4JE9A

Crystal structure of an engineered metal-free ridc1 construct with four interfacial disulfide bonds
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
106
structure length
106
Chain Sequence
b'ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHDALHLANCGKVKEAQAAAEQLKCTCNACHQKYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title In Vitro and Cellular Self-Assembly of a Zn-Binding Protein Cryptand via Templated Disulfide Bonds.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 44
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4je9A00
1QQ3A 3DE8A 1S05A 3NMKA 4ER9A 4CDYA 5JP7A 4N4WA 3QVZA 3U8PA 3ZQVA 2XLMA 3M15A 2YKZA 2XLVA 1A7VA 3QW1A 5AGFA 3ZTZA 5JT4A 256BA 5JUAA 1NBBA 2CCYA 4IB4A 2YL1A 5JVEA 2YL3A 4L6RA 3QW0A 3M4CA 1CGNA 1YZCA 4JEBA 3C63A 2XL8A 2XL6A 4JKVA 3TOMA 3NMIA 2XLHA 4CDAA 4U9DA 5JRAA 3HNJA 1YZAA 3HNIA 1LM3B 2XLEA 1E83A 3C62A 1CGOA 3ZQYA 3TOLA 3IQ6A 2YLGA 2BC5A 3FOOA 2YL7A 1MQVA 1RCPA 3DE9A 4D4XA 2YLDA 3VRCA 5B3IA 3QVYA 4CIPA 1CPRA 4CJOA 1BBHA 2XM0A 4IAQA 1EKYA 3M4BA 2XLOA 1QPUA 3L1MA 1M6TA 4CJGA 4CX9A 4ULVA 4D4NA 1JAFA 2XLWA 2QLAA 4WGZA 3NMJA 3ZWIA 3FOPA 1APCA 3M79A 3HNKA 2J8WA 4JE9A 4EIYA 1YYXA 2YLIA 3HNLA 4N6HA 1E86A 1YYJA 2XLDA 3IQ5A 2XM4A 4JEAA 4U9EA 1E85A 1GQAA 2J9BA 5JSLA 5JS5A 4NC3A 3ZTMA 4CDVA 1CPQA 5JLIA 4WGYA 1E84A 4IARA 2YL0A
chains in the Genus database with same CATH superfamily
1QQ3A 2EIJC 1V55C 4H4KC 1BR2A 1TR2A 3O10A 3RQFA 2GFHA 5BQHA 3AQBA 1SYQA 4OD4A 4XPYA 4HFKB 2HZ8A 2OJQA 2Q00A 4FWVA 5E3AA 3MYFA 5BUOA 1O3UA 3ZQVA 2HV7A 3DM5A 1TQGA 4BJ6A 2XLVA 3GEEA 3I4UA 3NYLA 4KBLA 1WOLA 4IJJA 3X1OA 4KC9A 2O9XA 3U2MA 3QW1A 3RQEA 1NZEA 2PNOA 3LAYA 4EHPA 5KYWB 3K7DA 3WODF 1OCZC 2E87A 2YEVA 4RDAA 3V5ZA 5JUAA 1G8XA 2A69F 3AG1C 4IB4A 4U5GA 1ZU5A 2NUPA 2WZGA 3RIPA 2R7OA 3HJCA 2ZXOA 1PD0A 4L6RA 1LKXA 4ONSA 4HE8D 5EK0A 3M4CA 4CS9C 1U0BB 3CEXA 3J06A 3U9MA 3C18A 3GM2A 3WAQA 4AL0A 4K1OA 2WVOA 2L6FA 3K1IA 4JC7A 1JPJA 3AGTA 1ZW3A 4Q7CA 4WABA 4JKVA 2M4EA 2R7SA 3TOMA 3NMIA 4Z9JA 4DRHB 4U9DA 5L0GA 5JRAA 4ANJA 2KJGA 2ZD9A 3HNJA 1YZAA 3TQOA 1NG1A 2HS5A 3SZRA 3MYIA 1LM3B 1RJ9B 1Z5ZA 4BEMJ 2GWWA 2Q3TA 1K40A 3CQZA 3DJUB 2XLEA 3KKBA 1LE2A 1Y6DA 3AOUA 3K66A 3C62A 5COMA 1RMVA 1VTMP 3EFOA 2XXAB 2KNHA 2YWAA 1I4YA 3ZQYA 1XZPA 2JX0A 2CGEA 3NRHA 3KMIA 3TOLA 3W8IA 3IQ6A 4GQHA 1JOGA 1WATA 2YL7A 3A11A 2HJ3A 1MNEA 1PD1A 2AVKA 3TJ6A 3PDMP 1A7EA 1OQCA 2G3KA 2PBEA 1H7IA 2DYSC 4D4XA 3VRCA 1E2XA 1SR2A 3LS0A 2W4BA 2GA0A 2X51A 1SZIA 2J9UA 2HUJA 3ZVRA 4YL1A 2MHRA 1T5OA 4HFFB 4NQFA 2C04A 1EKYA 3SXMA 2QY9A 2V26A 2G62A 2RSEB 2XLOA 4KNVA 4J32B 2KYHA 2DYRC 3L1MA 5B3SC 4OIQF 1ZVZA 1GGQA 2W4MA 1MMNA 3S27A 1FMVA 4G7ZF 1UFBA 2ASRA 5L0CA 4BJ5C 4LLEA 1R4TA 5T3TA 3KYJA 2A6EF 1FMWA 5L0HA 2QLAA 4PACA 4WGZA 3NMJA 1EI7A 4LERA 5FZTA 3UGOA 3EZHA 3M79A 4MVZA 2HKVA 1BZ4A 3OEOA 5DLJA 3C8ZA 4JVSA 4DVZA 1YYXA 2LSEA 3Q6NA 3QMKA 5COFA 2PX0A 4NTFA 3HNLA 4YK5A 1E86A 1YJGA 3BRJA 2HV6A 3C8GD 4MVUA 2YVKA 1J8MF 3S29A 4DJ9A 1OCCC 1E85A 1C02A 3B0PA 5JSLA 2J9VA 2KW3C 3DZAA 3B71A 3O39A 4LDQA 1HE9A 1RKEA 3S28A 1IW7F 1CPQA 2EPKX 3ZTMA 4CSAA 1ZHTA 2QNLA 3EH1A 4I1OB 1E84A 5E3CA 5F28E 4Z9HA 4BJTA 5A6KA 3U8VA 5COGA 1TWCA 4CIHA 5KYUA 3NMKA 4BJ6C 2WL8A 2Z15A 1H9TA 1L7CA 3L34A 4N4WA 2PP4A 3U8PA 5F5FA 2NUTB 5K0IA 3LNRA 2FFHA 4LACB 5A6AA 3S84A 2Q4FA 3M15A 1OCRC 3KPHA 2NPUA 3G50A 4OIRF 1I4ZA 4XQ1A 4AX2A 1A7VA 4XEKA 5DS5A 2ZXPA 2KGOA 2JPUA 4MTFA 3ZTZA 2BE5F 3I5QA 4OIPF 3DXJF 5AC4A 1NBBA 5JVEA 1OXKA 2W45A 2YL3A 3K1IC 3NYMA 1UG7A 3MBGA 1RXQA 3T6BA 4YL3A 3UR3C 2UUHA 3V5XA 1CGNA 1D1BA 1V74B 4W8PA 5KYXB 3U0CA 2AWCA 2VB6A 1VB5A 1W2WA 1ZZPA 5DVWA 3TD7A 4ZLDA 1ST6A 3G4ZA 3AG2C 4OINF 2XL8A 2XL6A 3R2PA 1O5HA 2P0NA 1HW2A 3LUTB 1Z23A 3IPMO 2XLHA 2R9RB 2H7VC 2Y39A 1NFOA 3EGDA 1JR8A 2AP3A 4MW3A 2XSEA 4DRIB 3TULA 4DRJB 1VK5A 1T6UA 1M2VB 1D0ZA 2OEXA 4PFPA 4G7HF 4NTBA 4IWBA 1NLXA 5KYYA 3FAJA 3FDQA 1MMDA 2TMVP 4X0RA 3EHMA 1JMWA 1K05A 1OCOC 2PFDA 2QUPA 1V54C 2V3CC 1CGOA 2NSFA 2W9YA 4JCHA 2X0CA 1D0YA 4JURI 2VCBA 4KNWA 4U5EE 3B9QA 2EPNA 4XPXA 4O79A 4DVYP 1J8YF 1RCPA 3DI5A 2QE9A 3NKEA 2HSBA 3QZCA 3JRTA 4JTAB 3DE9A 1OR3A 2JD3A 2NUPB 2A6HF 3MFNA 1AEPA 3DKAA 4CIPA 4W8KA 4XLPF 1O87A 2DI3A 1B68A 3AJMA 3DJNB 4CJOA 5KYWA 4RD9A 1BBHA 1TWHA 2L7AA 4IAQA 4U5CE 2VH3A 4U5HA 4XEVA 1D0XA 3RW0A 5DS6A 4M63A 4RBNA 5A69A 1TFOB 1QPUA 3NG1A 2CDQA 1T6IA 3ABMC 4J7TA 4EBBA 3TJ5A 2VCAA 2FGYA 3FHDA 3KL4A 1YVIA 4OIOF 2Q9BA 2IBFA 5IY5C 2HMZA 2IXPA 2J0WA 1U89A 3FMSA 1NU9C 1JAFA 2AU5A 2XLWA 3EJNA 2L6HA 2ZXRA 4P6IC 4BJ1A 4C3DA 2R7RA 4JJFA 1N1CA 3ZWIA 3R7CA 4PK4A 3FOPA 4P9FA 1Q0DA 2CNWD 3S0XA 3HKKA 4HEAJ 5L3QA 5BQGA 3HNKA 1TFKB 3IQTA 4LLCA 3U2LA 1QVXA 2LCHA 3UMHA 1TKNA 2WVNA 4QI0A 2ICWG 3L8JA 5T3WA 2P61A 5A6JA 2XXAA 2B0HA 2XL4A 2YQYA 1GS9A 4H54A 3OA1A 3RQGA 5A6BD 1Z3IX 1YAUO 1A7DA 5DS4A 4AE4B 3HTKC 3ASNC 4PJNA 2F22A 1VOMA 3O55A 1ZHXA 3AQCA 4YWQA 1EQ1A 1Q0MA 2LIGA 3IEEA 3U3BA 3GORA 3EHNA 1T6QA 3W8HA 4FAPB 4XPWA 1D1CA 3K1HA 2NSGA 3L0IA 4ULWA 1MMGA 4K0DA 4P9TA 1FFTC 3DD7A 2HMQA 3WHNA 4CDYA 4ER9A 5JP7A 3NKDA 2A0BA 2GDCA 5TJ5E 3ABKC 2MYSA 3EGXB 4DXWA 2XLMA 3NDBB 1H6GA 2J9WA 5F5HA 2PX3A 4I1MA 5E2QA 4EKWA 4KI2A 2XS8A 5T1DB 4YT8A 4GYTA 4EBJA 4PJJA 1YLMA 5AGFA 2H7BA 3ZG1A 4A2NB 1HY5A 4JW1A 5EHHA 3V5YA 3L8IA 1G4WR 5JT4A 3JSEO 4E18A 3S9OA 1RKCA 1V4AA 256BA 3GODA 3E70C 1XWJA 2CCYA 2YL1A 3EG9B 3MX3A 4EBKA 1VLTA 2YRFA 3CAXA 1C03A 4EWCA 2AWYA 2R25A 2R7TA 2R7VA 2CNWA 2CW0F 3CSKA 3JYHA 3K6BA 4I3MA 5B1AC 3UNGC 2R02A 4U5FE 2YHSA 1YZCA 4JEBA 4GEHA 3KH2A 5BQIA 3C63A 1RKEB 3GWLA 2J46A 4FESA 1ZU4A 2DGJA 2NG1A 2RD9A 2OOCA 2EIMC 3GM1A 4YL0A 1SF8A 2P7VA 2EPMX 3AG3C 1ZW2A 1BDJB 5A6BA 3LNMB 4G0HA 4PJLA 3U5SA 1TWGA 4C7OA 4BPMA 3POVA 1FTSA 4N06A 1M57C 3HNIA 4MTOA 3EH2A 3JRMO 1ZYRF 3M1CB 2IXMA 3LEVA 2H7OA 4CBEA 3ECSA 3FXHA 4DOZA 3A9CA 1A41A 3SXKA 1NSGB 1U6HA 3RVYA 3V7OA 2OEVA 2P6VA 1PV3A 3H2UA 4YJWA 2XRHA 2J7PD 2YLGA 2BC5A 2D5RB 2YZSA 3C7JA 1DOWA 3FOOA 2NUTA 3US6A 3GWNA 2DB4A 4IRUA 3SP1A 1FR0A 1VYIA 3X2QC 2WVQA 5CI8A 4CS8A 3FVYA 5AC5A 4A4AA 3DM9B 4EUKB 1OW7A 3SYNA 3AGUA 5L0IA 4C3BA 5EGYA 1LS4A 4YT2A 1HE1A 2PF4E 2R7QA 3ABLC 3OWTA 5GPGB 3C8GA 3W2VA 3M4BA 3MLGA 3W2WA 2R7XA 5HSWA 4OD5A 4XWJA 3B0UX 4G78A 1OW6A 1ZHZA 1SMYF 2LFFA 1LS1A 1M6TA 2L81A 3BEHA 4XLNF 4C3EA 4CJGA 3S90A 4E7SA 1BR1A 3GM3A 2XS1A 1K04A 4MVMA 4JRZA 3T4RA 4CX9A 5KYYB 4O6MA 4D4NA 1LPEA 4K7BA 2Y3GA 3ZDLA 1OXBA 5L0DA 3JCUQ 5FCLA 2A0UA 2OQMA 1APCA 2J0XA 1M2VA 2OCCC 3I5PA 3N24A 5L3VA 2ZXWC 2J8WA 4IAOA 3AG4C 4G7OF 4FX5A 1LE4A 2LP4A 2IYLD 1EA8A 1KNYA 2G3VA 4JE9A 4BEJA 4EIYA 3Q6MA 1Z63A 2EILC 5CI9A 3EPVA 1QLEC 3K33A 1NFNA 1YARO 2EINC 3B29A 2LD6A 2UUIA 2OU6A 2XLDA 3IQ5A 4XEFA 1HMDA 1T01A 1F1MA 1IZMA 1A0BA 1QKRA 1AVOB 1TWAA 2XM4A 3E9VA 4N6CA 2MWQA 4U9EA 5DQTA 3DWWA 2EPOA 3T9OA 2KQ9A 3LEOA 5JS5A 2J7PA 4NC3A 4CDVA 2KC3A 4MVSA 3U9JA 3IQCA 1D1AA 2OG2A 2Y3DA 3ASOC 4WGYA 3VM6A 3N0TA 2HSQA 2IXNA 2J45A 2VCCA 2YL0A 4IARA 3B0VC 4NCQA 3LESA 3DE8A 1S05A 3EFOB 1FAPB 3LJBA 1VMAA 1Z7Qc 2KK1A 3EZIA 1JPNA 1VYKA 1RJ9A 4WJ0A 3VF0A 3QVZA 4J7YA 4QI2A 1NU7D 2Y3HA 1FFHA 2Y69C 3JSZA 4MVQA 5B1BC 1CGME 2Q9CA 2D4UA 2YKZA 3O6XA 2CYDA 2LQGA 2Y3BA 2M64A 5HV9A 4CSAC 5L0JA 4E0IA 2A1DD 3LS1A 2LK4A 4MQ9F 1H9GA 1WN0A 1AUEA 1LIHA 2BL2A 1WTYA 1MMAA 2QTVA 2WB7A 4R32A 3WG7C 3GANA 3RKOF 3ZIBA 5E33A 4E0HA 1YA9A 3VAYA 4F4BA 3QW0A 1Y4CA 2WZLA 3Q7LA 3H2VA 4U5BE 3GEHA 3LLKA 2A68F 2WZFA 1OKKD 3DAFA 3RYLA 3UMKA 4Q4ZF 4MVRA 3RFYA 5KYNA 4CS9A 1DOVA 1YDIA 4AE4A 4MW8A 4CDAA 3KYIA 3PHF2 1Q0FA 2VASA 4QDLA 3Q7GA 4MNDA 1L3PA 3SNHA 2IM8A 2EPLX 2OKUA 5KYXA 4LDRA 1KTMA 1PCXA 1G5ZA 3FAPB 1Q0GA 4BG0A 4O7GA 3UMIA 5DQZA 1HW1A 3ZC4A 3GEIA 3RVZA 1E83A 1S7ZA 4JJGA 4XTKA 2VC9A 3ATPA 2IXOA 3SEOA 1ORSC 1YA7O 3EGXA 1KU2A 1M56C 3JZ0A 4Z9IA 1Z6AA 4CS8C 2B0JA 2Q9AA 2HFIA 1MQVA 1WASA 3IHUA 3JTLO 2Q7RA 2FAPB 5D91A 2R05A 2YLDA 3T6GB 1R5ID 4AL1A 1G4US 5B3IA 3DMDA 1ORYA 3F47A 3QVYA 4DBRA 1CPRA 3QTHA 2KSFA 4MTGA 3H65A 1OR2A 4JTDB 4NTAA 1T9KA 2ETSA 3JT1A 3RH3A 1FNTc 3TK0A 5KYUB 4PFOA 1MNDA 2XM0A 3EG9A 1VLSA 1GM5A 1HMOA 5CIVA 4E17A 5D92A 1ORJA 4PR9A 4JCZA 4I44A 2ZPAA 2P1AA 4C7OB 1ZHWA 2L6GA 2L9JA 4YT5A 1I5NA 5L0FA 3NYJA 1C17M 1LVKA 4NY3A 3DAGA 1LI5A 4IGGA 1Q0KA 3PCVA 4ULVA 4AK9A 1OKKA 4CS7A 4DBQA 3UGPA 4UDVA 3LLIA 3F46A 2GAQA 3SXZA 3G4XA 4JZAA 4MS2A 4YN0B 4B6IA 2IOQA 3U3FA 4BJ5A 1JRAA 1OW8A 2I15A 3ZSUA 4J30B 3JYYA 1QZXA 4PJMA 1ZHYA 2H8AA 3SXYA 2YLIA 2LFDA 2EIKC 2OJED 1M2OA 4N6HA 1WGWA 3W4YA 1LI7A 3N2ZB 1YYJA 4O6NA 2I8BA 4O6YA 2C03A 3EGDB 3EQLF 4JEAA 1GQAA 3VYWA 2J9BA 2R7UA 3C8GB 3T6JA 3CZ6A 2R7WA 2R03A 2HJMA 4U5DE 4JIOA 3ITFA 3PMRA 3HLZA 1QSPA 5JLIA 4LDKA 4YT4A 1WWPA 4JTCB 4E7ZA 4ZLCA 1BR4A 3RF3A 4Q5SF 4MVOA 1XZQA
chains in the Genus database with same CATH topology
1QQ3A 3DE8A 1S05A 3NMKA 4ER9A 4CDYA 5JP7A 4N4WA 3QVZA 3U8PA 3ZQVA 2XLMA 3M15A 2YKZA 2XLVA 1A7VA 3QW1A 5AGFA 3ZTZA 5JT4A 256BA 5JUAA 1NBBA 2CCYA 4IB4A 2YL1A 5JVEA 2YL3A 4L6RA 3QW0A 3M4CA 1CGNA 1YZCA 4JEBA 3C63A 2XL8A 2XL6A 4JKVA 3TOMA 3NMIA 2XLHA 4CDAA 4U9DA 5JRAA 3HNJA 1YZAA 3HNIA 1LM3B 2XLEA 1E83A 3C62A 1CGOA 3ZQYA 3TOLA 3IQ6A 2YLGA 2BC5A 3FOOA 2YL7A 1MQVA 1RCPA 3DE9A 4D4XA 2YLDA 3VRCA 5B3IA 3QVYA 4CIPA 1CPRA 4CJOA 1BBHA 2XM0A 4IAQA 1EKYA 3M4BA 2XLOA 1QPUA 3L1MA 1M6TA 4CJGA 4CX9A 4ULVA 4D4NA 1JAFA 2XLWA 2QLAA 4WGZA 3NMJA 3ZWIA 3FOPA 1APCA 3M79A 3HNKA 2J8WA 4JE9A 4EIYA 1YYXA 2YLIA 3HNLA 4N6HA 1E86A 1YYJA 2XLDA 3IQ5A 2XM4A 4JEAA 4U9EA 1E85A 1GQAA 2J9BA 5JSLA 5JS5A 4NC3A 3ZTMA 4CDVA 1CPQA 5JLIA 4WGYA 1E84A 4IARA 2YL0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QQ3 A;  3DE8 A;  1S05 A;  3NMK A;  4ER9 A;  4CDY A;  5JP7 A;  4N4W A;  3QVZ A;  3U8P A;  3ZQV A;  2XLM A;  3M15 A;  2YKZ A;  2XLV A;  1A7V A;  3QW1 A;  5AGF A;  3ZTZ A;  5JT4 A;  256B A;  5JUA A;  1NBB A;  2CCY A;  4IB4 A;  2YL1 A;  5JVE A;  2YL3 A;  4L6R A;  3QW0 A;  3M4C A;  1CGN A;  1YZC A;  4JEB A;  3C63 A;  2XL8 A;  2XL6 A;  4JKV A;  3TOM A;  3NMI A;  2XLH A;  4CDA A;  4U9D A;  5JRA A;  3HNJ A;  1YZA A;  3HNI A;  1LM3 B;  2XLE A;  1E83 A;  3C62 A;  1CGO A;  3ZQY A;  3TOL A;  3IQ6 A;  2YLG A;  2BC5 A;  3FOO A;  2YL7 A;  1MQV A;  1RCP A;  3DE9 A;  4D4X A;  2YLD A;  3VRC A;  5B3I A;  3QVY A;  4CIP A;  1CPR A;  4CJO A;  1BBH A;  2XM0 A;  4IAQ A;  1EKY A;  3M4B A;  2XLO A;  1QPU A;  3L1M A;  1M6T A;  4CJG A;  4CX9 A;  4ULV A;  4D4N A;  1JAF A;  2XLW A;  2QLA A;  4WGZ A;  3NMJ A;  3ZWI A;  3FOP A;  1APC A;  3M79 A;  3HNK A;  2J8W A;  4JE9 A;  4EIY A;  1YYX A;  2YLI A;  3HNL A;  4N6H A;  1E86 A;  1YYJ A;  2XLD A;  3IQ5 A;  2XM4 A;  4JEA A;  4U9E A;  1E85 A;  1GQA A;  2J9B A;  5JSL A;  5JS5 A;  4NC3 A;  3ZTM A;  4CDV A;  1CPQ A;  5JLI A;  4WGY A;  1E84 A;  4IAR A;  2YL0 A; 
#chains in the Genus database with same CATH topology
 1QQ3 A;  2EIJ C;  1V55 C;  4H4K C;  1BR2 A;  1TR2 A;  3O10 A;  3RQF A;  2GFH A;  5BQH A;  3AQB A;  1SYQ A;  4OD4 A;  4XPY A;  4HFK B;  2HZ8 A;  2OJQ A;  2Q00 A;  4FWV A;  5E3A A;  3MYF A;  5BUO A;  1O3U A;  3ZQV A;  2HV7 A;  3DM5 A;  1TQG A;  4BJ6 A;  2XLV A;  3GEE A;  3I4U A;  3NYL A;  4KBL A;  1WOL A;  4IJJ A;  3X1O A;  4KC9 A;  2O9X A;  3U2M A;  3QW1 A;  3RQE A;  1NZE A;  2PNO A;  3LAY A;  4EHP A;  5KYW B;  3K7D A;  3WOD F;  1OCZ C;  2E87 A;  2YEV A;  4RDA A;  3V5Z A;  5JUA A;  1G8X A;  2A69 F;  3AG1 C;  4IB4 A;  4U5G A;  1ZU5 A;  2NUP A;  2WZG A;  3RIP A;  2R7O A;  3HJC A;  2ZXO A;  1PD0 A;  4L6R A;  1LKX A;  4ONS A;  4HE8 D;  5EK0 A;  3M4C A;  4CS9 C;  1U0B B;  3CEX A;  3J06 A;  3U9M A;  3C18 A;  3GM2 A;  3WAQ A;  4AL0 A;  4K1O A;  2WVO A;  2L6F A;  3K1I A;  4JC7 A;  1JPJ A;  3AGT A;  1ZW3 A;  4Q7C A;  4WAB A;  4JKV A;  2M4E A;  2R7S A;  3TOM A;  3NMI A;  4Z9J A;  4DRH B;  4U9D A;  5L0G A;  5JRA A;  4ANJ A;  2KJG A;  2ZD9 A;  3HNJ A;  1YZA A;  3TQO A;  1NG1 A;  2HS5 A;  3SZR A;  3MYI A;  1LM3 B;  1RJ9 B;  1Z5Z A;  4BEM J;  2GWW A;  2Q3T A;  1K40 A;  3CQZ A;  3DJU B;  2XLE A;  3KKB A;  1LE2 A;  1Y6D A;  3AOU A;  3K66 A;  3C62 A;  5COM A;  1RMV A;  1VTM P;  3EFO A;  2XXA B;  2KNH A;  2YWA A;  1I4Y A;  3ZQY A;  1XZP A;  2JX0 A;  2CGE A;  3NRH A;  3KMI A;  3TOL A;  3W8I A;  3IQ6 A;  4GQH A;  1JOG A;  1WAT A;  2YL7 A;  3A11 A;  2HJ3 A;  1MNE A;  1PD1 A;  2AVK A;  3TJ6 A;  3PDM P;  1A7E A;  1OQC A;  2G3K A;  2PBE A;  1H7I A;  2DYS C;  4D4X A;  3VRC A;  1E2X A;  1SR2 A;  3LS0 A;  2W4B A;  2GA0 A;  2X51 A;  1SZI A;  2J9U A;  2HUJ A;  3ZVR A;  4YL1 A;  2MHR A;  1T5O A;  4HFF B;  4NQF A;  2C04 A;  1EKY A;  3SXM A;  2QY9 A;  2V26 A;  2G62 A;  2RSE B;  2XLO A;  4KNV A;  4J32 B;  2KYH A;  2DYR C;  3L1M A;  5B3S C;  4OIQ F;  1ZVZ A;  1GGQ A;  2W4M A;  1MMN A;  3S27 A;  1FMV A;  4G7Z F;  1UFB A;  2ASR A;  5L0C A;  4BJ5 C;  4LLE A;  1R4T A;  5T3T A;  3KYJ A;  2A6E F;  1FMW A;  5L0H A;  2QLA A;  4PAC A;  4WGZ A;  3NMJ A;  1EI7 A;  4LER A;  5FZT A;  3UGO A;  3EZH A;  3M79 A;  4MVZ A;  2HKV A;  1BZ4 A;  3OEO A;  5DLJ A;  3C8Z A;  4JVS A;  4DVZ A;  1YYX A;  2LSE A;  3Q6N A;  3QMK A;  5COF A;  2PX0 A;  4NTF A;  3HNL A;  4YK5 A;  1E86 A;  1YJG A;  3BRJ A;  2HV6 A;  3C8G D;  4MVU A;  2YVK A;  1J8M F;  3S29 A;  4DJ9 A;  1OCC C;  1E85 A;  1C02 A;  3B0P A;  5JSL A;  2J9V A;  2KW3 C;  3DZA A;  3B71 A;  3O39 A;  4LDQ A;  1HE9 A;  1RKE A;  3S28 A;  1IW7 F;  1CPQ A;  2EPK X;  3ZTM A;  4CSA A;  1ZHT A;  2QNL A;  3EH1 A;  4I1O B;  1E84 A;  5E3C A;  5F28 E;  4Z9H A;  4BJT A;  5A6K A;  3U8V A;  5COG A;  1TWC A;  4CIH A;  5KYU A;  3NMK A;  4BJ6 C;  2WL8 A;  2Z15 A;  1H9T A;  1L7C A;  3L34 A;  4N4W A;  2PP4 A;  3U8P A;  5F5F A;  2NUT B;  5K0I A;  3LNR A;  2FFH A;  4LAC B;  5A6A A;  3S84 A;  2Q4F A;  3M15 A;  1OCR C;  3KPH A;  2NPU A;  3G50 A;  4OIR F;  1I4Z A;  4XQ1 A;  4AX2 A;  1A7V A;  4XEK A;  5DS5 A;  2ZXP A;  2KGO A;  2JPU A;  4MTF A;  3ZTZ A;  2BE5 F;  3I5Q A;  4OIP F;  3DXJ F;  5AC4 A;  1NBB A;  5JVE A;  1OXK A;  2W45 A;  2YL3 A;  3K1I C;  3NYM A;  1UG7 A;  3MBG A;  1RXQ A;  3T6B A;  4YL3 A;  3UR3 C;  2UUH A;  3V5X A;  1CGN A;  1D1B A;  1V74 B;  4W8P A;  5KYX B;  3U0C A;  2AWC A;  2VB6 A;  1VB5 A;  1W2W A;  1ZZP A;  5DVW A;  3TD7 A;  4ZLD A;  1ST6 A;  3G4Z A;  3AG2 C;  4OIN F;  2XL8 A;  2XL6 A;  3R2P A;  1O5H A;  2P0N A;  1HW2 A;  3LUT B;  1Z23 A;  3IPM O;  2XLH A;  2R9R B;  2H7V C;  2Y39 A;  1NFO A;  3EGD A;  1JR8 A;  2AP3 A;  4MW3 A;  2XSE A;  4DRI B;  3TUL A;  4DRJ B;  1VK5 A;  1T6U A;  1M2V B;  1D0Z A;  2OEX A;  4PFP A;  4G7H F;  4NTB A;  4IWB A;  1NLX A;  5KYY A;  3FAJ A;  3FDQ A;  1MMD A;  2TMV P;  4X0R A;  3EHM A;  1JMW A;  1K05 A;  1OCO C;  2PFD A;  2QUP A;  1V54 C;  2V3C C;  1CGO A;  2NSF A;  2W9Y A;  4JCH A;  2X0C A;  1D0Y A;  4JUR I;  2VCB A;  4KNW A;  4U5E E;  3B9Q A;  2EPN A;  4XPX A;  4O79 A;  4DVY P;  1J8Y F;  1RCP A;  3DI5 A;  2QE9 A;  3NKE A;  2HSB A;  3QZC A;  3JRT A;  4JTA B;  3DE9 A;  1OR3 A;  2JD3 A;  2NUP B;  2A6H F;  3MFN A;  1AEP A;  3DKA A;  4CIP A;  4W8K A;  4XLP F;  1O87 A;  2DI3 A;  1B68 A;  3AJM A;  3DJN B;  4CJO A;  5KYW A;  4RD9 A;  1BBH A;  1TWH A;  2L7A A;  4IAQ A;  4U5C E;  2VH3 A;  4U5H A;  4XEV A;  1D0X A;  3RW0 A;  5DS6 A;  4M63 A;  4RBN A;  5A69 A;  1TFO B;  1QPU A;  3NG1 A;  2CDQ A;  1T6I A;  3ABM C;  4J7T A;  4EBB A;  3TJ5 A;  2VCA A;  2FGY A;  3FHD A;  3KL4 A;  1YVI A;  4OIO F;  2Q9B A;  2IBF A;  5IY5 C;  2HMZ A;  2IXP A;  2J0W A;  1U89 A;  3FMS A;  1NU9 C;  1JAF A;  2AU5 A;  2XLW A;  3EJN A;  2L6H A;  2ZXR A;  4P6I C;  4BJ1 A;  4C3D A;  2R7R A;  4JJF A;  1N1C A;  3ZWI A;  3R7C A;  4PK4 A;  3FOP A;  4P9F A;  1Q0D A;  2CNW D;  3S0X A;  3HKK A;  4HEA J;  5L3Q A;  5BQG A;  3HNK A;  1TFK B;  3IQT A;  4LLC A;  3U2L A;  1QVX A;  2LCH A;  3UMH A;  1TKN A;  2WVN A;  4QI0 A;  2ICW G;  3L8J A;  5T3W A;  2P61 A;  5A6J A;  2XXA A;  2B0H A;  2XL4 A;  2YQY A;  1GS9 A;  4H54 A;  3OA1 A;  3RQG A;  5A6B D;  1Z3I X;  1YAU O;  1A7D A;  5DS4 A;  4AE4 B;  3HTK C;  3ASN C;  4PJN A;  2F22 A;  1VOM A;  3O55 A;  1ZHX A;  3AQC A;  4YWQ A;  1EQ1 A;  1Q0M A;  2LIG A;  3IEE A;  3U3B A;  3GOR A;  3EHN A;  1T6Q A;  3W8H A;  4FAP B;  4XPW A;  1D1C A;  3K1H A;  2NSG A;  3L0I A;  4ULW A;  1MMG A;  4K0D A;  4P9T A;  1FFT C;  3DD7 A;  2HMQ A;  3WHN A;  4CDY A;  4ER9 A;  5JP7 A;  3NKD A;  2A0B A;  2GDC A;  5TJ5 E;  3ABK C;  2MYS A;  3EGX B;  4DXW A;  2XLM A;  3NDB B;  1H6G A;  2J9W A;  5F5H A;  2PX3 A;  4I1M A;  5E2Q A;  4EKW A;  4KI2 A;  2XS8 A;  5T1D B;  4YT8 A;  4GYT A;  4EBJ A;  4PJJ A;  1YLM A;  5AGF A;  2H7B A;  3ZG1 A;  4A2N B;  1HY5 A;  4JW1 A;  5EHH A;  3V5Y A;  3L8I A;  1G4W R;  5JT4 A;  3JSE O;  4E18 A;  3S9O A;  1RKC A;  1V4A A;  256B A;  3GOD A;  3E70 C;  1XWJ A;  2CCY A;  2YL1 A;  3EG9 B;  3MX3 A;  4EBK A;  1VLT A;  2YRF A;  3CAX A;  1C03 A;  4EWC A;  2AWY A;  2R25 A;  2R7T A;  2R7V A;  2CNW A;  2CW0 F;  3CSK A;  3JYH A;  3K6B A;  4I3M A;  5B1A C;  3UNG C;  2R02 A;  4U5F E;  2YHS A;  1YZC A;  4JEB A;  4GEH A;  3KH2 A;  5BQI A;  3C63 A;  1RKE B;  3GWL A;  2J46 A;  4FES A;  1ZU4 A;  2DGJ A;  2NG1 A;  2RD9 A;  2OOC A;  2EIM C;  3GM1 A;  4YL0 A;  1SF8 A;  2P7V A;  2EPM X;  3AG3 C;  1ZW2 A;  1BDJ B;  5A6B A;  3LNM B;  4G0H A;  4PJL A;  3U5S A;  1TWG A;  4C7O A;  4BPM A;  3POV A;  1FTS A;  4N06 A;  1M57 C;  3HNI A;  4MTO A;  3EH2 A;  3JRM O;  1ZYR F;  3M1C B;  2IXM A;  3LEV A;  2H7O A;  4CBE A;  3ECS A;  3FXH A;  4DOZ A;  3A9C A;  1A41 A;  3SXK A;  1NSG B;  1U6H A;  3RVY A;  3V7O A;  2OEV A;  2P6V A;  1PV3 A;  3H2U A;  4YJW A;  2XRH A;  2J7P D;  2YLG A;  2BC5 A;  2D5R B;  2YZS A;  3C7J A;  1DOW A;  3FOO A;  2NUT A;  3US6 A;  3GWN A;  2DB4 A;  4IRU A;  3SP1 A;  1FR0 A;  1VYI A;  3X2Q C;  2WVQ A;  5CI8 A;  4CS8 A;  3FVY A;  5AC5 A;  4A4A A;  3DM9 B;  4EUK B;  1OW7 A;  3SYN A;  3AGU A;  5L0I A;  4C3B A;  5EGY A;  1LS4 A;  4YT2 A;  1HE1 A;  2PF4 E;  2R7Q A;  3ABL C;  3OWT A;  5GPG B;  3C8G A;  3W2V A;  3M4B A;  3MLG A;  3W2W A;  2R7X A;  5HSW A;  4OD5 A;  4XWJ A;  3B0U X;  4G78 A;  1OW6 A;  1ZHZ A;  1SMY F;  2LFF A;  1LS1 A;  1M6T A;  2L81 A;  3BEH A;  4XLN F;  4C3E A;  4CJG A;  3S90 A;  4E7S A;  1BR1 A;  3GM3 A;  2XS1 A;  1K04 A;  4MVM A;  4JRZ A;  3T4R A;  4CX9 A;  5KYY B;  4O6M A;  4D4N A;  1LPE A;  4K7B A;  2Y3G A;  3ZDL A;  1OXB A;  5L0D A;  3JCU Q;  5FCL A;  2A0U A;  2OQM A;  1APC A;  2J0X A;  1M2V A;  2OCC C;  3I5P A;  3N24 A;  5L3V A;  2ZXW C;  2J8W A;  4IAO A;  3AG4 C;  4G7O F;  4FX5 A;  1LE4 A;  2LP4 A;  2IYL D;  1EA8 A;  1KNY A;  2G3V A;  4JE9 A;  4BEJ A;  4EIY A;  3Q6M A;  1Z63 A;  2EIL C;  5CI9 A;  3EPV A;  1QLE C;  3K33 A;  1NFN A;  1YAR O;  2EIN C;  3B29 A;  2LD6 A;  2UUI A;  2OU6 A;  2XLD A;  3IQ5 A;  4XEF A;  1HMD A;  1T01 A;  1F1M A;  1IZM A;  1A0B A;  1QKR A;  1AVO B;  1TWA A;  2XM4 A;  3E9V A;  4N6C A;  2MWQ A;  4U9E A;  5DQT A;  3DWW A;  2EPO A;  3T9O A;  2KQ9 A;  3LEO A;  5JS5 A;  2J7P A;  4NC3 A;  4CDV A;  2KC3 A;  4MVS A;  3U9J A;  3IQC A;  1D1A A;  2OG2 A;  2Y3D A;  3ASO C;  4WGY A;  3VM6 A;  3N0T A;  2HSQ A;  2IXN A;  2J45 A;  2VCC A;  2YL0 A;  4IAR A;  3B0V C;  4NCQ A;  3LES A;  3DE8 A;  1S05 A;  3EFO B;  1FAP B;  3LJB A;  1VMA A;  1Z7Q c;  2KK1 A;  3EZI A;  1JPN A;  1VYK A;  1RJ9 A;  4WJ0 A;  3VF0 A;  3QVZ A;  4J7Y A;  4QI2 A;  1NU7 D;  2Y3H A;  1FFH A;  2Y69 C;  3JSZ A;  4MVQ A;  5B1B C;  1CGM E;  2Q9C A;  2D4U A;  2YKZ A;  3O6X A;  2CYD A;  2LQG A;  2Y3B A;  2M64 A;  5HV9 A;  4CSA C;  5L0J A;  4E0I A;  2A1D D;  3LS1 A;  2LK4 A;  4MQ9 F;  1H9G A;  1WN0 A;  1AUE A;  1LIH A;  2BL2 A;  1WTY A;  1MMA A;  2QTV A;  2WB7 A;  4R32 A;  3WG7 C;  3GAN A;  3RKO F;  3ZIB A;  5E33 A;  4E0H A;  1YA9 A;  3VAY A;  4F4B A;  3QW0 A;  1Y4C A;  2WZL A;  3Q7L A;  3H2V A;  4U5B E;  3GEH A;  3LLK A;  2A68 F;  2WZF A;  1OKK D;  3DAF A;  3RYL A;  3UMK A;  4Q4Z F;  4MVR A;  3RFY A;  5KYN A;  4CS9 A;  1DOV A;  1YDI A;  4AE4 A;  4MW8 A;  4CDA A;  3KYI A;  3PHF 2;  1Q0F A;  2VAS A;  4QDL A;  3Q7G A;  4MND A;  1L3P A;  3SNH A;  2IM8 A;  2EPL X;  2OKU A;  5KYX A;  4LDR A;  1KTM A;  1PCX A;  1G5Z A;  3FAP B;  1Q0G A;  4BG0 A;  4O7G A;  3UMI A;  5DQZ A;  1HW1 A;  3ZC4 A;  3GEI A;  3RVZ A;  1E83 A;  1S7Z A;  4JJG A;  4XTK A;  2VC9 A;  3ATP A;  2IXO A;  3SEO A;  1ORS C;  1YA7 O;  3EGX A;  1KU2 A;  1M56 C;  3JZ0 A;  4Z9I A;  1Z6A A;  4CS8 C;  2B0J A;  2Q9A A;  2HFI A;  1MQV A;  1WAS A;  3IHU A;  3JTL O;  2Q7R A;  2FAP B;  5D91 A;  2R05 A;  2YLD A;  3T6G B;  1R5I D;  4AL1 A;  1G4U S;  5B3I A;  3DMD A;  1ORY A;  3F47 A;  3QVY A;  4DBR A;  1CPR A;  3QTH A;  2KSF A;  4MTG A;  3H65 A;  1OR2 A;  4JTD B;  4NTA A;  1T9K A;  2ETS A;  3JT1 A;  3RH3 A;  1FNT c;  3TK0 A;  5KYU B;  4PFO A;  1MND A;  2XM0 A;  3EG9 A;  1VLS A;  1GM5 A;  1HMO A;  5CIV A;  4E17 A;  5D92 A;  1ORJ A;  4PR9 A;  4JCZ A;  4I44 A;  2ZPA A;  2P1A A;  4C7O B;  1ZHW A;  2L6G A;  2L9J A;  4YT5 A;  1I5N A;  5L0F A;  3NYJ A;  1C17 M;  1LVK A;  4NY3 A;  3DAG A;  1LI5 A;  4IGG A;  1Q0K A;  3PCV A;  4ULV A;  4AK9 A;  1OKK A;  4CS7 A;  4DBQ A;  3UGP A;  4UDV A;  3LLI A;  3F46 A;  2GAQ A;  3SXZ A;  3G4X A;  4JZA A;  4MS2 A;  4YN0 B;  4B6I A;  2IOQ A;  3U3F A;  4BJ5 A;  1JRA A;  1OW8 A;  2I15 A;  3ZSU A;  4J30 B;  3JYY A;  1QZX A;  4PJM A;  1ZHY A;  2H8A A;  3SXY A;  2YLI A;  2LFD A;  2EIK C;  2OJE D;  1M2O A;  4N6H A;  1WGW A;  3W4Y A;  1LI7 A;  3N2Z B;  1YYJ A;  4O6N A;  2I8B A;  4O6Y A;  2C03 A;  3EGD B;  3EQL F;  4JEA A;  1GQA A;  3VYW A;  2J9B A;  2R7U A;  3C8G B;  3T6J A;  3CZ6 A;  2R7W A;  2R03 A;  2HJM A;  4U5D E;  4JIO A;  3ITF A;  3PMR A;  3HLZ A;  1QSP A;  5JLI A;  4LDK A;  4YT4 A;  1WWP A;  4JTC B;  4E7Z A;  4ZLC A;  1BR4 A;  3RF3 A;  4Q5S F;  4MVO A;  1XZQ A; 
#chains in the Genus database with same CATH homology
 1QQ3 A;  3DE8 A;  1S05 A;  3NMK A;  4ER9 A;  4CDY A;  5JP7 A;  4N4W A;  3QVZ A;  3U8P A;  3ZQV A;  2XLM A;  3M15 A;  2YKZ A;  2XLV A;  1A7V A;  3QW1 A;  5AGF A;  3ZTZ A;  5JT4 A;  256B A;  5JUA A;  1NBB A;  2CCY A;  4IB4 A;  2YL1 A;  5JVE A;  2YL3 A;  4L6R A;  3QW0 A;  3M4C A;  1CGN A;  1YZC A;  4JEB A;  3C63 A;  2XL8 A;  2XL6 A;  4JKV A;  3TOM A;  3NMI A;  2XLH A;  4CDA A;  4U9D A;  5JRA A;  3HNJ A;  1YZA A;  3HNI A;  1LM3 B;  2XLE A;  1E83 A;  3C62 A;  1CGO A;  3ZQY A;  3TOL A;  3IQ6 A;  2YLG A;  2BC5 A;  3FOO A;  2YL7 A;  1MQV A;  1RCP A;  3DE9 A;  4D4X A;  2YLD A;  3VRC A;  5B3I A;  3QVY A;  4CIP A;  1CPR A;  4CJO A;  1BBH A;  2XM0 A;  4IAQ A;  1EKY A;  3M4B A;  2XLO A;  1QPU A;  3L1M A;  1M6T A;  4CJG A;  4CX9 A;  4ULV A;  4D4N A;  1JAF A;  2XLW A;  2QLA A;  4WGZ A;  3NMJ A;  3ZWI A;  3FOP A;  1APC A;  3M79 A;  3HNK A;  2J8W A;  4JE9 A;  4EIY A;  1YYX A;  2YLI A;  3HNL A;  4N6H A;  1E86 A;  1YYJ A;  2XLD A;  3IQ5 A;  2XM4 A;  4JEA A;  4U9E A;  1E85 A;  1GQA A;  2J9B A;  5JSL A;  5JS5 A;  4NC3 A;  3ZTM A;  4CDV A;  1CPQ A;  5JLI A;  4WGY A;  1E84 A;  4IAR A;  2YL0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...