 4MZCA 5AIVA 3UARA 4CDOA 4PUAA 3BCIA 19GSA 3L9VA 1WIKA 4EO3A 2GQMA 1Z7PA 1QK8A 1SD8A 5CP1A 2GS3A 3ERGA 3GSTA 1RW1A 3Q19A 5B6NA 2L4QA 2NTOA 6GSYA 5ECRB 5HFKA 1EOHA 2AV4A 5KEJA 1U87A 2MMAA 2H70A 4MMMA 3D5JA 3TKSC 1H75A 2KHPA 2XC2A 2DJKA 1OVNA 2FCHA 5ID2B 1O8XA 1XVQA 4HQSA 1M2BA 2P0GA 3CRTA 1ERWA 2M46A 2PGTA 5CRHA 5ECSA 4BWSA 4PNFA 5FHIA 2C8UA 2DJ2A 1B8XA 3UAPA 2F8AA 1A8YA 3SWLA 3M3MA 5D96A 3VWVA 3F6DA 3TDGA 3GRXA 5CREA 3FR9A 5LCZA 2PPTA 4BPYA 4X0XA 4F82A 4EDZA 2JADA 4KDUA 1A24A 3WGEA 3QAWA 4IHUA 1AAZA 4TKYA 3GX0A 2HSYA 4FYUA 2L59A 5KN2A 4IBPA 2E2GA 1S3DA 3UBKA 2M80A 5G2ZA 4F2IA 3TKSA 1ZYEA 2MYGA 4QL7A 1XBSA 1ZOFA 5A4UA 3EWLA 2FWFA 4DVCA 1XIYA 5B6MA 1X5EA 2RUFA 4AJ8A 2L5OA 2H76A 6GSWA 1OKDA 4MK3A 5DVBA 3WGXA 3M1GA 2H1GA 4TXVA 2QGVA 2VOCA 1K0AA 3L0HA 2H1AA 1XXUA 1JLWA 2VLUA 1ST9A 2BJXA 2KLXA 3D22A 1Z6MA 5IMZA 1G0TA 3CXGA 4ZILA 1XCCA 4MP4A 1Z9HA 4ECBA 1V2AA 1KTEA 4XTSA 3H8QA 3RPPA 1G7EA 1KBNA 4GSTA 3FZ4A 6GSSA 1SJIA 4TRXA 1HNBA 3A3TA 4K9ZA 2LV3A 4AF2A 5DALB 3ZVJA 4ML1A 22GSA 1TRWA 1XOBA 5HR3A 3HJPA 4N0ZA 1TK8B 3ZFLA 3EINA 3D4MA 3G7JA 2AB6A 2YJHA 4ZXGA 3CRUA 2WDUA 3KTBA 3IOSA 3M9JA 1G7OA 5IQYA 1TI1A 2YV9A 3ZYWA 2C0FA 6GSXA 5ECPB 2DSAA 2FWGA 2L6DA 1OE8A 2RM5A 3DVXA 4L5OA 3ME8A 5JWRB 4YQUA 2O8VB 3CTGA 2H71A 3C1SA 2IN3A 3FY7A 4MDCA 2TRCP 1WMJA 3CMIA 3G9BA 3K8NA 1YEXA 1URMA 2LNSA 4CHSA 3GV1A 2PU9C 4FYBA 1PN9A 4ZIJA 4IGJA 1K0CA 3IHQA 2RIIA 3CSJA 2YZUA 3DKSA 1R4WA 1GRXA 2LRNA 4EE0A 2O85A 2YWMA 2VAFA 5IIZA 1JZDA 4N0VA 3UOMA 1SD9A 4K2DA 4ZBBA 1G6WA 5ABRA 3TOUA 2LJKA 1USBA 2OACA 2AAWA 2N5BA 2X64A 3QR6A 2MMZA 3A2VA 3RBTA 2HNLA 4KNDA 4ZB9A 1DBYA 3GTUA 5D9VA 2R37A 1CQGA 2GSRA 3L4NA 4XS4B 4KE3A 1GWCA 3HVVA 4K7OA 5B7CA 4OFNA 4D73A 3AY8A 2PVQA 2K8SA 2BTOT 2O87A 2YWOA 4TR1A 2FHEA 2X99A 3GX8A 2PUKC 3PINA 3UVHA 1PGTA 2N5AA 2B1LA 4HZ2A 1X9WB 4GLTA 4HOJA 1EV9A 3ZFBA 1PL2A 3IPZA 3ZIJA 1AC1A 5C04A 1TTZA 2H01A 2EIQA 2B5YA 1S3CA 1PD21 2H30A 1F6MC 4IP1A 1TRSA 1SYRA 3NIVA 4G2EA 1TI3A 4MCUA 5DBQA 1YQ1A 2RM6A 4ECCA 4LL1B 2FA4A 2I81A 4J57E 1EP8A 1K0MA 5GSTA 3MSZA 1GLQA 2D2ZA 5H5SA 3UIWA 3KTLA 1K0NA 4PUFC 2L6CA 1FAAA 1B9XC 2VL9A 3QCPA 4I6XA 3IA1A 1V58A 4ML6A 2H72A 5DQSA 4ECIA 2IFQA 3GURA 4EXJA 4RI6A 3E0UA 1F9MA 1X9SB 5ECMB 3W8SA 2TRXA 3TJKA 2CV4A 2OE3A 2LEGA 2FY6A 3ZIVA 1IYHA 1MD4A 2VCVA 4OO5A 1KNGA 1ZMAA 5AN1A 5IO2A 3P90A 5J41A 1B4QA 2DMMA 2J9HA 4ILFA 2KP1A 2JSYA 4MPGA 4OD7A 4XRAA 1AQXA 5IMFA 4F0BA 2H74A 1DE2A 1XWAA 2CQ9A 3VK9A 3EMPA 1O7UA 2H0IA 2OE0A 1O8WA 1VRSD 3RPNA 4O32A 4GQCA 1ERTA 3GH6A 1O81A 5G5EA 1QXHA 1ON4A 1AUCA 2EC4A 3V1WA 11GSA 3P7XA 2DC5A 4V2MA 5IPGA 3KMNA 2H75A 1QQ2A 4WBRD 1XW5A 4RUVA 1VF3A 1THOA 3F4TA 2OADA 1HQOA 5IO0A 1XWGA 3GN3A 5B8AA 2GZZA 2LJRA 7GSSA 3IRAA 2BMXA 2XHFA 3FKFA 4NHZA 3WT2A 2B1KA 1FB6A 3TB2A 2J23A 3GNJA 5ENUA 4X1UA 4Q5FA 2IPAA 3GKXA 4DSSA 1M9AA 4IN0A 2VLTA 3VPTA 4PQ1A 4GF0A 4I5QA 1M99A 3ISOA 2YJ7A 1DSBA 4PNGA 3IBHA 3KMOA 2YZHA 2IMEA 4L0UA 1XVWA 1NM3A 1Y6EA 1B4PA 3HXSA 2WCIA 4GQFA 3BBYA 2B5XA 3TRQA 2LNTA 4KX4A 1O73A 1Z5YE 2HLSA 5LD0A 3TCOA 4MF6A 3UVTA 4Q5QA 3F4SA 4MA9A 3LG6A 5F0GA 3CYNA 2R4VA 1OKTA 1M7TA 3APOA 4BA7A 1EGOA 1OC8A 5DCHA 2AUVA 2L5LA 2VD0A 2X8CA 4QL9A 1TU7A 2X8HA 2GT5A 5ECNB 1GLPA 2B7KA 3O3TA 2G2QA 1ILOA 3HCZA 3EC3A 5ECLB 1ZCPA 3PGTA 2ON7A 2YV7A 3GA4A 4AGSA 4IW9A 4MF7A 1NW2A 3GKMA 1YF0A 2V41A 1ERUA 1YKCA 4K6XA 1N8JA 1X5DA 3DD3A 3DWVA 2HFDA 1DUGA 2DJ1A 4BVXA 2C0DA 2YWIA 1VF2A 5H5RA 3HVXA 1FG4A 3F6FA 4IP6A 2JZSA 3UEMA 5HFGA 4MH3A 2B6MA 5D9TA 5CYYA 1GUKA 4G19A 2C0EA 1XW6A 3LJRA 4I2UA 1V98A 4WF5A 5DJMA 5JCWA 4J56E 3MDKA 2V6OA 3I6AA 2CZ3A 1T4ZA 1A8LA 1QMVA 2VLVA 3H79A 2KP2A 2OA7A 2P5RA 3IXRA 3TKRA 3O76A 3LXTA 1F3BA 5JWOB 2NBSA 1K3LA 2VL3A 2WJUA 1BYEA 2GDRA 4K7NA 3TKQA 2YNXA 1OAZA 5CRGA 3PH9A 4WR5A 5HQPA 2WULA 1T00A 4OO4A 2FA8A 1K3YA 4NMUA 3GL3A 1QUWA 1GUHA 3HD5A 3ZVJD 1SKWB 1MD3A 1W89A 3BJ5A 3CBUA 4KH7A 5ECOB 2YANA 1GSSA 1S3AA 2B3SA 2CAIA 2DJJA 3A2WA 3KEBA 3VWWA 5D8IA 4KDYA 4V1Ag 2HE3A 1GNWA 3APSA 3GTUB 4POBA 4RQXA 2VD1A 1SJ6A 1SYXA 2V32A 4D73B 1GULA 2IMDA 2PBJA 5AGYA 4OCEA 1AW9A 3ZLPA 10GSA 2IMKA 1A2MA 4HS1A
chains in the Genus database with same CATH superfamily
4ISDA 1Z7RA 5JCUA 1SKSB 3QOUA 4WR4A 16GSA 3H1NA 1GTUA 5J5NA 3BOAA 1ERVA 1SK2A 3QFBC 5AISA 5IOWA 3TKPA 4Z2UA 2YP6A 3Q18A 3FZ9A 1GUMA 3IC4A 4JRRA 2RUEA 1OC3A 3F63A 2LRCA 1WE0A 4JR6A 2EIOA 1PX7A 1OC9A 2PVOC 1Y25A 4PQHA 1JLVA 2XBQA 2NVLA 3WD6A 1AQVA 3BCKA 2E7PA 3VPQA 2VL2C 4F03A 1M9BA 1A0FA 3FR6A 2IFQB 2JACA 3U6VA 1PFOA 1KEBA 3LYPA 2C1YA 1V57A 4JU5A 2P5QA 4RI7A 2VCWA 5G31A 1GSUA 4MF5A 2LUSA 12GSA 4EF0A 2QA1A 3WYWA 2GSTA 5IMVA 4FIWA 3Q6OA 3UBLA 1S3RA 3M8NA 2CVBA 1EEJA 4AJ7A 1XWBA 1K0OA 4ID0A 2QSIA 1GSDA 2XPDA 4DSRA 4MZWA 3SBCA 4V2NA 1UN2A 3F4RA 2A2SA 1JFUA 4GSSA 1MTCA 2R2JA 2QKEA 1FB0A 5J3RA 3S9FA 4PX1A 3W8JA 4PTSA 4YH2A 5ECQB 2Z9SA 2C3QA 2JL4A 3GUSA 2FGXA 3VFIA 3C71A 1GTIA 3ERFA 2PWJA 4RQRA 2DMLA 3I69A 4IKHA 1XPVA 4HDEA 4GWRA 3TJFA 2PN8A 3M0FA 2VL2A 5ELGA 2FWEA 2O7KA 1BG5A 3GYKA 3O6TA 4KGIA 1EOGA 4USSA 2LJAA 4J2FA 4MZBA 5BMUA 4F9ZA 2YPMA 3LXZA 1T8EB 2R3XA 1BQ7A 3FZ5A 4HZ4A 3KM6A 3GH9A 3VWUA 4PURA 4K0GA 2C3TA 2WFCA 4XS6A 4HUAA 4KDXA 1AXDA 5F8BA 4Z2RA 1TK5B 1Q98A 1A2LA 3FRCA 1EWXA 1C72A 4HEA2 1K0BA 3WT1A 4GTUA 2IMFA 1A0RP 2JZTA 3DXBA 4NXIA 2IIYA 1YDKA 4DSSB 2YOIA 2PERA 2F3MA 2ZNMA 5EVOA 2TIRA 1FHEA 1PKWA 4LLRA 3WGDA 5H5QA 2JSZA 4LL4B 4ACSA 2WZ9A 3DYRA 1O6JA 1YZXA 3MAKA 4PXOA 2HSHA 3KXOA 2LQOA 3I9V2 4K0NA 2EIRA 5CNWA 2H1DA 5FWGA 5GSSA 4NV5A 3HHVA 3BD2A 4YQMA 2E2MA 2GSQA 4OCFA 1WOUA 1M0UA 3TGZA 4WBJA 5A4WA 2WS2A 1GTAA 4AJ6A 3ZTLA 2FUG2 1JZWA 3TKSE 14GSA 2MMOA 2CX3A 1J08A 5ECHB 3EU3A 3ZITA 4NPBA 4EIQA 4Q5NA 5DJLA 2LRTA 1FVKA 5C00A 1XZOA 4KB3A 5GAPD 2VIMA 4V1Ap 3J7Yk 4G0IA 2HXKA 4L5LA 2F9SA 4EC0A 3P2AA 5E59A 1F2EA 4TN8A 2IJYA 1SJZA 1MDKA 5G1LA 4BVXB 4MPFA 3GKKA 1UVZA 1XFLA 2IMIA 1PN0A 1VF4A 1YY7A 3QAGA 4MJBA 1ZYPA 3LGCA 1ZZYA 4G10A 4EVMA 1XWCA 4G0LA 5G5FA 5FT3A 4E8HA 1SENA 3MIXA 2R5GA 4TR4A 4FO5A 2GLRA 1U6TA 3LYKA 2NPBA 1Z3EA 2GTUA 3VI7A 1U3IA 2VCXA 1MEKA 2H6ZA 1SL0B 5DDLA 3A5IA 3MYDA 3FZAA 1PA3A 1JHBA 3G7IA 4GCIA 4HQZA 2GVPA 1HYUA 2V1MA 2C80A 2CZ2A 5EPFA 5A4VA 2V6KA 3R2QA 2RLIA 3KJYA 4EUYA 2JZRA 9GSSA 2FD3A 3C7MA 4O92A 4Z7XA 1W4VA 3TRPA 4L0WA 1GSEA 3KD0A 2H0GA 3NZNA 3FYGA 2V2GA 4JEDA 4MH2A 2H6XA 2DIYA 4JBBA 4HU9A 5AIXA 1J0FA 3DVWA 4WF4A 2JU5A 5EY6A 4WETA 2KOKA 3CSHA 5KN0A 2HYXA 4OWYA 3CTFA 4YAPA 2K6VA 3UL3A 4YAVA 4K1FA 3FR3A 3IR4A 5F06A 1X9MB 5G30A 1M2AA 4TR0A 1G6YA 4G9HA 1QFNA 4GXZA 1MDJA 2A2PA 2A2RA 3H93A 2CAQA 3C73A 3OR5A 1TDIA 1TOFA 4BVYA 4PQIA 2VM1A 5IMAA 1PMTA 4CW9A 3F3QA 4CY8A 2WGRA 3DRNA 2ZUPA 5D93A 1T7PB 4MJCA 4I2TA 1JZRA 4O5UA 3E3EA 4Q5RA 1YF1A 1K0DA 3P8WA 3I43A 2F51A 4IJIA 2XPEA 3GKNA 1GTBA 2H0HA 3F8UA 3QAVA 2OBIA 2HRAA 3GSSA 1WRYA 2LQQA 5DCGA 3QFAC 4TXOA 3D0ZA 6GSUA 1I9DA 4NHWA 3DMLA 3HJMA 1WP0A 5HR0A 2FWHA 4WKWA 2I1UA 3QMXA 1Q4JA 1OC9B 2VCZA 3HVNA 2GZPA 3EVIA 3LEFA 4POMA 5HR1A 3F0IA 1DE1A 2UZ8A 4IJ3A 2I4AA 3L9SA 3GMFA 1XWKA 4TW5A 1SL1B 2MMNA 1TRUA 20GSA 2R0PA 3IV4A 1JZOA 2A4VA 3RDWA 4X43A 4KW6A 5DQYA 2HT9A 1T3BA 3H4KA 2OBKA 3A2XA 3EE2A 2GT6A 4XCSA 2E0QA 1WJKA 1V9WA 2CVKA 2HRNA 3DEXA 3W6GA 4ZBDA 2CT6A 4LA1A 5INYA 1PRXA 1E2YA 3RHBA 1EGRA 2HI7A 3M9KA 4OMVA 2H66A 3EPTA 3GHAA 2GQKA 2K8VA 1YEPA 4HJ2A 2HZEA 3FW2A 3TOTA 1GSFA 4MLYA 2DKHA 3LORA 4ICYA 2YWNA 3IDVA 1BAYA 4TR3A 1F3AA 5COHA 4IQ1A 5E4WA 1GSYA 2NDOA 4JR4A 1CQHA 1SK0A 1NSWA 4IVFA 3LFLA 5DAKA 2B5EA 2WB9A 3EU4A 1VGLA 4MABA 5D73A 1NHOA 1TW9A 2DLXA 4EIPA 3A5WA 4XS1A 5B8BA 4EKZA 1T4YA 3KZQA 3GL5A 1OYJA 3HY2A 2DJ3A 4K8MA 4TR1B 3L78A 3MNGA 4N11A 1YKAA 3DGQA 1ZGNA 2WRTA 2YN1A 3EURA 6GSVA 3FK8A 3L9UA 2H6YA 4NWYA 4XHMA 2GSSA 4IQAA 1GNEA 4KCEA 3VURA 2X8GA 1E6BA 2N5FA 4OFTA 1R5PA 2H1BA 1F37A 4ZL7A 1SL2B 1FO5A 2F8FA 4N10A 5KN3A 5JCGA 2OKAA 3VWXA 3C1RA 3GFKA 4NAXA 5ID2A 5CRDA 1TK0B 13GSA 4H86A 3QD9A 5IM9A 2C4JA 1EZKA 2REMA 4WEYA 2K9FA 4MNNA 5CO3A 4DEJA 2MBTA 4DSQA 4EDYA 4FYCA 3TRXA 4BIKA 1ML6A 1X5CA 17GSA 4WXTA 1X0RA 3D21A 1B9YC 3EMXA 1R26A 2O89A 3ZMKA 1XW9A 4LMWA 3ZRDA 4GRFA 5CAXA 1M2DA 4KSMA 4JZQA 18GSA 1HD2A 2AJQB 1PSQA 4PGTA 5ECIB 3KIJA 2QC7A 4BL7A 3TJJA 4YKGA 2GGTA 2LKUA 2ALBA 2YCDA 3IAS2 1EP7A 1XOAA 4ZB8A 3US3A 2ES7A 2OE1A 3DIEA 4QQ7A 5HFIA 4IELA 3TJGA 4ZBAA 1WPIA 2M72A 3HJOA 3D4TA 3TUEA 3ZL5A 1PX6A 3IHGA 1TP9A 3FHKA 3HVSA 2H8LA 3ED3A 3G7YA 5LNKe 4L8EA 2LTKA 1XG8A 1TJDA 1UA5A 1SKRB 2MBSA 4CY6A 3RHCA 5J9BA 4K2XA 1ABAA 4K5SA 2VCTA 5J4UA 3KGKA 3LW9A 5IMDA 2DJ0A 1Z6NA 4MJAA 1PL1A 2R6KA 4XIHA 5G1KA 5IPHA 1WWJA 2A4HA 3FEUA 1FVJA 2MZCA 3E9JB 2VCQA 3GIXA 1ZYNA 3HDCA 1LBKA 2GZYA 4K7IA 2LSTA 2IWTA 1ZL9A 5ELAA 2K18A 1IYIA 3LSZA 5JWQB 3KH7A 1A23A 2H19A 1MDIA 2I3YA 4O7HA 5GZZB 5EL8A 4LMVA 1BJXA 4KUNA 5DALA 2ZCTA 2VUPA 4F0CA 1TXXA 4ECJA 1UC7A 3ME7A 1K3OA 3KP9A 4I97A 1N2AA 2I9HA 4HJMA 1NHYA 3C8EA 4TVEA 4O5RA 4HU7A 2L4CA 1SK1A 1U3AA 3U5RE 1ZYQB 2QA2A 4HI7A 1BX9A 1V40A 1QGVA 3HZ4A 4GSNA 6GSTA 1BEDA 1PKZA 4KAEA 5ECKB 3LQ7A 3HA9A 3IK9A 2VM2A 4BVYB 5D9XA 3KP8A 3IAM2 3IK7A 4BWQA 2C0GA 3TJBA 8GSSA 1U88A 4NV2A 2G0FA 1B48A 3N9JA 4KCAA 2KUCA 1T1VA 3J7Yb 1HNAA 1R7HA 2P31A 3QPMA 1SU9A 3ERWA 5GAND 5CRWA 3QDNA 1VF1A 4KA0A 2L57A 4TXOB 5IMCA 4E8EA 1EV4A 3LWAA 2H73A 3APQA 3KCMA 1EEMA 4TOPA 1FW1A 4POKA 1THXA 1I5GA 3UMAA 1RQMA 1GH2A 2B7JA 4KSOA 3PR8A 3HZ8A 3ZREA 2FNOA 3IE3A 4YKFA 2FLSA 3VLNA 2LS5A 3RAZA 2HZFA 1FOVA 2ON5A 3ZMLA 5D9WA 3KH9A 1TU8A 3ZZXA 2HRFA 4I8BA 1O85A 1OE7A 2XBIA 1GSQA 5F07A 3NOFA 3CSIA 3N5OA 4XRDA 3JCML 2CA8A 5IOXA 5A5KA 2CX4A 2VO4A 1RK4A 1H4OA 5J9CA 4ULXA 1ACVA 3F9UA 1AIUA 4XS4A 3D6IA 3MWHA 1GP1A 4N30A 1LU4A 1J9BA 2IL3A 2GQLA 4POLA 2AHEA 1HNCA 1TRVA 1LJRA 2HZEB 3UJ1A 1AQWA 4ZL8A 3HKRA 4ZL9A 1A2JA 2DBCA 3VI5A 2C3NA 1GL8A 4IS0A 4OFMA 3F3RA 2DIZA 3Q74A 3HYPA 2PMTA 5DAKB 4MJEA 2OJLA 4V2LA 4JE1A 4P3YB 1TKDB 1R5AA 5HR2A 1PQNA 5KN1A 3EYTA 2CVDA 4FH8A 4EL1A 2AYTA 4ZB6A 1YJ6A 4YQVA 5F05A 5L71A 4MZCA 5BRTA 5AIVA 3UARA 4CDOA 4PUAA 3BCIA 19GSA 3L9VA 1WIKA 4EO3A 2GQMA 1Z7PA 1QK8A 4FQUA 4O5QA 1SD8A 5CP1A 2GS3A 3ERGA 3GSTA 1RW1A 3Q19A 5B6NA 4HSCX 2L4QA 2NTOA 6GSYA 5ECRB 5HFKA 1EOHA 2AV4A 5KEJA 1U87A 2MMAA 2H70A 4MMMA 3D5JA 3TKSC 1H75A 2KHPA 2XC2A 2DJKA 1OVNA 2FCHA 5ID2B 1O8XA 1XVQA 4HQSA 1M2BA 2P0GA 3CRTA 1ERWA 2M46A 2PGTA 5CRHA 5ECSA 4BWSA 4PNFA 5FHIA 2C8UA 2DJ2A 1B8XA 3UAPA 2F8AA 1A8YA 3SWLA 3M3MA 5D96A 3VWVA 3F6DA 3TDGA 3GRXA 5CREA 3FR9A 5LCZA 2PPTA 4BPYA 4X0XA 4F82A 4EDZA 2JADA 4KDUA 4BL7B 1A24A 3WGEA 3QAWA 4IHUA 1AAZA 4TKYA 3GX0A 2HSYA 4FYUA 2L59A 5KN2A 4IBPA 2E2GA 1S3DA 3UBKA 2M80A 5G2ZA 4F2IA 3TKSA 1ZYEA 2MYGA 4QL7A 1XBSA 1ZOFA 5A4UA 3EWLA 2FWFA 4DVCA 1XIYA 5B6MA 1X5EA 2RUFA 4AJ8A 5KOXA 2L5OA 2H76A 6GSWA 1OKDA 4MK3A 5DVBA 3WGXA 3M1GA 2H1GA 4TXVA 2QGVA 2VOCA 1K0AA 3L0HA 2H1AA 1XXUA 1JLWA 2VLUA 1ST9A 2BJXA 2KLXA 3D22A 1Z6MA 5IMZA 1G0TA 3CXGA 4ZILA 1XCCA 4MP4A 1Z9HA 4ECBA 1V2AA 1KTEA 4XTSA 3H8QA 3RPPA 1G7EA 1KBNA 4GSTA 3FZ4A 6GSSA 1SJIA 4TRXA 1HNBA 3A3TA 4K9ZA 2LV3A 4AF2A 5DALB 3ZVJA 4ML1A 22GSA 1TRWA 1XOBA 5HR3A 3HJPA 4N0ZA 1TK8B 3ZFLA 3EINA 3D4MA 3G7JA 2AB6A 2YJHA 4ZXGA 3CRUA 2WDUA 3KTBA 3IOSA 3M9JA 1G7OA 5IQYA 1TI1A 2YV9A 3ZYWA 2C0FA 6GSXA 5ECPB 2DSAA 2FWGA 2L6DA 1OE8A 2RM5A 3DVXA 4L5OA 3ME8A 5JWRB 4YQUA 2O8VB 3CTGA 2H71A 3C1SA 2IN3A 3FY7A 4K5RA 4MDCA 2TRCP 1WMJA 3CMIA 3G9BA 3K8NA 1YEXA 1URMA 2LNSA 4CHSA 3GV1A 2PU9C 4FYBA 1PN9A 4ZIJA 4IGJA 1K0CA 3IHQA 2RIIA 3CSJA 2YZUA 3DKSA 2HRKA 1R4WA 1GRXA 3FMWA 3PPUA 2LRNA 4EE0A 2O85A 2YWMA 2VAFA 5IIZA 1JZDA 4N0VA 3UOMA 1SD9A 4K2DA 4ZBBA 1G6WA 5ABRA 3TOUA 2LJKA 1USBA 2OACA 2AAWA 2N5BA 2X64A 3QR6A 2MMZA 3A2VA 3RBTA 2HNLA 4KNDA 4ZB9A 1DBYA 3GTUA 5D9VA 2R37A 1CQGA 2GSRA 3L4NA 4XS4B 4KE3A 1GWCA 3HVVA 4K7OA 5B7CA 4OFNA 4D73A 3AY8A 2PVQA 2K8SA 2BTOT 2O87A 2YWOA 4TR1A 2FHEA 2X99A 3GX8A 2PUKC 3PINA 3UVHA 3CQFA 1PGTA 2N5AA 2B1LA 4HZ2A 1X9WB 4GLTA 4HOJA 1EV9A 3ZFBA 1PL2A 3IPZA 3IC8A 3ZIJA 1AC1A 5C04A 1TTZA 2H01A 2EIQA 2B5YA 1S3CA 1PD21 2H30A 1F6MC 4IP1A 1TRSA 1SYRA 3NIVA 4G2EA 1TI3A 4MCUA 5DBQA 2R0GA 1YQ1A 2RM6A 4ECCA 4LL1B 2FA4A 2I81A 4J57E 1EP8A 2X4AA 1K0MA 5GSTA 3MSZA 1GLQA 2D2ZA 5H5SA 3UIWA 3R3EA 3KTLA 1K0NA 4PUFC 2L6CA 1FAAA 1B9XC 2VL9A 3QCPA 4I6XA 3IA1A 1V58A 4ML6A 2H72A 5DQSA 4ECIA 2IFQA 3GURA 4EXJA 4RI6A 3E0UA 1F9MA 1X9SB 4A5PA 5ECMB 3W8SA 2TRXA 3TJKA 2CV4A 4KF9A 2OE3A 2LEGA 2FY6A 3ZIVA 1IYHA 1MD4A 2VCVA 4OO5A 1KNGA 1ZMAA 1M3IA 5AN1A 5IO2A 3P90A 5J41A 1B4QA 2DMMA 2J9HA 4ILFA 2KP1A 2JSYA 4MPGA 4OD7A 4XRAA 1AQXA 5IMFA 4F0BA 2H74A 4G0KA 1DE2A 1XWAA 2CQ9A 3VK9A 3EMPA 1O7UA 2H0IA 2OE0A 1O8WA 1VRSD 2DKIA 3RPNA 4O32A 4GQCA 1ERTA 3GH6A 1O81A 5G5EA 1QXHA 1ON4A 1AUCA 2EC4A 3V1WA 11GSA 3P7XA 2DC5A 4V2MA 5IPGA 3KMNA 2H75A 1QQ2A 4WBRD 1XW5A 4RUVA 1VF3A 1THOA 3F4TA 2OADA 1HQOA 5IO0A 1XWGA 3GN3A 5B8AA 2GZZA 2LJRA 7GSSA 3IRAA 2BMXA 2XHFA 3FKFA 4NHZA 3WT2A 2B1KA 1FB6A 3TB2A 2J23A 3GNJA 5ENUA 4X1UA 4Q5FA 2IPAA 3GKXA 4DSSA 1M9AA 4IN0A 2VLTA 3VPTA 4PQ1A 4GF0A 4I5QA 1M99A 3ISOA 2YJ7A 1DSBA 4X4JA 4PNGA 3IBHA 3KMOA 2YZHA 2IMEA 4L0UA 1XVWA 1NM3A 1Y6EA 1B4PA 3HXSA 2WCIA 4GQFA 3BBYA 2B5XA 3TRQA 2LNTA 4KX4A 1O73A 1Z5YE 2HLSA 5LD0A 3TCOA 4MF6A 3UVTA 4Q5QA 3F4SA 4MA9A 3LG6A 5F0GA 2R0CA 3CYNA 2R4VA 1OKTA 1M7TA 3APOA 4BA7A 1EGOA 1OC8A 5DCHA 2AUVA 2L5LA 2VD0A 2X8CA 4QL9A 1TU7A 2X8HA 2GT5A 5ECNB 1FOHA 1GLPA 2B7KA 3O3TA 2G2QA 1ILOA 3HCZA 3EC3A 5ECLB 2HSMA 1ZCPA 3PGTA 2ON7A 2YV7A 3GA4A 4AGSA 4IW9A 4MF7A 1NW2A 3GKMA 1YF0A 2V41A 1ERUA 1YKCA 4K6XA 1N8JA 1X5DA 3DD3A 3DWVA 2HFDA 1DUGA 2DJ1A 4Z2TA 4BVXA 2C0DA 2YWIA 1VF2A 5H5RA 3HVXA 1FG4A 3F6FA 4IP6A 2JZSA 3UEMA 5HFGA 4MH3A 2B6MA 5D9TA 5CYYA 1GUKA 4G19A 2C0EA 1XW6A 3LJRA 4I2UA 1V98A 4WF5A 5DJMA 5JCWA 4J56E 3MDKA 2V6OA 3I6AA 2CZ3A 1T4ZA 1A8LA 1QMVA 2VLVA 3H79A 2KP2A 2OA7A 2P5RA 3IXRA 3TKRA 3O76A 3LXTA 1F3BA 5JWOB 2NBSA 1K3LA 2VL3A 2WJUA 1BYEA 2GDRA 4K7NA 3TKQA 2YNXA 1OAZA 5CRGA 3PH9A 4WR5A 5HQPA 2WULA 1T00A 4OO4A 2FA8A 1K3YA 4NMUA 3GL3A 1QUWA 1GUHA 3HD5A 1M3JA 3ZVJD 1SKWB 1MD3A 1W89A 3BJ5A 3CBUA 4KH7A 5ECOB 2YANA 1GSSA 1S3AA 2B3SA 2CAIA 2DJJA 3A2WA 3KEBA 3VWWA 5D8IA 4KDYA 4V1Ag 2HE3A 1GNWA 3APSA 3GTUB 4POBA 4RQXA 2VD1A 1SJ6A 1SYXA 2V32A 5KOWA 4D73B 1GULA 2IMDA 2PBJA 5AGYA 4OCEA 1AW9A 3ZLPA 10GSA 2IMKA 1A2MA 2X49A 4HS1A
chains in the Genus database with same CATH topology
4ISDA 1Z7RA 5JCUA 1SKSB 3QOUA 4WR4A 16GSA 3H1NA 1GTUA 5J5NA 3BOAA 1ERVA 1SK2A 3QFBC 5AISA 5IOWA 3TKPA 4Z2UA 2YP6A 3Q18A 3FZ9A 1GUMA 3IC4A 4JRRA 2RUEA 1OC3A 3F63A 2LRCA 1WE0A 4JR6A 2EIOA 1PX7A 1OC9A 2PVOC 1Y25A 4PQHA 1JLVA 2XBQA 2NVLA 3WD6A 1AQVA 3BCKA 2E7PA 3VPQA 2VL2C 4F03A 1M9BA 1A0FA 3FR6A 2IFQB 2JACA 3U6VA 1KEBA 3LYPA 2C1YA 1V57A 4JU5A 2P5QA 4RI7A 2VCWA 5G31A 1GSUA 4MF5A 2LUSA 12GSA 4EF0A 2QA1A 3WYWA 2GSTA 5IMVA 4FIWA 3Q6OA 3UBLA 3M8NA 2CVBA 1EEJA 4AJ7A 1XWBA 1K0OA 4ID0A 2QSIA 1GSDA 2XPDA 4DSRA 4MZWA 3SBCA 4V2NA 1UN2A 3F4RA 2A2SA 1JFUA 4GSSA 1MTCA 2R2JA 2QKEA 1FB0A 5J3RA 3S9FA 4PX1A 3W8JA 4PTSA 4YH2A 5ECQB 2Z9SA 2C3QA 2JL4A 3GUSA 2FGXA 3VFIA 3C71A 1GTIA 3ERFA 2PWJA 4RQRA 2DMLA 3I69A 4IKHA 1XPVA 4HDEA 4GWRA 3TJFA 2PN8A 3M0FA 2VL2A 5ELGA 2FWEA 2O7KA 1BG5A 3GYKA 3O6TA 4KGIA 1EOGA 4USSA 2LJAA 4J2FA 4MZBA 5BMUA 4F9ZA 2YPMA 3LXZA 1T8EB 2R3XA 1BQ7A 3FZ5A 4HZ4A 3KM6A 3GH9A 3VWUA 4PURA 4K0GA 2C3TA 2WFCA 4XS6A 4HUAA 4KDXA 1AXDA 5F8BA 4Z2RA 1TK5B 1Q98A 1A2LA 3FRCA 1EWXA 1C72A 4HEA2 1K0BA 3WT1A 4GTUA 2IMFA 1A0RP 2JZTA 3DXBA 4NXIA 2IIYA 1YDKA 4DSSB 2YOIA 2PERA 2F3MA 2ZNMA 5EVOA 2TIRA 1FHEA 1PKWA 4LLRA 3WGDA 5H5QA 2JSZA 4LL4B 4ACSA 2WZ9A 3DYRA 1O6JA 1YZXA 3MAKA 4PXOA 2HSHA 3KXOA 2LQOA 3I9V2 4K0NA 2EIRA 5CNWA 2H1DA 5FWGA 5GSSA 4NV5A 3HHVA 3BD2A 4YQMA 2E2MA 2GSQA 4OCFA 1WOUA 1M0UA 3TGZA 4WBJA 5A4WA 2WS2A 1GTAA 4AJ6A 3ZTLA 2FUG2 1JZWA 3TKSE 14GSA 2MMOA 2CX3A 1J08A 5ECHB 3EU3A 3ZITA 4NPBA 4EIQA 4Q5NA 5DJLA 2LRTA 1FVKA 5C00A 1XZOA 4KB3A 5GAPD 2VIMA 4V1Ap 3J7Yk 4G0IA 2HXKA 4L5LA 2F9SA 4EC0A 3P2AA 5E59A 1F2EA 4TN8A 2IJYA 1SJZA 1MDKA 5G1LA 4BVXB 4MPFA 3GKKA 1UVZA 1XFLA 2IMIA 1PN0A 1VF4A 1YY7A 3QAGA 4MJBA 1ZYPA 3LGCA 1ZZYA 4G10A 4EVMA 1XWCA 4G0LA 5G5FA 5FT3A 4E8HA 1SENA 3MIXA 2R5GA 4TR4A 4FO5A 2GLRA 1U6TA 3LYKA 2NPBA 1Z3EA 2GTUA 3VI7A 1U3IA 2VCXA 1MEKA 2H6ZA 1SL0B 5DDLA 3A5IA 3MYDA 3FZAA 1PA3A 1JHBA 3G7IA 4GCIA 4HQZA 2GVPA 1HYUA 2V1MA 2C80A 2CZ2A 5EPFA 5A4VA 2V6KA 3R2QA 2RLIA 3KJYA 4EUYA 2JZRA 9GSSA 2FD3A 3C7MA 4O92A 4Z7XA 1W4VA 3TRPA 4L0WA 1GSEA 3KD0A 2H0GA 3NZNA 3FYGA 2V2GA 4JEDA 4MH2A 2H6XA 2DIYA 4JBBA 4HU9A 5AIXA 1J0FA 3DVWA 4WF4A 2JU5A 5EY6A 4WETA 2KOKA 3CSHA 5KN0A 2HYXA 4OWYA 3CTFA 4YAPA 2K6VA 3UL3A 4YAVA 4K1FA 3FR3A 3IR4A 5F06A 1X9MB 5G30A 1M2AA 4TR0A 1G6YA 4G9HA 1QFNA 4GXZA 1MDJA 2A2PA 2A2RA 3H93A 2CAQA 3C73A 3OR5A 1TDIA 1TOFA 4BVYA 4PQIA 2VM1A 5IMAA 1PMTA 4CW9A 3F3QA 4CY8A 2WGRA 3DRNA 2ZUPA 5D93A 1T7PB 4MJCA 4I2TA 1JZRA 4O5UA 3E3EA 4Q5RA 1YF1A 1K0DA 3P8WA 3I43A 2F51A 4IJIA 2XPEA 3GKNA 1GTBA 2H0HA 3F8UA 3QAVA 2OBIA 2HRAA 3GSSA 1WRYA 2LQQA 5DCGA 3QFAC 4TXOA 3D0ZA 6GSUA 1I9DA 4NHWA 3DMLA 3HJMA 1WP0A 5HR0A 2FWHA 4WKWA 2I1UA 3QMXA 1Q4JA 1OC9B 2VCZA 2GZPA 3EVIA 3LEFA 4POMA 5HR1A 3F0IA 1DE1A 2UZ8A 4IJ3A 2I4AA 3L9SA 3GMFA 1XWKA 4TW5A 1SL1B 2MMNA 1TRUA 20GSA 2R0PA 3IV4A 1JZOA 2A4VA 3RDWA 4X43A 4KW6A 5DQYA 2HT9A 1T3BA 3H4KA 2OBKA 3A2XA 3EE2A 2GT6A 4XCSA 2E0QA 1WJKA 1V9WA 2CVKA 2HRNA 3DEXA 3W6GA 4ZBDA 2CT6A 4LA1A 5INYA 1PRXA 1E2YA 3RHBA 1EGRA 2HI7A 3M9KA 4OMVA 2H66A 3EPTA 3GHAA 2GQKA 2K8VA 1YEPA 4HJ2A 2HZEA 3FW2A 3TOTA 1GSFA 4MLYA 2DKHA 3LORA 4ICYA 2YWNA 3IDVA 1BAYA 4TR3A 1F3AA 5COHA 4IQ1A 5E4WA 1GSYA 2NDOA 4JR4A 1CQHA 1SK0A 1NSWA 4IVFA 3LFLA 5DAKA 2B5EA 2WB9A 3EU4A 1VGLA 4MABA 5D73A 1NHOA 1TW9A 2DLXA 4EIPA 3A5WA 4XS1A 5B8BA 4EKZA 1T4YA 3KZQA 3GL5A 1OYJA 3HY2A 2DJ3A 4K8MA 4TR1B 3L78A 3MNGA 4N11A 1YKAA 3DGQA 1ZGNA 2WRTA 2YN1A 3EURA 6GSVA 3FK8A 3L9UA 2H6YA 4NWYA 4XHMA 2GSSA 4IQAA 1GNEA 4KCEA 3VURA 2X8GA 1E6BA 2N5FA 4OFTA 1R5PA 2H1BA 1F37A 4ZL7A 1SL2B 1FO5A 2F8FA 4N10A 5KN3A 5JCGA 2OKAA 3VWXA 3C1RA 3GFKA 4NAXA 5ID2A 5CRDA 1TK0B 13GSA 4H86A 3QD9A 5IM9A 2C4JA 1EZKA 2REMA 4WEYA 2K9FA 4MNNA 5CO3A 4DEJA 2MBTA 4DSQA 4EDYA 4FYCA 3TRXA 1ML6A 1X5CA 17GSA 4WXTA 1X0RA 3D21A 1B9YC 3EMXA 1R26A 2O89A 3ZMKA 1XW9A 4LMWA 3ZRDA 4GRFA 5CAXA 1M2DA 4KSMA 4JZQA 18GSA 1HD2A 2AJQB 1PSQA 4PGTA 5ECIB 3KIJA 2QC7A 4BL7A 3TJJA 4YKGA 2GGTA 2LKUA 2ALBA 2YCDA 3IAS2 1EP7A 1XOAA 4ZB8A 3US3A 2ES7A 2OE1A 3DIEA 4QQ7A 5HFIA 4IELA 3TJGA 4ZBAA 1WPIA 2M72A 3HJOA 3D4TA 3TUEA 3ZL5A 1PX6A 3IHGA 1TP9A 3FHKA 3HVSA 2H8LA 3ED3A 3G7YA 5LNKe 4L8EA 2LTKA 1TJDA 1UA5A 1SKRB 2MBSA 4CY6A 3RHCA 5J9BA 4K2XA 1ABAA 4K5SA 2VCTA 5J4UA 3KGKA 3LW9A 5IMDA 2DJ0A 1Z6NA 4MJAA 1PL1A 2R6KA 4XIHA 5G1KA 5IPHA 1WWJA 2A4HA 3FEUA 1FVJA 2MZCA 3E9JB 2VCQA 3GIXA 1ZYNA 3HDCA 1LBKA 2GZYA 4K7IA 2LSTA 2IWTA 1ZL9A 5ELAA 2K18A 1IYIA 3LSZA 5JWQB 3KH7A 1A23A 2H19A 1MDIA 2I3YA 4O7HA 5GZZB 5EL8A 4LMVA 1BJXA 4KUNA 5DALA 2ZCTA 2VUPA 4F0CA 1TXXA 4ECJA 1UC7A 3ME7A 1K3OA 3KP9A 4I97A 1N2AA 2I9HA 4HJMA 1NHYA 3C8EA 4TVEA 4O5RA 4HU7A 2L4CA 1SK1A 1U3AA 3U5RE 1ZYQB 2QA2A 4HI7A 1BX9A 1V40A 1QGVA 3HZ4A 4GSNA 6GSTA 1BEDA 1PKZA 4KAEA 5ECKB 3LQ7A 3HA9A 3IK9A 2VM2A 4BVYB 5D9XA 3KP8A 3IAM2 3IK7A 4BWQA 2C0GA 3TJBA 8GSSA 1U88A 4NV2A 2G0FA 1B48A 3N9JA 4KCAA 2KUCA 1T1VA 3J7Yb 1HNAA 1R7HA 2P31A 3QPMA 1SU9A 3ERWA 5GAND 5CRWA 3QDNA 1VF1A 4KA0A 2L57A 4TXOB 5IMCA 4E8EA 1EV4A 3LWAA 2H73A 3APQA 3KCMA 1EEMA 4TOPA 1FW1A 4POKA 1THXA 1I5GA 3UMAA 1RQMA 1GH2A 2B7JA 4KSOA 3PR8A 3HZ8A 3ZREA 2FNOA 3IE3A 4YKFA 2FLSA 3VLNA 2LS5A 3RAZA 2HZFA 1FOVA 2ON5A 3ZMLA 5D9WA 3KH9A 1TU8A 3ZZXA 2HRFA 4I8BA 1O85A 1OE7A 2XBIA 1GSQA 5F07A 3NOFA 3CSIA 3N5OA 4XRDA 3JCML 2CA8A 5IOXA 5A5KA 2CX4A 2VO4A 1RK4A 1H4OA 5J9CA 4ULXA 1ACVA 3F9UA 1AIUA 4XS4A 3D6IA 3MWHA 1GP1A 4N30A 1LU4A 1J9BA 2IL3A 2GQLA 4POLA 2AHEA 1HNCA 1TRVA 1LJRA 2HZEB 3UJ1A 1AQWA 4ZL8A 3HKRA 4ZL9A 1A2JA 2DBCA 3VI5A 2C3NA 1GL8A 4IS0A 4OFMA 3F3RA 2DIZA 3Q74A 3HYPA 2PMTA 5DAKB 4MJEA 2OJLA 4V2LA 4JE1A 4P3YB 1TKDB 1R5AA 5HR2A 1PQNA 5KN1A 3EYTA 2CVDA 4FH8A 4EL1A 2AYTA 4ZB6A 1YJ6A 4YQVA 5F05A 5L71A 4MZCA 5BRTA 5AIVA 3UARA 4CDOA 4PUAA 3BCIA 19GSA 3L9VA 1WIKA 4EO3A 2GQMA 1Z7PA 1QK8A 4FQUA 4O5QA 1SD8A 5CP1A 2GS3A 3ERGA 3GSTA 1RW1A 3Q19A 5B6NA 2L4QA 2NTOA 6GSYA 5ECRB 5HFKA 1EOHA 2AV4A 5KEJA 1U87A 2MMAA 2H70A 4MMMA 3D5JA 3TKSC 1H75A 2KHPA 2XC2A 2DJKA 1OVNA 2FCHA 5ID2B 1O8XA 1XVQA 4HQSA 1M2BA 2P0GA 3CRTA 1ERWA 2M46A 2PGTA 5CRHA 5ECSA 4BWSA 4PNFA 5FHIA 2C8UA 2DJ2A 1B8XA 3UAPA 2F8AA 1A8YA 3SWLA 3M3MA 5D96A 3VWVA 3F6DA 3TDGA 3GRXA 5CREA 3FR9A 5LCZA 2PPTA 4BPYA 4X0XA 4F82A 4EDZA 2JADA 4KDUA 4BL7B 1A24A 3WGEA 3QAWA 4IHUA 1AAZA 4TKYA 3GX0A 2HSYA 4FYUA 2L59A 5KN2A 4IBPA 2E2GA 1S3DA 3UBKA 2M80A 5G2ZA 4F2IA 3TKSA 1ZYEA 2MYGA 4QL7A 1XBSA 1ZOFA 5A4UA 3EWLA 2FWFA 4DVCA 1XIYA 5B6MA 1X5EA 2RUFA 4AJ8A 5KOXA 2L5OA 2H76A 6GSWA 1OKDA 4MK3A 5DVBA 3WGXA 3M1GA 2H1GA 4TXVA 2QGVA 2VOCA 1K0AA 3L0HA 2H1AA 1XXUA 1JLWA 2VLUA 1ST9A 2BJXA 2KLXA 3D22A 1Z6MA 5IMZA 1G0TA 3CXGA 4ZILA 1XCCA 4MP4A 1Z9HA 4ECBA 1V2AA 1KTEA 4XTSA 3H8QA 3RPPA 1G7EA 1KBNA 4GSTA 3FZ4A 6GSSA 1SJIA 4TRXA 1HNBA 3A3TA 4K9ZA 2LV3A 4AF2A 5DALB 3ZVJA 4ML1A 22GSA 1TRWA 1XOBA 5HR3A 3HJPA 4N0ZA 1TK8B 3ZFLA 3EINA 3D4MA 3G7JA 2AB6A 2YJHA 4ZXGA 3CRUA 2WDUA 3KTBA 3IOSA 3M9JA 1G7OA 5IQYA 1TI1A 2YV9A 3ZYWA 2C0FA 6GSXA 5ECPB 2DSAA 2FWGA 2L6DA 1OE8A 2RM5A 3DVXA 4L5OA 3ME8A 5JWRB 4YQUA 2O8VB 3CTGA 2H71A 3C1SA 2IN3A 3FY7A 4K5RA 4MDCA 2TRCP 1WMJA 3CMIA 3G9BA 3K8NA 1YEXA 1URMA 2LNSA 4CHSA 3GV1A 2PU9C 4FYBA 1PN9A 4ZIJA 4IGJA 1K0CA 3IHQA 2RIIA 3CSJA 2YZUA 3DKSA 2HRKA 1R4WA 1GRXA 3FMWA 3PPUA 2LRNA 4EE0A 2O85A 2YWMA 2VAFA 5IIZA 1JZDA 4N0VA 3UOMA 1SD9A 4K2DA 4ZBBA 1G6WA 5ABRA 3TOUA 2LJKA 1USBA 2OACA 2AAWA 2N5BA 2X64A 3QR6A 2MMZA 3A2VA 3RBTA 2HNLA 4KNDA 4ZB9A 1DBYA 3GTUA 5D9VA 2R37A 1CQGA 2GSRA 3L4NA 4XS4B 4KE3A 1GWCA 3HVVA 4K7OA 5B7CA 4OFNA 4D73A 3AY8A 2PVQA 2K8SA 2BTOT 2O87A 2YWOA 4TR1A 2FHEA 2X99A 3GX8A 2PUKC 3PINA 3UVHA 1PGTA 2N5AA 2B1LA 4HZ2A 1X9WB 4GLTA 4HOJA 1EV9A 3ZFBA 1PL2A 3IPZA 3IC8A 3ZIJA 1AC1A 5C04A 1TTZA 2H01A 2EIQA 2B5YA 1S3CA 1PD21 2H30A 1F6MC 4IP1A 1TRSA 1SYRA 3NIVA 4G2EA 1TI3A 4MCUA 5DBQA 2R0GA 1YQ1A 2RM6A 4ECCA 4LL1B 2FA4A 2I81A 4J57E 1EP8A 2X4AA 1K0MA 5GSTA 3MSZA 1GLQA 2D2ZA 5H5SA 3UIWA 3R3EA 3KTLA 1K0NA 4PUFC 2L6CA 1FAAA 1B9XC 2VL9A 3QCPA 4I6XA 3IA1A 1V58A 4ML6A 2H72A 5DQSA 4ECIA 2IFQA 3GURA 4EXJA 4RI6A 3E0UA 1F9MA 1X9SB 4A5PA 5ECMB 3W8SA 2TRXA 3TJKA 2CV4A 4KF9A 2OE3A 2LEGA 2FY6A 3ZIVA 1IYHA 1MD4A 2VCVA 4OO5A 1KNGA 1ZMAA 5AN1A 5IO2A 3P90A 5J41A 1B4QA 2DMMA 2J9HA 4ILFA 2KP1A 2JSYA 4MPGA 4OD7A 4XRAA 1AQXA 5IMFA 4F0BA 2H74A 4G0KA 1DE2A 1XWAA 2CQ9A 3VK9A 3EMPA 1O7UA 2H0IA 2OE0A 1O8WA 1VRSD 2DKIA 3RPNA 4O32A 4GQCA 1ERTA 3GH6A 1O81A 5G5EA 1QXHA 1ON4A 1AUCA 2EC4A 3V1WA 11GSA 3P7XA 2DC5A 4V2MA 5IPGA 3KMNA 2H75A 1QQ2A 4WBRD 1XW5A 4RUVA 1VF3A 1THOA 3F4TA 2OADA 1HQOA 5IO0A 1XWGA 3GN3A 5B8AA 2GZZA 2LJRA 7GSSA 3IRAA 2BMXA 2XHFA 3FKFA 4NHZA 3WT2A 2B1KA 1FB6A 3TB2A 2J23A 3GNJA 5ENUA 4X1UA 4Q5FA 2IPAA 3GKXA 4DSSA 1M9AA 4IN0A 2VLTA 3VPTA 4PQ1A 4GF0A 4I5QA 1M99A 3ISOA 2YJ7A 1DSBA 4X4JA 4PNGA 3IBHA 3KMOA 2YZHA 2IMEA 4L0UA 1XVWA 1NM3A 1Y6EA 1B4PA 3HXSA 2WCIA 4GQFA 3BBYA 2B5XA 3TRQA 2LNTA 4KX4A 1O73A 1Z5YE 2HLSA 5LD0A 3TCOA 4MF6A 3UVTA 4Q5QA 3F4SA 4MA9A 3LG6A 5F0GA 2R0CA 3CYNA 2R4VA 1OKTA 1M7TA 3APOA 4BA7A 1EGOA 1OC8A 5DCHA 2AUVA 2L5LA 2VD0A 2X8CA 4QL9A 1TU7A 2X8HA 2GT5A 5ECNB 1FOHA 1GLPA 2B7KA 3O3TA 2G2QA 1ILOA 3HCZA 3EC3A 5ECLB 2HSMA 1ZCPA 3PGTA 2ON7A 2YV7A 3GA4A 4AGSA 4IW9A 4MF7A 1NW2A 3GKMA 1YF0A 2V41A 1ERUA 1YKCA 4K6XA 1N8JA 1X5DA 3DD3A 3DWVA 2HFDA 1DUGA 2DJ1A 4Z2TA 4BVXA 2C0DA 2YWIA 1VF2A 5H5RA 3HVXA 1FG4A 3F6FA 4IP6A 2JZSA 3UEMA 5HFGA 4MH3A 2B6MA 5D9TA 5CYYA 1GUKA 4G19A 2C0EA 1XW6A 3LJRA 4I2UA 1V98A 4WF5A 5DJMA 5JCWA 4J56E 3MDKA 2V6OA 3I6AA 2CZ3A 1T4ZA 1A8LA 1QMVA 2VLVA 3H79A 2KP2A 2OA7A 2P5RA 3IXRA 3TKRA 3O76A 3LXTA 1F3BA 5JWOB 2NBSA 1K3LA 2VL3A 2WJUA 1BYEA 2GDRA 4K7NA 3TKQA 2YNXA 1OAZA 5CRGA 3PH9A 4WR5A 5HQPA 2WULA 1T00A 4OO4A 2FA8A 1K3YA 4NMUA 3GL3A 1QUWA 1GUHA 3HD5A 3ZVJD 1SKWB 1MD3A 1W89A 3BJ5A 3CBUA 4KH7A 5ECOB 2YANA 1GSSA 1S3AA 2B3SA 2CAIA 2DJJA 3A2WA 3KEBA 3VWWA 5D8IA 4KDYA 4V1Ag 2HE3A 1GNWA 3APSA 3GTUB 4POBA 4RQXA 2VD1A 1SJ6A 1SYXA 2V32A 5KOWA 4D73B 1GULA 2IMDA 2PBJA 5AGYA 4OCEA 1AW9A 3ZLPA 10GSA 2IMKA 1A2MA 2X49A 4HS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ISD A;  1Z7R A;  5JCU A;  1SKS B;  3QOU A;  4WR4 A;  16GS A;  3H1N A;  1GTU A;  5J5N A;  3BOA A;  1ERV A;  1SK2 A;  3QFB C;  5AIS A;  5IOW A;  3TKP A;  2YP6 A;  3Q18 A;  3FZ9 A;  1GUM A;  3IC4 A;  4JRR A;  2RUE A;  1OC3 A;  3F63 A;  2LRC A;  1WE0 A;  4JR6 A;  2EIO A;  1PX7 A;  1OC9 A;  2PVO C;  1Y25 A;  4PQH A;  1JLV A;  2XBQ A;  2NVL A;  3WD6 A;  1AQV A;  3BCK A;  2E7P A;  3VPQ A;  2VL2 C;  4F03 A;  1M9B A;  1A0F A;  3FR6 A;  2IFQ B;  2JAC A;  3U6V A;  1KEB A;  3LYP A;  2C1Y A;  1V57 A;  4JU5 A;  2P5Q A;  4RI7 A;  2VCW A;  5G31 A;  1GSU A;  4MF5 A;  2LUS A;  12GS A;  4EF0 A;  3WYW A;  2GST A;  5IMV A;  4FIW A;  3Q6O A;  3UBL A;  3M8N A;  2CVB A;  1EEJ A;  4AJ7 A;  1XWB A;  1K0O A;  4ID0 A;  2QSI A;  1GSD A;  2XPD A;  4DSR A;  4MZW A;  3SBC A;  4V2N A;  1UN2 A;  3F4R A;  2A2S A;  1JFU A;  4GSS A;  1MTC A;  2R2J A;  2QKE A;  1FB0 A;  5J3R A;  3S9F A;  4PX1 A;  3W8J A;  4YH2 A;  5ECQ B;  2Z9S A;  2C3Q A;  2JL4 A;  3GUS A;  2FGX A;  3VFI A;  3C71 A;  1GTI A;  3ERF A;  2PWJ A;  4RQR A;  2DML A;  3I69 A;  4IKH A;  1XPV A;  4HDE A;  4GWR A;  3TJF A;  2PN8 A;  3M0F A;  2VL2 A;  5ELG A;  2FWE A;  2O7K A;  1BG5 A;  3GYK A;  3O6T A;  4KGI A;  1EOG A;  2LJA A;  4J2F A;  4MZB A;  4F9Z A;  2YPM A;  3LXZ A;  1T8E B;  2R3X A;  1BQ7 A;  3FZ5 A;  4HZ4 A;  3KM6 A;  3GH9 A;  3VWU A;  4PUR A;  4K0G A;  2C3T A;  2WFC A;  4XS6 A;  4HUA A;  4KDX A;  1AXD A;  5F8B A;  1TK5 B;  1Q98 A;  1A2L A;  3FRC A;  1EWX A;  1C72 A;  4HEA 2;  1K0B A;  3WT1 A;  4GTU A;  2IMF A;  1A0R P;  2JZT A;  3DXB A;  4NXI A;  2IIY A;  1YDK A;  4DSS B;  2YOI A;  2PER A;  2F3M A;  2ZNM A;  5EVO A;  2TIR A;  1FHE A;  1PKW A;  4LLR A;  3WGD A;  5H5Q A;  2JSZ A;  4LL4 B;  4ACS A;  2WZ9 A;  3DYR A;  1O6J A;  1YZX A;  3MAK A;  4PXO A;  2HSH A;  3KXO A;  2LQO A;  3I9V 2;  4K0N A;  2EIR A;  5CNW A;  2H1D A;  5FWG A;  5GSS A;  4NV5 A;  3HHV A;  3BD2 A;  4YQM A;  2E2M A;  2GSQ A;  4OCF A;  1WOU A;  1M0U A;  3TGZ A;  4WBJ A;  5A4W A;  2WS2 A;  1GTA A;  4AJ6 A;  3ZTL A;  2FUG 2;  1JZW A;  3TKS E;  14GS A;  2MMO A;  2CX3 A;  1J08 A;  5ECH B;  3EU3 A;  3ZIT A;  4NPB A;  4Q5N A;  5DJL A;  2LRT A;  1FVK A;  5C00 A;  1XZO A;  4KB3 A;  5GAP D;  2VIM A;  4V1A p;  3J7Y k;  2HXK A;  4L5L A;  2F9S A;  4EC0 A;  3P2A A;  5E59 A;  1F2E A;  4TN8 A;  2IJY A;  1SJZ A;  1MDK A;  5G1L A;  4MPF A;  3GKK A;  1UVZ A;  1XFL A;  2IMI A;  1VF4 A;  1YY7 A;  3QAG A;  4MJB A;  3LGC A;  1ZZY A;  4G10 A;  4EVM A;  1XWC A;  5G5F A;  5FT3 A;  4E8H A;  1SEN A;  2R5G A;  4TR4 A;  4FO5 A;  2GLR A;  1U6T A;  3LYK A;  2NPB A;  1Z3E A;  2GTU A;  3VI7 A;  1U3I A;  2VCX A;  1MEK A;  2H6Z A;  1SL0 B;  5DDL A;  3FZA A;  1PA3 A;  1JHB A;  3G7I A;  4GCI A;  4HQZ A;  2GVP A;  1HYU A;  2V1M A;  2C80 A;  2CZ2 A;  5EPF A;  5A4V A;  2V6K A;  3R2Q A;  2RLI A;  3KJY A;  4EUY A;  2JZR A;  9GSS A;  2FD3 A;  3C7M A;  4O92 A;  4Z7X A;  1W4V A;  3TRP A;  4L0W A;  1GSE A;  3KD0 A;  2H0G A;  3NZN A;  3FYG A;  2V2G A;  4JED A;  4MH2 A;  2H6X A;  2DIY A;  4JBB A;  4HU9 A;  5AIX A;  1J0F A;  3DVW A;  4WF4 A;  2JU5 A;  5EY6 A;  4WET A;  2KOK A;  3CSH A;  5KN0 A;  2HYX A;  4OWY A;  3CTF A;  4YAP A;  2K6V A;  3UL3 A;  4YAV A;  4K1F A;  3FR3 A;  3IR4 A;  5F06 A;  1X9M B;  5G30 A;  1M2A A;  4TR0 A;  1G6Y A;  4G9H A;  1QFN A;  4GXZ A;  1MDJ A;  2A2R A;  3H93 A;  2CAQ A;  3C73 A;  3OR5 A;  1TDI A;  1TOF A;  4BVY A;  4PQI A;  2VM1 A;  5IMA A;  1PMT A;  4CW9 A;  3F3Q A;  2WGR A;  3DRN A;  2ZUP A;  5D93 A;  1T7P B;  4MJC A;  4I2T A;  1JZR A;  3E3E A;  4Q5R A;  1YF1 A;  1K0D A;  3P8W A;  3I43 A;  2F51 A;  4IJI A;  2XPE A;  3GKN A;  1GTB A;  2H0H A;  3F8U A;  3QAV A;  2OBI A;  5DCG A;  3GSS A;  1WRY A;  2LQQ A;  3QFA C;  4TXO A;  3D0Z A;  6GSU A;  1I9D A;  4NHW A;  3DML A;  3HJM A;  1WP0 A;  5HR0 A;  2FWH A;  4WKW A;  2I1U A;  3QMX A;  1Q4J A;  1OC9 B;  2VCZ A;  2GZP A;  3EVI A;  3LEF A;  4POM A;  5HR1 A;  3F0I A;  1DE1 A;  4IJ3 A;  2I4A A;  3L9S A;  3GMF A;  1XWK A;  4TW5 A;  1SL1 B;  2MMN A;  1TRU A;  20GS A;  3IV4 A;  1JZO A;  2A4V A;  3RDW A;  4X43 A;  4KW6 A;  5DQY A;  2HT9 A;  1T3B A;  3H4K A;  2OBK A;  3A2X A;  3EE2 A;  2GT6 A;  4XCS A;  2E0Q A;  1WJK A;  1V9W A;  2CVK A;  2HRN A;  3DEX A;  3W6G A;  4ZBD A;  2CT6 A;  4LA1 A;  5INY A;  1PRX A;  1E2Y A;  3RHB A;  1EGR A;  2HI7 A;  3M9K A;  4OMV A;  2H66 A;  3GHA A;  2GQK A;  2K8V A;  1YEP A;  4HJ2 A;  2HZE A;  3FW2 A;  3TOT A;  1GSF A;  4MLY A;  3LOR A;  2YWN A;  3IDV A;  1BAY A;  4TR3 A;  1F3A A;  5COH A;  4IQ1 A;  5E4W A;  1GSY A;  2NDO A;  4JR4 A;  1CQH A;  1SK0 A;  1NSW A;  4IVF A;  3LFL A;  5DAK A;  2B5E A;  2WB9 A;  3EU4 A;  1VGL A;  4MAB A;  5D73 A;  1NHO A;  1TW9 A;  2DLX A;  3A5W A;  4XS1 A;  5B8B A;  4EKZ A;  1T4Y A;  3KZQ A;  3GL5 A;  1OYJ A;  3HY2 A;  2DJ3 A;  4K8M A;  4TR1 B;  3L78 A;  3MNG A;  4N11 A;  1YKA A;  3DGQ A;  1ZGN A;  2WRT A;  2YN1 A;  3EUR A;  6GSV A;  3FK8 A;  3L9U A;  2H6Y A;  4NWY A;  4XHM A;  2GSS A;  4IQA A;  1GNE A;  4KCE A;  3VUR A;  2X8G A;  1E6B A;  2N5F A;  4OFT A;  1R5P A;  2H1B A;  1F37 A;  4ZL7 A;  1SL2 B;  1FO5 A;  2F8F A;  4N10 A;  5KN3 A;  5JCG A;  2OKA A;  3VWX A;  3C1R A;  3GFK A;  4NAX A;  5ID2 A;  5CRD A;  1TK0 B;  13GS A;  4H86 A;  3QD9 A;  5IM9 A;  2C4J A;  1EZK A;  2REM A;  4WEY A;  2K9F A;  5CO3 A;  4DEJ A;  2MBT A;  4DSQ A;  4EDY A;  4FYC A;  3TRX A;  1ML6 A;  1X5C A;  17GS A;  4WXT A;  1X0R A;  3D21 A;  1B9Y C;  3EMX A;  1R26 A;  2O89 A;  3ZMK A;  1XW9 A;  4LMW A;  3ZRD A;  4GRF A;  5CAX A;  1M2D A;  4KSM A;  4JZQ A;  18GS A;  1HD2 A;  2AJQ B;  1PSQ A;  4PGT A;  5ECI B;  3KIJ A;  2QC7 A;  4BL7 A;  3TJJ A;  2GGT A;  2LKU A;  2ALB A;  2YCD A;  3IAS 2;  1EP7 A;  1XOA A;  4ZB8 A;  3US3 A;  2ES7 A;  2OE1 A;  3DIE A;  4QQ7 A;  5HFI A;  4IEL A;  3TJG A;  4ZBA A;  1WPI A;  2M72 A;  3HJO A;  3D4T A;  3TUE A;  3ZL5 A;  1PX6 A;  1TP9 A;  3FHK A;  3HVS A;  2H8L A;  3ED3 A;  3G7Y A;  5LNK e;  4L8E A;  2LTK A;  1TJD A;  1UA5 A;  1SKR B;  2MBS A;  3RHC A;  5J9B A;  1ABA A;  2VCT A;  5J4U A;  3KGK A;  5IMD A;  2DJ0 A;  1Z6N A;  4MJA A;  1PL1 A;  2R6K A;  4XIH A;  5G1K A;  5IPH A;  1WWJ A;  3FEU A;  1FVJ A;  2MZC A;  3E9J B;  2VCQ A;  3GIX A;  3HDC A;  1LBK A;  2GZY A;  4K7I A;  2LST A;  2IWT A;  1ZL9 A;  5ELA A;  2K18 A;  1IYI A;  3LSZ A;  5JWQ B;  3KH7 A;  1A23 A;  2H19 A;  1MDI A;  2I3Y A;  4O7H A;  5GZZ B;  5EL8 A;  4LMV A;  1BJX A;  4KUN A;  5DAL A;  2ZCT A;  2VUP A;  4F0C A;  1TXX A;  4ECJ A;  1UC7 A;  3ME7 A;  1K3O A;  3KP9 A;  4I97 A;  1N2A A;  2I9H A;  4HJM A;  1NHY A;  3C8E A;  4TVE A;  4O5R A;  4HU7 A;  2L4C A;  1SK1 A;  1U3A A;  3U5R E;  1ZYQ B;  4HI7 A;  1BX9 A;  1V40 A;  1QGV A;  3HZ4 A;  4GSN A;  6GST A;  1BED A;  1PKZ A;  4KAE A;  5ECK B;  3LQ7 A;  3HA9 A;  3IK9 A;  2VM2 A;  5D9X A;  3KP8 A;  3IAM 2;  3IK7 A;  4BWQ A;  2C0G A;  3TJB A;  8GSS A;  1U88 A;  4NV2 A;  2G0F A;  1B48 A;  3N9J A;  4KCA A;  2KUC A;  1T1V A;  3J7Y b;  1HNA A;  1R7H A;  2P31 A;  3QPM A;  1SU9 A;  3ERW A;  5GAN D;  5CRW A;  3QDN A;  1VF1 A;  4KA0 A;  2L57 A;  4TXO B;  5IMC A;  4E8E A;  1EV4 A;  3LWA A;  2H73 A;  3APQ A;  3KCM A;  1EEM A;  4TOP A;  1FW1 A;  4POK A;  1THX A;  1I5G A;  3UMA A;  1RQM A;  1GH2 A;  2B7J A;  4KSO A;  3PR8 A;  3HZ8 A;  3ZRE A;  2FNO A;  3IE3 A;  2FLS A;  3VLN A;  2LS5 A;  3RAZ A;  2HZF A;  1FOV A;  2ON5 A;  3ZML A;  5D9W A;  3KH9 A;  1TU8 A;  3ZZX A;  2HRF A;  4I8B A;  1O85 A;  1OE7 A;  2XBI A;  1GSQ A;  5F07 A;  3NOF A;  3CSI A;  3N5O A;  4XRD A;  3JCM L;  2CA8 A;  5IOX A;  5A5K A;  2CX4 A;  2VO4 A;  1RK4 A;  1H4O A;  5J9C A;  4ULX A;  1ACV A;  3F9U A;  1AIU A;  4XS4 A;  3D6I A;  3MWH A;  1GP1 A;  4N30 A;  1LU4 A;  1J9B A;  2IL3 A;  2GQL A;  4POL A;  2AHE A;  1HNC A;  1TRV A;  1LJR A;  2HZE B;  3UJ1 A;  1AQW A;  4ZL8 A;  3HKR A;  4ZL9 A;  1A2J A;  2DBC A;  3VI5 A;  2C3N A;  1GL8 A;  4IS0 A;  4OFM A;  3F3R A;  2DIZ A;  3Q74 A;  3HYP A;  2PMT A;  5DAK B;  4MJE A;  2OJL A;  4V2L A;  4JE1 A;  4P3Y B;  1TKD B;  1R5A A;  5HR2 A;  1PQN A;  5KN1 A;  3EYT A;  2CVD A;  4FH8 A;  4EL1 A;  2AYT A;  4ZB6 A;  1YJ6 A;  4YQV A;  5F05 A;  5L71 A;  4MZC A;  5AIV A;  3UAR A;  4CDO A;  4PUA A;  3BCI A;  19GS A;  3L9V A;  1WIK A;  4EO3 A;  2GQM A;  1Z7P A;  1QK8 A;  1SD8 A;  5CP1 A;  2GS3 A;  3ERG A;  3GST A;  1RW1 A;  3Q19 A;  5B6N A;  2L4Q A;  2NTO A;  6GSY A;  5ECR B;  5HFK A;  1EOH A;  2AV4 A;  5KEJ A;  1U87 A;  2MMA A;  2H70 A;  4MMM A;  3D5J A;  3TKS C;  1H75 A;  2KHP A;  2XC2 A;  2DJK A;  1OVN A;  2FCH A;  5ID2 B;  1O8X A;  1XVQ A;  4HQS A;  1M2B A;  2P0G A;  3CRT A;  1ERW A;  2M46 A;  2PGT A;  5CRH A;  5ECS A;  4BWS A;  4PNF A;  5FHI A;  2C8U A;  2DJ2 A;  1B8X A;  3UAP A;  2F8A A;  1A8Y A;  3SWL A;  3M3M A;  5D96 A;  3VWV A;  3F6D A;  3TDG A;  3GRX A;  5CRE A;  3FR9 A;  5LCZ A;  2PPT A;  4BPY A;  4X0X A;  4F82 A;  4EDZ A;  2JAD A;  4KDU A;  1A24 A;  3WGE A;  3QAW A;  4IHU A;  1AAZ A;  4TKY A;  3GX0 A;  2HSY A;  4FYU A;  2L59 A;  5KN2 A;  4IBP A;  2E2G A;  1S3D A;  3UBK A;  2M80 A;  5G2Z A;  4F2I A;  3TKS A;  1ZYE A;  2MYG A;  4QL7 A;  1XBS A;  1ZOF A;  5A4U A;  3EWL A;  2FWF A;  4DVC A;  1XIY A;  5B6M A;  1X5E A;  2RUF A;  4AJ8 A;  2L5O A;  2H76 A;  6GSW A;  1OKD A;  4MK3 A;  5DVB A;  3WGX A;  3M1G A;  2H1G A;  4TXV A;  2QGV A;  2VOC A;  1K0A A;  3L0H A;  2H1A A;  1XXU A;  1JLW A;  2VLU A;  1ST9 A;  2BJX A;  2KLX A;  3D22 A;  1Z6M A;  5IMZ A;  1G0T A;  3CXG A;  4ZIL A;  1XCC A;  4MP4 A;  1Z9H A;  4ECB A;  1V2A A;  1KTE A;  4XTS A;  3H8Q A;  3RPP A;  1G7E A;  1KBN A;  4GST A;  3FZ4 A;  6GSS A;  1SJI A;  4TRX A;  1HNB A;  3A3T A;  4K9Z A;  2LV3 A;  4AF2 A;  5DAL B;  3ZVJ A;  4ML1 A;  22GS A;  1TRW A;  1XOB A;  5HR3 A;  3HJP A;  4N0Z A;  1TK8 B;  3ZFL A;  3EIN A;  3D4M A;  3G7J A;  2AB6 A;  2YJH A;  4ZXG A;  3CRU A;  2WDU A;  3KTB A;  3IOS A;  3M9J A;  1G7O A;  5IQY A;  1TI1 A;  2YV9 A;  3ZYW A;  2C0F A;  6GSX A;  5ECP B;  2DSA A;  2FWG A;  2L6D A;  1OE8 A;  2RM5 A;  3DVX A;  4L5O A;  3ME8 A;  5JWR B;  4YQU A;  2O8V B;  3CTG A;  2H71 A;  3C1S A;  2IN3 A;  3FY7 A;  4MDC A;  2TRC P;  1WMJ A;  3CMI A;  3G9B A;  3K8N A;  1YEX A;  1URM A;  2LNS A;  4CHS A;  3GV1 A;  2PU9 C;  4FYB A;  1PN9 A;  4ZIJ A;  4IGJ A;  1K0C A;  3IHQ A;  2RII A;  3CSJ A;  2YZU A;  3DKS A;  1R4W A;  1GRX A;  2LRN A;  4EE0 A;  2O85 A;  2YWM A;  2VAF A;  5IIZ A;  1JZD A;  4N0V A;  3UOM A;  1SD9 A;  4K2D A;  4ZBB A;  1G6W A;  5ABR A;  3TOU A;  2LJK A;  1USB A;  2OAC A;  2AAW A;  2N5B A;  2X64 A;  3QR6 A;  2MMZ A;  3A2V A;  3RBT A;  2HNL A;  4KND A;  4ZB9 A;  1DBY A;  3GTU A;  5D9V A;  2R37 A;  1CQG A;  2GSR A;  3L4N A;  4XS4 B;  4KE3 A;  1GWC A;  3HVV A;  4K7O A;  5B7C A;  4OFN A;  4D73 A;  3AY8 A;  2PVQ A;  2K8S A;  2BTO T;  2O87 A;  2YWO A;  4TR1 A;  2FHE A;  2X99 A;  3GX8 A;  2PUK C;  3PIN A;  3UVH A;  1PGT A;  2N5A A;  2B1L A;  4HZ2 A;  1X9W B;  4GLT A;  4HOJ A;  1EV9 A;  3ZFB A;  1PL2 A;  3IPZ A;  3ZIJ A;  1AC1 A;  5C04 A;  1TTZ A;  2H01 A;  2EIQ A;  2B5Y A;  1S3C A;  1PD2 1;  2H30 A;  1F6M C;  4IP1 A;  1TRS A;  1SYR A;  3NIV A;  4G2E A;  1TI3 A;  4MCU A;  5DBQ A;  1YQ1 A;  2RM6 A;  4ECC A;  4LL1 B;  2FA4 A;  2I81 A;  4J57 E;  1EP8 A;  1K0M A;  5GST A;  3MSZ A;  1GLQ A;  2D2Z A;  5H5S A;  3UIW A;  3KTL A;  1K0N A;  4PUF C;  2L6C A;  1FAA A;  1B9X C;  2VL9 A;  3QCP A;  4I6X A;  3IA1 A;  1V58 A;  4ML6 A;  2H72 A;  5DQS A;  4ECI A;  2IFQ A;  3GUR A;  4EXJ A;  4RI6 A;  3E0U A;  1F9M A;  1X9S B;  5ECM B;  3W8S A;  2TRX A;  3TJK A;  2CV4 A;  2OE3 A;  2LEG A;  2FY6 A;  3ZIV A;  1IYH A;  1MD4 A;  2VCV A;  4OO5 A;  1KNG A;  1ZMA A;  5AN1 A;  5IO2 A;  3P90 A;  5J41 A;  1B4Q A;  2DMM A;  2J9H A;  4ILF A;  2KP1 A;  2JSY A;  4MPG A;  4OD7 A;  4XRA A;  1AQX A;  5IMF A;  4F0B A;  2H74 A;  1DE2 A;  1XWA A;  2CQ9 A;  3VK9 A;  3EMP A;  1O7U A;  2H0I A;  2OE0 A;  1O8W A;  1VRS D;  3RPN A;  4O32 A;  4GQC A;  1ERT A;  3GH6 A;  1O81 A;  5G5E A;  1QXH A;  1ON4 A;  1AUC A;  2EC4 A;  3V1W A;  11GS A;  3P7X A;  2DC5 A;  4V2M A;  5IPG A;  3KMN A;  2H75 A;  1QQ2 A;  4WBR D;  1XW5 A;  4RUV A;  1VF3 A;  1THO A;  3F4T A;  2OAD A;  1HQO A;  5IO0 A;  1XWG A;  3GN3 A;  5B8A A;  2GZZ A;  2LJR A;  7GSS A;  3IRA A;  2BMX A;  2XHF A;  3FKF A;  4NHZ A;  3WT2 A;  2B1K A;  1FB6 A;  3TB2 A;  2J23 A;  3GNJ A;  5ENU A;  4X1U A;  4Q5F A;  2IPA A;  3GKX A;  4DSS A;  1M9A A;  4IN0 A;  2VLT A;  3VPT A;  4PQ1 A;  4GF0 A;  4I5Q A;  1M99 A;  3ISO A;  2YJ7 A;  1DSB A;  4PNG A;  3IBH A;  3KMO A;  2YZH A;  2IME A;  4L0U A;  1XVW A;  1NM3 A;  1Y6E A;  1B4P A;  3HXS A;  2WCI A;  4GQF A;  3BBY A;  2B5X A;  3TRQ A;  2LNT A;  4KX4 A;  1O73 A;  1Z5Y E;  2HLS A;  5LD0 A;  3TCO A;  4MF6 A;  3UVT A;  4Q5Q A;  3F4S A;  4MA9 A;  3LG6 A;  5F0G A;  3CYN A;  2R4V A;  1OKT A;  1M7T A;  3APO A;  4BA7 A;  1EGO A;  1OC8 A;  5DCH A;  2AUV A;  2L5L A;  2VD0 A;  2X8C A;  4QL9 A;  1TU7 A;  2X8H A;  2GT5 A;  5ECN B;  1GLP A;  2B7K A;  3O3T A;  2G2Q A;  1ILO A;  3HCZ A;  3EC3 A;  5ECL B;  1ZCP A;  3PGT A;  2ON7 A;  2YV7 A;  3GA4 A;  4AGS A;  4IW9 A;  4MF7 A;  1NW2 A;  3GKM A;  1YF0 A;  2V41 A;  1ERU A;  1YKC A;  4K6X A;  1N8J A;  1X5D A;  3DD3 A;  3DWV A;  2HFD A;  1DUG A;  2DJ1 A;  4BVX A;  2C0D A;  2YWI A;  1VF2 A;  5H5R A;  3HVX A;  1FG4 A;  3F6F A;  4IP6 A;  2JZS A;  3UEM A;  5HFG A;  4MH3 A;  2B6M A;  5D9T A;  5CYY A;  1GUK A;  4G19 A;  2C0E A;  1XW6 A;  3LJR A;  4I2U A;  1V98 A;  4WF5 A;  5DJM A;  5JCW A;  4J56 E;  3MDK A;  2V6O A;  3I6A A;  2CZ3 A;  1T4Z A;  1A8L A;  1QMV A;  2VLV A;  3H79 A;  2KP2 A;  2OA7 A;  2P5R A;  3IXR A;  3TKR A;  3O76 A;  3LXT A;  1F3B A;  5JWO B;  2NBS A;  1K3L A;  2VL3 A;  2WJU A;  1BYE A;  2GDR A;  4K7N A;  3TKQ A;  2YNX A;  1OAZ A;  5CRG A;  3PH9 A;  4WR5 A;  5HQP A;  2WUL A;  1T00 A;  4OO4 A;  2FA8 A;  1K3Y A;  4NMU A;  3GL3 A;  1QUW A;  1GUH A;  3HD5 A;  3ZVJ D;  1SKW B;  1MD3 A;  1W89 A;  3BJ5 A;  3CBU A;  4KH7 A;  5ECO B;  2YAN A;  1GSS A;  1S3A A;  2B3S A;  2CAI A;  2DJJ A;  3A2W A;  3KEB A;  3VWW A;  5D8I A;  4KDY A;  4V1A g;  2HE3 A;  1GNW A;  3APS A;  3GTU B;  4POB A;  4RQX A;  2VD1 A;  1SJ6 A;  1SYX A;  2V32 A;  4D73 B;  1GUL A;  2IMD A;  2PBJ A;  5AGY A;  4OCE A;  1AW9 A;  3ZLP A;  10GS A;  2IMK A;  1A2M A;  4HS1 A; 
#chains in the Genus database with same CATH topology
 4ISD A;  1Z7R A;  5JCU A;  1SKS B;  3QOU A;  4WR4 A;  16GS A;  3H1N A;  1GTU A;  5J5N A;  3BOA A;  1ERV A;  1SK2 A;  3QFB C;  5AIS A;  5IOW A;  3TKP A;  4Z2U A;  2YP6 A;  3Q18 A;  3FZ9 A;  1GUM A;  3IC4 A;  4JRR A;  2RUE A;  1OC3 A;  3F63 A;  2LRC A;  1WE0 A;  4JR6 A;  2EIO A;  1PX7 A;  1OC9 A;  2PVO C;  1Y25 A;  4PQH A;  1JLV A;  2XBQ A;  2NVL A;  3WD6 A;  1AQV A;  3BCK A;  2E7P A;  3VPQ A;  2VL2 C;  4F03 A;  1M9B A;  1A0F A;  3FR6 A;  2IFQ B;  2JAC A;  3U6V A;  1PFO A;  1KEB A;  3LYP A;  2C1Y A;  1V57 A;  4JU5 A;  2P5Q A;  4RI7 A;  2VCW A;  5G31 A;  1GSU A;  4MF5 A;  2LUS A;  12GS A;  4EF0 A;  2QA1 A;  3WYW A;  2GST A;  5IMV A;  4FIW A;  3Q6O A;  3UBL A;  1S3R A;  3M8N A;  2CVB A;  1EEJ A;  4AJ7 A;  1XWB A;  1K0O A;  4ID0 A;  2QSI A;  1GSD A;  2XPD A;  4DSR A;  4MZW A;  3SBC A;  4V2N A;  1UN2 A;  3F4R A;  2A2S A;  1JFU A;  4GSS A;  1MTC A;  2R2J A;  2QKE A;  1FB0 A;  5J3R A;  3S9F A;  4PX1 A;  3W8J A;  4PTS A;  4YH2 A;  5ECQ B;  2Z9S A;  2C3Q A;  2JL4 A;  3GUS A;  2FGX A;  3VFI A;  3C71 A;  1GTI A;  3ERF A;  2PWJ A;  4RQR A;  2DML A;  3I69 A;  4IKH A;  1XPV A;  4HDE A;  4GWR A;  3TJF A;  2PN8 A;  3M0F A;  2VL2 A;  5ELG A;  2FWE A;  2O7K A;  1BG5 A;  3GYK A;  3O6T A;  4KGI A;  1EOG A;  4USS A;  2LJA A;  4J2F A;  4MZB A;  5BMU A;  4F9Z A;  2YPM A;  3LXZ A;  1T8E B;  2R3X A;  1BQ7 A;  3FZ5 A;  4HZ4 A;  3KM6 A;  3GH9 A;  3VWU A;  4PUR A;  4K0G A;  2C3T A;  2WFC A;  4XS6 A;  4HUA A;  4KDX A;  1AXD A;  5F8B A;  4Z2R A;  1TK5 B;  1Q98 A;  1A2L A;  3FRC A;  1EWX A;  1C72 A;  4HEA 2;  1K0B A;  3WT1 A;  4GTU A;  2IMF A;  1A0R P;  2JZT A;  3DXB A;  4NXI A;  2IIY A;  1YDK A;  4DSS B;  2YOI A;  2PER A;  2F3M A;  2ZNM A;  5EVO A;  2TIR A;  1FHE A;  1PKW A;  4LLR A;  3WGD A;  5H5Q A;  2JSZ A;  4LL4 B;  4ACS A;  2WZ9 A;  3DYR A;  1O6J A;  1YZX A;  3MAK A;  4PXO A;  2HSH A;  3KXO A;  2LQO A;  3I9V 2;  4K0N A;  2EIR A;  5CNW A;  2H1D A;  5FWG A;  5GSS A;  4NV5 A;  3HHV A;  3BD2 A;  4YQM A;  2E2M A;  2GSQ A;  4OCF A;  1WOU A;  1M0U A;  3TGZ A;  4WBJ A;  5A4W A;  2WS2 A;  1GTA A;  4AJ6 A;  3ZTL A;  2FUG 2;  1JZW A;  3TKS E;  14GS A;  2MMO A;  2CX3 A;  1J08 A;  5ECH B;  3EU3 A;  3ZIT A;  4NPB A;  4EIQ A;  4Q5N A;  5DJL A;  2LRT A;  1FVK A;  5C00 A;  1XZO A;  4KB3 A;  5GAP D;  2VIM A;  4V1A p;  3J7Y k;  4G0I A;  2HXK A;  4L5L A;  2F9S A;  4EC0 A;  3P2A A;  5E59 A;  1F2E A;  4TN8 A;  2IJY A;  1SJZ A;  1MDK A;  5G1L A;  4BVX B;  4MPF A;  3GKK A;  1UVZ A;  1XFL A;  2IMI A;  1PN0 A;  1VF4 A;  1YY7 A;  3QAG A;  4MJB A;  1ZYP A;  3LGC A;  1ZZY A;  4G10 A;  4EVM A;  1XWC A;  4G0L A;  5G5F A;  5FT3 A;  4E8H A;  1SEN A;  3MIX A;  2R5G A;  4TR4 A;  4FO5 A;  2GLR A;  1U6T A;  3LYK A;  2NPB A;  1Z3E A;  2GTU A;  3VI7 A;  1U3I A;  2VCX A;  1MEK A;  2H6Z A;  1SL0 B;  5DDL A;  3A5I A;  3MYD A;  3FZA A;  1PA3 A;  1JHB A;  3G7I A;  4GCI A;  4HQZ A;  2GVP A;  1HYU A;  2V1M A;  2C80 A;  2CZ2 A;  5EPF A;  5A4V A;  2V6K A;  3R2Q A;  2RLI A;  3KJY A;  4EUY A;  2JZR A;  9GSS A;  2FD3 A;  3C7M A;  4O92 A;  4Z7X A;  1W4V A;  3TRP A;  4L0W A;  1GSE A;  3KD0 A;  2H0G A;  3NZN A;  3FYG A;  2V2G A;  4JED A;  4MH2 A;  2H6X A;  2DIY A;  4JBB A;  4HU9 A;  5AIX A;  1J0F A;  3DVW A;  4WF4 A;  2JU5 A;  5EY6 A;  4WET A;  2KOK A;  3CSH A;  5KN0 A;  2HYX A;  4OWY A;  3CTF A;  4YAP A;  2K6V A;  3UL3 A;  4YAV A;  4K1F A;  3FR3 A;  3IR4 A;  5F06 A;  1X9M B;  5G30 A;  1M2A A;  4TR0 A;  1G6Y A;  4G9H A;  1QFN A;  4GXZ A;  1MDJ A;  2A2P A;  2A2R A;  3H93 A;  2CAQ A;  3C73 A;  3OR5 A;  1TDI A;  1TOF A;  4BVY A;  4PQI A;  2VM1 A;  5IMA A;  1PMT A;  4CW9 A;  3F3Q A;  4CY8 A;  2WGR A;  3DRN A;  2ZUP A;  5D93 A;  1T7P B;  4MJC A;  4I2T A;  1JZR A;  4O5U A;  3E3E A;  4Q5R A;  1YF1 A;  1K0D A;  3P8W A;  3I43 A;  2F51 A;  4IJI A;  2XPE A;  3GKN A;  1GTB A;  2H0H A;  3F8U A;  3QAV A;  2OBI A;  2HRA A;  3GSS A;  1WRY A;  2LQQ A;  5DCG A;  3QFA C;  4TXO A;  3D0Z A;  6GSU A;  1I9D A;  4NHW A;  3DML A;  3HJM A;  1WP0 A;  5HR0 A;  2FWH A;  4WKW A;  2I1U A;  3QMX A;  1Q4J A;  1OC9 B;  2VCZ A;  3HVN A;  2GZP A;  3EVI A;  3LEF A;  4POM A;  5HR1 A;  3F0I A;  1DE1 A;  2UZ8 A;  4IJ3 A;  2I4A A;  3L9S A;  3GMF A;  1XWK A;  4TW5 A;  1SL1 B;  2MMN A;  1TRU A;  20GS A;  2R0P A;  3IV4 A;  1JZO A;  2A4V A;  3RDW A;  4X43 A;  4KW6 A;  5DQY A;  2HT9 A;  1T3B A;  3H4K A;  2OBK A;  3A2X A;  3EE2 A;  2GT6 A;  4XCS A;  2E0Q A;  1WJK A;  1V9W A;  2CVK A;  2HRN A;  3DEX A;  3W6G A;  4ZBD A;  2CT6 A;  4LA1 A;  5INY A;  1PRX A;  1E2Y A;  3RHB A;  1EGR A;  2HI7 A;  3M9K A;  4OMV A;  2H66 A;  3EPT A;  3GHA A;  2GQK A;  2K8V A;  1YEP A;  4HJ2 A;  2HZE A;  3FW2 A;  3TOT A;  1GSF A;  4MLY A;  2DKH A;  3LOR A;  4ICY A;  2YWN A;  3IDV A;  1BAY A;  4TR3 A;  1F3A A;  5COH A;  4IQ1 A;  5E4W A;  1GSY A;  2NDO A;  4JR4 A;  1CQH A;  1SK0 A;  1NSW A;  4IVF A;  3LFL A;  5DAK A;  2B5E A;  2WB9 A;  3EU4 A;  1VGL A;  4MAB A;  5D73 A;  1NHO A;  1TW9 A;  2DLX A;  4EIP A;  3A5W A;  4XS1 A;  5B8B A;  4EKZ A;  1T4Y A;  3KZQ A;  3GL5 A;  1OYJ A;  3HY2 A;  2DJ3 A;  4K8M A;  4TR1 B;  3L78 A;  3MNG A;  4N11 A;  1YKA A;  3DGQ A;  1ZGN A;  2WRT A;  2YN1 A;  3EUR A;  6GSV A;  3FK8 A;  3L9U A;  2H6Y A;  4NWY A;  4XHM A;  2GSS A;  4IQA A;  1GNE A;  4KCE A;  3VUR A;  2X8G A;  1E6B A;  2N5F A;  4OFT A;  1R5P A;  2H1B A;  1F37 A;  4ZL7 A;  1SL2 B;  1FO5 A;  2F8F A;  4N10 A;  5KN3 A;  5JCG A;  2OKA A;  3VWX A;  3C1R A;  3GFK A;  4NAX A;  5ID2 A;  5CRD A;  1TK0 B;  13GS A;  4H86 A;  3QD9 A;  5IM9 A;  2C4J A;  1EZK A;  2REM A;  4WEY A;  2K9F A;  4MNN A;  5CO3 A;  4DEJ A;  2MBT A;  4DSQ A;  4EDY A;  4FYC A;  3TRX A;  4BIK A;  1ML6 A;  1X5C A;  17GS A;  4WXT A;  1X0R A;  3D21 A;  1B9Y C;  3EMX A;  1R26 A;  2O89 A;  3ZMK A;  1XW9 A;  4LMW A;  3ZRD A;  4GRF A;  5CAX A;  1M2D A;  4KSM A;  4JZQ A;  18GS A;  1HD2 A;  2AJQ B;  1PSQ A;  4PGT A;  5ECI B;  3KIJ A;  2QC7 A;  4BL7 A;  3TJJ A;  4YKG A;  2GGT A;  2LKU A;  2ALB A;  2YCD A;  3IAS 2;  1EP7 A;  1XOA A;  4ZB8 A;  3US3 A;  2ES7 A;  2OE1 A;  3DIE A;  4QQ7 A;  5HFI A;  4IEL A;  3TJG A;  4ZBA A;  1WPI A;  2M72 A;  3HJO A;  3D4T A;  3TUE A;  3ZL5 A;  1PX6 A;  3IHG A;  1TP9 A;  3FHK A;  3HVS A;  2H8L A;  3ED3 A;  3G7Y A;  5LNK e;  4L8E A;  2LTK A;  1XG8 A;  1TJD A;  1UA5 A;  1SKR B;  2MBS A;  4CY6 A;  3RHC A;  5J9B A;  4K2X A;  1ABA A;  4K5S A;  2VCT A;  5J4U A;  3KGK A;  3LW9 A;  5IMD A;  2DJ0 A;  1Z6N A;  4MJA A;  1PL1 A;  2R6K A;  4XIH A;  5G1K A;  5IPH A;  1WWJ A;  2A4H A;  3FEU A;  1FVJ A;  2MZC A;  3E9J B;  2VCQ A;  3GIX A;  1ZYN A;  3HDC A;  1LBK A;  2GZY A;  4K7I A;  2LST A;  2IWT A;  1ZL9 A;  5ELA A;  2K18 A;  1IYI A;  3LSZ A;  5JWQ B;  3KH7 A;  1A23 A;  2H19 A;  1MDI A;  2I3Y A;  4O7H A;  5GZZ B;  5EL8 A;  4LMV A;  1BJX A;  4KUN A;  5DAL A;  2ZCT A;  2VUP A;  4F0C A;  1TXX A;  4ECJ A;  1UC7 A;  3ME7 A;  1K3O A;  3KP9 A;  4I97 A;  1N2A A;  2I9H A;  4HJM A;  1NHY A;  3C8E A;  4TVE A;  4O5R A;  4HU7 A;  2L4C A;  1SK1 A;  1U3A A;  3U5R E;  1ZYQ B;  2QA2 A;  4HI7 A;  1BX9 A;  1V40 A;  1QGV A;  3HZ4 A;  4GSN A;  6GST A;  1BED A;  1PKZ A;  4KAE A;  5ECK B;  3LQ7 A;  3HA9 A;  3IK9 A;  2VM2 A;  4BVY B;  5D9X A;  3KP8 A;  3IAM 2;  3IK7 A;  4BWQ A;  2C0G A;  3TJB A;  8GSS A;  1U88 A;  4NV2 A;  2G0F A;  1B48 A;  3N9J A;  4KCA A;  2KUC A;  1T1V A;  3J7Y b;  1HNA A;  1R7H A;  2P31 A;  3QPM A;  1SU9 A;  3ERW A;  5GAN D;  5CRW A;  3QDN A;  1VF1 A;  4KA0 A;  2L57 A;  4TXO B;  5IMC A;  4E8E A;  1EV4 A;  3LWA A;  2H73 A;  3APQ A;  3KCM A;  1EEM A;  4TOP A;  1FW1 A;  4POK A;  1THX A;  1I5G A;  3UMA A;  1RQM A;  1GH2 A;  2B7J A;  4KSO A;  3PR8 A;  3HZ8 A;  3ZRE A;  2FNO A;  3IE3 A;  4YKF A;  2FLS A;  3VLN A;  2LS5 A;  3RAZ A;  2HZF A;  1FOV A;  2ON5 A;  3ZML A;  5D9W A;  3KH9 A;  1TU8 A;  3ZZX A;  2HRF A;  4I8B A;  1O85 A;  1OE7 A;  2XBI A;  1GSQ A;  5F07 A;  3NOF A;  3CSI A;  3N5O A;  4XRD A;  3JCM L;  2CA8 A;  5IOX A;  5A5K A;  2CX4 A;  2VO4 A;  1RK4 A;  1H4O A;  5J9C A;  4ULX A;  1ACV A;  3F9U A;  1AIU A;  4XS4 A;  3D6I A;  3MWH A;  1GP1 A;  4N30 A;  1LU4 A;  1J9B A;  2IL3 A;  2GQL A;  4POL A;  2AHE A;  1HNC A;  1TRV A;  1LJR A;  2HZE B;  3UJ1 A;  1AQW A;  4ZL8 A;  3HKR A;  4ZL9 A;  1A2J A;  2DBC A;  3VI5 A;  2C3N A;  1GL8 A;  4IS0 A;  4OFM A;  3F3R A;  2DIZ A;  3Q74 A;  3HYP A;  2PMT A;  5DAK B;  4MJE A;  2OJL A;  4V2L A;  4JE1 A;  4P3Y B;  1TKD B;  1R5A A;  5HR2 A;  1PQN A;  5KN1 A;  3EYT A;  2CVD A;  4FH8 A;  4EL1 A;  2AYT A;  4ZB6 A;  1YJ6 A;  4YQV A;  5F05 A;  5L71 A;  4MZC A;  5BRT A;  5AIV A;  3UAR A;  4CDO A;  4PUA A;  3BCI A;  19GS A;  3L9V A;  1WIK A;  4EO3 A;  2GQM A;  1Z7P A;  1QK8 A;  4FQU A;  4O5Q A;  1SD8 A;  5CP1 A;  2GS3 A;  3ERG A;  3GST A;  1RW1 A;  3Q19 A;  5B6N A;  4HSC X;  2L4Q A;  2NTO A;  6GSY A;  5ECR B;  5HFK A;  1EOH A;  2AV4 A;  5KEJ A;  1U87 A;  2MMA A;  2H70 A;  4MMM A;  3D5J A;  3TKS C;  1H75 A;  2KHP A;  2XC2 A;  2DJK A;  1OVN A;  2FCH A;  5ID2 B;  1O8X A;  1XVQ A;  4HQS A;  1M2B A;  2P0G A;  3CRT A;  1ERW A;  2M46 A;  2PGT A;  5CRH A;  5ECS A;  4BWS A;  4PNF A;  5FHI A;  2C8U A;  2DJ2 A;  1B8X A;  3UAP A;  2F8A A;  1A8Y A;  3SWL A;  3M3M A;  5D96 A;  3VWV A;  3F6D A;  3TDG A;  3GRX A;  5CRE A;  3FR9 A;  5LCZ A;  2PPT A;  4BPY A;  4X0X A;  4F82 A;  4EDZ A;  2JAD A;  4KDU A;  4BL7 B;  1A24 A;  3WGE A;  3QAW A;  4IHU A;  1AAZ A;  4TKY A;  3GX0 A;  2HSY A;  4FYU A;  2L59 A;  5KN2 A;  4IBP A;  2E2G A;  1S3D A;  3UBK A;  2M80 A;  5G2Z A;  4F2I A;  3TKS A;  1ZYE A;  2MYG A;  4QL7 A;  1XBS A;  1ZOF A;  5A4U A;  3EWL A;  2FWF A;  4DVC A;  1XIY A;  5B6M A;  1X5E A;  2RUF A;  4AJ8 A;  5KOX A;  2L5O A;  2H76 A;  6GSW A;  1OKD A;  4MK3 A;  5DVB A;  3WGX A;  3M1G A;  2H1G A;  4TXV A;  2QGV A;  2VOC A;  1K0A A;  3L0H A;  2H1A A;  1XXU A;  1JLW A;  2VLU A;  1ST9 A;  2BJX A;  2KLX A;  3D22 A;  1Z6M A;  5IMZ A;  1G0T A;  3CXG A;  4ZIL A;  1XCC A;  4MP4 A;  1Z9H A;  4ECB A;  1V2A A;  1KTE A;  4XTS A;  3H8Q A;  3RPP A;  1G7E A;  1KBN A;  4GST A;  3FZ4 A;  6GSS A;  1SJI A;  4TRX A;  1HNB A;  3A3T A;  4K9Z A;  2LV3 A;  4AF2 A;  5DAL B;  3ZVJ A;  4ML1 A;  22GS A;  1TRW A;  1XOB A;  5HR3 A;  3HJP A;  4N0Z A;  1TK8 B;  3ZFL A;  3EIN A;  3D4M A;  3G7J A;  2AB6 A;  2YJH A;  4ZXG A;  3CRU A;  2WDU A;  3KTB A;  3IOS A;  3M9J A;  1G7O A;  5IQY A;  1TI1 A;  2YV9 A;  3ZYW A;  2C0F A;  6GSX A;  5ECP B;  2DSA A;  2FWG A;  2L6D A;  1OE8 A;  2RM5 A;  3DVX A;  4L5O A;  3ME8 A;  5JWR B;  4YQU A;  2O8V B;  3CTG A;  2H71 A;  3C1S A;  2IN3 A;  3FY7 A;  4K5R A;  4MDC A;  2TRC P;  1WMJ A;  3CMI A;  3G9B A;  3K8N A;  1YEX A;  1URM A;  2LNS A;  4CHS A;  3GV1 A;  2PU9 C;  4FYB A;  1PN9 A;  4ZIJ A;  4IGJ A;  1K0C A;  3IHQ A;  2RII A;  3CSJ A;  2YZU A;  3DKS A;  2HRK A;  1R4W A;  1GRX A;  3FMW A;  3PPU A;  2LRN A;  4EE0 A;  2O85 A;  2YWM A;  2VAF A;  5IIZ A;  1JZD A;  4N0V A;  3UOM A;  1SD9 A;  4K2D A;  4ZBB A;  1G6W A;  5ABR A;  3TOU A;  2LJK A;  1USB A;  2OAC A;  2AAW A;  2N5B A;  2X64 A;  3QR6 A;  2MMZ A;  3A2V A;  3RBT A;  2HNL A;  4KND A;  4ZB9 A;  1DBY A;  3GTU A;  5D9V A;  2R37 A;  1CQG A;  2GSR A;  3L4N A;  4XS4 B;  4KE3 A;  1GWC A;  3HVV A;  4K7O A;  5B7C A;  4OFN A;  4D73 A;  3AY8 A;  2PVQ A;  2K8S A;  2BTO T;  2O87 A;  2YWO A;  4TR1 A;  2FHE A;  2X99 A;  3GX8 A;  2PUK C;  3PIN A;  3UVH A;  3CQF A;  1PGT A;  2N5A A;  2B1L A;  4HZ2 A;  1X9W B;  4GLT A;  4HOJ A;  1EV9 A;  3ZFB A;  1PL2 A;  3IPZ A;  3IC8 A;  3ZIJ A;  1AC1 A;  5C04 A;  1TTZ A;  2H01 A;  2EIQ A;  2B5Y A;  1S3C A;  1PD2 1;  2H30 A;  1F6M C;  4IP1 A;  1TRS A;  1SYR A;  3NIV A;  4G2E A;  1TI3 A;  4MCU A;  5DBQ A;  2R0G A;  1YQ1 A;  2RM6 A;  4ECC A;  4LL1 B;  2FA4 A;  2I81 A;  4J57 E;  1EP8 A;  2X4A A;  1K0M A;  5GST A;  3MSZ A;  1GLQ A;  2D2Z A;  5H5S A;  3UIW A;  3R3E A;  3KTL A;  1K0N A;  4PUF C;  2L6C A;  1FAA A;  1B9X C;  2VL9 A;  3QCP A;  4I6X A;  3IA1 A;  1V58 A;  4ML6 A;  2H72 A;  5DQS A;  4ECI A;  2IFQ A;  3GUR A;  4EXJ A;  4RI6 A;  3E0U A;  1F9M A;  1X9S B;  4A5P A;  5ECM B;  3W8S A;  2TRX A;  3TJK A;  2CV4 A;  4KF9 A;  2OE3 A;  2LEG A;  2FY6 A;  3ZIV A;  1IYH A;  1MD4 A;  2VCV A;  4OO5 A;  1KNG A;  1ZMA A;  1M3I A;  5AN1 A;  5IO2 A;  3P90 A;  5J41 A;  1B4Q A;  2DMM A;  2J9H A;  4ILF A;  2KP1 A;  2JSY A;  4MPG A;  4OD7 A;  4XRA A;  1AQX A;  5IMF A;  4F0B A;  2H74 A;  4G0K A;  1DE2 A;  1XWA A;  2CQ9 A;  3VK9 A;  3EMP A;  1O7U A;  2H0I A;  2OE0 A;  1O8W A;  1VRS D;  2DKI A;  3RPN A;  4O32 A;  4GQC A;  1ERT A;  3GH6 A;  1O81 A;  5G5E A;  1QXH A;  1ON4 A;  1AUC A;  2EC4 A;  3V1W A;  11GS A;  3P7X A;  2DC5 A;  4V2M A;  5IPG A;  3KMN A;  2H75 A;  1QQ2 A;  4WBR D;  1XW5 A;  4RUV A;  1VF3 A;  1THO A;  3F4T A;  2OAD A;  1HQO A;  5IO0 A;  1XWG A;  3GN3 A;  5B8A A;  2GZZ A;  2LJR A;  7GSS A;  3IRA A;  2BMX A;  2XHF A;  3FKF A;  4NHZ A;  3WT2 A;  2B1K A;  1FB6 A;  3TB2 A;  2J23 A;  3GNJ A;  5ENU A;  4X1U A;  4Q5F A;  2IPA A;  3GKX A;  4DSS A;  1M9A A;  4IN0 A;  2VLT A;  3VPT A;  4PQ1 A;  4GF0 A;  4I5Q A;  1M99 A;  3ISO A;  2YJ7 A;  1DSB A;  4X4J A;  4PNG A;  3IBH A;  3KMO A;  2YZH A;  2IME A;  4L0U A;  1XVW A;  1NM3 A;  1Y6E A;  1B4P A;  3HXS A;  2WCI A;  4GQF A;  3BBY A;  2B5X A;  3TRQ A;  2LNT A;  4KX4 A;  1O73 A;  1Z5Y E;  2HLS A;  5LD0 A;  3TCO A;  4MF6 A;  3UVT A;  4Q5Q A;  3F4S A;  4MA9 A;  3LG6 A;  5F0G A;  2R0C A;  3CYN A;  2R4V A;  1OKT A;  1M7T A;  3APO A;  4BA7 A;  1EGO A;  1OC8 A;  5DCH A;  2AUV A;  2L5L A;  2VD0 A;  2X8C A;  4QL9 A;  1TU7 A;  2X8H A;  2GT5 A;  5ECN B;  1FOH A;  1GLP A;  2B7K A;  3O3T A;  2G2Q A;  1ILO A;  3HCZ A;  3EC3 A;  5ECL B;  2HSM A;  1ZCP A;  3PGT A;  2ON7 A;  2YV7 A;  3GA4 A;  4AGS A;  4IW9 A;  4MF7 A;  1NW2 A;  3GKM A;  1YF0 A;  2V41 A;  1ERU A;  1YKC A;  4K6X A;  1N8J A;  1X5D A;  3DD3 A;  3DWV A;  2HFD A;  1DUG A;  2DJ1 A;  4Z2T A;  4BVX A;  2C0D A;  2YWI A;  1VF2 A;  5H5R A;  3HVX A;  1FG4 A;  3F6F A;  4IP6 A;  2JZS A;  3UEM A;  5HFG A;  4MH3 A;  2B6M A;  5D9T A;  5CYY A;  1GUK A;  4G19 A;  2C0E A;  1XW6 A;  3LJR A;  4I2U A;  1V98 A;  4WF5 A;  5DJM A;  5JCW A;  4J56 E;  3MDK A;  2V6O A;  3I6A A;  2CZ3 A;  1T4Z A;  1A8L A;  1QMV A;  2VLV A;  3H79 A;  2KP2 A;  2OA7 A;  2P5R A;  3IXR A;  3TKR A;  3O76 A;  3LXT A;  1F3B A;  5JWO B;  2NBS A;  1K3L A;  2VL3 A;  2WJU A;  1BYE A;  2GDR A;  4K7N A;  3TKQ A;  2YNX A;  1OAZ A;  5CRG A;  3PH9 A;  4WR5 A;  5HQP A;  2WUL A;  1T00 A;  4OO4 A;  2FA8 A;  1K3Y A;  4NMU A;  3GL3 A;  1QUW A;  1GUH A;  3HD5 A;  1M3J A;  3ZVJ D;  1SKW B;  1MD3 A;  1W89 A;  3BJ5 A;  3CBU A;  4KH7 A;  5ECO B;  2YAN A;  1GSS A;  1S3A A;  2B3S A;  2CAI A;  2DJJ A;  3A2W A;  3KEB A;  3VWW A;  5D8I A;  4KDY A;  4V1A g;  2HE3 A;  1GNW A;  3APS A;  3GTU B;  4POB A;  4RQX A;  2VD1 A;  1SJ6 A;  1SYX A;  2V32 A;  5KOW A;  4D73 B;  1GUL A;  2IMD A;  2PBJ A;  5AGY A;  4OCE A;  1AW9 A;  3ZLP A;  10GS A;  2IMK A;  1A2M A;  2X49 A;  4HS1 A; 
#chains in the Genus database with same CATH homology
 4ISD A;  1Z7R A;  5JCU A;  1SKS B;  3QOU A;  4WR4 A;  16GS A;  3H1N A;  1GTU A;  5J5N A;  3BOA A;  1ERV A;  1SK2 A;  3QFB C;  5AIS A;  5IOW A;  3TKP A;  4Z2U A;  2YP6 A;  3Q18 A;  3FZ9 A;  1GUM A;  3IC4 A;  4JRR A;  2RUE A;  1OC3 A;  3F63 A;  2LRC A;  1WE0 A;  4JR6 A;  2EIO A;  1PX7 A;  1OC9 A;  2PVO C;  1Y25 A;  4PQH A;  1JLV A;  2XBQ A;  2NVL A;  3WD6 A;  1AQV A;  3BCK A;  2E7P A;  3VPQ A;  2VL2 C;  4F03 A;  1M9B A;  1A0F A;  3FR6 A;  2IFQ B;  2JAC A;  3U6V A;  1KEB A;  3LYP A;  2C1Y A;  1V57 A;  4JU5 A;  2P5Q A;  4RI7 A;  2VCW A;  5G31 A;  1GSU A;  4MF5 A;  2LUS A;  12GS A;  4EF0 A;  2QA1 A;  3WYW A;  2GST A;  5IMV A;  4FIW A;  3Q6O A;  3UBL A;  3M8N A;  2CVB A;  1EEJ A;  4AJ7 A;  1XWB A;  1K0O A;  4ID0 A;  2QSI A;  1GSD A;  2XPD A;  4DSR A;  4MZW A;  3SBC A;  4V2N A;  1UN2 A;  3F4R A;  2A2S A;  1JFU A;  4GSS A;  1MTC A;  2R2J A;  2QKE A;  1FB0 A;  5J3R A;  3S9F A;  4PX1 A;  3W8J A;  4PTS A;  4YH2 A;  5ECQ B;  2Z9S A;  2C3Q A;  2JL4 A;  3GUS A;  2FGX A;  3VFI A;  3C71 A;  1GTI A;  3ERF A;  2PWJ A;  4RQR A;  2DML A;  3I69 A;  4IKH A;  1XPV A;  4HDE A;  4GWR A;  3TJF A;  2PN8 A;  3M0F A;  2VL2 A;  5ELG A;  2FWE A;  2O7K A;  1BG5 A;  3GYK A;  3O6T A;  4KGI A;  1EOG A;  4USS A;  2LJA A;  4J2F A;  4MZB A;  5BMU A;  4F9Z A;  2YPM A;  3LXZ A;  1T8E B;  2R3X A;  1BQ7 A;  3FZ5 A;  4HZ4 A;  3KM6 A;  3GH9 A;  3VWU A;  4PUR A;  4K0G A;  2C3T A;  2WFC A;  4XS6 A;  4HUA A;  4KDX A;  1AXD A;  5F8B A;  4Z2R A;  1TK5 B;  1Q98 A;  1A2L A;  3FRC A;  1EWX A;  1C72 A;  4HEA 2;  1K0B A;  3WT1 A;  4GTU A;  2IMF A;  1A0R P;  2JZT A;  3DXB A;  4NXI A;  2IIY A;  1YDK A;  4DSS B;  2YOI A;  2PER A;  2F3M A;  2ZNM A;  5EVO A;  2TIR A;  1FHE A;  1PKW A;  4LLR A;  3WGD A;  5H5Q A;  2JSZ A;  4LL4 B;  4ACS A;  2WZ9 A;  3DYR A;  1O6J A;  1YZX A;  3MAK A;  4PXO A;  2HSH A;  3KXO A;  2LQO A;  3I9V 2;  4K0N A;  2EIR A;  5CNW A;  2H1D A;  5FWG A;  5GSS A;  4NV5 A;  3HHV A;  3BD2 A;  4YQM A;  2E2M A;  2GSQ A;  4OCF A;  1WOU A;  1M0U A;  3TGZ A;  4WBJ A;  5A4W A;  2WS2 A;  1GTA A;  4AJ6 A;  3ZTL A;  2FUG 2;  1JZW A;  3TKS E;  14GS A;  2MMO A;  2CX3 A;  1J08 A;  5ECH B;  3EU3 A;  3ZIT A;  4NPB A;  4EIQ A;  4Q5N A;  5DJL A;  2LRT A;  1FVK A;  5C00 A;  1XZO A;  4KB3 A;  5GAP D;  2VIM A;  4V1A p;  3J7Y k;  4G0I A;  2HXK A;  4L5L A;  2F9S A;  4EC0 A;  3P2A A;  5E59 A;  1F2E A;  4TN8 A;  2IJY A;  1SJZ A;  1MDK A;  5G1L A;  4BVX B;  4MPF A;  3GKK A;  1UVZ A;  1XFL A;  2IMI A;  1PN0 A;  1VF4 A;  1YY7 A;  3QAG A;  4MJB A;  1ZYP A;  3LGC A;  1ZZY A;  4G10 A;  4EVM A;  1XWC A;  4G0L A;  5G5F A;  5FT3 A;  4E8H A;  1SEN A;  3MIX A;  2R5G A;  4TR4 A;  4FO5 A;  2GLR A;  1U6T A;  3LYK A;  2NPB A;  1Z3E A;  2GTU A;  3VI7 A;  1U3I A;  2VCX A;  1MEK A;  2H6Z A;  1SL0 B;  5DDL A;  3A5I A;  3MYD A;  3FZA A;  1PA3 A;  1JHB A;  3G7I A;  4GCI A;  4HQZ A;  2GVP A;  1HYU A;  2V1M A;  2C80 A;  2CZ2 A;  5EPF A;  5A4V A;  2V6K A;  3R2Q A;  2RLI A;  3KJY A;  4EUY A;  2JZR A;  9GSS A;  2FD3 A;  3C7M A;  4O92 A;  4Z7X A;  1W4V A;  3TRP A;  4L0W A;  1GSE A;  3KD0 A;  2H0G A;  3NZN A;  3FYG A;  2V2G A;  4JED A;  4MH2 A;  2H6X A;  2DIY A;  4JBB A;  4HU9 A;  5AIX A;  1J0F A;  3DVW A;  4WF4 A;  2JU5 A;  5EY6 A;  4WET A;  2KOK A;  3CSH A;  5KN0 A;  2HYX A;  4OWY A;  3CTF A;  4YAP A;  2K6V A;  3UL3 A;  4YAV A;  4K1F A;  3FR3 A;  3IR4 A;  5F06 A;  1X9M B;  5G30 A;  1M2A A;  4TR0 A;  1G6Y A;  4G9H A;  1QFN A;  4GXZ A;  1MDJ A;  2A2P A;  2A2R A;  3H93 A;  2CAQ A;  3C73 A;  3OR5 A;  1TDI A;  1TOF A;  4BVY A;  4PQI A;  2VM1 A;  5IMA A;  1PMT A;  4CW9 A;  3F3Q A;  4CY8 A;  2WGR A;  3DRN A;  2ZUP A;  5D93 A;  1T7P B;  4MJC A;  4I2T A;  1JZR A;  4O5U A;  3E3E A;  4Q5R A;  1YF1 A;  1K0D A;  3P8W A;  3I43 A;  2F51 A;  4IJI A;  2XPE A;  3GKN A;  1GTB A;  2H0H A;  3F8U A;  3QAV A;  2OBI A;  2HRA A;  3GSS A;  1WRY A;  2LQQ A;  5DCG A;  3QFA C;  4TXO A;  3D0Z A;  6GSU A;  1I9D A;  4NHW A;  3DML A;  3HJM A;  1WP0 A;  5HR0 A;  2FWH A;  4WKW A;  2I1U A;  3QMX A;  1Q4J A;  1OC9 B;  2VCZ A;  2GZP A;  3EVI A;  3LEF A;  4POM A;  5HR1 A;  3F0I A;  1DE1 A;  2UZ8 A;  4IJ3 A;  2I4A A;  3L9S A;  3GMF A;  1XWK A;  4TW5 A;  1SL1 B;  2MMN A;  1TRU A;  20GS A;  2R0P A;  3IV4 A;  1JZO A;  2A4V A;  3RDW A;  4X43 A;  4KW6 A;  5DQY A;  2HT9 A;  1T3B A;  3H4K A;  2OBK A;  3A2X A;  3EE2 A;  2GT6 A;  4XCS A;  2E0Q A;  1WJK A;  1V9W A;  2CVK A;  2HRN A;  3DEX A;  3W6G A;  4ZBD A;  2CT6 A;  4LA1 A;  5INY A;  1PRX A;  1E2Y A;  3RHB A;  1EGR A;  2HI7 A;  3M9K A;  4OMV A;  2H66 A;  3EPT A;  3GHA A;  2GQK A;  2K8V A;  1YEP A;  4HJ2 A;  2HZE A;  3FW2 A;  3TOT A;  1GSF A;  4MLY A;  2DKH A;  3LOR A;  4ICY A;  2YWN A;  3IDV A;  1BAY A;  4TR3 A;  1F3A A;  5COH A;  4IQ1 A;  5E4W A;  1GSY A;  2NDO A;  4JR4 A;  1CQH A;  1SK0 A;  1NSW A;  4IVF A;  3LFL A;  5DAK A;  2B5E A;  2WB9 A;  3EU4 A;  1VGL A;  4MAB A;  5D73 A;  1NHO A;  1TW9 A;  2DLX A;  4EIP A;  3A5W A;  4XS1 A;  5B8B A;  4EKZ A;  1T4Y A;  3KZQ A;  3GL5 A;  1OYJ A;  3HY2 A;  2DJ3 A;  4K8M A;  4TR1 B;  3L78 A;  3MNG A;  4N11 A;  1YKA A;  3DGQ A;  1ZGN A;  2WRT A;  2YN1 A;  3EUR A;  6GSV A;  3FK8 A;  3L9U A;  2H6Y A;  4NWY A;  4XHM A;  2GSS A;  4IQA A;  1GNE A;  4KCE A;  3VUR A;  2X8G A;  1E6B A;  2N5F A;  4OFT A;  1R5P A;  2H1B A;  1F37 A;  4ZL7 A;  1SL2 B;  1FO5 A;  2F8F A;  4N10 A;  5KN3 A;  5JCG A;  2OKA A;  3VWX A;  3C1R A;  3GFK A;  4NAX A;  5ID2 A;  5CRD A;  1TK0 B;  13GS A;  4H86 A;  3QD9 A;  5IM9 A;  2C4J A;  1EZK A;  2REM A;  4WEY A;  2K9F A;  4MNN A;  5CO3 A;  4DEJ A;  2MBT A;  4DSQ A;  4EDY A;  4FYC A;  3TRX A;  1ML6 A;  1X5C A;  17GS A;  4WXT A;  1X0R A;  3D21 A;  1B9Y C;  3EMX A;  1R26 A;  2O89 A;  3ZMK A;  1XW9 A;  4LMW A;  3ZRD A;  4GRF A;  5CAX A;  1M2D A;  4KSM A;  4JZQ A;  18GS A;  1HD2 A;  2AJQ B;  1PSQ A;  4PGT A;  5ECI B;  3KIJ A;  2QC7 A;  4BL7 A;  3TJJ A;  4YKG A;  2GGT A;  2LKU A;  2ALB A;  2YCD A;  3IAS 2;  1EP7 A;  1XOA A;  4ZB8 A;  3US3 A;  2ES7 A;  2OE1 A;  3DIE A;  4QQ7 A;  5HFI A;  4IEL A;  3TJG A;  4ZBA A;  1WPI A;  2M72 A;  3HJO A;  3D4T A;  3TUE A;  3ZL5 A;  1PX6 A;  3IHG A;  1TP9 A;  3FHK A;  3HVS A;  2H8L A;  3ED3 A;  3G7Y A;  5LNK e;  4L8E A;  2LTK A;  1TJD A;  1UA5 A;  1SKR B;  2MBS A;  4CY6 A;  3RHC A;  5J9B A;  4K2X A;  1ABA A;  4K5S A;  2VCT A;  5J4U A;  3KGK A;  3LW9 A;  5IMD A;  2DJ0 A;  1Z6N A;  4MJA A;  1PL1 A;  2R6K A;  4XIH A;  5G1K A;  5IPH A;  1WWJ A;  2A4H A;  3FEU A;  1FVJ A;  2MZC A;  3E9J B;  2VCQ A;  3GIX A;  1ZYN A;  3HDC A;  1LBK A;  2GZY A;  4K7I A;  2LST A;  2IWT A;  1ZL9 A;  5ELA A;  2K18 A;  1IYI A;  3LSZ A;  5JWQ B;  3KH7 A;  1A23 A;  2H19 A;  1MDI A;  2I3Y A;  4O7H A;  5GZZ B;  5EL8 A;  4LMV A;  1BJX A;  4KUN A;  5DAL A;  2ZCT A;  2VUP A;  4F0C A;  1TXX A;  4ECJ A;  1UC7 A;  3ME7 A;  1K3O A;  3KP9 A;  4I97 A;  1N2A A;  2I9H A;  4HJM A;  1NHY A;  3C8E A;  4TVE A;  4O5R A;  4HU7 A;  2L4C A;  1SK1 A;  1U3A A;  3U5R E;  1ZYQ B;  2QA2 A;  4HI7 A;  1BX9 A;  1V40 A;  1QGV A;  3HZ4 A;  4GSN A;  6GST A;  1BED A;  1PKZ A;  4KAE A;  5ECK B;  3LQ7 A;  3HA9 A;  3IK9 A;  2VM2 A;  4BVY B;  5D9X A;  3KP8 A;  3IAM 2;  3IK7 A;  4BWQ A;  2C0G A;  3TJB A;  8GSS A;  1U88 A;  4NV2 A;  2G0F A;  1B48 A;  3N9J A;  4KCA A;  2KUC A;  1T1V A;  3J7Y b;  1HNA A;  1R7H A;  2P31 A;  3QPM A;  1SU9 A;  3ERW A;  5GAN D;  5CRW A;  3QDN A;  1VF1 A;  4KA0 A;  2L57 A;  4TXO B;  5IMC A;  4E8E A;  1EV4 A;  3LWA A;  2H73 A;  3APQ A;  3KCM A;  1EEM A;  4TOP A;  1FW1 A;  4POK A;  1THX A;  1I5G A;  3UMA A;  1RQM A;  1GH2 A;  2B7J A;  4KSO A;  3PR8 A;  3HZ8 A;  3ZRE A;  2FNO A;  3IE3 A;  4YKF A;  2FLS A;  3VLN A;  2LS5 A;  3RAZ A;  2HZF A;  1FOV A;  2ON5 A;  3ZML A;  5D9W A;  3KH9 A;  1TU8 A;  3ZZX A;  2HRF A;  4I8B A;  1O85 A;  1OE7 A;  2XBI A;  1GSQ A;  5F07 A;  3NOF A;  3CSI A;  3N5O A;  4XRD A;  3JCM L;  2CA8 A;  5IOX A;  5A5K A;  2CX4 A;  2VO4 A;  1RK4 A;  1H4O A;  5J9C A;  4ULX A;  1ACV A;  3F9U A;  1AIU A;  4XS4 A;  3D6I A;  3MWH A;  1GP1 A;  4N30 A;  1LU4 A;  1J9B A;  2IL3 A;  2GQL A;  4POL A;  2AHE A;  1HNC A;  1TRV A;  1LJR A;  2HZE B;  3UJ1 A;  1AQW A;  4ZL8 A;  3HKR A;  4ZL9 A;  1A2J A;  2DBC A;  3VI5 A;  2C3N A;  1GL8 A;  4IS0 A;  4OFM A;  3F3R A;  2DIZ A;  3Q74 A;  3HYP A;  2PMT A;  5DAK B;  4MJE A;  2OJL A;  4V2L A;  4JE1 A;  4P3Y B;  1TKD B;  1R5A A;  5HR2 A;  1PQN A;  5KN1 A;  3EYT A;  2CVD A;  4FH8 A;  4EL1 A;  2AYT A;  4ZB6 A;  1YJ6 A;  4YQV A;  5F05 A;  5L71 A;  4MZC A;  5BRT A;  5AIV A;  3UAR A;  4CDO A;  4PUA A;  3BCI A;  19GS A;  3L9V A;  1WIK A;  4EO3 A;  2GQM A;  1Z7P A;  1QK8 A;  4FQU A;  4O5Q A;  1SD8 A;  5CP1 A;  2GS3 A;  3ERG A;  3GST A;  1RW1 A;  3Q19 A;  5B6N A;  2L4Q A;  2NTO A;  6GSY A;  5ECR B;  5HFK A;  1EOH A;  2AV4 A;  5KEJ A;  1U87 A;  2MMA A;  2H70 A;  4MMM A;  3D5J A;  3TKS C;  1H75 A;  2KHP A;  2XC2 A;  2DJK A;  1OVN A;  2FCH A;  5ID2 B;  1O8X A;  1XVQ A;  4HQS A;  1M2B A;  2P0G A;  3CRT A;  1ERW A;  2M46 A;  2PGT A;  5CRH A;  5ECS A;  4BWS A;  4PNF A;  5FHI A;  2C8U A;  2DJ2 A;  1B8X A;  3UAP A;  2F8A A;  1A8Y A;  3SWL A;  3M3M A;  5D96 A;  3VWV A;  3F6D A;  3TDG A;  3GRX A;  5CRE A;  3FR9 A;  5LCZ A;  2PPT A;  4BPY A;  4X0X A;  4F82 A;  4EDZ A;  2JAD A;  4KDU A;  4BL7 B;  1A24 A;  3WGE A;  3QAW A;  4IHU A;  1AAZ A;  4TKY A;  3GX0 A;  2HSY A;  4FYU A;  2L59 A;  5KN2 A;  4IBP A;  2E2G A;  1S3D A;  3UBK A;  2M80 A;  5G2Z A;  4F2I A;  3TKS A;  1ZYE A;  2MYG A;  4QL7 A;  1XBS A;  1ZOF A;  5A4U A;  3EWL A;  2FWF A;  4DVC A;  1XIY A;  5B6M A;  1X5E A;  2RUF A;  4AJ8 A;  5KOX A;  2L5O A;  2H76 A;  6GSW A;  1OKD A;  4MK3 A;  5DVB A;  3WGX A;  3M1G A;  2H1G A;  4TXV A;  2QGV A;  2VOC A;  1K0A A;  3L0H A;  2H1A A;  1XXU A;  1JLW A;  2VLU A;  1ST9 A;  2BJX A;  2KLX A;  3D22 A;  1Z6M A;  5IMZ A;  1G0T A;  3CXG A;  4ZIL A;  1XCC A;  4MP4 A;  1Z9H A;  4ECB A;  1V2A A;  1KTE A;  4XTS A;  3H8Q A;  3RPP A;  1G7E A;  1KBN A;  4GST A;  3FZ4 A;  6GSS A;  1SJI A;  4TRX A;  1HNB A;  3A3T A;  4K9Z A;  2LV3 A;  4AF2 A;  5DAL B;  3ZVJ A;  4ML1 A;  22GS A;  1TRW A;  1XOB A;  5HR3 A;  3HJP A;  4N0Z A;  1TK8 B;  3ZFL A;  3EIN A;  3D4M A;  3G7J A;  2AB6 A;  2YJH A;  4ZXG A;  3CRU A;  2WDU A;  3KTB A;  3IOS A;  3M9J A;  1G7O A;  5IQY A;  1TI1 A;  2YV9 A;  3ZYW A;  2C0F A;  6GSX A;  5ECP B;  2DSA A;  2FWG A;  2L6D A;  1OE8 A;  2RM5 A;  3DVX A;  4L5O A;  3ME8 A;  5JWR B;  4YQU A;  2O8V B;  3CTG A;  2H71 A;  3C1S A;  2IN3 A;  3FY7 A;  4K5R A;  4MDC A;  2TRC P;  1WMJ A;  3CMI A;  3G9B A;  3K8N A;  1YEX A;  1URM A;  2LNS A;  4CHS A;  3GV1 A;  2PU9 C;  4FYB A;  1PN9 A;  4ZIJ A;  4IGJ A;  1K0C A;  3IHQ A;  2RII A;  3CSJ A;  2YZU A;  3DKS A;  2HRK A;  1R4W A;  1GRX A;  3FMW A;  3PPU A;  2LRN A;  4EE0 A;  2O85 A;  2YWM A;  2VAF A;  5IIZ A;  1JZD A;  4N0V A;  3UOM A;  1SD9 A;  4K2D A;  4ZBB A;  1G6W A;  5ABR A;  3TOU A;  2LJK A;  1USB A;  2OAC A;  2AAW A;  2N5B A;  2X64 A;  3QR6 A;  2MMZ A;  3A2V A;  3RBT A;  2HNL A;  4KND A;  4ZB9 A;  1DBY A;  3GTU A;  5D9V A;  2R37 A;  1CQG A;  2GSR A;  3L4N A;  4XS4 B;  4KE3 A;  1GWC A;  3HVV A;  4K7O A;  5B7C A;  4OFN A;  4D73 A;  3AY8 A;  2PVQ A;  2K8S A;  2BTO T;  2O87 A;  2YWO A;  4TR1 A;  2FHE A;  2X99 A;  3GX8 A;  2PUK C;  3PIN A;  3UVH A;  1PGT A;  2N5A A;  2B1L A;  4HZ2 A;  1X9W B;  4GLT A;  4HOJ A;  1EV9 A;  3ZFB A;  1PL2 A;  3IPZ A;  3IC8 A;  3ZIJ A;  1AC1 A;  5C04 A;  1TTZ A;  2H01 A;  2EIQ A;  2B5Y A;  1S3C A;  1PD2 1;  2H30 A;  1F6M C;  4IP1 A;  1TRS A;  1SYR A;  3NIV A;  4G2E A;  1TI3 A;  4MCU A;  5DBQ A;  2R0G A;  1YQ1 A;  2RM6 A;  4ECC A;  4LL1 B;  2FA4 A;  2I81 A;  4J57 E;  1EP8 A;  2X4A A;  1K0M A;  5GST A;  3MSZ A;  1GLQ A;  2D2Z A;  5H5S A;  3UIW A;  3R3E A;  3KTL A;  1K0N A;  4PUF C;  2L6C A;  1FAA A;  1B9X C;  2VL9 A;  3QCP A;  4I6X A;  3IA1 A;  1V58 A;  4ML6 A;  2H72 A;  5DQS A;  4ECI A;  2IFQ A;  3GUR A;  4EXJ A;  4RI6 A;  3E0U A;  1F9M A;  1X9S B;  4A5P A;  5ECM B;  3W8S A;  2TRX A;  3TJK A;  2CV4 A;  4KF9 A;  2OE3 A;  2LEG A;  2FY6 A;  3ZIV A;  1IYH A;  1MD4 A;  2VCV A;  4OO5 A;  1KNG A;  1ZMA A;  5AN1 A;  5IO2 A;  3P90 A;  5J41 A;  1B4Q A;  2DMM A;  2J9H A;  4ILF A;  2KP1 A;  2JSY A;  4MPG A;  4OD7 A;  4XRA A;  1AQX A;  5IMF A;  4F0B A;  2H74 A;  4G0K A;  1DE2 A;  1XWA A;  2CQ9 A;  3VK9 A;  3EMP A;  1O7U A;  2H0I A;  2OE0 A;  1O8W A;  1VRS D;  2DKI A;  3RPN A;  4O32 A;  4GQC A;  1ERT A;  3GH6 A;  1O81 A;  5G5E A;  1QXH A;  1ON4 A;  1AUC A;  2EC4 A;  3V1W A;  11GS A;  3P7X A;  2DC5 A;  4V2M A;  5IPG A;  3KMN A;  2H75 A;  1QQ2 A;  4WBR D;  1XW5 A;  4RUV A;  1VF3 A;  1THO A;  3F4T A;  2OAD A;  1HQO A;  5IO0 A;  1XWG A;  3GN3 A;  5B8A A;  2GZZ A;  2LJR A;  7GSS A;  3IRA A;  2BMX A;  2XHF A;  3FKF A;  4NHZ A;  3WT2 A;  2B1K A;  1FB6 A;  3TB2 A;  2J23 A;  3GNJ A;  5ENU A;  4X1U A;  4Q5F A;  2IPA A;  3GKX A;  4DSS A;  1M9A A;  4IN0 A;  2VLT A;  3VPT A;  4PQ1 A;  4GF0 A;  4I5Q A;  1M99 A;  3ISO A;  2YJ7 A;  1DSB A;  4X4J A;  4PNG A;  3IBH A;  3KMO A;  2YZH A;  2IME A;  4L0U A;  1XVW A;  1NM3 A;  1Y6E A;  1B4P A;  3HXS A;  2WCI A;  4GQF A;  3BBY A;  2B5X A;  3TRQ A;  2LNT A;  4KX4 A;  1O73 A;  1Z5Y E;  2HLS A;  5LD0 A;  3TCO A;  4MF6 A;  3UVT A;  4Q5Q A;  3F4S A;  4MA9 A;  3LG6 A;  5F0G A;  2R0C A;  3CYN A;  2R4V A;  1OKT A;  1M7T A;  3APO A;  4BA7 A;  1EGO A;  1OC8 A;  5DCH A;  2AUV A;  2L5L A;  2VD0 A;  2X8C A;  4QL9 A;  1TU7 A;  2X8H A;  2GT5 A;  5ECN B;  1FOH A;  1GLP A;  2B7K A;  3O3T A;  2G2Q A;  1ILO A;  3HCZ A;  3EC3 A;  5ECL B;  2HSM A;  1ZCP A;  3PGT A;  2ON7 A;  2YV7 A;  3GA4 A;  4AGS A;  4IW9 A;  4MF7 A;  1NW2 A;  3GKM A;  1YF0 A;  2V41 A;  1ERU A;  1YKC A;  4K6X A;  1N8J A;  1X5D A;  3DD3 A;  3DWV A;  2HFD A;  1DUG A;  2DJ1 A;  4Z2T A;  4BVX A;  2C0D A;  2YWI A;  1VF2 A;  5H5R A;  3HVX A;  1FG4 A;  3F6F A;  4IP6 A;  2JZS A;  3UEM A;  5HFG A;  4MH3 A;  2B6M A;  5D9T A;  5CYY A;  1GUK A;  4G19 A;  2C0E A;  1XW6 A;  3LJR A;  4I2U A;  1V98 A;  4WF5 A;  5DJM A;  5JCW A;  4J56 E;  3MDK A;  2V6O A;  3I6A A;  2CZ3 A;  1T4Z A;  1A8L A;  1QMV A;  2VLV A;  3H79 A;  2KP2 A;  2OA7 A;  2P5R A;  3IXR A;  3TKR A;  3O76 A;  3LXT A;  1F3B A;  5JWO B;  2NBS A;  1K3L A;  2VL3 A;  2WJU A;  1BYE A;  2GDR A;  4K7N A;  3TKQ A;  2YNX A;  1OAZ A;  5CRG A;  3PH9 A;  4WR5 A;  5HQP A;  2WUL A;  1T00 A;  4OO4 A;  2FA8 A;  1K3Y A;  4NMU A;  3GL3 A;  1QUW A;  1GUH A;  3HD5 A;  3ZVJ D;  1SKW B;  1MD3 A;  1W89 A;  3BJ5 A;  3CBU A;  4KH7 A;  5ECO B;  2YAN A;  1GSS A;  1S3A A;  2B3S A;  2CAI A;  2DJJ A;  3A2W A;  3KEB A;  3VWW A;  5D8I A;  4KDY A;  4V1A g;  2HE3 A;  1GNW A;  3APS A;  3GTU B;  4POB A;  4RQX A;  2VD1 A;  1SJ6 A;  1SYX A;  2V32 A;  5KOW A;  4D73 B;  1GUL A;  2IMD A;  2PBJ A;  5AGY A;  4OCE A;  1AW9 A;  3ZLP A;  10GS A;  2IMK A;  1A2M A;  2X49 A;  4HS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...