4JE9A

Crystal structure of an engineered metal-free ridc1 construct with four interfacial disulfide bonds
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHDALHLANCGKVKEAQAAAEQLKCTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title In Vitro and Cellular Self-Assembly of a Zn-Binding Protein Cryptand via Templated Disulfide Bonds.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 44
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4je9A00
5JLIA 1YZAA 1BBHA 2YLDA 4EIYA 1E85A 1QQ3A 4JKVA 5JT4A 3DE9A 3TOMA 4WGYA 3U8PA 2XL8A 4CDAA 3QVZA 3DE8A 2XLDA 1YZCA 1YYXA 4NC3A 4IAQA 2QLAA 1YYJA 2XLOA 2YL3A 1LM3B 4JEAA 5AGFA 3M15A 2XLEA 256BA 1E84A 3M79A 2BC5A 1E83A 2YL1A 3QW1A 3QVYA 4U9DA 3NMKA 4CIPA 3HNLA 1NBBA 1CGNA 1E86A 1CGOA 2YL0A 3VRCA 1CPQA 3C63A 5JSLA 3TOLA 4CDVA 2XM4A 3NMIA 2YKZA 1CPRA 3ZQVA 4WGZA 1M6TA 5JRAA 3FOOA 4N4WA 5JP7A 3ZTMA 4IARA 3NMJA 4JE9A 4CJOA 3HNKA 1EKYA 4N6HA 4U9EA 5B3IA 3IQ6A 3ZWIA 1MQVA 3ZTZA 2J9BA 5JVEA 3M4BA 3HNJA 2YL7A 2YLIA 5JS5A 3M4CA 4ULVA 2CCYA 1JAFA 1S05A 2XL6A 4JEBA 3L1MA 2XM0A 4D4XA 2XLVA 4L6RA 4CDYA 5JUAA 4CJGA 3FOPA 4CX9A 1GQAA 1QPUA 4D4NA 2J8WA 2YLGA 1A7VA 3ZQYA 3IQ5A 2XLMA 3HNIA 2XLHA 1RCPA 2XLWA 3C62A 3QW0A 4IB4A 4ER9A 1APCA
chains in the Genus database with same CATH superfamily
2MWQA 4PFOA 4HEAJ 3TJ5A 4Z9HA 5JLIA 3QZCA 1BBHA 1BDJB 2AU5A 4NCQA 1H9GA 1O3UA 4U5DE 4Q5SF 5T3WA 1VYKA 2CNWD 2YLDA 1TQGA 2WL8A 3H65A 2NPUA 3I5PA 1Z7Qc 3WG7C 2L6FA 1QQ3A 2W45A 3JCUQ 1TFOB 5L3VA 1Q0FA 3U3FA 3ITFA 3MBGA 1OCCC 4DRIB 1D0XA 1NZEA 4JRZA 3FMSA 2L81A 1O87A 3NYMA 4LERA 1KNYA 1JPJA 5A69A 4Q7CA 1D1AA 1MNDA 3DMDA 1LS4A 3W8HA 1DOWA 4UDVA 5DS4A 1RKEA 3N2ZB 3QVZA 2XLDA 2PX0A 2A1DD 4U5BE 1OXBA 2V3CC 2J0WA 2KGOA 1A41A 3AGUA 3JRTA 1W2WA 4MVMA 3A11A 2ETSA 3JTLO 4NTBA 4OIQF 3NDBB 2R7SA 4NC3A 2HUJA 2L6HA 3ATPA 3R7CA 1IW7F 1SZIA 2YL3A 3UGPA 4BJ1A 3LUTB 2EINC 3F47A 3AGTA 4P9FA 4XLNF 4HFFB 4O6NA 3U8VA 2XLEA 256BA 2CW0F 2JX0A 2Y69C 1HW2A 5EGYA 2B0JA 4H54A 1SR2A 3M79A 4JURI 2WZGA 5COFA 1XWJA 5EK0A 1E84A 4OIOF 1IZMA 4K1OA 2H7VC 2EIMC 4IGGA 4OD5A 3NMKA 4CS8A 1EI7A 1WATA 4BJTA 5L0JA 4J32B 4AX2A 3K1HA 3L8IA 1UFBA 3HTKC 1SF8A 2MYSA 2OJQA 1OR2A 1CGNA 3K6BA 1E86A 1GM5A 3LAYA 2TMVP 4NTAA 3WODF 1HE9A 3CAXA 2P1AA 3L0IA 1Q0GA 1D0YA 5BQIA 2Q00A 3W2WA 3C63A 3FVYA 2IXOA 3EJNA 4R32A 3TOLA 3MYFA 3ZDLA 3S0XA 4OD4A 2Z15A 2UUHA 3KPHA 2IXPA 2EPMX 4RDAA 4BPMA 2DI3A 4YN0B 3O6XA 1AVOB 3EGDB 1OKKD 3QTHA 4WGZA 4CS9A 4DRHB 1FMVA 4N4WA 1R5ID 4MVQA 5JP7A 1E2XA 3DAFA 4JE9A 4MVZA 1TWCA 2WZLA 3HNKA 1LI7A 4BJ6C 4N6HA 5DQZA 3O55A 2I15A 3IQ6A 4JJGA 4LLCA 2R7UA 4XEKA 1LVKA 4WABA 4ZLCA 1T6IA 2CNWA 3DXJF 3QMKA 1M2OA 3L34A 4KI2A 2VCCA 1H6GA 4BG0A 1I4YA 4WJ0A 4K0DA 5F5HA 1FAPB 3U9JA 5JS5A 1FTSA 1MMGA 1Q0MA 3AG3C 4FESA 4K7BA 4N6CA 4XQ1A 2AWYA 5COMA 5E33A 4ZLDA 3EH2A 3FAPB 3WHNA 1M2VA 2LFDA 2AWCA 2R03A 4A2NB 4G7OF 5EHHA 2ZPAA 1JAFA 4MNDA 1VK5A 4C3EA 1HMDA 2QNLA 2XL6A 4J30B 2R9RB 4CBEA 2XM0A 5IY5C 1JOGA 2XLVA 1YLMA 3BEHA 5DLJA 3FDQA 3BRJA 5BQHA 3GEIA 1JMWA 1YAUO 4PR9A 3ABLC 5B1AC 2VCBA 3S28A 3ZG1A 4W8KA 3EGXA 3AG4C 5D92A 2R7WA 3IQ5A 1A0BA 3G4ZA 1SYQA 1T5OA 5K0IA 3RQFA 3DJUB 1Y6DA 1WN0A 3F46A 4F4BA 1Z3IX 3RVYA 2OOCA 3MYIA 1APCA 3PCVA 4O79A 4AE4B 3S84A 4IAOA 1YDIA 5DVWA 4BJ5A 4Q4ZF 1LI5A 2LQGA 1YJGA 2FAPB 3AJMA 3C8GD 3G4XA 3GODA 3NKDA 1V74B 4DJ9A 1OW6A 2ZXWC 1J8YF 4NY3A 2OQMA 3AOUA 3H2UA 4EBBA 1NSGB 3IPMO 4YK5A 3ECSA 3VF0A 5DQTA 4B6IA 1E85A 2CDQA 2OG2A 2HMQA 4IWBA 4J7YA 3T6BA 4C3DA 4KNWA 3CSKA 4YWQA 2XSEA 5KYUB 3DE9A 1Z6AA 2Q9CA 4FWVA 4XPWA 1OKKA 2XL4A 4WGYA 4MTFA 3SZRA 1TFKB 2XL8A 1FR0A 5KYWB 4OIPF 3W2VA 2J7PD 3CQZA 3SXZA 3TD7A 3EG9A 1ZHTA 1PCXA 4I1MA 4JTAB 1OW7A 1YA7O 1QZXA 3L8JA 3N24A 3LNRA 4LDQA 4MVSA 2KQ9A 1YYJA 2OCCC 4IAQA 3S29A 5AGFA 5L0HA 1D0ZA 3M15A 2XS8A 4JZAA 5AC4A 1J8MF 2NSFA 3JSEO 4CS9C 1OW8A 2KW3C 2HJMA 3GORA 3VYWA 2OEXA 2H7BA 1JRAA 3B71A 3QW1A 3ZSUA 2EIJC 3T6JA 2ASRA 3Q7GA 3QVYA 2KJGA 4U9DA 4MQ9F 2W9YA 2AVKA 3HNLA 3S90A 3HKKA 4C7OB 2JD3A 1BR1A 5A6BD 3LESA 2PX3A 4U5EE 3EGDA 3DM5A 3G50A 1NBBA 1C02A 1G8XA 1R4TA 2R7QA 2R7OA 3VM6A 2HSBA 2E87A 4EUKB 4DBRA 3PDMP 2BE5F 3NKEA 1K05A 2J0XA 1CPQA 4MVOA 1T6UA 1OXKA 4PJMA 1A7EA 1Y4CA 2UUIA 2GA0A 4XPYA 2AP3A 1Z5ZA 4LDKA 4EKWA 1O5HA 3POVA 2A0UA 4DXWA 3TQOA 2D4UA 3ASNC 4PJJA 2HKVA 2IOQA 3EPVA 2Q7RA 2P7VA 4Z9JA 3FHDA 4HFKB 1LS1A 2EPOA 1VLTA 2LD6A 4IARA 4E18A 5CIVA 5KYXB 1VYIA 2I8BA 3EFOA 3B0PA 5L0GA 1EKYA 5B3IA 1G4WR 3ZWIA 3C8GA 4U5FE 2XS1A 2EPLX 1TKNA 3JYYA 3ZTZA 4YT4A 4FX5A 1LKXA 2J9BA 4DRJB 5JVEA 3GM3A 4PJLA 1RJ9A 3AG2C 3FAJA 2XRHA 1U89A 2V26A 4XWJA 1ZU4A 2KC3A 4PK4A 1BR4A 4G78A 2P0NA 1HMOA 4U5GA 2YL7A 1ZHYA 2YLIA 3GANA 4AL0A 4E17A 2W4MA 3AQBA 3LS1A 4XEVA 3WAQA 4JTDB 2NUTA 4NQFA 1RXQA 2HMZA 3SXYA 1JR8A 2KYHA 2ZD9A 2J7PA 3DI5A 2O9XA 5KYYA 2R7TA 3Q6MA 4QI2A 4D4XA 4BEJA 2YHSA 5JUAA 1S7ZA 3ABKC 3E70C 3KYIA 3ZVRA 2GDCA 2R05A 3FOPA 3LNMB 2XXAA 2WVOA 1ORYA 3PHF2 1GQAA 1QKRA 2A68F 1QPUA 2C04A 2HV7A 2VB6A 4GQHA 2J8WA 1V4AA 1A7VA 3CZ6A 3IQTA 4D4NA 3KYJA 3J06A 2QTVA 2HSQA 4G7HF 3EH1A 3NG1A 2XLMA 4YT8A 2FFHA 2XLHA 1U0BB 4GEHA 2DYSC 3GEHA 4MVUA 5DS5A 3C62A 3IHUA 3QW0A 4JVSA 5A6BA 3UMHA 4ER9A 5L0CA 4EHPA 2LIGA 3AG1C 3K1IA 3K66A 1LE2A 3PMRA 2NG1A 3LLIA 4U5CE 4H4KC 2A6HF 1CGME 2OKUA 4MS2A 4KBLA 4EIYA 1L7CA 4LLEA 3UR3C 2P61A 3GWLA 3RF3A 3RYLA 2OEVA 3A9CA 2NUPA 3KH2A 2Q9BA 1L3PA 3VAYA 5E3CA 4JKVA 5JT4A 4JIOA 4DVZA 5CI9A 1EQ1A 5HSWA 1QSPA 1ZW2A 2G3KA 2KK1A 2Y39A 4MTGA 4I44A 4JC7A 3TOMA 3U8PA 1PV3A 2GWWA 2WB7A 2DB4A 4KNVA 3X2QC 4CDAA 3U5SA 1TWHA 3RQGA 3MFNA 2Y3GA 4YT5A 2IM8A 4E7ZA 3RH3A 2QLAA 3CEXA 3SNHA 1D1BA 2XLOA 3OWTA 2OU6A 3C18A 3U2MA 3DWWA 2HV6A 2LCHA 3K7DA 3LEOA 1AEPA 1FFHA 1FMWA 4JCZA 2J45A 5FCLA 1NU9C 1RMVA 5L0FA 3UMIA 3GEEA 2EILC 2R25A 2BC5A 3SP1A 2CGEA 2YL1A 2L6GA 4E0HA 1Z23A 1WWPA 2EIKC 3RFYA 1Q0KA 5BUOA 4I1OB 4CS8C 1TWGA 2QY9A 4ONSA 1ZZPA 2MHRA 2ZXOA 2IXMA 1N1CA 1C17M 2VCAA 3S27A 4IJJA 2YL0A 3VRCA 1M57C 2WZFA 3K33A 2VASA 2GAQA 1T9KA 4ULWA 3SYNA 5JSLA 3U0CA 1YARO 3OEOA 5D91A 4BEMJ 1T01A 2GFHA 2PFDA 3ZC4A 2VH3A 1NFOA 4RD9A 2J9UA 3ZIBA 3NMIA 2OJED 4JCHA 3ZQVA 3B9QA 3EHMA 2C03A 1M6TA 4YT2A 5JRAA 1VB5A 3JSZA 1BZ4A 3OA1A 1FNTc 3NMJA 3GM2A 3RW0A 3LEVA 1OR3A 4I3MA 1JPNA 4LDRA 2CYDA 1MQVA 4PJNA 1H9TA 1Z63A 3LLKA 1M2VB 3LJBA 1VTMP 1PD0A 2VC9A 4OIRF 2Y3BA 5KYNA 3DD7A 5E2QA 3ASOC 3NYLA 2H7OA 3HNJA 3SEOA 1ORSC 2P6VA 2YRFA 5A6JA 2R7XA 2IYLD 2ZXRA 3EHNA 3I5QA 1G4US 3DAGA 3S9OA 4ULVA 3JYHA 4MW8A 2DYRC 3K1IC 1YVIA 3SXKA 2HFIA 1LPEA 1MMNA 3DJNB 2Q3TA 2JPUA 4PACA 4C3BA 2NSGA 3DKAA 2ZXPA 1LIHA 3EGXB 3L1MA 1KTMA 4MW3A 1T6QA 1WGWA 1NLXA 2ICWG 4QI0A 1UG7A 4FAPB 4L6RA 4CDYA 2EPKX 3HLZA 4CJGA 2Y3HA 4CX9A 2A69F 3FXHA 1NFNA 2LK4A 3I4UA 3N0TA 2X51A 1WTYA 4X0RA 2R7RA 3V7OA 3H2VA 2J46A 3ZQYA 2DGJA 2PF4E 1U6HA 3HNIA 1V55C 4EWCA 3JT1A 1C03A 3Q7LA 1DOVA 2IBFA 3RQEA 1RKCA 4IB4A 1HE1A 4XPXA 4YL3A 1ZW3A 3MX3A 4XTKA 1HW1A 4BJ5C 3X1OA 1YZAA 1K40A 1GS9A 5T3TA 4N06A 5L3QA 3IQCA 2BL2A 3NYJA 1MNEA 3EG9B 3RVZA 3TJ6A 5L0DA 1MMDA 1QVXA 3E9VA 2FGYA 4AE4A 2R02A 5FZTA 3TK0A 3C7JA 5DS6A 3DE8A 3EZIA 3MLGA 1TR2A 3GM1A 3KL4A 3UNGC 2YEVA 1YZCA 4MVRA 5HV9A 1YYXA 3B0VC 4J7TA 1QLEC 5F28E 1SMYF 3EQLF 1EA8A 3JRMO 1ZU5A 4O7GA 5KYUA 3O39A 4CSAA 3JZ0A 1LM3B 4JEAA 4YL0A 2IXNA 3V5XA 1ZHZA 5L0IA 3EZHA 4CIHA 2PBEA 3HJCA 5KYWA 4OINF 4E0IA 4JJFA 1RKEB 1GGQA 1A7DA 1E83A 1D1CA 2A6EF 1FFTC 5A6AA 5B1BC 2WVNA 4E7SA 1OCZC 2LFFA 1HY5A 2Q4FA 3T9OA 4CIPA 3DM9B 1B68A 3V5YA 2EPNA 2H8AA 3UMKA 4RBNA 4P9TA 3SXMA 4DVYP 1CGOA 3KKBA 5T1DB 1VMAA 2HS5A 4P6IC 4AL1A 2D5RB 4MTOA 4IRUA 2J9VA 4JW1A 1I5NA 2HZ8A 3EFOB 4PFPA 4EBJA 5F5FA 1WOLA 4CDVA 2XM4A 3C8GB 3C8ZA 5GPGB 4C7OA 1MMAA 1XZQA 1AUEA 3R2PA 4O6MA 4XEFA 5COGA 2YVKA 1F1MA 1OCRC 4CS7A 2YKZA 3U9MA 4G7ZF 1RJ9B 1CPRA 2WVQA 2PNOA 1VOMA 3V5ZA 3FOOA 4ANJA 3RIPA 3ZTMA 2X0CA 4JTCB 1ZYRF 4CJOA 3T6GB 1M56C 3IEEA 4U9EA 2QUPA 1V54C 1ZVZA 4W8PA 2F22A 2PP4A 5BQGA 2NUTB 1OCOC 4O6YA 2B0HA 2L7AA 1WASA 1KU2A 3M1CB 2KNHA 1TWAA 5KYYB 3U2LA 2A0BA 4Z9IA 3M4BA 5TJ5E 5B3SC 3NRHA 5KYXA 1NU7D 1I4ZA 5AC5A 1ZHWA 3UGOA 2XXAB 3M4CA 2L9JA 2Y3DA 2CCYA 1VLSA 2M4EA 4GYTA 4YL1A 2G62A 2LP4A 1H7IA 1S05A 2J9WA 3GWNA 4LACB 4G0HA 3B29A 3LS0A 3DZAA 2W4BA 4JEBA 2KSFA 3B0UX 2YWAA 4KC9A 3T4RA 1BR2A 1ZHXA 4EBKA 5A6KA 2Q9AA 4DOZA 2RD9A 3AQCA 4YJWA 2YZSA 4BJ6A 4XLPF 2G3VA 5E3AA 3W8IA 5CI8A 3RKOF 1NG1A 1YA9A 2M64A 4NTFA 1OQCA 2HJ3A 3O10A 1G5ZA 2YLGA 4QDLA 3W4YA 2QE9A 4M63A 3U3BA 3US6A 4DBQA 1Q0DA 1RCPA 3ABMC 4HE8D 4A4AA 2RSEB 1LE4A 1ORJA 2XLWA 4U5HA 1K04A 2YQYA 2R7VA 2NUPB 3KMIA 3Q6NA 4CSAC 1PD1A 3TULA 1XZPA 4AK9A 1ST6A 2LSEA
chains in the Genus database with same CATH topology
5JLIA 1YZAA 1BBHA 2YLDA 4EIYA 1E85A 1QQ3A 4JKVA 5JT4A 3DE9A 3TOMA 4WGYA 3U8PA 2XL8A 4CDAA 3QVZA 3DE8A 2XLDA 1YZCA 1YYXA 4NC3A 4IAQA 2QLAA 1YYJA 2XLOA 2YL3A 1LM3B 4JEAA 5AGFA 3M15A 2XLEA 256BA 1E84A 3M79A 2BC5A 1E83A 2YL1A 3QW1A 3QVYA 4U9DA 3NMKA 4CIPA 3HNLA 1NBBA 1CGNA 1E86A 1CGOA 2YL0A 3VRCA 1CPQA 3C63A 5JSLA 3TOLA 4CDVA 2XM4A 3NMIA 2YKZA 1CPRA 3ZQVA 4WGZA 1M6TA 5JRAA 3FOOA 4N4WA 5JP7A 3ZTMA 4IARA 3NMJA 4JE9A 4CJOA 3HNKA 1EKYA 4N6HA 4U9EA 5B3IA 3IQ6A 3ZWIA 1MQVA 3ZTZA 2J9BA 5JVEA 3M4BA 3HNJA 2YL7A 2YLIA 5JS5A 3M4CA 4ULVA 2CCYA 1JAFA 1S05A 2XL6A 4JEBA 3L1MA 2XM0A 4D4XA 2XLVA 4L6RA 4CDYA 5JUAA 4CJGA 3FOPA 4CX9A 1GQAA 1QPUA 4D4NA 2J8WA 2YLGA 1A7VA 3ZQYA 3IQ5A 2XLMA 3HNIA 2XLHA 1RCPA 2XLWA 3C62A 3QW0A 4IB4A 4ER9A 1APCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JLI A;  1YZA A;  1BBH A;  2YLD A;  4EIY A;  1E85 A;  1QQ3 A;  4JKV A;  5JT4 A;  3DE9 A;  3TOM A;  4WGY A;  3U8P A;  2XL8 A;  4CDA A;  3QVZ A;  3DE8 A;  2XLD A;  1YZC A;  1YYX A;  4NC3 A;  4IAQ A;  2QLA A;  1YYJ A;  2XLO A;  2YL3 A;  1LM3 B;  4JEA A;  5AGF A;  3M15 A;  2XLE A;  256B A;  1E84 A;  3M79 A;  2BC5 A;  1E83 A;  2YL1 A;  3QW1 A;  3QVY A;  4U9D A;  3NMK A;  4CIP A;  3HNL A;  1NBB A;  1CGN A;  1E86 A;  1CGO A;  2YL0 A;  3VRC A;  1CPQ A;  3C63 A;  5JSL A;  3TOL A;  4CDV A;  2XM4 A;  3NMI A;  2YKZ A;  1CPR A;  3ZQV A;  4WGZ A;  1M6T A;  5JRA A;  3FOO A;  4N4W A;  5JP7 A;  3ZTM A;  4IAR A;  3NMJ A;  4JE9 A;  4CJO A;  3HNK A;  1EKY A;  4N6H A;  4U9E A;  5B3I A;  3IQ6 A;  3ZWI A;  1MQV A;  3ZTZ A;  2J9B A;  5JVE A;  3M4B A;  3HNJ A;  2YL7 A;  2YLI A;  5JS5 A;  3M4C A;  4ULV A;  2CCY A;  1JAF A;  1S05 A;  2XL6 A;  4JEB A;  3L1M A;  2XM0 A;  4D4X A;  2XLV A;  4L6R A;  4CDY A;  5JUA A;  4CJG A;  3FOP A;  4CX9 A;  1GQA A;  1QPU A;  4D4N A;  2J8W A;  2YLG A;  1A7V A;  3ZQY A;  3IQ5 A;  2XLM A;  3HNI A;  2XLH A;  1RCP A;  2XLW A;  3C62 A;  3QW0 A;  4IB4 A;  4ER9 A;  1APC A; 
#chains in the Genus database with same CATH topology
 2MWQ A;  4PFO A;  4HEA J;  3TJ5 A;  4Z9H A;  5JLI A;  3QZC A;  1BBH A;  1BDJ B;  2AU5 A;  4NCQ A;  1H9G A;  1O3U A;  4U5D E;  4Q5S F;  5T3W A;  1VYK A;  2CNW D;  2YLD A;  1TQG A;  2WL8 A;  3H65 A;  2NPU A;  3I5P A;  1Z7Q c;  3WG7 C;  2L6F A;  1QQ3 A;  2W45 A;  3JCU Q;  1TFO B;  5L3V A;  1Q0F A;  3U3F A;  3ITF A;  3MBG A;  1OCC C;  4DRI B;  1D0X A;  1NZE A;  4JRZ A;  3FMS A;  2L81 A;  1O87 A;  3NYM A;  4LER A;  1KNY A;  1JPJ A;  5A69 A;  4Q7C A;  1D1A A;  1MND A;  3DMD A;  1LS4 A;  3W8H A;  1DOW A;  4UDV A;  5DS4 A;  1RKE A;  3N2Z B;  3QVZ A;  2XLD A;  2PX0 A;  2A1D D;  4U5B E;  1OXB A;  2V3C C;  2J0W A;  2KGO A;  1A41 A;  3AGU A;  3JRT A;  1W2W A;  4MVM A;  3A11 A;  2ETS A;  3JTL O;  4NTB A;  4OIQ F;  3NDB B;  2R7S A;  4NC3 A;  2HUJ A;  2L6H A;  3ATP A;  3R7C A;  1IW7 F;  1SZI A;  2YL3 A;  3UGP A;  4BJ1 A;  3LUT B;  2EIN C;  3F47 A;  3AGT A;  4P9F A;  4XLN F;  4HFF B;  4O6N A;  3U8V A;  2XLE A;  256B A;  2CW0 F;  2JX0 A;  2Y69 C;  1HW2 A;  5EGY A;  2B0J A;  4H54 A;  1SR2 A;  3M79 A;  4JUR I;  2WZG A;  5COF A;  1XWJ A;  5EK0 A;  1E84 A;  4OIO F;  1IZM A;  4K1O A;  2H7V C;  2EIM C;  4IGG A;  4OD5 A;  3NMK A;  4CS8 A;  1EI7 A;  1WAT A;  4BJT A;  5L0J A;  4J32 B;  4AX2 A;  3K1H A;  3L8I A;  1UFB A;  3HTK C;  1SF8 A;  2MYS A;  2OJQ A;  1OR2 A;  1CGN A;  3K6B A;  1E86 A;  1GM5 A;  3LAY A;  2TMV P;  4NTA A;  3WOD F;  1HE9 A;  3CAX A;  2P1A A;  3L0I A;  1Q0G A;  1D0Y A;  5BQI A;  2Q00 A;  3W2W A;  3C63 A;  3FVY A;  2IXO A;  3EJN A;  4R32 A;  3TOL A;  3MYF A;  3ZDL A;  3S0X A;  4OD4 A;  2Z15 A;  2UUH A;  3KPH A;  2IXP A;  2EPM X;  4RDA A;  4BPM A;  2DI3 A;  4YN0 B;  3O6X A;  1AVO B;  3EGD B;  1OKK D;  3QTH A;  4WGZ A;  4CS9 A;  4DRH B;  1FMV A;  4N4W A;  1R5I D;  4MVQ A;  5JP7 A;  1E2X A;  3DAF A;  4JE9 A;  4MVZ A;  1TWC A;  2WZL A;  3HNK A;  1LI7 A;  4BJ6 C;  4N6H A;  5DQZ A;  3O55 A;  2I15 A;  3IQ6 A;  4JJG A;  4LLC A;  2R7U A;  4XEK A;  1LVK A;  4WAB A;  4ZLC A;  1T6I A;  2CNW A;  3DXJ F;  3QMK A;  1M2O A;  3L34 A;  4KI2 A;  2VCC A;  1H6G A;  4BG0 A;  1I4Y A;  4WJ0 A;  4K0D A;  5F5H A;  1FAP B;  3U9J A;  5JS5 A;  1FTS A;  1MMG A;  1Q0M A;  3AG3 C;  4FES A;  4K7B A;  4N6C A;  4XQ1 A;  2AWY A;  5COM A;  5E33 A;  4ZLD A;  3EH2 A;  3FAP B;  3WHN A;  1M2V A;  2LFD A;  2AWC A;  2R03 A;  4A2N B;  4G7O F;  5EHH A;  2ZPA A;  1JAF A;  4MND A;  1VK5 A;  4C3E A;  1HMD A;  2QNL A;  2XL6 A;  4J30 B;  2R9R B;  4CBE A;  2XM0 A;  5IY5 C;  1JOG A;  2XLV A;  1YLM A;  3BEH A;  5DLJ A;  3FDQ A;  3BRJ A;  5BQH A;  3GEI A;  1JMW A;  1YAU O;  4PR9 A;  3ABL C;  5B1A C;  2VCB A;  3S28 A;  3ZG1 A;  4W8K A;  3EGX A;  3AG4 C;  5D92 A;  2R7W A;  3IQ5 A;  1A0B A;  3G4Z A;  1SYQ A;  1T5O A;  5K0I A;  3RQF A;  3DJU B;  1Y6D A;  1WN0 A;  3F46 A;  4F4B A;  1Z3I X;  3RVY A;  2OOC A;  3MYI A;  1APC A;  3PCV A;  4O79 A;  4AE4 B;  3S84 A;  4IAO A;  1YDI A;  5DVW A;  4BJ5 A;  4Q4Z F;  1LI5 A;  2LQG A;  1YJG A;  2FAP B;  3AJM A;  3C8G D;  3G4X A;  3GOD A;  3NKD A;  1V74 B;  4DJ9 A;  1OW6 A;  2ZXW C;  1J8Y F;  4NY3 A;  2OQM A;  3AOU A;  3H2U A;  4EBB A;  1NSG B;  3IPM O;  4YK5 A;  3ECS A;  3VF0 A;  5DQT A;  4B6I A;  1E85 A;  2CDQ A;  2OG2 A;  2HMQ A;  4IWB A;  4J7Y A;  3T6B A;  4C3D A;  4KNW A;  3CSK A;  4YWQ A;  2XSE A;  5KYU B;  3DE9 A;  1Z6A A;  2Q9C A;  4FWV A;  4XPW A;  1OKK A;  2XL4 A;  4WGY A;  4MTF A;  3SZR A;  1TFK B;  2XL8 A;  1FR0 A;  5KYW B;  4OIP F;  3W2V A;  2J7P D;  3CQZ A;  3SXZ A;  3TD7 A;  3EG9 A;  1ZHT A;  1PCX A;  4I1M A;  4JTA B;  1OW7 A;  1YA7 O;  1QZX A;  3L8J A;  3N24 A;  3LNR A;  4LDQ A;  4MVS A;  2KQ9 A;  1YYJ A;  2OCC C;  4IAQ A;  3S29 A;  5AGF A;  5L0H A;  1D0Z A;  3M15 A;  2XS8 A;  4JZA A;  5AC4 A;  1J8M F;  2NSF A;  3JSE O;  4CS9 C;  1OW8 A;  2KW3 C;  2HJM A;  3GOR A;  3VYW A;  2OEX A;  2H7B A;  1JRA A;  3B71 A;  3QW1 A;  3ZSU A;  2EIJ C;  3T6J A;  2ASR A;  3Q7G A;  3QVY A;  2KJG A;  4U9D A;  4MQ9 F;  2W9Y A;  2AVK A;  3HNL A;  3S90 A;  3HKK A;  4C7O B;  2JD3 A;  1BR1 A;  5A6B D;  3LES A;  2PX3 A;  4U5E E;  3EGD A;  3DM5 A;  3G50 A;  1NBB A;  1C02 A;  1G8X A;  1R4T A;  2R7Q A;  2R7O A;  3VM6 A;  2HSB A;  2E87 A;  4EUK B;  4DBR A;  3PDM P;  2BE5 F;  3NKE A;  1K05 A;  2J0X A;  1CPQ A;  4MVO A;  1T6U A;  1OXK A;  4PJM A;  1A7E A;  1Y4C A;  2UUI A;  2GA0 A;  4XPY A;  2AP3 A;  1Z5Z A;  4LDK A;  4EKW A;  1O5H A;  3POV A;  2A0U A;  4DXW A;  3TQO A;  2D4U A;  3ASN C;  4PJJ A;  2HKV A;  2IOQ A;  3EPV A;  2Q7R A;  2P7V A;  4Z9J A;  3FHD A;  4HFK B;  1LS1 A;  2EPO A;  1VLT A;  2LD6 A;  4IAR A;  4E18 A;  5CIV A;  5KYX B;  1VYI A;  2I8B A;  3EFO A;  3B0P A;  5L0G A;  1EKY A;  5B3I A;  1G4W R;  3ZWI A;  3C8G A;  4U5F E;  2XS1 A;  2EPL X;  1TKN A;  3JYY A;  3ZTZ A;  4YT4 A;  4FX5 A;  1LKX A;  2J9B A;  4DRJ B;  5JVE A;  3GM3 A;  4PJL A;  1RJ9 A;  3AG2 C;  3FAJ A;  2XRH A;  1U89 A;  2V26 A;  4XWJ A;  1ZU4 A;  2KC3 A;  4PK4 A;  1BR4 A;  4G78 A;  2P0N A;  1HMO A;  4U5G A;  2YL7 A;  1ZHY A;  2YLI A;  3GAN A;  4AL0 A;  4E17 A;  2W4M A;  3AQB A;  3LS1 A;  4XEV A;  3WAQ A;  4JTD B;  2NUT A;  4NQF A;  1RXQ A;  2HMZ A;  3SXY A;  1JR8 A;  2KYH A;  2ZD9 A;  2J7P A;  3DI5 A;  2O9X A;  5KYY A;  2R7T A;  3Q6M A;  4QI2 A;  4D4X A;  4BEJ A;  2YHS A;  5JUA A;  1S7Z A;  3ABK C;  3E70 C;  3KYI A;  3ZVR A;  2GDC A;  2R05 A;  3FOP A;  3LNM B;  2XXA A;  2WVO A;  1ORY A;  3PHF 2;  1GQA A;  1QKR A;  2A68 F;  1QPU A;  2C04 A;  2HV7 A;  2VB6 A;  4GQH A;  2J8W A;  1V4A A;  1A7V A;  3CZ6 A;  3IQT A;  4D4N A;  3KYJ A;  3J06 A;  2QTV A;  2HSQ A;  4G7H F;  3EH1 A;  3NG1 A;  2XLM A;  4YT8 A;  2FFH A;  2XLH A;  1U0B B;  4GEH A;  2DYS C;  3GEH A;  4MVU A;  5DS5 A;  3C62 A;  3IHU A;  3QW0 A;  4JVS A;  5A6B A;  3UMH A;  4ER9 A;  5L0C A;  4EHP A;  2LIG A;  3AG1 C;  3K1I A;  3K66 A;  1LE2 A;  3PMR A;  2NG1 A;  3LLI A;  4U5C E;  4H4K C;  2A6H F;  1CGM E;  2OKU A;  4MS2 A;  4KBL A;  4EIY A;  1L7C A;  4LLE A;  3UR3 C;  2P61 A;  3GWL A;  3RF3 A;  3RYL A;  2OEV A;  3A9C A;  2NUP A;  3KH2 A;  2Q9B A;  1L3P A;  3VAY A;  5E3C A;  4JKV A;  5JT4 A;  4JIO A;  4DVZ A;  5CI9 A;  1EQ1 A;  5HSW A;  1QSP A;  1ZW2 A;  2G3K A;  2KK1 A;  2Y39 A;  4MTG A;  4I44 A;  4JC7 A;  3TOM A;  3U8P A;  1PV3 A;  2GWW A;  2WB7 A;  2DB4 A;  4KNV A;  3X2Q C;  4CDA A;  3U5S A;  1TWH A;  3RQG A;  3MFN A;  2Y3G A;  4YT5 A;  2IM8 A;  4E7Z A;  3RH3 A;  2QLA A;  3CEX A;  3SNH A;  1D1B A;  2XLO A;  3OWT A;  2OU6 A;  3C18 A;  3U2M A;  3DWW A;  2HV6 A;  2LCH A;  3K7D A;  3LEO A;  1AEP A;  1FFH A;  1FMW A;  4JCZ A;  2J45 A;  5FCL A;  1NU9 C;  1RMV A;  5L0F A;  3UMI A;  3GEE A;  2EIL C;  2R25 A;  2BC5 A;  3SP1 A;  2CGE A;  2YL1 A;  2L6G A;  4E0H A;  1Z23 A;  1WWP A;  2EIK C;  3RFY A;  1Q0K A;  5BUO A;  4I1O B;  4CS8 C;  1TWG A;  2QY9 A;  4ONS A;  1ZZP A;  2MHR A;  2ZXO A;  2IXM A;  1N1C A;  1C17 M;  2VCA A;  3S27 A;  4IJJ A;  2YL0 A;  3VRC A;  1M57 C;  2WZF A;  3K33 A;  2VAS A;  2GAQ A;  1T9K A;  4ULW A;  3SYN A;  5JSL A;  3U0C A;  1YAR O;  3OEO A;  5D91 A;  4BEM J;  1T01 A;  2GFH A;  2PFD A;  3ZC4 A;  2VH3 A;  1NFO A;  4RD9 A;  2J9U A;  3ZIB A;  3NMI A;  2OJE D;  4JCH A;  3ZQV A;  3B9Q A;  3EHM A;  2C03 A;  1M6T A;  4YT2 A;  5JRA A;  1VB5 A;  3JSZ A;  1BZ4 A;  3OA1 A;  1FNT c;  3NMJ A;  3GM2 A;  3RW0 A;  3LEV A;  1OR3 A;  4I3M A;  1JPN A;  4LDR A;  2CYD A;  1MQV A;  4PJN A;  1H9T A;  1Z63 A;  3LLK A;  1M2V B;  3LJB A;  1VTM P;  1PD0 A;  2VC9 A;  4OIR F;  2Y3B A;  5KYN A;  3DD7 A;  5E2Q A;  3ASO C;  3NYL A;  2H7O A;  3HNJ A;  3SEO A;  1ORS C;  2P6V A;  2YRF A;  5A6J A;  2R7X A;  2IYL D;  2ZXR A;  3EHN A;  3I5Q A;  1G4U S;  3DAG A;  3S9O A;  4ULV A;  3JYH A;  4MW8 A;  2DYR C;  3K1I C;  1YVI A;  3SXK A;  2HFI A;  1LPE A;  1MMN A;  3DJN B;  2Q3T A;  2JPU A;  4PAC A;  4C3B A;  2NSG A;  3DKA A;  2ZXP A;  1LIH A;  3EGX B;  3L1M A;  1KTM A;  4MW3 A;  1T6Q A;  1WGW A;  1NLX A;  2ICW G;  4QI0 A;  1UG7 A;  4FAP B;  4L6R A;  4CDY A;  2EPK X;  3HLZ A;  4CJG A;  2Y3H A;  4CX9 A;  2A69 F;  3FXH A;  1NFN A;  2LK4 A;  3I4U A;  3N0T A;  2X51 A;  1WTY A;  4X0R A;  2R7R A;  3V7O A;  3H2V A;  2J46 A;  3ZQY A;  2DGJ A;  2PF4 E;  1U6H A;  3HNI A;  1V55 C;  4EWC A;  3JT1 A;  1C03 A;  3Q7L A;  1DOV A;  2IBF A;  3RQE A;  1RKC A;  4IB4 A;  1HE1 A;  4XPX A;  4YL3 A;  1ZW3 A;  3MX3 A;  4XTK A;  1HW1 A;  4BJ5 C;  3X1O A;  1YZA A;  1K40 A;  1GS9 A;  5T3T A;  4N06 A;  5L3Q A;  3IQC A;  2BL2 A;  3NYJ A;  1MNE A;  3EG9 B;  3RVZ A;  3TJ6 A;  5L0D A;  1MMD A;  1QVX A;  3E9V A;  2FGY A;  4AE4 A;  2R02 A;  5FZT A;  3TK0 A;  3C7J A;  5DS6 A;  3DE8 A;  3EZI A;  3MLG A;  1TR2 A;  3GM1 A;  3KL4 A;  3UNG C;  2YEV A;  1YZC A;  4MVR A;  5HV9 A;  1YYX A;  3B0V C;  4J7T A;  1QLE C;  5F28 E;  1SMY F;  3EQL F;  1EA8 A;  3JRM O;  1ZU5 A;  4O7G A;  5KYU A;  3O39 A;  4CSA A;  3JZ0 A;  1LM3 B;  4JEA A;  4YL0 A;  2IXN A;  3V5X A;  1ZHZ A;  5L0I A;  3EZH A;  4CIH A;  2PBE A;  3HJC A;  5KYW A;  4OIN F;  4E0I A;  4JJF A;  1RKE B;  1GGQ A;  1A7D A;  1E83 A;  1D1C A;  2A6E F;  1FFT C;  5A6A A;  5B1B C;  2WVN A;  4E7S A;  1OCZ C;  2LFF A;  1HY5 A;  2Q4F A;  3T9O A;  4CIP A;  3DM9 B;  1B68 A;  3V5Y A;  2EPN A;  2H8A A;  3UMK A;  4RBN A;  4P9T A;  3SXM A;  4DVY P;  1CGO A;  3KKB A;  5T1D B;  1VMA A;  2HS5 A;  4P6I C;  4AL1 A;  2D5R B;  4MTO A;  4IRU A;  2J9V A;  4JW1 A;  1I5N A;  2HZ8 A;  3EFO B;  4PFP A;  4EBJ A;  5F5F A;  1WOL A;  4CDV A;  2XM4 A;  3C8G B;  3C8Z A;  5GPG B;  4C7O A;  1MMA A;  1XZQ A;  1AUE A;  3R2P A;  4O6M A;  4XEF A;  5COG A;  2YVK A;  1F1M A;  1OCR C;  4CS7 A;  2YKZ A;  3U9M A;  4G7Z F;  1RJ9 B;  1CPR A;  2WVQ A;  2PNO A;  1VOM A;  3V5Z A;  3FOO A;  4ANJ A;  3RIP A;  3ZTM A;  2X0C A;  4JTC B;  1ZYR F;  4CJO A;  3T6G B;  1M56 C;  3IEE A;  4U9E A;  2QUP A;  1V54 C;  1ZVZ A;  4W8P A;  2F22 A;  2PP4 A;  5BQG A;  2NUT B;  1OCO C;  4O6Y A;  2B0H A;  2L7A A;  1WAS A;  1KU2 A;  3M1C B;  2KNH A;  1TWA A;  5KYY B;  3U2L A;  2A0B A;  4Z9I A;  3M4B A;  5TJ5 E;  5B3S C;  3NRH A;  5KYX A;  1NU7 D;  1I4Z A;  5AC5 A;  1ZHW A;  3UGO A;  2XXA B;  3M4C A;  2L9J A;  2Y3D A;  2CCY A;  1VLS A;  2M4E A;  4GYT A;  4YL1 A;  2G62 A;  2LP4 A;  1H7I A;  1S05 A;  2J9W A;  3GWN A;  4LAC B;  4G0H A;  3B29 A;  3LS0 A;  3DZA A;  2W4B A;  4JEB A;  2KSF A;  3B0U X;  2YWA A;  4KC9 A;  3T4R A;  1BR2 A;  1ZHX A;  4EBK A;  5A6K A;  2Q9A A;  4DOZ A;  2RD9 A;  3AQC A;  4YJW A;  2YZS A;  4BJ6 A;  4XLP F;  2G3V A;  5E3A A;  3W8I A;  5CI8 A;  3RKO F;  1NG1 A;  1YA9 A;  2M64 A;  4NTF A;  1OQC A;  2HJ3 A;  3O10 A;  1G5Z A;  2YLG A;  4QDL A;  3W4Y A;  2QE9 A;  4M63 A;  3U3B A;  3US6 A;  4DBQ A;  1Q0D A;  1RCP A;  3ABM C;  4HE8 D;  4A4A A;  2RSE B;  1LE4 A;  1ORJ A;  2XLW A;  4U5H A;  1K04 A;  2YQY A;  2R7V A;  2NUP B;  3KMI A;  3Q6N A;  4CSA C;  1PD1 A;  3TUL A;  1XZP A;  4AK9 A;  1ST6 A;  2LSE A; 
#chains in the Genus database with same CATH homology
 5JLI A;  1YZA A;  1BBH A;  2YLD A;  4EIY A;  1E85 A;  1QQ3 A;  4JKV A;  5JT4 A;  3DE9 A;  3TOM A;  4WGY A;  3U8P A;  2XL8 A;  4CDA A;  3QVZ A;  3DE8 A;  2XLD A;  1YZC A;  1YYX A;  4NC3 A;  4IAQ A;  2QLA A;  1YYJ A;  2XLO A;  2YL3 A;  1LM3 B;  4JEA A;  5AGF A;  3M15 A;  2XLE A;  256B A;  1E84 A;  3M79 A;  2BC5 A;  1E83 A;  2YL1 A;  3QW1 A;  3QVY A;  4U9D A;  3NMK A;  4CIP A;  3HNL A;  1NBB A;  1CGN A;  1E86 A;  1CGO A;  2YL0 A;  3VRC A;  1CPQ A;  3C63 A;  5JSL A;  3TOL A;  4CDV A;  2XM4 A;  3NMI A;  2YKZ A;  1CPR A;  3ZQV A;  4WGZ A;  1M6T A;  5JRA A;  3FOO A;  4N4W A;  5JP7 A;  3ZTM A;  4IAR A;  3NMJ A;  4JE9 A;  4CJO A;  3HNK A;  1EKY A;  4N6H A;  4U9E A;  5B3I A;  3IQ6 A;  3ZWI A;  1MQV A;  3ZTZ A;  2J9B A;  5JVE A;  3M4B A;  3HNJ A;  2YL7 A;  2YLI A;  5JS5 A;  3M4C A;  4ULV A;  2CCY A;  1JAF A;  1S05 A;  2XL6 A;  4JEB A;  3L1M A;  2XM0 A;  4D4X A;  2XLV A;  4L6R A;  4CDY A;  5JUA A;  4CJG A;  3FOP A;  4CX9 A;  1GQA A;  1QPU A;  4D4N A;  2J8W A;  2YLG A;  1A7V A;  3ZQY A;  3IQ5 A;  2XLM A;  3HNI A;  2XLH A;  1RCP A;  2XLW A;  3C62 A;  3QW0 A;  4IB4 A;  4ER9 A;  1APC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...