4JEAA

Crystal structure of an engineered zn-ridc1 construct with four interfacial disulfide bonds
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHDALHLANCGKVKEAQAAAEQLKCTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In Vitro and Cellular Self-Assembly of a Zn-Binding Protein Cryptand via Templated Disulfide Bonds.
pubmed doi rcsb
molecule keywords soluble cytochrome b562
molecule tags Electron transport
source organism Escherichia coli
total genus 46
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4jeaA00
1E84A 3M4BA 4U9EA 3DE9A 1E85A 3TOMA 3QW1A 4N6HA 4L6RA 2XLHA 1CGOA 1CPRA 3C62A 3IQ5A 4ER9A 1NBBA 3C63A 1MQVA 5JT4A 4WGYA 4NC3A 2XLWA 1CGNA 4CDVA 1YZCA 3HNKA 3M15A 5JP7A 1A7VA 4ULVA 2YL1A 3NMKA 4WGZA 256BA 4D4NA 3ZWIA 3TOLA 2YL0A 3L1MA 4JKVA 3M4CA 3QW0A 5JVEA 4CIPA 3DE8A 2XLDA 4EIYA 3ZQYA 3FOPA 4CDYA 3IQ6A 4IARA 2XLEA 2YL7A 4CJGA 2BC5A 1YYJA 3NMIA 5JUAA 2CCYA 3QVZA 2XM0A 3HNJA 4JE9A 2J8WA 2XLOA 3FOOA 4JEAA 3M79A 4U9DA 5B3IA 2XLVA 4IB4A 4JEBA 3ZQVA 3ZTZA 1E86A 4D4XA 1E83A 1M6TA 1BBHA 2YKZA 1YZAA 3HNLA 1JAFA 1QQ3A 4IAQA 2YL3A 2QLAA 5AGFA 3U8PA 3VRCA 3ZTMA 1RCPA 1S05A 4CX9A 2XL6A 1CPQA 5JLIA 5JSLA 3NMJA 1GQAA 2YLDA 2YLGA 3QVYA 3HNIA 2XLMA 2J9BA 1LM3B 4CDAA 2YLIA 1APCA 4N4WA 5JS5A 1EKYA 5JRAA 4CJOA 1QPUA 2XL8A 2XM4A 1YYXA
chains in the Genus database with same CATH superfamily
2VC9A 2NUTB 3M4BA 1JRAA 4U9EA 4O79A 2ETSA 4P6IC 5F28E 3EGXA 5TJ5E 2VASA 3BEHA 3C7JA 2OG2A 4L6RA 2XLHA 5BUOA 1CPRA 2R03A 3A11A 5FZTA 4ER9A 2Z15A 1HMOA 3JRTA 4YL0A 4AE4A 1NG1A 2UUHA 2AU5A 1W2WA 3GM3A 4Z9IA 1NFNA 3ZDLA 1LS4A 1HY5A 3AG1C 1JMWA 1J8MF 1ZHYA 2Q00A 4O7GA 1BR4A 1QLEC 1VYIA 1FNTc 3N0TA 1SF8A 1LS1A 2A6HF 3NYMA 3B29A 1Z7Qc 2H8AA 2HV6A 2XL4A 3EPVA 3QTHA 1RJ9B 2VCCA 4JZAA 3JRMO 3LS1A 2YL1A 4PJJA 1YDIA 4MVOA 2L81A 1QVXA 1ZZPA 2HUJA 3WODF 3ZWIA 4LDQA 3TD7A 1VK5A 1HE9A 2CW0F 2OOCA 3SEOA 1ZU4A 3TOLA 1RJ9A 1V54C 2L6GA 3L0IA 2OJQA 3QW0A 4KNWA 4MVSA 4CS9C 3EH2A 1Z23A 1V74B 1T5OA 2KC3A 3DE8A 1ZHWA 4MVZA 1OW7A 3T4RA 4EIYA 4U5BE 2YVKA 2ZXOA 4U5CE 3FOPA 3SXYA 3NKDA 1FR0A 1K40A 3IQ6A 3ASOC 4IARA 1BZ4A 1Y6DA 3B0UX 3PCVA 1J8YF 1ZVZA 1PD1A 3I5QA 3Q6MA 3IHUA 5DS4A 4U5DE 1WN0A 3H65A 1R4TA 1JPNA 1A7DA 4IGGA 1YYJA 1JPJA 1OW8A 4JTAB 1YLMA 3ATPA 4CIHA 3K7DA 2CCYA 3PHF2 4JJGA 1GM5A 3IQCA 1D1BA 2KYHA 2ZXWC 4P9FA 3GODA 2X0CA 4WABA 4A2NB 3DXJF 1TR2A 3HLZA 4E17A 4BJ1A 3FOOA 3DMDA 1ZHTA 1NFOA 5B3SC 1M56C 2W45A 2XLVA 5IY5C 3DKAA 3BRJA 3K1IC 4IB4A 4K7BA 4W8KA 1HW2A 5L3VA 3TJ5A 3V5XA 1M2OA 3U0CA 3MYIA 1FTSA 4U5HA 3RF3A 5A6JA 1QSPA 3EZIA 3JTLO 3LS0A 3ZTZA 5DQZA 3EHMA 3RFYA 3T6GB 2IYLD 3O10A 1A0BA 3FAPB 1EA8A 4OIOF 2WVQA 1F1MA 2PX0A 2TMVP 3RQGA 1WGWA 1M6TA 4DVYP 1M2VB 1VLTA 3KKBA 2L7AA 4JIOA 2HSQA 1BBHA 1A41A 1ORSC 1XZQA 2EPOA 2YKZA 3AOUA 2EILC 3DM5A 3JSEO 4C3EA 4E7SA 1SR2A 4DJ9A 1AEPA 1LIHA 2A68F 3C8GB 1G4WR 4OIQF 4CSAC 2XS8A 1IZMA 2GAQA 3EG9A 4NTBA 1S05A 3B0PA 1LE4A 1VLSA 1SMYF 2YQYA 3MYFA 2Q7RA 5KYUB 4CS9A 4EHPA 3KPHA 4CX9A 2XL6A 3L8JA 2JX0A 3ASNC 5JSLA 1WTYA 2OEXA 4ULWA 2YLGA 2J0WA 3X1OA 5CI9A 4BJTA 2XLMA 2J9BA 5F5HA 1MMGA 2VB6A 1LKXA 1RMVA 5DQTA 2W4MA 1SYQA 3UMHA 1I5NA 3DJUB 3S84A 3EJNA 5JS5A 2ZXPA 3GM2A 5BQHA 1MNEA 1H6GA 3GORA 1LPEA 2ASRA 3AG4C 3S28A 5HSWA 4PJNA 4C3BA 3RQEA 1Q0FA 2R7VA 2P61A 2R7UA 3ZSUA 3OEOA 2J9WA 4Z9JA 2B0HA 5L0HA 3AQBA 3K66A 3K1IA 3FVYA 1G8XA 4PJLA 1YA9A 4E0HA 3PDMP 3ABMC 5E33A 2RD9A 1CGOA 1FMWA 2Y39A 3FMSA 5L0GA 1UG7A 5L0FA 3KL4A 3H2VA 3LLKA 1MQVA 4DRJB 4OIPF 3GM1A 2PX3A 4MNDA 4AK9A 2XLWA 2J46A 3CAXA 4IJJA 3QMKA 3B0VC 1JR8A 2DB4A 2IBFA 4XPWA 3IPMO 1U6HA 1A7VA 1OCZC 2L9JA 4GYTA 1ZHZA 4WGZA 256BA 4CBEA 4KC9A 4D4NA 1MNDA 3EGXB 2J7PA 2CNWA 1PV3A 2YL0A 4JKVA 2DGJA 1TWHA 1HW1A 1H9GA 1R5ID 3AGTA 4PFPA 1UFBA 1OCRC 4AE4B 5KYXB 5COGA 4Q4ZF 2GDCA 2NUPA 2AP3A 1Q0DA 2NG1A 4LACB 3V5ZA 3VF0A 3I5PA 4H54A 2EINC 2KK1A 4F4BA 4HEAJ 3KYJA 2M4EA 4R32A 3WAQA 5KYXA 4G7HF 2H7OA 4ONSA 5CI8A 2YL7A 4CJGA 2R7TA 4NTFA 2V26A 2R7OA 1EKYA 4YT8A 2BC5A 2QUPA 3T9OA 3NMIA 3NG1A 4E18A 1OW6A 2HKVA 4JTDB 4KBLA 5JUAA 4QI2A 4FX5A 3O6XA 4LERA 4MW8A 3U2MA 2DI3A 3QVZA 4MS2A 1K04A 1RXQA 3G50A 2XM0A 4K1OA 4X0RA 3GEHA 5L0JA 3LNMB 4JE9A 3KH2A 1C17M 4JJFA 3C8GD 2XLOA 2YZSA 1TFOB 4J7YA 4BPMA 2R7WA 3TULA 3AJMA 4XPYA 1MMAA 1B68A 4JEAA 4U9DA 1OR3A 2PNOA 2DYSC 5B3IA 4HFKB 1G4US 2ICWG 2KNHA 2PBEA 5L0DA 2A1DD 4XLPF 4UDVA 3FDQA 4MW3A 1OR2A 4RD9A 1GGQA 3E9VA 4C7OB 2WZLA 1Q0GA 4B6IA 2QNLA 2R7XA 1TWCA 2A0UA 3K6BA 3U8VA 3U9JA 1Z3IX 3GEIA 4D4XA 2LP4A 2R9RB 1S7ZA 1VOMA 4C7OA 2F22A 2RSEB 1CGME 2FAPB 1YARO 5AC5A 1ZU5A 1H7IA 2NSFA 1M57C 1T6IA 5E3CA 3EQLF 2JPUA 3DJNB 2LIGA 3O55A 4IAQA 2YL3A 2QLAA 2AWCA 3FAJA 3C18A 5AGFA 1HE1A 4N06A 1RCPA 3OA1A 5JVEA 4JCHA 3S29A 3S90A 4YT5A 2OJED 3US6A 2IXOA 5L0IA 2OCCC 1YVIA 5COFA 4EUKB 4ANJA 2Q3TA 5JLIA 4AL0A 5D91A 3NMJA 5E3AA 2Q9CA 3VYWA 2YLDA 3QVYA 2I15A 4MVUA 1NU7D 4HFFB 4JRZA 3R7CA 3F46A 3SXMA 1T6QA 3ZG1A 3LLIA 4A4AA 1LM3B 1WOLA 4CDAA 1V55C 2J9UA 3POVA 3TQOA 3WHNA 2C04A 4PJMA 3UMKA 4PACA 2OKUA 2M64A 3EG9B 2KJGA 4IAOA 4JTCB 5DVWA 4DOZA 4DVZA 1BDJB 3DAFA 2WVNA 3LAYA 3MFNA 4XWJA 1QPUA 5JRAA 4KI2A 2XL8A 3SP1A 1HMDA 1YA7O 1I4ZA 1YYXA 2WL8A 1ST6A 3B71A 3RKOF 1LVKA 3GWNA 3SXZA 4BEJA 2VCAA 4QDLA 2D5RB 1LE2A 2Q4FA 2PF4E 4O6YA 3TOMA 2HZ8A 2G3VA 3PMRA 2ZPAA 1C02A 4N6HA 4E0IA 1OCCC 1Z5ZA 3CZ6A 3C62A 1QKRA 2IXPA 3IQTA 2EIMC 3IQ5A 2LFDA 2QTVA 1Y4CA 4PR9A 3C63A 2JD3A 2DYRC 4YN0B 4BJ6C 5JT4A 1D0XA 4LDKA 2EIKC 4WGYA 4NC3A 1RKCA 1AUEA 2EPNA 2LCHA 3WG7C 1AVOB 4AL1A 1YZCA 4CDVA 3LNRA 5KYYB 2IM8A 1O87A 2PP4A 2YRFA 4XPXA 4BG0A 2HJ3A 2CGEA 2EPKX 3JZ0A 4I1MA 5JP7A 2Y3HA 2HFIA 5D92A 3W4YA 3KMIA 4MVQA 1ZW3A 3K33A 4DBQA 1EQ1A 2NPUA 1KNYA 2BL2A 5KYYA 1Z63A 2A69F 3N24A 1MMNA 1TFKB 1L7CA 5B1BC 1I4YA 2PFDA 3C8ZA 2FGYA 3RW0A 3GEEA 2VH3A 2A6EF 3KYIA 4EKWA 2R7RA 1N1CA 3V7OA 1JOGA 2R02A 4XEKA 2XLDA 2GWWA 5T1DB 5CIVA 4OD5A 3SZRA 5K0IA 1K05A 1U0BB 4BEMJ 4E7ZA 4G0HA 2LD6A 2XRHA 1DOVA 2MWQA 4LDRA 2XLEA 1VMAA 2WZGA 4PK4A 1VTMP 3RVYA 1OXKA 2KGOA 2MHRA 1NLXA 1YAUO 1RKEB 2R7QA 2YWAA 3EGDB 3U5SA 3EFOB 3ZVRA 5L3QA 4Q5SF 2IOQA 3CEXA 3EZHA 3UGPA 2J8WA 3SYNA 3I4UA 2Y69C 3A9CA 2R7SA 2NUPB 1RKEA 3EGDA 2GA0A 2FFHA 4XLNF 1WATA 3EFOA 3MBGA 4BJ5A 3SNHA 4EWCA 4CS7A 3O39A 1L3PA 4JEBA 2D4UA 3HKKA 4YJWA 4N6CA 2H7VC 4BJ6A 3QZCA 2EPLX 3ZC4A 5EGYA 3JCUQ 3VAYA 1TKNA 4FAPB 3E70C 1E86A 3RVZA 2OEVA 2E87A 1E83A 4I44A 3LEVA 2J0XA 2G3KA 2NSGA 3R2PA 3ZIBA 5BQIA 1EI7A 1NZEA 4XEFA 3W2WA 4OINF 2HS5A 1YZAA 3S27A 4WJ0A 1GS9A 3CQZA 1KTMA 2OQMA 3K1HA 4H4KC 1QQ3A 5T3TA 5DS6A 2IXNA 3U8PA 5GPGB 3ZTMA 3Q7GA 4U5GA 5EHHA 2V3CC 2HMZA 1FMVA 2ZD9A 1Q0MA 4P9TA 4NTAA 3M1CB 1BR1A 1CPQA 2AVKA 4J30B 1ZW2A 2NUTA 1Q0KA 2G62A 2Y3GA 4MTFA 4C3DA 2Q9AA 1GQAA 4RBNA 3J06A 4JVSA 2XXAB 3W2VA 3W8HA 4IRUA 3H2UA 5A6BA 1OQCA 3JYYA 3UR3C 1QZXA 3ABKC 4O6NA 3T6JA 1OKKA 3ITFA 2YLIA 1ORYA 4N4WA 4G7OF 2XXAA 1D0YA 3NKEA 2QE9A 4NY3A 2O9XA 3LESA 2KW3C 4CJOA 1WASA 2LQGA 4I3MA 3NYJA 4OIRF 2XM4A 4PFOA 3DAGA 5B1AC 3NRHA 3V5YA 3HTKC 1DOWA 1E84A 4W8PA 1NSGB 3DE9A 2CDQA 4ZLCA 1E85A 3DD7A 3G4XA 5KYNA 5HV9A 3QW1A 1H9TA 3AQCA 4M63A 3EHNA 3GWLA 4GQHA 3N2ZB 3GANA 4AX2A 1NBBA 1T6UA 4EBKA 3JT1A 3L34A 1NU9C 4CS8C 1ORJA 2HSBA 4NCQA 5E2QA 1CGNA 1XWJA 2BE5F 2P6VA 4J7TA 3F47A 4MQ9F 3HNKA 1WWPA 1U89A 3U9MA 4XTKA 4RDAA 5T3WA 5A6KA 4I1OB 3M15A 5A69A 3U2LA 2WZFA 1PCXA 2J7PD 2CNWD 2LK4A 4ULVA 3NMKA 3DWWA 1C03A 3DZAA 4DBRA 3JSZA 1MMDA 4MVRA 4LLCA 1A7EA 2EPMX 2I8BA 3JYHA 3OWTA 4Q7CA 3L1MA 2KQ9A 4YL3A 1VYKA 3M4CA 4YWQA 4CIPA 1TWGA 5BQGA 3CSKA 4BJ5C 4DRHB 3MLGA 4DRIB 1D0ZA 4JCZA 4EBJA 3DM9B 2R05A 1PD0A 2Y3BA 3ZQYA 2P7VA 2C03A 4CDYA 2QY9A 3S9OA 5F5FA 4MTOA 2L6HA 3U3FA 4Z9HA 1E2XA 2AWYA 5DLJA 1D1AA 1O3UA 4YT2A 3MX3A 3FHDA 3TK0A 3Q7LA 4MVMA 2XSEA 1LI7A 2WB7A 5COMA 3RQFA 4DXWA 1IW7F 1KU2A 4FWVA 4U5FE 3UMIA 1T01A 3HNJA 2B0JA 1M2VA 2KSFA 2Q9BA 4JURI 3VM6A 3RYLA 1TQGA 5L0CA 3M79A 3NYLA 4O6MA 2A0BA 3X2QC 5DS5A 3C8GA 3RIPA 3B9QA 3ZQVA 2W9YA 2P1AA 4IWBA 3SXKA 1VB5A 2J45A 2XS1A 5KYUA 3LEOA 3U3BA 2L6FA 5A6BD 2P0NA 1O5HA 4CS8A 3AG3C 1OKKD 4XQ1A 3T6BA 2HJMA 2W4BA 1ZHXA 3L8IA 4KNVA 4JW1A 4K0DA 5EK0A 5KYWB 1BR2A 1V4AA 4YK5A 4G78A 1OCOC 4U5EE 3NDBB 3AGUA 3HNLA 1JAFA 2YEVA 1ZYRF 1FFTC 1TWAA 2CYDA 4J32B 3EH1A 3VRCA 5KYWA 2WVOA 2IXMA 2OU6A 1YJGA 1OXBA 1XZPA 4XEVA 2HV7A 3S0XA 2VCBA 2MYSA 1D1CA 2X51A 4YL1A 3UGOA 1FAPB 1FFHA 3IEEA 4HE8D 4OD4A 4EBBA 4G7ZF 3W8IA 4LLEA 3HJCA 3HNIA 4NQFA 4ZLDA 2EIJC 1T9KA 2LFFA 3AG2C 4JC7A 3ECSA 4GEHA 2ZXRA 5FCLA 2GFHA 2H7BA 2J9VA 2YHSA 3LUTB 3UNGC 5AC4A 1SZIA 3FXHA 4FESA 1Z6AA 1G5ZA 3RH3A 1APCA 1LI5A 4MTGA 2Y3DA 3LJBA 2R25A 2HMQA 3TJ6A 4YT4A 4CSAA 3DI5A 2UUIA 3ABLC 3G4ZA 4QI0A 5A6AA 2LSEA 3Q6NA
chains in the Genus database with same CATH topology
1E84A 3M4BA 4U9EA 3DE9A 1E85A 3TOMA 3QW1A 4N6HA 4L6RA 2XLHA 1CGOA 1CPRA 3C62A 3IQ5A 4ER9A 1NBBA 3C63A 1MQVA 5JT4A 4WGYA 4NC3A 2XLWA 1CGNA 4CDVA 1YZCA 3HNKA 3M15A 5JP7A 1A7VA 4ULVA 2YL1A 3NMKA 4WGZA 256BA 4D4NA 3ZWIA 3TOLA 2YL0A 3L1MA 4JKVA 3M4CA 3QW0A 5JVEA 4CIPA 3DE8A 2XLDA 4EIYA 3ZQYA 3FOPA 4CDYA 3IQ6A 4IARA 2XLEA 2YL7A 4CJGA 2BC5A 1YYJA 3NMIA 5JUAA 2CCYA 3QVZA 2XM0A 3HNJA 4JE9A 2J8WA 2XLOA 3FOOA 4JEAA 3M79A 4U9DA 5B3IA 2XLVA 4IB4A 4JEBA 3ZQVA 3ZTZA 1E86A 4D4XA 1E83A 1M6TA 1BBHA 2YKZA 1YZAA 3HNLA 1JAFA 1QQ3A 4IAQA 2YL3A 2QLAA 5AGFA 3U8PA 3VRCA 3ZTMA 1RCPA 1S05A 4CX9A 2XL6A 1CPQA 5JLIA 5JSLA 3NMJA 1GQAA 2YLDA 2YLGA 3QVYA 3HNIA 2XLMA 2J9BA 1LM3B 4CDAA 2YLIA 1APCA 4N4WA 5JS5A 1EKYA 5JRAA 4CJOA 1QPUA 2XL8A 2XM4A 1YYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E84 A;  3M4B A;  4U9E A;  3DE9 A;  1E85 A;  3TOM A;  3QW1 A;  4N6H A;  4L6R A;  2XLH A;  1CGO A;  1CPR A;  3C62 A;  3IQ5 A;  4ER9 A;  1NBB A;  3C63 A;  1MQV A;  5JT4 A;  4WGY A;  4NC3 A;  2XLW A;  1CGN A;  4CDV A;  1YZC A;  3HNK A;  3M15 A;  5JP7 A;  1A7V A;  4ULV A;  2YL1 A;  3NMK A;  4WGZ A;  256B A;  4D4N A;  3ZWI A;  3TOL A;  2YL0 A;  3L1M A;  4JKV A;  3M4C A;  3QW0 A;  5JVE A;  4CIP A;  3DE8 A;  2XLD A;  4EIY A;  3ZQY A;  3FOP A;  4CDY A;  3IQ6 A;  4IAR A;  2XLE A;  2YL7 A;  4CJG A;  2BC5 A;  1YYJ A;  3NMI A;  5JUA A;  2CCY A;  3QVZ A;  2XM0 A;  3HNJ A;  4JE9 A;  2J8W A;  2XLO A;  3FOO A;  4JEA A;  3M79 A;  4U9D A;  5B3I A;  2XLV A;  4IB4 A;  4JEB A;  3ZQV A;  3ZTZ A;  1E86 A;  4D4X A;  1E83 A;  1M6T A;  1BBH A;  2YKZ A;  1YZA A;  3HNL A;  1JAF A;  1QQ3 A;  4IAQ A;  2YL3 A;  2QLA A;  5AGF A;  3U8P A;  3VRC A;  3ZTM A;  1RCP A;  1S05 A;  4CX9 A;  2XL6 A;  1CPQ A;  5JLI A;  5JSL A;  3NMJ A;  1GQA A;  2YLD A;  2YLG A;  3QVY A;  3HNI A;  2XLM A;  2J9B A;  1LM3 B;  4CDA A;  2YLI A;  1APC A;  4N4W A;  5JS5 A;  1EKY A;  5JRA A;  4CJO A;  1QPU A;  2XL8 A;  2XM4 A;  1YYX A; 
#chains in the Genus database with same CATH topology
 2VC9 A;  2NUT B;  3M4B A;  1JRA A;  4U9E A;  4O79 A;  2ETS A;  4P6I C;  5F28 E;  3EGX A;  5TJ5 E;  2VAS A;  3BEH A;  3C7J A;  2OG2 A;  4L6R A;  2XLH A;  5BUO A;  1CPR A;  2R03 A;  3A11 A;  5FZT A;  4ER9 A;  2Z15 A;  1HMO A;  3JRT A;  4YL0 A;  4AE4 A;  1NG1 A;  2UUH A;  2AU5 A;  1W2W A;  3GM3 A;  4Z9I A;  1NFN A;  3ZDL A;  1LS4 A;  1HY5 A;  3AG1 C;  1JMW A;  1J8M F;  1ZHY A;  2Q00 A;  4O7G A;  1BR4 A;  1QLE C;  1VYI A;  1FNT c;  3N0T A;  1SF8 A;  1LS1 A;  2A6H F;  3NYM A;  3B29 A;  1Z7Q c;  2H8A A;  2HV6 A;  2XL4 A;  3EPV A;  3QTH A;  1RJ9 B;  2VCC A;  4JZA A;  3JRM O;  3LS1 A;  2YL1 A;  4PJJ A;  1YDI A;  4MVO A;  2L81 A;  1QVX A;  1ZZP A;  2HUJ A;  3WOD F;  3ZWI A;  4LDQ A;  3TD7 A;  1VK5 A;  1HE9 A;  2CW0 F;  2OOC A;  3SEO A;  1ZU4 A;  3TOL A;  1RJ9 A;  1V54 C;  2L6G A;  3L0I A;  2OJQ A;  3QW0 A;  4KNW A;  4MVS A;  4CS9 C;  3EH2 A;  1Z23 A;  1V74 B;  1T5O A;  2KC3 A;  3DE8 A;  1ZHW A;  4MVZ A;  1OW7 A;  3T4R A;  4EIY A;  4U5B E;  2YVK A;  2ZXO A;  4U5C E;  3FOP A;  3SXY A;  3NKD A;  1FR0 A;  1K40 A;  3IQ6 A;  3ASO C;  4IAR A;  1BZ4 A;  1Y6D A;  3B0U X;  3PCV A;  1J8Y F;  1ZVZ A;  1PD1 A;  3I5Q A;  3Q6M A;  3IHU A;  5DS4 A;  4U5D E;  1WN0 A;  3H65 A;  1R4T A;  1JPN A;  1A7D A;  4IGG A;  1YYJ A;  1JPJ A;  1OW8 A;  4JTA B;  1YLM A;  3ATP A;  4CIH A;  3K7D A;  2CCY A;  3PHF 2;  4JJG A;  1GM5 A;  3IQC A;  1D1B A;  2KYH A;  2ZXW C;  4P9F A;  3GOD A;  2X0C A;  4WAB A;  4A2N B;  3DXJ F;  1TR2 A;  3HLZ A;  4E17 A;  4BJ1 A;  3FOO A;  3DMD A;  1ZHT A;  1NFO A;  5B3S C;  1M56 C;  2W45 A;  2XLV A;  5IY5 C;  3DKA A;  3BRJ A;  3K1I C;  4IB4 A;  4K7B A;  4W8K A;  1HW2 A;  5L3V A;  3TJ5 A;  3V5X A;  1M2O A;  3U0C A;  3MYI A;  1FTS A;  4U5H A;  3RF3 A;  5A6J A;  1QSP A;  3EZI A;  3JTL O;  3LS0 A;  3ZTZ A;  5DQZ A;  3EHM A;  3RFY A;  3T6G B;  2IYL D;  3O10 A;  1A0B A;  3FAP B;  1EA8 A;  4OIO F;  2WVQ A;  1F1M A;  2PX0 A;  2TMV P;  3RQG A;  1WGW A;  1M6T A;  4DVY P;  1M2V B;  1VLT A;  3KKB A;  2L7A A;  4JIO A;  2HSQ A;  1BBH A;  1A41 A;  1ORS C;  1XZQ A;  2EPO A;  2YKZ A;  3AOU A;  2EIL C;  3DM5 A;  3JSE O;  4C3E A;  4E7S A;  1SR2 A;  4DJ9 A;  1AEP A;  1LIH A;  2A68 F;  3C8G B;  1G4W R;  4OIQ F;  4CSA C;  2XS8 A;  1IZM A;  2GAQ A;  3EG9 A;  4NTB A;  1S05 A;  3B0P A;  1LE4 A;  1VLS A;  1SMY F;  2YQY A;  3MYF A;  2Q7R A;  5KYU B;  4CS9 A;  4EHP A;  3KPH A;  4CX9 A;  2XL6 A;  3L8J A;  2JX0 A;  3ASN C;  5JSL A;  1WTY A;  2OEX A;  4ULW A;  2YLG A;  2J0W A;  3X1O A;  5CI9 A;  4BJT A;  2XLM A;  2J9B A;  5F5H A;  1MMG A;  2VB6 A;  1LKX A;  1RMV A;  5DQT A;  2W4M A;  1SYQ A;  3UMH A;  1I5N A;  3DJU B;  3S84 A;  3EJN A;  5JS5 A;  2ZXP A;  3GM2 A;  5BQH A;  1MNE A;  1H6G A;  3GOR A;  1LPE A;  2ASR A;  3AG4 C;  3S28 A;  5HSW A;  4PJN A;  4C3B A;  3RQE A;  1Q0F A;  2R7V A;  2P61 A;  2R7U A;  3ZSU A;  3OEO A;  2J9W A;  4Z9J A;  2B0H A;  5L0H A;  3AQB A;  3K66 A;  3K1I A;  3FVY A;  1G8X A;  4PJL A;  1YA9 A;  4E0H A;  3PDM P;  3ABM C;  5E33 A;  2RD9 A;  1CGO A;  1FMW A;  2Y39 A;  3FMS A;  5L0G A;  1UG7 A;  5L0F A;  3KL4 A;  3H2V A;  3LLK A;  1MQV A;  4DRJ B;  4OIP F;  3GM1 A;  2PX3 A;  4MND A;  4AK9 A;  2XLW A;  2J46 A;  3CAX A;  4IJJ A;  3QMK A;  3B0V C;  1JR8 A;  2DB4 A;  2IBF A;  4XPW A;  3IPM O;  1U6H A;  1A7V A;  1OCZ C;  2L9J A;  4GYT A;  1ZHZ A;  4WGZ A;  256B A;  4CBE A;  4KC9 A;  4D4N A;  1MND A;  3EGX B;  2J7P A;  2CNW A;  1PV3 A;  2YL0 A;  4JKV A;  2DGJ A;  1TWH A;  1HW1 A;  1H9G A;  1R5I D;  3AGT A;  4PFP A;  1UFB A;  1OCR C;  4AE4 B;  5KYX B;  5COG A;  4Q4Z F;  2GDC A;  2NUP A;  2AP3 A;  1Q0D A;  2NG1 A;  4LAC B;  3V5Z A;  3VF0 A;  3I5P A;  4H54 A;  2EIN C;  2KK1 A;  4F4B A;  4HEA J;  3KYJ A;  2M4E A;  4R32 A;  3WAQ A;  5KYX A;  4G7H F;  2H7O A;  4ONS A;  5CI8 A;  2YL7 A;  4CJG A;  2R7T A;  4NTF A;  2V26 A;  2R7O A;  1EKY A;  4YT8 A;  2BC5 A;  2QUP A;  3T9O A;  3NMI A;  3NG1 A;  4E18 A;  1OW6 A;  2HKV A;  4JTD B;  4KBL A;  5JUA A;  4QI2 A;  4FX5 A;  3O6X A;  4LER A;  4MW8 A;  3U2M A;  2DI3 A;  3QVZ A;  4MS2 A;  1K04 A;  1RXQ A;  3G50 A;  2XM0 A;  4K1O A;  4X0R A;  3GEH A;  5L0J A;  3LNM B;  4JE9 A;  3KH2 A;  1C17 M;  4JJF A;  3C8G D;  2XLO A;  2YZS A;  1TFO B;  4J7Y A;  4BPM A;  2R7W A;  3TUL A;  3AJM A;  4XPY A;  1MMA A;  1B68 A;  4JEA A;  4U9D A;  1OR3 A;  2PNO A;  2DYS C;  5B3I A;  4HFK B;  1G4U S;  2ICW G;  2KNH A;  2PBE A;  5L0D A;  2A1D D;  4XLP F;  4UDV A;  3FDQ A;  4MW3 A;  1OR2 A;  4RD9 A;  1GGQ A;  3E9V A;  4C7O B;  2WZL A;  1Q0G A;  4B6I A;  2QNL A;  2R7X A;  1TWC A;  2A0U A;  3K6B A;  3U8V A;  3U9J A;  1Z3I X;  3GEI A;  4D4X A;  2LP4 A;  2R9R B;  1S7Z A;  1VOM A;  4C7O A;  2F22 A;  2RSE B;  1CGM E;  2FAP B;  1YAR O;  5AC5 A;  1ZU5 A;  1H7I A;  2NSF A;  1M57 C;  1T6I A;  5E3C A;  3EQL F;  2JPU A;  3DJN B;  2LIG A;  3O55 A;  4IAQ A;  2YL3 A;  2QLA A;  2AWC A;  3FAJ A;  3C18 A;  5AGF A;  1HE1 A;  4N06 A;  1RCP A;  3OA1 A;  5JVE A;  4JCH A;  3S29 A;  3S90 A;  4YT5 A;  2OJE D;  3US6 A;  2IXO A;  5L0I A;  2OCC C;  1YVI A;  5COF A;  4EUK B;  4ANJ A;  2Q3T A;  5JLI A;  4AL0 A;  5D91 A;  3NMJ A;  5E3A A;  2Q9C A;  3VYW A;  2YLD A;  3QVY A;  2I15 A;  4MVU A;  1NU7 D;  4HFF B;  4JRZ A;  3R7C A;  3F46 A;  3SXM A;  1T6Q A;  3ZG1 A;  3LLI A;  4A4A A;  1LM3 B;  1WOL A;  4CDA A;  1V55 C;  2J9U A;  3POV A;  3TQO A;  3WHN A;  2C04 A;  4PJM A;  3UMK A;  4PAC A;  2OKU A;  2M64 A;  3EG9 B;  2KJG A;  4IAO A;  4JTC B;  5DVW A;  4DOZ A;  4DVZ A;  1BDJ B;  3DAF A;  2WVN A;  3LAY A;  3MFN A;  4XWJ A;  1QPU A;  5JRA A;  4KI2 A;  2XL8 A;  3SP1 A;  1HMD A;  1YA7 O;  1I4Z A;  1YYX A;  2WL8 A;  1ST6 A;  3B71 A;  3RKO F;  1LVK A;  3GWN A;  3SXZ A;  4BEJ A;  2VCA A;  4QDL A;  2D5R B;  1LE2 A;  2Q4F A;  2PF4 E;  4O6Y A;  3TOM A;  2HZ8 A;  2G3V A;  3PMR A;  2ZPA A;  1C02 A;  4N6H A;  4E0I A;  1OCC C;  1Z5Z A;  3CZ6 A;  3C62 A;  1QKR A;  2IXP A;  3IQT A;  2EIM C;  3IQ5 A;  2LFD A;  2QTV A;  1Y4C A;  4PR9 A;  3C63 A;  2JD3 A;  2DYR C;  4YN0 B;  4BJ6 C;  5JT4 A;  1D0X A;  4LDK A;  2EIK C;  4WGY A;  4NC3 A;  1RKC A;  1AUE A;  2EPN A;  2LCH A;  3WG7 C;  1AVO B;  4AL1 A;  1YZC A;  4CDV A;  3LNR A;  5KYY B;  2IM8 A;  1O87 A;  2PP4 A;  2YRF A;  4XPX A;  4BG0 A;  2HJ3 A;  2CGE A;  2EPK X;  3JZ0 A;  4I1M A;  5JP7 A;  2Y3H A;  2HFI A;  5D92 A;  3W4Y A;  3KMI A;  4MVQ A;  1ZW3 A;  3K33 A;  4DBQ A;  1EQ1 A;  2NPU A;  1KNY A;  2BL2 A;  5KYY A;  1Z63 A;  2A69 F;  3N24 A;  1MMN A;  1TFK B;  1L7C A;  5B1B C;  1I4Y A;  2PFD A;  3C8Z A;  2FGY A;  3RW0 A;  3GEE A;  2VH3 A;  2A6E F;  3KYI A;  4EKW A;  2R7R A;  1N1C A;  3V7O A;  1JOG A;  2R02 A;  4XEK A;  2XLD A;  2GWW A;  5T1D B;  5CIV A;  4OD5 A;  3SZR A;  5K0I A;  1K05 A;  1U0B B;  4BEM J;  4E7Z A;  4G0H A;  2LD6 A;  2XRH A;  1DOV A;  2MWQ A;  4LDR A;  2XLE A;  1VMA A;  2WZG A;  4PK4 A;  1VTM P;  3RVY A;  1OXK A;  2KGO A;  2MHR A;  1NLX A;  1YAU O;  1RKE B;  2R7Q A;  2YWA A;  3EGD B;  3U5S A;  3EFO B;  3ZVR A;  5L3Q A;  4Q5S F;  2IOQ A;  3CEX A;  3EZH A;  3UGP A;  2J8W A;  3SYN A;  3I4U A;  2Y69 C;  3A9C A;  2R7S A;  2NUP B;  1RKE A;  3EGD A;  2GA0 A;  2FFH A;  4XLN F;  1WAT A;  3EFO A;  3MBG A;  4BJ5 A;  3SNH A;  4EWC A;  4CS7 A;  3O39 A;  1L3P A;  4JEB A;  2D4U A;  3HKK A;  4YJW A;  4N6C A;  2H7V C;  4BJ6 A;  3QZC A;  2EPL X;  3ZC4 A;  5EGY A;  3JCU Q;  3VAY A;  1TKN A;  4FAP B;  3E70 C;  1E86 A;  3RVZ A;  2OEV A;  2E87 A;  1E83 A;  4I44 A;  3LEV A;  2J0X A;  2G3K A;  2NSG A;  3R2P A;  3ZIB A;  5BQI A;  1EI7 A;  1NZE A;  4XEF A;  3W2W A;  4OIN F;  2HS5 A;  1YZA A;  3S27 A;  4WJ0 A;  1GS9 A;  3CQZ A;  1KTM A;  2OQM A;  3K1H A;  4H4K C;  1QQ3 A;  5T3T A;  5DS6 A;  2IXN A;  3U8P A;  5GPG B;  3ZTM A;  3Q7G A;  4U5G A;  5EHH A;  2V3C C;  2HMZ A;  1FMV A;  2ZD9 A;  1Q0M A;  4P9T A;  4NTA A;  3M1C B;  1BR1 A;  1CPQ A;  2AVK A;  4J30 B;  1ZW2 A;  2NUT A;  1Q0K A;  2G62 A;  2Y3G A;  4MTF A;  4C3D A;  2Q9A A;  1GQA A;  4RBN A;  3J06 A;  4JVS A;  2XXA B;  3W2V A;  3W8H A;  4IRU A;  3H2U A;  5A6B A;  1OQC A;  3JYY A;  3UR3 C;  1QZX A;  3ABK C;  4O6N A;  3T6J A;  1OKK A;  3ITF A;  2YLI A;  1ORY A;  4N4W A;  4G7O F;  2XXA A;  1D0Y A;  3NKE A;  2QE9 A;  4NY3 A;  2O9X A;  3LES A;  2KW3 C;  4CJO A;  1WAS A;  2LQG A;  4I3M A;  3NYJ A;  4OIR F;  2XM4 A;  4PFO A;  3DAG A;  5B1A C;  3NRH A;  3V5Y A;  3HTK C;  1DOW A;  1E84 A;  4W8P A;  1NSG B;  3DE9 A;  2CDQ A;  4ZLC A;  1E85 A;  3DD7 A;  3G4X A;  5KYN A;  5HV9 A;  3QW1 A;  1H9T A;  3AQC A;  4M63 A;  3EHN A;  3GWL A;  4GQH A;  3N2Z B;  3GAN A;  4AX2 A;  1NBB A;  1T6U A;  4EBK A;  3JT1 A;  3L34 A;  1NU9 C;  4CS8 C;  1ORJ A;  2HSB A;  4NCQ A;  5E2Q A;  1CGN A;  1XWJ A;  2BE5 F;  2P6V A;  4J7T A;  3F47 A;  4MQ9 F;  3HNK A;  1WWP A;  1U89 A;  3U9M A;  4XTK A;  4RDA A;  5T3W A;  5A6K A;  4I1O B;  3M15 A;  5A69 A;  3U2L A;  2WZF A;  1PCX A;  2J7P D;  2CNW D;  2LK4 A;  4ULV A;  3NMK A;  3DWW A;  1C03 A;  3DZA A;  4DBR A;  3JSZ A;  1MMD A;  4MVR A;  4LLC A;  1A7E A;  2EPM X;  2I8B A;  3JYH A;  3OWT A;  4Q7C A;  3L1M A;  2KQ9 A;  4YL3 A;  1VYK A;  3M4C A;  4YWQ A;  4CIP A;  1TWG A;  5BQG A;  3CSK A;  4BJ5 C;  4DRH B;  3MLG A;  4DRI B;  1D0Z A;  4JCZ A;  4EBJ A;  3DM9 B;  2R05 A;  1PD0 A;  2Y3B A;  3ZQY A;  2P7V A;  2C03 A;  4CDY A;  2QY9 A;  3S9O A;  5F5F A;  4MTO A;  2L6H A;  3U3F A;  4Z9H A;  1E2X A;  2AWY A;  5DLJ A;  1D1A A;  1O3U A;  4YT2 A;  3MX3 A;  3FHD A;  3TK0 A;  3Q7L A;  4MVM A;  2XSE A;  1LI7 A;  2WB7 A;  5COM A;  3RQF A;  4DXW A;  1IW7 F;  1KU2 A;  4FWV A;  4U5F E;  3UMI A;  1T01 A;  3HNJ A;  2B0J A;  1M2V A;  2KSF A;  2Q9B A;  4JUR I;  3VM6 A;  3RYL A;  1TQG A;  5L0C A;  3M79 A;  3NYL A;  4O6M A;  2A0B A;  3X2Q C;  5DS5 A;  3C8G A;  3RIP A;  3B9Q A;  3ZQV A;  2W9Y A;  2P1A A;  4IWB A;  3SXK A;  1VB5 A;  2J45 A;  2XS1 A;  5KYU A;  3LEO A;  3U3B A;  2L6F A;  5A6B D;  2P0N A;  1O5H A;  4CS8 A;  3AG3 C;  1OKK D;  4XQ1 A;  3T6B A;  2HJM A;  2W4B A;  1ZHX A;  3L8I A;  4KNV A;  4JW1 A;  4K0D A;  5EK0 A;  5KYW B;  1BR2 A;  1V4A A;  4YK5 A;  4G78 A;  1OCO C;  4U5E E;  3NDB B;  3AGU A;  3HNL A;  1JAF A;  2YEV A;  1ZYR F;  1FFT C;  1TWA A;  2CYD A;  4J32 B;  3EH1 A;  3VRC A;  5KYW A;  2WVO A;  2IXM A;  2OU6 A;  1YJG A;  1OXB A;  1XZP A;  4XEV A;  2HV7 A;  3S0X A;  2VCB A;  2MYS A;  1D1C A;  2X51 A;  4YL1 A;  3UGO A;  1FAP B;  1FFH A;  3IEE A;  4HE8 D;  4OD4 A;  4EBB A;  4G7Z F;  3W8I A;  4LLE A;  3HJC A;  3HNI A;  4NQF A;  4ZLD A;  2EIJ C;  1T9K A;  2LFF A;  3AG2 C;  4JC7 A;  3ECS A;  4GEH A;  2ZXR A;  5FCL A;  2GFH A;  2H7B A;  2J9V A;  2YHS A;  3LUT B;  3UNG C;  5AC4 A;  1SZI A;  3FXH A;  4FES A;  1Z6A A;  1G5Z A;  3RH3 A;  1APC A;  1LI5 A;  4MTG A;  2Y3D A;  3LJB A;  2R25 A;  2HMQ A;  3TJ6 A;  4YT4 A;  4CSA A;  3DI5 A;  2UUI A;  3ABL C;  3G4Z A;  4QI0 A;  5A6A A;  2LSE A;  3Q6N A; 
#chains in the Genus database with same CATH homology
 1E84 A;  3M4B A;  4U9E A;  3DE9 A;  1E85 A;  3TOM A;  3QW1 A;  4N6H A;  4L6R A;  2XLH A;  1CGO A;  1CPR A;  3C62 A;  3IQ5 A;  4ER9 A;  1NBB A;  3C63 A;  1MQV A;  5JT4 A;  4WGY A;  4NC3 A;  2XLW A;  1CGN A;  4CDV A;  1YZC A;  3HNK A;  3M15 A;  5JP7 A;  1A7V A;  4ULV A;  2YL1 A;  3NMK A;  4WGZ A;  256B A;  4D4N A;  3ZWI A;  3TOL A;  2YL0 A;  3L1M A;  4JKV A;  3M4C A;  3QW0 A;  5JVE A;  4CIP A;  3DE8 A;  2XLD A;  4EIY A;  3ZQY A;  3FOP A;  4CDY A;  3IQ6 A;  4IAR A;  2XLE A;  2YL7 A;  4CJG A;  2BC5 A;  1YYJ A;  3NMI A;  5JUA A;  2CCY A;  3QVZ A;  2XM0 A;  3HNJ A;  4JE9 A;  2J8W A;  2XLO A;  3FOO A;  4JEA A;  3M79 A;  4U9D A;  5B3I A;  2XLV A;  4IB4 A;  4JEB A;  3ZQV A;  3ZTZ A;  1E86 A;  4D4X A;  1E83 A;  1M6T A;  1BBH A;  2YKZ A;  1YZA A;  3HNL A;  1JAF A;  1QQ3 A;  4IAQ A;  2YL3 A;  2QLA A;  5AGF A;  3U8P A;  3VRC A;  3ZTM A;  1RCP A;  1S05 A;  4CX9 A;  2XL6 A;  1CPQ A;  5JLI A;  5JSL A;  3NMJ A;  1GQA A;  2YLD A;  2YLG A;  3QVY A;  3HNI A;  2XLM A;  2J9B A;  1LM3 B;  4CDA A;  2YLI A;  1APC A;  4N4W A;  5JS5 A;  1EKY A;  5JRA A;  4CJO A;  1QPU A;  2XL8 A;  2XM4 A;  1YYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...