4JE9A

Crystal structure of an engineered metal-free ridc1 construct with four interfacial disulfide bonds
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
106
structure length
106
Chain Sequence
b'ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHDALHLANCGKVKEAQAAAEQLKCTCNACHQKYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title In Vitro and Cellular Self-Assembly of a Zn-Binding Protein Cryptand via Templated Disulfide Bonds.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 44
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4je9A00
3C62A 4CIPA 5JLIA 3FOPA 3ZQVA 3IQ6A 3DE8A 1APCA 5JSLA 1QQ3A 1YYXA 5JP7A 3ZTZA 1NBBA 3NMKA 5B3IA 4EIYA 4IARA 1E83A 2J8WA 1YZCA 4JE9A 4ULVA 3ZQYA 3HNKA 4N4WA 2YLIA 1MQVA 2XL8A 1QPUA 3QVYA 3VRCA 2YLGA 2XLMA 3HNIA 4WGYA 3C63A 2BC5A 4CJGA 1JAFA 4D4NA 1LM3B 4JEBA 1YYJA 1YZAA 2XM4A 5JUAA 3M4BA 2CCYA 2XLHA 3DE9A 5JVEA 2XM0A 2YKZA 1CPRA 1E85A 4CDYA 3QW0A 4ER9A 3NMIA 2XL6A 3TOLA 1E84A 3ZTMA 4JEAA 3QVZA 5JRAA 2J9BA 2YL0A 2YL7A 4CJOA 1EKYA 3HNLA 2YLDA 3NMJA 1S05A 4CDAA 2XLVA 3M15A 4JKVA 4U9EA 4NC3A 5AGFA 1GQAA 4N6HA 4IB4A 2YL1A 4D4XA 4WGZA 3HNJA 2XLEA 3M4CA 1CGNA 4CDVA 3L1MA 4IAQA 3U8PA 1E86A 3QW1A 4L6RA 3M79A 256BA 3FOOA 3ZWIA 1A7VA 2QLAA 1BBHA 2XLOA 1RCPA 4U9DA 1M6TA 1CGOA 2YL3A 3TOMA 2XLDA 4CX9A 1CPQA 3IQ5A 5JS5A 5JT4A 2XLWA
chains in the Genus database with same CATH superfamily
1VMAA 1YARO 2EIMC 2LP4A 3CQZA 4YT8A 4CIPA 3ZQVA 1BR1A 4OD4A 3EGDA 5HV9A 1QLEC 4FX5A 5L0JA 3IQ6A 1PCXA 4O6MA 4PFPA 3RIPA 1W2WA 1EA8A 4U5CE 3RH3A 4YWQA 1WATA 1WWPA 1XZPA 2ZXPA 3S27A 4XPYA 3UGPA 1OKKD 2Y39A 1YYXA 3EGDB 3GM3A 3JRMO 1FTSA 4JIOA 2W4BA 3EGXB 2CW0F 1QZXA 1CGME 4MVRA 5B3IA 3POVA 4OIPF 3EZIA 2LK4A 1Q0GA 2EINC 4K7BA 2P0NA 2P61A 4MVZA 4EIYA 2HV6A 3IHUA 2J7PD 4BJ6A 2J8WA 1LE4A 4A2NB 4ULVA 3DWWA 4JTCB 2HJMA 4Z9JA 1ORSC 4EBKA 3N2ZB 5T3WA 1D1AA 1OR2A 3FHDA 1KTMA 2NUTB 1V4AA 3HNIA 4RDAA 1GM5A 3JYYA 4PACA 5KYNA 1YVIA 2BC5A 3E70C 1H9TA 1LIHA 4YL3A 1NZEA 3O6XA 3RQFA 1JAFA 2CDQA 2J45A 3NRHA 4D4NA 4E18A 4F4BA 2A0BA 5L0HA 3A11A 5TJ5E 2XRHA 3ITFA 4U5FE 3WG7C 2VB6A 1L3PA 5L0DA 4XWJA 4DOZA 2ICWG 3ASNC 3JSZA 1LS4A 2IM8A 3KMIA 1T5OA 3M4BA 4IJJA 2A68F 4G7OF 4FESA 1BR2A 2L6FA 5EK0A 1I4ZA 3QMKA 2R7SA 3AGTA 2PX0A 1NU7D 1G4US 2M4EA 3U0CA 2YKZA 4N6CA 2NUPA 3M1CB 3ZG1A 2WB7A 3G4XA 3JSEO 1TWHA 4YN0B 2HJ3A 3GWNA 2HMZA 2C04A 3U5SA 3X2QC 2WZGA 4Q4ZF 2P1AA 5L3VA 3K1HA 4H4KC 3E9VA 2YL7A 4I1OB 1BDJB 2NUPB 4XLPF 1WASA 4GQHA 2YLDA 3NMJA 4BJ5C 4EBJA 3EHMA 4CDAA 2EIKC 4M63A 1OCZC 3EQLF 4K1OA 1ZU5A 4OD5A 2GAQA 4JKVA 2ASRA 2XS8A 3LNRA 4U9EA 3V5XA 1SF8A 1NU9C 1GQAA 4LACB 1G4WR 1PD1A 3DM9B 5EGYA 1RXQA 2VCCA 4IB4A 3ASOC 1UFBA 1RKCA 2YL1A 3JTLO 3L8JA 2NSGA 2OEXA 2GWWA 1RJ9A 3NG1A 4G78A 5L0IA 4IGGA 1D0ZA 3M4CA 4Z9HA 1T9KA 3SXZA 1WN0A 1Q0DA 3L1MA 5B1BC 4C3BA 3L34A 5CI8A 3PHF2 1A7EA 1HE1A 1RJ9B 2MWQA 4IAQA 4QI0A 3LS0A 1OW8A 4R32A 3TD7A 4CSAA 3U8PA 5DQTA 3S84A 4JTDB 2OEVA 3F47A 3M79A 1F1MA 4L6RA 4HE8D 1Z7Qc 3V5YA 1L7CA 4C3EA 256BA 1NFOA 3B71A 3JRTA 3Q6MA 3FOOA 4E7SA 5IY5C 3CAXA 2QLAA 2YRFA 2FGYA 3EG9B 4PJNA 1QSPA 2D4UA 2DB4A 2YVKA 2KGOA 2YWAA 1FMWA 3UMKA 4U5HA 3Q7GA 4K0DA 4E0IA 5CIVA 1LE2A 2YL3A 4C7OB 2PP4A 3CEXA 3Q7LA 3EZHA 4MVUA 4LLCA 1TWAA 2PBEA 3I5PA 2IOQA 1LVKA 3Q6NA 2YEVA 4XEVA 5EHHA 2XLWA 2ZXRA 1BR4A 1I5NA 1VYIA 1B68A 2AU5A 3VF0A 2PNOA 3FOPA 5HSWA 5GPGB 3C8ZA 3CSKA 4ANJA 3DE8A 3LLKA 2OCCC 2OJED 2R03A 1APCA 5JSLA 1QQ3A 2G62A 3DJUB 1C02A 3U8VA 2H8AA 1TWGA 1U89A 3TJ5A 3ZTZA 3NYLA 4CS9A 2EPNA 4FWVA 3WODF 1HE9A 5COFA 1JPJA 3NMKA 1G8XA 3FAJA 5L3QA 2DYSC 3EFOB 1K04A 4XLNF 4QI2A 3RQEA 3GODA 1C03A 1YDIA 5KYXA 4NTFA 4IWBA 4YL1A 4IARA 4MVQA 1E83A 1KU2A 4HFKB 4JE9A 3ZQYA 1S7ZA 3S9OA 5DLJA 4N4WA 1MNEA 5KYXB 3ZVRA 1C17M 5F5HA 3ZSUA 4BJTA 4H54A 1J8YF 1MQVA 2XL8A 3K7DA 4C3DA 4A4AA 2QNLA 3EGXA 1YJGA 4ULWA 3C63A 3A9CA 5D91A 3UMHA 5KYYB 1JPNA 1V54C 2WVQA 3HTKC 3AGUA 1ZU4A 2BE5F 2KNHA 3K1IA 5FZTA 4EUKB 2MYSA 1XZQA 2WVOA 5A6KA 2AVKA 2B0JA 3BEHA 1OXBA 3ATPA 3LESA 1ZVZA 4NCQA 2DI3A 4E7ZA 4I44A 1FFTC 4B6IA 1LPEA 5JUAA 3IQCA 2CCYA 4ONSA 3W2WA 5JVEA 2XM0A 2MHRA 4O6YA 3AG1C 2X0CA 3G50A 2NUTA 4MVMA 2UUHA 2JX0A 2GA0A 4MNDA 5COMA 1E85A 1A0BA 5JLIA 3U3FA 1T6IA 2IXMA 4JEAA 3TQOA 3NKEA 4I1MA 4JVSA 4YL0A 1TKNA 2ETSA 2YL0A 4BG0A 3QTHA 1EKYA 3HNLA 4WABA 1D1BA 2Q9CA 2XLVA 1VOMA 3M15A 2GFHA 2VH3A 4LDQA 4JZAA 1DOWA 1U6HA 3DMDA 4XQ1A 3RVYA 4Q5SF 4NC3A 4O7GA 3VAYA 1OCCC 3LJBA 2LFDA 4RD9A 5AGFA 5A6JA 3W8HA 1RKEB 2OKUA 5AC5A 4D4XA 3DZAA 1WTYA 1HW2A 3SEOA 1Z23A 2KW3C 2H7OA 2XLEA 3R7CA 1WGWA 2R7OA 3LAYA 3H65A 4MW8A 5E2QA 4JJFA 1ORYA 4CIHA 4J32B 5T1DB 2H7VC 4NTAA 5K0IA 5KYWA 3O10A 3AG4C 4BJ6C 4CS7A 2R7VA 3S29A 4EWCA 2OJQA 2WL8A 4OIQF 2JD3A 5KYWB 1A7VA 2FAPB 2KQ9A 2R7QA 4JRZA 3UR3C 3GEIA 2KYHA 2L9JA 3HKKA 4Q7CA 3SXYA 4PR9A 4DRJB 5FCLA 2TMVP 3DI5A 2V3CC 4P6IC 3DAGA 1CGOA 1MMGA 4J30B 1V74B 2FFHA 2YQYA 3US6A 2Q00A 2ZPAA 2XXAB 1Q0MA 4RBNA 2XLDA 3EHNA 5JT4A 3FDQA 3KYJA 3DJNB 4YK5A 3RKOF 4EHPA 3RYLA 4KBLA 1MNDA 1ZZPA 4LDKA 2HZ8A 3C62A 4KC9A 4ZLDA 3T6GB 3S90A 4G7HF 2HMQA 3B0PA 1YA7O 2I15A 4DBQA 4NQFA 3EG9A 3GM1A 2OOCA 5A6AA 2NSFA 1BZ4A 3DKAA 4MVOA 3GORA 5F28E 4HFFB 5JP7A 2E87A 5B1AC 3RQGA 2IXOA 3UNGC 3ECSA 3PCVA 1HMOA 2LIGA 5BQIA 3R2PA 5L0GA 3UGOA 4C7OA 1TR2A 3SXKA 3DAFA 2P7VA 2Q4FA 3LEVA 1NLXA 2A69F 2G3KA 3K33A 5A6BA 1T6QA 4KNVA 1VTMP 5AC4A 2W4MA 3U2LA 2C03A 1MMAA 1Q0FA 4CS8A 1YZCA 3OA1A 1K05A 3RF3A 2VC9A 3FMSA 2Z15A 3HNKA 3DXJF 3EH2A 3IEEA 4GYTA 4KNWA 1OCRC 1NFNA 1QKRA 2J9VA 2YLIA 4PJLA 4CBEA 2YLGA 2XLMA 2YHSA 2LD6A 2O9XA 2Q9BA 1Z63A 1AUEA 4U5DE 2RSEB 1D1CA 5T3TA 3MBGA 3PDMP 1R5ID 2W45A 3EFOA 2H7BA 1GS9A 1LM3B 2YZSA 2EPKX 2A6HF 1ZHXA 4CSAC 4AE4A 1YLMA 2P6VA 3SP1A 2Y3HA 3G4ZA 2EPOA 4XPXA 2I8BA 4MTFA 2DYRC 4Z9IA 2HFIA 2ZXWC 2CNWD 1O5HA 2XM4A 2NPUA 3GWLA 3OEOA 3AOUA 1HMDA 4AE4B 2L81A 4FAPB 2W9YA 1RMVA 1FR0A 2R25A 4O6NA 4EKWA 1A41A 1T01A 1VYKA 5BQGA 2PX3A 2IXNA 4DJ9A 4E17A 3QW0A 4ER9A 5KYYA 1Z6AA 3TOLA 2OQMA 1ORJA 2KK1A 5A69A 2OG2A 2IYLD 3B9QA 3T4RA 1AEPA 3C8GA 1ZW3A 2Y69C 3QVZA 3ZTMA 5JRAA 2M64A 2J9BA 3AQCA 2R05A 1OW6A 1LS1A 3V7OA 3GEEA 2DGJA 2Q9AA 1YAUO 3I4UA 2PF4E 3C8GB 4P9TA 2A0UA 2EPLX 4JJGA 4NTBA 4MVSA 1TFOB 1IW7F 4J7TA 3SYNA 2CYDA 4UDVA 4ZLCA 3U2MA 1Z3IX 3EJNA 3QZCA 3U9JA 5E33A 1I4YA 2HSQA 2HV7A 3KL4A 4WGZA 2L6HA 4CS9C 5BQHA 3HNJA 4PJMA 5B3SC 2KSFA 4CDVA 5F5FA 1OXKA 4PFOA 1KNYA 3T6JA 4KI2A 3S0XA 2AWYA 3T6BA 3J06A 3LNMB 4G7ZF 2RD9A 4BJ1A 1NG1A 2Y3DA 2BL2A 2HKVA 3OWTA 1D0YA 2QY9A 2Y3BA 3JZ0A 4JURI 3WAQA 3N0TA 3ZWIA 2IXPA 4MQ9F 4EBBA 1M2OA 3ABKC 1ZHTA 3JT1A 3U3BA 5E3CA 4JTAB 1RCPA 5DS4A 4U9DA 1RKEA 2Y3GA 1TFKB 4XPWA 4IRUA 4AL0A 5DQZA 1Y4CA 3FXHA 3GEHA 2KJGA 3TOMA 5A6BD 2CNWA 2XSEA 3TK0A 2NG1A 3DM5A 3JCUQ 3K1IC 3KH2A 3LEOA 1H7IA 3LS1A 2D5RB 2QE9A 3GANA 3MX3A 5L0CA 1G5ZA 2X51A 1XWJA 4JEBA 4N06A 2QUPA 1TWCA 1MMDA 4JW1A 5COGA 4BJ5A 1HW1A 1UG7A 1FNTc 2B0HA 2AWCA 1PD0A 2XS1A 3NKDA 1U0BB 2J46A 4J7YA 4WJ0A 1SMYF 1FMVA 1VB5A 3JYHA 4PJJA 3I5QA 1D0XA 3AJMA 3GM2A 1ZHYA 2A6EF 1EI7A 1Q0KA 3H2VA 3MFNA 3ZIBA 1JOGA 1ZYRF 1FFHA 2PFDA 4YJWA 1OCOC 2XXAA 1NBBA 2R7TA 2L6GA 1NSGB 3HLZA 3NDBB 2R02A 2Q7RA 3AG3C 5DS6A 4I3MA 3U9MA 3C18A 2ZXOA 3TULA 1OW7A 3K6BA 4W8KA 2A1DD 4YT2A 3O39A 1K40A 3AQBA 1M56C 2GDCA 4NY3A 4DBRA 2R9RB 3RW0A 1H9GA 2J0WA 4O79A 4XEFA 2R7UA 2ZD9A 2XL4A 2AP3A 2IBFA 3K66A 3QVYA 3MYFA 1A7DA 3VRCA 3W2VA 3C8GD 4WGYA 1J8MF 3VM6A 3ZDLA 1E2XA 1T6UA 4YT4A 2J9UA 3TJ6A 1OKKA 1TQGA 4XEKA 4DXWA 2LCHA 4CJGA 2CGEA 1JRAA 5BUOA 4PK4A 4X0RA 1M2VA 2F22A 4P9FA 4IAOA 3S28A 2UUIA 2HSBA 2R7RA 1YYJA 1LI5A 1M57C 1YZAA 2EPMX 2J9WA 2HS5A 2VCAA 4BPMA 3ABLC 1SR2A 4JCZA 4OIOF 2KC3A 5D92A 1JMWA 1GGQA 2LFFA 1M2VB 2G3VA 2JPUA 3MLGA 4OINF 2XLHA 3DE9A 2WZFA 4OIRF 5L0FA 2R7XA 1HY5A 2J7PA 3W8IA 3EPVA 3RFYA 3O55A 3B0UX 4U5EE 1SZIA 2HUJA 3UMIA 1JR8A 1LKXA 2LQGA 1CPRA 2LSEA 2L7AA 1OQCA 1QVXA 2VASA 3L0IA 4CDYA 3NMIA 4DVYP 1EQ1A 2XL6A 2QTVA 1E84A 3LUTB 3PMRA 3SZRA 3SNHA 3B0VC 3W4YA 3DD7A 1LI7A 3NYMA 4CJOA 3HJCA 2R7WA 2Q3TA 3KYIA 4JC7A 1S05A 1ZHZA 3NYJA 4U5BE 1R4TA 1DOVA 4W8PA 4MS2A 5DS5A 4AL1A 3LLIA 1Y6DA 4N6HA 5KYUA 4AX2A 3B29A 4LDRA 1WOLA 3VYWA 4YT5A 3SXMA 1AVOB 3IPMO 3AG2C 3ZC4A 1ST6A 3C7JA 2VCBA 5E3AA 5KYUB 4U5GA 1CGNA 1H6GA 3N24A 4DVZA 4LERA 3MYIA 2WZLA 3KPHA 4DRHB 1VK5A 2EIJC 3F46A 3FAPB 4BEMJ 1E86A 5CI9A 2WVNA 1VLSA 4HEAJ 3QW1A 4CS8C 3X1OA 3V5ZA 1FAPB 4LLEA 3T9OA 4QDLA 1YA9A 1VLTA 4MW3A 4BEJA 1PV3A 4E0HA 1ZHWA 3RVZA 1BBHA 2XLOA 2V26A 3FVYA 3L8IA 4MTGA 1M6TA 1ZW2A 1O87A 4MTOA 1N1CA 3H2UA 3CZ6A 3IQTA 3EH1A 1Z5ZA 5DVWA 3ABMC 4G0HA 1O3UA 2EILC 3WHNA 4XTKA 4CX9A 1CPQA 1MMNA 1SYQA 1V55C 3IQ5A 1OR3A 4GEHA 2J0XA 4DRIB 5JS5A 1IZMA 2OU6A 1QPUA 3KKBA 4AK9A 3BRJA 4JCHA
chains in the Genus database with same CATH topology
3C62A 4CIPA 5JLIA 3FOPA 3ZQVA 3IQ6A 3DE8A 1APCA 5JSLA 1QQ3A 1YYXA 5JP7A 3ZTZA 1NBBA 3NMKA 5B3IA 4EIYA 4IARA 1E83A 2J8WA 1YZCA 4JE9A 4ULVA 3ZQYA 3HNKA 4N4WA 2YLIA 1MQVA 2XL8A 1QPUA 3QVYA 3VRCA 2YLGA 2XLMA 3HNIA 4WGYA 3C63A 2BC5A 4CJGA 1JAFA 4D4NA 1LM3B 4JEBA 1YYJA 1YZAA 2XM4A 5JUAA 3M4BA 2CCYA 2XLHA 3DE9A 5JVEA 2XM0A 2YKZA 1CPRA 1E85A 4CDYA 3QW0A 4ER9A 3NMIA 2XL6A 3TOLA 1E84A 3ZTMA 4JEAA 3QVZA 5JRAA 2J9BA 2YL0A 2YL7A 4CJOA 1EKYA 3HNLA 2YLDA 3NMJA 1S05A 4CDAA 2XLVA 3M15A 4JKVA 4U9EA 4NC3A 5AGFA 1GQAA 4N6HA 4IB4A 2YL1A 4D4XA 4WGZA 3HNJA 2XLEA 3M4CA 1CGNA 4CDVA 3L1MA 4IAQA 3U8PA 1E86A 3QW1A 4L6RA 3M79A 256BA 3FOOA 3ZWIA 1A7VA 2QLAA 1BBHA 2XLOA 1RCPA 4U9DA 1M6TA 1CGOA 2YL3A 3TOMA 2XLDA 4CX9A 1CPQA 3IQ5A 5JS5A 5JT4A 2XLWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C62 A;  4CIP A;  5JLI A;  3FOP A;  3ZQV A;  3IQ6 A;  3DE8 A;  1APC A;  5JSL A;  1QQ3 A;  1YYX A;  5JP7 A;  3ZTZ A;  1NBB A;  3NMK A;  5B3I A;  4EIY A;  4IAR A;  1E83 A;  2J8W A;  1YZC A;  4JE9 A;  4ULV A;  3ZQY A;  3HNK A;  4N4W A;  2YLI A;  1MQV A;  2XL8 A;  1QPU A;  3QVY A;  3VRC A;  2YLG A;  2XLM A;  3HNI A;  4WGY A;  3C63 A;  2BC5 A;  4CJG A;  1JAF A;  4D4N A;  1LM3 B;  4JEB A;  1YYJ A;  1YZA A;  2XM4 A;  5JUA A;  3M4B A;  2CCY A;  2XLH A;  3DE9 A;  5JVE A;  2XM0 A;  2YKZ A;  1CPR A;  1E85 A;  4CDY A;  3QW0 A;  4ER9 A;  3NMI A;  2XL6 A;  3TOL A;  1E84 A;  3ZTM A;  4JEA A;  3QVZ A;  5JRA A;  2J9B A;  2YL0 A;  2YL7 A;  4CJO A;  1EKY A;  3HNL A;  2YLD A;  3NMJ A;  1S05 A;  4CDA A;  2XLV A;  3M15 A;  4JKV A;  4U9E A;  4NC3 A;  5AGF A;  1GQA A;  4N6H A;  4IB4 A;  2YL1 A;  4D4X A;  4WGZ A;  3HNJ A;  2XLE A;  3M4C A;  1CGN A;  4CDV A;  3L1M A;  4IAQ A;  3U8P A;  1E86 A;  3QW1 A;  4L6R A;  3M79 A;  256B A;  3FOO A;  3ZWI A;  1A7V A;  2QLA A;  1BBH A;  2XLO A;  1RCP A;  4U9D A;  1M6T A;  1CGO A;  2YL3 A;  3TOM A;  2XLD A;  4CX9 A;  1CPQ A;  3IQ5 A;  5JS5 A;  5JT4 A;  2XLW A; 
#chains in the Genus database with same CATH topology
 1VMA A;  1YAR O;  2EIM C;  2LP4 A;  3CQZ A;  4YT8 A;  4CIP A;  3ZQV A;  1BR1 A;  4OD4 A;  3EGD A;  5HV9 A;  1QLE C;  4FX5 A;  5L0J A;  3IQ6 A;  1PCX A;  4O6M A;  4PFP A;  3RIP A;  1W2W A;  1EA8 A;  4U5C E;  3RH3 A;  4YWQ A;  1WAT A;  1WWP A;  1XZP A;  2ZXP A;  3S27 A;  4XPY A;  3UGP A;  1OKK D;  2Y39 A;  1YYX A;  3EGD B;  3GM3 A;  3JRM O;  1FTS A;  4JIO A;  2W4B A;  3EGX B;  2CW0 F;  1QZX A;  1CGM E;  4MVR A;  5B3I A;  3POV A;  4OIP F;  3EZI A;  2LK4 A;  1Q0G A;  2EIN C;  4K7B A;  2P0N A;  2P61 A;  4MVZ A;  4EIY A;  2HV6 A;  3IHU A;  2J7P D;  4BJ6 A;  2J8W A;  1LE4 A;  4A2N B;  4ULV A;  3DWW A;  4JTC B;  2HJM A;  4Z9J A;  1ORS C;  4EBK A;  3N2Z B;  5T3W A;  1D1A A;  1OR2 A;  3FHD A;  1KTM A;  2NUT B;  1V4A A;  3HNI A;  4RDA A;  1GM5 A;  3JYY A;  4PAC A;  5KYN A;  1YVI A;  2BC5 A;  3E70 C;  1H9T A;  1LIH A;  4YL3 A;  1NZE A;  3O6X A;  3RQF A;  1JAF A;  2CDQ A;  2J45 A;  3NRH A;  4D4N A;  4E18 A;  4F4B A;  2A0B A;  5L0H A;  3A11 A;  5TJ5 E;  2XRH A;  3ITF A;  4U5F E;  3WG7 C;  2VB6 A;  1L3P A;  5L0D A;  4XWJ A;  4DOZ A;  2ICW G;  3ASN C;  3JSZ A;  1LS4 A;  2IM8 A;  3KMI A;  1T5O A;  3M4B A;  4IJJ A;  2A68 F;  4G7O F;  4FES A;  1BR2 A;  2L6F A;  5EK0 A;  1I4Z A;  3QMK A;  2R7S A;  3AGT A;  2PX0 A;  1NU7 D;  1G4U S;  2M4E A;  3U0C A;  2YKZ A;  4N6C A;  2NUP A;  3M1C B;  3ZG1 A;  2WB7 A;  3G4X A;  3JSE O;  1TWH A;  4YN0 B;  2HJ3 A;  3GWN A;  2HMZ A;  2C04 A;  3U5S A;  3X2Q C;  2WZG A;  4Q4Z F;  2P1A A;  5L3V A;  3K1H A;  4H4K C;  3E9V A;  2YL7 A;  4I1O B;  1BDJ B;  2NUP B;  4XLP F;  1WAS A;  4GQH A;  2YLD A;  3NMJ A;  4BJ5 C;  4EBJ A;  3EHM A;  4CDA A;  2EIK C;  4M63 A;  1OCZ C;  3EQL F;  4K1O A;  1ZU5 A;  4OD5 A;  2GAQ A;  4JKV A;  2ASR A;  2XS8 A;  3LNR A;  4U9E A;  3V5X A;  1SF8 A;  1NU9 C;  1GQA A;  4LAC B;  1G4W R;  1PD1 A;  3DM9 B;  5EGY A;  1RXQ A;  2VCC A;  4IB4 A;  3ASO C;  1UFB A;  1RKC A;  2YL1 A;  3JTL O;  3L8J A;  2NSG A;  2OEX A;  2GWW A;  1RJ9 A;  3NG1 A;  4G78 A;  5L0I A;  4IGG A;  1D0Z A;  3M4C A;  4Z9H A;  1T9K A;  3SXZ A;  1WN0 A;  1Q0D A;  3L1M A;  5B1B C;  4C3B A;  3L34 A;  5CI8 A;  3PHF 2;  1A7E A;  1HE1 A;  1RJ9 B;  2MWQ A;  4IAQ A;  4QI0 A;  3LS0 A;  1OW8 A;  4R32 A;  3TD7 A;  4CSA A;  3U8P A;  5DQT A;  3S84 A;  4JTD B;  2OEV A;  3F47 A;  3M79 A;  1F1M A;  4L6R A;  4HE8 D;  1Z7Q c;  3V5Y A;  1L7C A;  4C3E A;  256B A;  1NFO A;  3B71 A;  3JRT A;  3Q6M A;  3FOO A;  4E7S A;  5IY5 C;  3CAX A;  2QLA A;  2YRF A;  2FGY A;  3EG9 B;  4PJN A;  1QSP A;  2D4U A;  2DB4 A;  2YVK A;  2KGO A;  2YWA A;  1FMW A;  3UMK A;  4U5H A;  3Q7G A;  4K0D A;  4E0I A;  5CIV A;  1LE2 A;  2YL3 A;  4C7O B;  2PP4 A;  3CEX A;  3Q7L A;  3EZH A;  4MVU A;  4LLC A;  1TWA A;  2PBE A;  3I5P A;  2IOQ A;  1LVK A;  3Q6N A;  2YEV A;  4XEV A;  5EHH A;  2XLW A;  2ZXR A;  1BR4 A;  1I5N A;  1VYI A;  1B68 A;  2AU5 A;  3VF0 A;  2PNO A;  3FOP A;  5HSW A;  5GPG B;  3C8Z A;  3CSK A;  4ANJ A;  3DE8 A;  3LLK A;  2OCC C;  2OJE D;  2R03 A;  1APC A;  5JSL A;  1QQ3 A;  2G62 A;  3DJU B;  1C02 A;  3U8V A;  2H8A A;  1TWG A;  1U89 A;  3TJ5 A;  3ZTZ A;  3NYL A;  4CS9 A;  2EPN A;  4FWV A;  3WOD F;  1HE9 A;  5COF A;  1JPJ A;  3NMK A;  1G8X A;  3FAJ A;  5L3Q A;  2DYS C;  3EFO B;  1K04 A;  4XLN F;  4QI2 A;  3RQE A;  3GOD A;  1C03 A;  1YDI A;  5KYX A;  4NTF A;  4IWB A;  4YL1 A;  4IAR A;  4MVQ A;  1E83 A;  1KU2 A;  4HFK B;  4JE9 A;  3ZQY A;  1S7Z A;  3S9O A;  5DLJ A;  4N4W A;  1MNE A;  5KYX B;  3ZVR A;  1C17 M;  5F5H A;  3ZSU A;  4BJT A;  4H54 A;  1J8Y F;  1MQV A;  2XL8 A;  3K7D A;  4C3D A;  4A4A A;  2QNL A;  3EGX A;  1YJG A;  4ULW A;  3C63 A;  3A9C A;  5D91 A;  3UMH A;  5KYY B;  1JPN A;  1V54 C;  2WVQ A;  3HTK C;  3AGU A;  1ZU4 A;  2BE5 F;  2KNH A;  3K1I A;  5FZT A;  4EUK B;  2MYS A;  1XZQ A;  2WVO A;  5A6K A;  2AVK A;  2B0J A;  3BEH A;  1OXB A;  3ATP A;  3LES A;  1ZVZ A;  4NCQ A;  2DI3 A;  4E7Z A;  4I44 A;  1FFT C;  4B6I A;  1LPE A;  5JUA A;  3IQC A;  2CCY A;  4ONS A;  3W2W A;  5JVE A;  2XM0 A;  2MHR A;  4O6Y A;  3AG1 C;  2X0C A;  3G50 A;  2NUT A;  4MVM A;  2UUH A;  2JX0 A;  2GA0 A;  4MND A;  5COM A;  1E85 A;  1A0B A;  5JLI A;  3U3F A;  1T6I A;  2IXM A;  4JEA A;  3TQO A;  3NKE A;  4I1M A;  4JVS A;  4YL0 A;  1TKN A;  2ETS A;  2YL0 A;  4BG0 A;  3QTH A;  1EKY A;  3HNL A;  4WAB A;  1D1B A;  2Q9C A;  2XLV A;  1VOM A;  3M15 A;  2GFH A;  2VH3 A;  4LDQ A;  4JZA A;  1DOW A;  1U6H A;  3DMD A;  4XQ1 A;  3RVY A;  4Q5S F;  4NC3 A;  4O7G A;  3VAY A;  1OCC C;  3LJB A;  2LFD A;  4RD9 A;  5AGF A;  5A6J A;  3W8H A;  1RKE B;  2OKU A;  5AC5 A;  4D4X A;  3DZA A;  1WTY A;  1HW2 A;  3SEO A;  1Z23 A;  2KW3 C;  2H7O A;  2XLE A;  3R7C A;  1WGW A;  2R7O A;  3LAY A;  3H65 A;  4MW8 A;  5E2Q A;  4JJF A;  1ORY A;  4CIH A;  4J32 B;  5T1D B;  2H7V C;  4NTA A;  5K0I A;  5KYW A;  3O10 A;  3AG4 C;  4BJ6 C;  4CS7 A;  2R7V A;  3S29 A;  4EWC A;  2OJQ A;  2WL8 A;  4OIQ F;  2JD3 A;  5KYW B;  1A7V A;  2FAP B;  2KQ9 A;  2R7Q A;  4JRZ A;  3UR3 C;  3GEI A;  2KYH A;  2L9J A;  3HKK A;  4Q7C A;  3SXY A;  4PR9 A;  4DRJ B;  5FCL A;  2TMV P;  3DI5 A;  2V3C C;  4P6I C;  3DAG A;  1CGO A;  1MMG A;  4J30 B;  1V74 B;  2FFH A;  2YQY A;  3US6 A;  2Q00 A;  2ZPA A;  2XXA B;  1Q0M A;  4RBN A;  2XLD A;  3EHN A;  5JT4 A;  3FDQ A;  3KYJ A;  3DJN B;  4YK5 A;  3RKO F;  4EHP A;  3RYL A;  4KBL A;  1MND A;  1ZZP A;  4LDK A;  2HZ8 A;  3C62 A;  4KC9 A;  4ZLD A;  3T6G B;  3S90 A;  4G7H F;  2HMQ A;  3B0P A;  1YA7 O;  2I15 A;  4DBQ A;  4NQF A;  3EG9 A;  3GM1 A;  2OOC A;  5A6A A;  2NSF A;  1BZ4 A;  3DKA A;  4MVO A;  3GOR A;  5F28 E;  4HFF B;  5JP7 A;  2E87 A;  5B1A C;  3RQG A;  2IXO A;  3UNG C;  3ECS A;  3PCV A;  1HMO A;  2LIG A;  5BQI A;  3R2P A;  5L0G A;  3UGO A;  4C7O A;  1TR2 A;  3SXK A;  3DAF A;  2P7V A;  2Q4F A;  3LEV A;  1NLX A;  2A69 F;  2G3K A;  3K33 A;  5A6B A;  1T6Q A;  4KNV A;  1VTM P;  5AC4 A;  2W4M A;  3U2L A;  2C03 A;  1MMA A;  1Q0F A;  4CS8 A;  1YZC A;  3OA1 A;  1K05 A;  3RF3 A;  2VC9 A;  3FMS A;  2Z15 A;  3HNK A;  3DXJ F;  3EH2 A;  3IEE A;  4GYT A;  4KNW A;  1OCR C;  1NFN A;  1QKR A;  2J9V A;  2YLI A;  4PJL A;  4CBE A;  2YLG A;  2XLM A;  2YHS A;  2LD6 A;  2O9X A;  2Q9B A;  1Z63 A;  1AUE A;  4U5D E;  2RSE B;  1D1C A;  5T3T A;  3MBG A;  3PDM P;  1R5I D;  2W45 A;  3EFO A;  2H7B A;  1GS9 A;  1LM3 B;  2YZS A;  2EPK X;  2A6H F;  1ZHX A;  4CSA C;  4AE4 A;  1YLM A;  2P6V A;  3SP1 A;  2Y3H A;  3G4Z A;  2EPO A;  4XPX A;  2I8B A;  4MTF A;  2DYR C;  4Z9I A;  2HFI A;  2ZXW C;  2CNW D;  1O5H A;  2XM4 A;  2NPU A;  3GWL A;  3OEO A;  3AOU A;  1HMD A;  4AE4 B;  2L81 A;  4FAP B;  2W9Y A;  1RMV A;  1FR0 A;  2R25 A;  4O6N A;  4EKW A;  1A41 A;  1T01 A;  1VYK A;  5BQG A;  2PX3 A;  2IXN A;  4DJ9 A;  4E17 A;  3QW0 A;  4ER9 A;  5KYY A;  1Z6A A;  3TOL A;  2OQM A;  1ORJ A;  2KK1 A;  5A69 A;  2OG2 A;  2IYL D;  3B9Q A;  3T4R A;  1AEP A;  3C8G A;  1ZW3 A;  2Y69 C;  3QVZ A;  3ZTM A;  5JRA A;  2M64 A;  2J9B A;  3AQC A;  2R05 A;  1OW6 A;  1LS1 A;  3V7O A;  3GEE A;  2DGJ A;  2Q9A A;  1YAU O;  3I4U A;  2PF4 E;  3C8G B;  4P9T A;  2A0U A;  2EPL X;  4JJG A;  4NTB A;  4MVS A;  1TFO B;  1IW7 F;  4J7T A;  3SYN A;  2CYD A;  4UDV A;  4ZLC A;  3U2M A;  1Z3I X;  3EJN A;  3QZC A;  3U9J A;  5E33 A;  1I4Y A;  2HSQ A;  2HV7 A;  3KL4 A;  4WGZ A;  2L6H A;  4CS9 C;  5BQH A;  3HNJ A;  4PJM A;  5B3S C;  2KSF A;  4CDV A;  5F5F A;  1OXK A;  4PFO A;  1KNY A;  3T6J A;  4KI2 A;  3S0X A;  2AWY A;  3T6B A;  3J06 A;  3LNM B;  4G7Z F;  2RD9 A;  4BJ1 A;  1NG1 A;  2Y3D A;  2BL2 A;  2HKV A;  3OWT A;  1D0Y A;  2QY9 A;  2Y3B A;  3JZ0 A;  4JUR I;  3WAQ A;  3N0T A;  3ZWI A;  2IXP A;  4MQ9 F;  4EBB A;  1M2O A;  3ABK C;  1ZHT A;  3JT1 A;  3U3B A;  5E3C A;  4JTA B;  1RCP A;  5DS4 A;  4U9D A;  1RKE A;  2Y3G A;  1TFK B;  4XPW A;  4IRU A;  4AL0 A;  5DQZ A;  1Y4C A;  3FXH A;  3GEH A;  2KJG A;  3TOM A;  5A6B D;  2CNW A;  2XSE A;  3TK0 A;  2NG1 A;  3DM5 A;  3JCU Q;  3K1I C;  3KH2 A;  3LEO A;  1H7I A;  3LS1 A;  2D5R B;  2QE9 A;  3GAN A;  3MX3 A;  5L0C A;  1G5Z A;  2X51 A;  1XWJ A;  4JEB A;  4N06 A;  2QUP A;  1TWC A;  1MMD A;  4JW1 A;  5COG A;  4BJ5 A;  1HW1 A;  1UG7 A;  1FNT c;  2B0H A;  2AWC A;  1PD0 A;  2XS1 A;  3NKD A;  1U0B B;  2J46 A;  4J7Y A;  4WJ0 A;  1SMY F;  1FMV A;  1VB5 A;  3JYH A;  4PJJ A;  3I5Q A;  1D0X A;  3AJM A;  3GM2 A;  1ZHY A;  2A6E F;  1EI7 A;  1Q0K A;  3H2V A;  3MFN A;  3ZIB A;  1JOG A;  1ZYR F;  1FFH A;  2PFD A;  4YJW A;  1OCO C;  2XXA A;  1NBB A;  2R7T A;  2L6G A;  1NSG B;  3HLZ A;  3NDB B;  2R02 A;  2Q7R A;  3AG3 C;  5DS6 A;  4I3M A;  3U9M A;  3C18 A;  2ZXO A;  3TUL A;  1OW7 A;  3K6B A;  4W8K A;  2A1D D;  4YT2 A;  3O39 A;  1K40 A;  3AQB A;  1M56 C;  2GDC A;  4NY3 A;  4DBR A;  2R9R B;  3RW0 A;  1H9G A;  2J0W A;  4O79 A;  4XEF A;  2R7U A;  2ZD9 A;  2XL4 A;  2AP3 A;  2IBF A;  3K66 A;  3QVY A;  3MYF A;  1A7D A;  3VRC A;  3W2V A;  3C8G D;  4WGY A;  1J8M F;  3VM6 A;  3ZDL A;  1E2X A;  1T6U A;  4YT4 A;  2J9U A;  3TJ6 A;  1OKK A;  1TQG A;  4XEK A;  4DXW A;  2LCH A;  4CJG A;  2CGE A;  1JRA A;  5BUO A;  4PK4 A;  4X0R A;  1M2V A;  2F22 A;  4P9F A;  4IAO A;  3S28 A;  2UUI A;  2HSB A;  2R7R A;  1YYJ A;  1LI5 A;  1M57 C;  1YZA A;  2EPM X;  2J9W A;  2HS5 A;  2VCA A;  4BPM A;  3ABL C;  1SR2 A;  4JCZ A;  4OIO F;  2KC3 A;  5D92 A;  1JMW A;  1GGQ A;  2LFF A;  1M2V B;  2G3V A;  2JPU A;  3MLG A;  4OIN F;  2XLH A;  3DE9 A;  2WZF A;  4OIR F;  5L0F A;  2R7X A;  1HY5 A;  2J7P A;  3W8I A;  3EPV A;  3RFY A;  3O55 A;  3B0U X;  4U5E E;  1SZI A;  2HUJ A;  3UMI A;  1JR8 A;  1LKX A;  2LQG A;  1CPR A;  2LSE A;  2L7A A;  1OQC A;  1QVX A;  2VAS A;  3L0I A;  4CDY A;  3NMI A;  4DVY P;  1EQ1 A;  2XL6 A;  2QTV A;  1E84 A;  3LUT B;  3PMR A;  3SZR A;  3SNH A;  3B0V C;  3W4Y A;  3DD7 A;  1LI7 A;  3NYM A;  4CJO A;  3HJC A;  2R7W A;  2Q3T A;  3KYI A;  4JC7 A;  1S05 A;  1ZHZ A;  3NYJ A;  4U5B E;  1R4T A;  1DOV A;  4W8P A;  4MS2 A;  5DS5 A;  4AL1 A;  3LLI A;  1Y6D A;  4N6H A;  5KYU A;  4AX2 A;  3B29 A;  4LDR A;  1WOL A;  3VYW A;  4YT5 A;  3SXM A;  1AVO B;  3IPM O;  3AG2 C;  3ZC4 A;  1ST6 A;  3C7J A;  2VCB A;  5E3A A;  5KYU B;  4U5G A;  1CGN A;  1H6G A;  3N24 A;  4DVZ A;  4LER A;  3MYI A;  2WZL A;  3KPH A;  4DRH B;  1VK5 A;  2EIJ C;  3F46 A;  3FAP B;  4BEM J;  1E86 A;  5CI9 A;  2WVN A;  1VLS A;  4HEA J;  3QW1 A;  4CS8 C;  3X1O A;  3V5Z A;  1FAP B;  4LLE A;  3T9O A;  4QDL A;  1YA9 A;  1VLT A;  4MW3 A;  4BEJ A;  1PV3 A;  4E0H A;  1ZHW A;  3RVZ A;  1BBH A;  2XLO A;  2V26 A;  3FVY A;  3L8I A;  4MTG A;  1M6T A;  1ZW2 A;  1O87 A;  4MTO A;  1N1C A;  3H2U A;  3CZ6 A;  3IQT A;  3EH1 A;  1Z5Z A;  5DVW A;  3ABM C;  4G0H A;  1O3U A;  2EIL C;  3WHN A;  4XTK A;  4CX9 A;  1CPQ A;  1MMN A;  1SYQ A;  1V55 C;  3IQ5 A;  1OR3 A;  4GEH A;  2J0X A;  4DRI B;  5JS5 A;  1IZM A;  2OU6 A;  1QPU A;  3KKB A;  4AK9 A;  3BRJ A;  4JCH A; 
#chains in the Genus database with same CATH homology
 3C62 A;  4CIP A;  5JLI A;  3FOP A;  3ZQV A;  3IQ6 A;  3DE8 A;  1APC A;  5JSL A;  1QQ3 A;  1YYX A;  5JP7 A;  3ZTZ A;  1NBB A;  3NMK A;  5B3I A;  4EIY A;  4IAR A;  1E83 A;  2J8W A;  1YZC A;  4JE9 A;  4ULV A;  3ZQY A;  3HNK A;  4N4W A;  2YLI A;  1MQV A;  2XL8 A;  1QPU A;  3QVY A;  3VRC A;  2YLG A;  2XLM A;  3HNI A;  4WGY A;  3C63 A;  2BC5 A;  4CJG A;  1JAF A;  4D4N A;  1LM3 B;  4JEB A;  1YYJ A;  1YZA A;  2XM4 A;  5JUA A;  3M4B A;  2CCY A;  2XLH A;  3DE9 A;  5JVE A;  2XM0 A;  2YKZ A;  1CPR A;  1E85 A;  4CDY A;  3QW0 A;  4ER9 A;  3NMI A;  2XL6 A;  3TOL A;  1E84 A;  3ZTM A;  4JEA A;  3QVZ A;  5JRA A;  2J9B A;  2YL0 A;  2YL7 A;  4CJO A;  1EKY A;  3HNL A;  2YLD A;  3NMJ A;  1S05 A;  4CDA A;  2XLV A;  3M15 A;  4JKV A;  4U9E A;  4NC3 A;  5AGF A;  1GQA A;  4N6H A;  4IB4 A;  2YL1 A;  4D4X A;  4WGZ A;  3HNJ A;  2XLE A;  3M4C A;  1CGN A;  4CDV A;  3L1M A;  4IAQ A;  3U8P A;  1E86 A;  3QW1 A;  4L6R A;  3M79 A;  256B A;  3FOO A;  3ZWI A;  1A7V A;  2QLA A;  1BBH A;  2XLO A;  1RCP A;  4U9D A;  1M6T A;  1CGO A;  2YL3 A;  3TOM A;  2XLD A;  4CX9 A;  1CPQ A;  3IQ5 A;  5JS5 A;  5JT4 A;  2XLW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...