4JEAA

Crystal structure of an engineered zn-ridc1 construct with four interfacial disulfide bonds
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHDALHLANCGKVKEAQAAAEQLKCTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords soluble cytochrome b562
publication title In Vitro and Cellular Self-Assembly of a Zn-Binding Protein Cryptand via Templated Disulfide Bonds.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 46
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4jeaA00
2YL3A 2XM4A 3HNJA 1YZAA 2J8WA 3HNKA 3L1MA 1APCA 2XLDA 2CCYA 3C63A 3QVZA 3QVYA 3ZTZA 5JLIA 1YYJA 1LM3B 4WGYA 5JVEA 5JS5A 2BC5A 1CGOA 3NMKA 2XL6A 3ZQVA 3IQ5A 2YKZA 2YLDA 2XLVA 2QLAA 3NMJA 2YL0A 3FOPA 4N4WA 1QQ3A 4CJGA 3C62A 5JRAA 1A7VA 4CX9A 5JT4A 4JKVA 2YL1A 4JEBA 4JEAA 1GQAA 4U9EA 2J9BA 2XLMA 3TOMA 3QW1A 1E83A 4CJOA 2XLWA 1YYXA 2XLHA 3VRCA 4WGZA 3FOOA 1QPUA 2XL8A 1JAFA 1CGNA 3HNLA 3ZWIA 4CDAA 1E86A 1S05A 2XLOA 4JE9A 3NMIA 4ER9A 1RCPA 4D4XA 256BA 4U9DA 5JP7A 1CPQA 3U8PA 4CDVA 4L6RA 1E84A 5JSLA 1YZCA 3ZQYA 4EIYA 3DE8A 2YL7A 3ZTMA 1CPRA 4CDYA 1EKYA 2XM0A 4NC3A 1E85A 4CIPA 4IARA 5JUAA 3M4BA 2YLIA 4ULVA 5B3IA 3M15A 1M6TA 1BBHA 3QW0A 1MQVA 3DE9A 3M79A 4N6HA 4IB4A 3IQ6A 2YLGA 4D4NA 5AGFA 3HNIA 3M4CA 4IAQA 3TOLA 1NBBA 2XLEA
chains in the Genus database with same CATH superfamily
1I4ZA 2ICWG 2MWQA 3HNJA 3TULA 2DGJA 5A6BD 4U5GA 3RQFA 3EJNA 3N0TA 3S9OA 1TFKB 3RF3A 4BJ5C 1OXKA 4JTDB 1ZHWA 3T6BA 2CCYA 2VCBA 2PNOA 3US6A 2NUPA 1K04A 2H7OA 2XXAA 3FHDA 2LCHA 1HE9A 2CGEA 5DVWA 1FFTC 2YWAA 1U89A 2JPUA 3DAFA 3QMKA 1OXBA 5CI9A 1PD1A 2M4EA 3LEOA 3B9QA 2XL4A 4IRUA 2A6EF 4HEAJ 1Q0FA 1RMVA 5F5HA 2BC5A 1HY5A 3EHMA 2P6VA 2FGYA 3DMDA 3RKOF 3OEOA 1M57C 3M1CB 2W4BA 2L9JA 4Q7CA 4EHPA 4RD9A 3W4YA 2H7BA 3DM9B 3EH1A 3GM2A 1FTSA 3O39A 2MYSA 4J32B 3U3BA 2R7RA 2Q4FA 4KC9A 2YKZA 1T9KA 4BJ6A 2L81A 2Y3GA 3OA1A 1YARO 3C8ZA 2IYLD 5COMA 4CIHA 1D1CA 3NMJA 3EPVA 2YL0A 1EA8A 1G5ZA 2R05A 2EIJC 1BDJB 1SYQA 3MYFA 1NLXA 3KMIA 4C3BA 4QI2A 4G7ZF 3QZCA 3BEHA 1ZU5A 5B1AC 1S7ZA 3DM5A 4JKVA 4CSAA 4OIQF 1GQAA 4MVUA 3NDBB 2A0BA 5EGYA 3WHNA 1KNYA 4XLPF 4JJFA 1JRAA 1LVKA 2R7VA 5KYYB 1ORSC 1VLTA 4CJOA 1YDIA 3K7DA 3N24A 1BZ4A 4N06A 4MVSA 3RVYA 3FOOA 2LQGA 2QTVA 1N1CA 1QPUA 2NUPB 4GEHA 2XL8A 1WTYA 1YVIA 3SXMA 1JR8A 5B3SC 3QTHA 3F46A 4OD5A 1HE1A 5BQIA 4DBQA 3H2VA 2R7XA 3FAJA 3ZSUA 4JE9A 2IXOA 3NMIA 2KGOA 1MMNA 2P0NA 4XWJA 2MHRA 4H54A 3UNGC 2G3KA 3W2WA 4CS9C 4QI0A 3ZIBA 4LLEA 2PP4A 2HFIA 256BA 1EI7A 3GANA 1V55C 3PCVA 3FVYA 4MVRA 3NRHA 3EH2A 2X51A 1AVOB 2OU6A 3ABLC 4L6RA 1G8XA 3T6JA 1QZXA 5JSLA 1YZCA 4JTCB 2ZXPA 4U5FE 5A6KA 1LS4A 1ZW2A 5L3QA 3S29A 4NTFA 2YL7A 1OR3A 5D92A 4Z9JA 4EBBA 2R02A 1OCRC 1V54C 1SZIA 2WZLA 3HLZA 3CEXA 4XPXA 3LEVA 2FAPB 3S28A 2E87A 4GQHA 1I4YA 2TMVP 1V74B 3IEEA 3RIPA 2C04A 2QUPA 3K6BA 1O3UA 3BRJA 3C7JA 2ZPAA 3EGDA 5A6AA 1IW7F 3AGUA 2YLIA 4JRZA 5A6BA 3S84A 2HMZA 4E0HA 2L6HA 3M15A 4I44A 1U6HA 2NSGA 2NUTB 2RSEB 3E9VA 3AQBA 4JCHA 1Q0GA 3K33A 3E70C 3V5YA 5E3CA 1T6IA 1BBHA 3JT1A 3DE9A 4JZAA 2LD6A 4PJMA 3ATPA 4PACA 4U5CE 1C02A 1M2OA 2LP4A 1NFNA 3JSZA 1T6UA 2I15A 3GORA 3AQCA 4IB4A 3O6XA 4IAOA 4MVOA 1WN0A 4P9TA 2Q7RA 4CS7A 2R7UA 1D0ZA 3VYWA 1PCXA 3DJUB 4BPMA 2R03A 1FMWA 3HNIA 4MW8A 2HKVA 2J9VA 4NY3A 4PFPA 4CBEA 1E2XA 3L0IA 3H2UA 1Z7Qc 1OKKD 3W2VA 1HW2A 4PJLA 2XM4A 2D4UA 3L34A 3OWTA 4XPYA 2YZSA 1VTMP 2J8WA 3B0PA 4BJ6C 1DOVA 2R7SA 5HV9A 2B0JA 4OD4A 3QVZA 1O5HA 1OW7A 4HFKB 4MNDA 1SR2A 2L6GA 2J7PD 2EIKC 4AL0A 4J7TA 4XLNF 2XSEA 5DS5A 2J45A 1LM3B 2HJMA 1UFBA 3AGTA 4RBNA 1MMDA 4CSAC 1CGOA 1M2VA 4MTGA 4PJNA 2C03A 5KYUA 1D1AA 2KJGA 2G3VA 2NPUA 3FAPB 3UMKA 2HV6A 5CIVA 3DWWA 3N2ZB 1MNEA 3C8GA 3CQZA 1RJ9B 2PFDA 4B6IA 4MTOA 3KH2A 3V5XA 4G7HF 2HSQA 2IOQA 2LFDA 3EFOB 3L8JA 4PK4A 1NSGB 3UGOA 2YLDA 4XEVA 1OCOC 2WB7A 4O7GA 4DVZA 4K1OA 3U9MA 1OW8A 5B1BC 3ECSA 2UUHA 1Q0MA 2J9UA 4GYTA 1QVXA 5F28E 4C3EA 4G7OF 1ZHXA 2WZFA 1NFOA 1NG1A 4CX9A 3B29A 4LERA 4EUKB 1VOMA 3X2QC 1QSPA 2CNWA 4BG0A 4X0RA 5EHHA 4JEBA 4M63A 3WAQA 2J9BA 2L6FA 1ZU4A 1A7DA 3QW1A 1OR2A 3ITFA 2FFHA 1YYXA 4XEFA 4Z9HA 4XQ1A 4U5DE 2PBEA 2XS8A 4A4AA 2A69F 5KYXB 1MMAA 2J9WA 4PFOA 2BE5F 3JRMO 2GAQA 1CGNA 3F47A 4LACB 1ZHTA 3V7OA 4BEMJ 3TD7A 3ZG1A 2AP3A 2GDCA 3DZAA 4E17A 1LE2A 5L0HA 2R7TA 3ZDLA 2NG1A 1M2VB 1D1BA 1F1MA 5BUOA 3ZVRA 1ZW3A 2W9YA 1JOGA 2UUIA 3WG7C 4K7BA 5T3WA 2KYHA 1W2WA 2ASRA 3C8GB 4WABA 2HMQA 2AWCA 4HE8D 4YK5A 4U9DA 1YA9A 5JP7A 4DRHB 4JTAB 4JVSA 3S27A 3GODA 3H65A 1WATA 2WL8A 4O79A 4CS8C 2CW0F 4C3DA 3CSKA 1CGME 4OIRF 3DE8A 4F4BA 4ANJA 4O6MA 1CPRA 4DJ9A 2XXAB 1R5ID 5DLJA 2AVKA 2J0WA 2KQ9A 2Y39A 3KKBA 4R32A 5DS4A 1AUEA 1SMYF 2HV7A 3JYYA 4J7YA 4U5EE 4YN0B 5JUAA 3I5PA 1H7IA 1FFHA 2BL2A 4JW1A 4ULVA 4U5BE 5F5FA 1ZHYA 4I1MA 1WWPA 1TR2A 1M6TA 1TKNA 3TJ5A 3POVA 1RKEA 2J0XA 3QW0A 2VCCA 4AL1A 2DYRC 3MFNA 2M64A 4E18A 4EWCA 1VK5A 4JCZA 4IGGA 3EQLF 2EPKX 2R25A 4I3MA 2EINC 2EIMC 2Y3DA 2W45A 1LE4A 4H4KC 4D4NA 3EZHA 3TOLA 3AJMA 1NBBA 2VH3A 3GWNA 4J30B 5FCLA 4BJ5A 3S0XA 2LIGA 4UDVA 1H6GA 1FR0A 5L0FA 1YZAA 4C7OA 2O9XA 1ZHZA 1APCA 1HMDA 2XLDA 3LLKA 4XTKA 3AG3C 3C63A 3A9CA 1BR2A 1OCCC 2QY9A 3IPMO 5E3AA 1Q0DA 3GM3A 4ULWA 3W8IA 5JLIA 1GM5A 4BJTA 2J46A 1Z63A 2ZD9A 4YL1A 4YL3A 1J8YF 1K05A 3G4ZA 3DXJF 4WGYA 5JVEA 3O55A 2JD3A 5JS5A 3A11A 3G4XA 3T6GB 5L0DA 4OIOF 2P1AA 1AEPA 1QLEC 1FNTc 2P7VA 3UMHA 1L7CA 1T01A 4U5HA 3U2LA 3RVZA 1Y6DA 1ST6A 2ZXOA 1BR4A 3PMRA 4QDLA 5KYWA 5CI8A 4YWQA 4DOZA 4KNVA 2OOCA 3B0VC 2OJED 1LS1A 3CAXA 1SF8A 2QLAA 3I4UA 3J06A 4N4WA 1LPEA 1QQ3A 1LI7A 3C62A 5FZTA 1ZVZA 3AG1C 1XZPA 1VMAA 1A7VA 2OG2A 1H9TA 1OW6A 2Y3HA 2Q9BA 3KYJA 3MYIA 4U9EA 4ZLCA 2OCCC 2YQYA 4AK9A 1VYIA 4CJGA 1E83A 2I8BA 4C7OB 3VM6A 2XLWA 4Q5SF 2XLHA 3X1OA 4G0HA 4WGZA 2R7QA 1FMVA 4FX5A 3W8HA 5L0IA 2KC3A 2EPLX 3EGDB 2EPOA 3RH3A 4K0DA 1YLMA 2L7AA 1HMOA 5COGA 3TJ6A 1LKXA 3U8VA 1WGWA 2W4MA 4AX2A 3ZWIA 3K66A 4CDAA 2IBFA 3LAYA 4LDRA 2YEVA 4CS9A 4NTAA 4ER9A 4DRJB 3SXKA 2WVOA 1DOWA 3EHNA 3MX3A 2CDQA 3KL4A 4D4XA 5KYWB 3KYIA 2A0UA 1JPNA 4FWVA 4O6NA 2IXMA 2QNLA 2AWYA 2ZXWC 1CPQA 3SXZA 3U5SA 1ORJA 1Z3IX 3U8PA 4CDVA 4EKWA 5AC4A 2HUJA 1E84A 1Z23A 3ZQYA 1KU2A 3Q6NA 3DKAA 3U9JA 2R7WA 3Q7LA 1BR1A 2KK1A 5L3VA 5TJ5E 4EBJA 1RXQA 3HTKC 2EPNA 1OQCA 2NSFA 1I5NA 3DJNB 4NTBA 4E7SA 5KYNA 3EGXA 1PD0A 2QE9A 1IZMA 4Q4ZF 1YJGA 2WVNA 5KYYA 1EKYA 3DD7A 4MVMA 3VF0A 1TWAA 4JC7A 3AOUA 2V26A 3M4BA 4MQ9F 4YT4A 2A6HF 1HW1A 4ZLDA 1V4AA 2VB6A 4W8PA 3R2PA 2GWWA 1OCZC 5KYUB 1LI5A 1G4US 5L0JA 2HJ3A 5BQHA 1NU9C 2JX0A 2PF4E 2Q3TA 2XRHA 1A41A 1LIHA 2DB4A 3M79A 1G4WR 1TQGA 4N6CA 4N6HA 5L0CA 3ASOC 3LLIA 4MVQA 3EG9A 5AC5A 3TQOA 1XWJA 3GWLA 5A6JA 1D0XA 3K1HA 2CYDA 3M4CA 3NKEA 4IAQA 3VAYA 2OJQA 3UMIA 2YHSA 1VB5A 1TWCA 2XLEA 2YL3A 4ONSA 2X0CA 5HSWA 4G78A 2LK4A 3HNKA 2GA0A 2OKUA 3L1MA 4XEKA 2XS1A 3S90A 3LS0A 3NYMA 3T4RA 1VYKA 1OKKA 1NU7D 2Q00A 1L3PA 3DI5A 4JURI 2Q9AA 5DQZA 5IY5C 2EPMX 4O6YA 3QVYA 3LNRA 4JJGA 3JZ0A 3ZTZA 3GEIA 5A69A 1C03A 1C17M 2DYSC 2VASA 1XZQA 1YYJA 2WZGA 3EGXB 1T6QA 1A7EA 3GEHA 3C18A 3R7CA 3U2MA 4MVZA 3K1IA 3Q6MA 2WVQA 3C8GD 5T1DB 2J7PA 4FAPB 3JSEO 3V5ZA 4KNWA 3NMKA 3JCUQ 2YRFA 3KPHA 3MLGA 5BQGA 1J8MF 4YJWA 3WODF 2XL6A 2OEXA 3NYLA 1FAPB 3NKDA 1D0YA 2NUTA 5T3TA 3ZQVA 4RDAA 3UR3C 3U0CA 2Z15A 3ABMC 3IQ5A 3RW0A 1KTMA 1ORYA 2PX0A 4BEJA 1PV3A 2LSEA 3ZC4A 3FXHA 4JIOA 1VLSA 5E2QA 4DXWA 2XLVA 3EZIA 3FOPA 2VC9A 1MMGA 2CNWD 1Q0KA 2P61A 3T9OA 3ASNC 5DS6A 5JRAA 3EG9B 1YAUO 3G50A 3O10A 3RQGA 3SP1A 5JT4A 2R7OA 3HJCA 2IXPA 3JRTA 3FDQA 1EQ1A 2YL1A 4JEAA 3NYJA 4E0IA 2R9RB 3TK0A 3UGPA 3I5QA 1TFOB 3SYNA 2XLMA 3HKKA 3SZRA 3TOMA 4W8KA 4PJJA 3VRCA 4AE4A 4DBRA 2V3CC 3DAGA 4LDQA 4Z9IA 2PX3A 1B68A 2KNHA 5GPGB 3AG4C 1JAFA 4XPWA 4MS2A 1TWGA 2D5RB 3LS1A 3MBGA 3LESA 3HNLA 3NG1A 4BJ1A 2LFFA 1RKEB 3GM1A 1O87A 3CZ6A 1E86A 2H7VC 2HZ8A 1R4TA 1S05A 2ZXRA 2XLOA 3JTLO 3IQCA 3PDMP 1RKCA 2KSFA 1Y4CA 1QKRA 2YVKA 1U0BB 1RJ9A 4YT2A 3AG2C 3SEOA 5D91A 1T5OA 3PHF2 1RCPA 2A68F 3LJBA 1Z5ZA 3EFOA 2G62A 4YT5A 4CS8A 4YT8A 4NQFA 2EILC 2Q9CA 2IXNA 2HSBA 1WOLA 4IJJA 1M56C 4KBLA 1ZZPA 1TWHA 3IHUA 4MTFA 1H9GA 1UG7A 1JPJA 2B0HA 5E33A 4OINF 2OQMA 4EIYA 3RYLA 2ETSA 4FESA 4LLCA 5COFA 2A1DD 5EK0A 3ZTMA 2VCAA 4P9FA 4CDYA 4LDKA 4YL0A 4PR9A 2Y3BA 1GS9A 5DQTA 2XM0A 3Q7GA 4NC3A 3IQTA 2AU5A 5L0GA 1E85A 2H8AA 4CIPA 4IARA 4MW3A 1MNDA 5KYXA 2OEVA 4AE4B 2HS5A 1WASA 3FMSA 5B3IA 3B0UX 3B71A 2F22A 4A2NB 3RFYA 4OIPF 1NZEA 1YA7O 2Y69C 3SNHA 3U3FA 4NCQA 4E7ZA 5K0IA 3JYHA 1MQVA 2RD9A 3L8IA 4I1OB 1JMWA 2GFHA 4DRIB 4EBKA 2IM8A 4IWBA 3LUTB 4HFFB 1K40A 3IQ6A 3K1IC 3LNMB 1A0BA 3SXYA 1Z6AA 1ZYRF 4KI2A 2YLGA 5AGFA 3ABKC 1GGQA 4P6IC 2KW3C 4WJ0A 3GEEA 3RQEA 4DVYP 2DI3A
chains in the Genus database with same CATH topology
2YL3A 2XM4A 3HNJA 1YZAA 2J8WA 3HNKA 3L1MA 1APCA 2XLDA 2CCYA 3C63A 3QVZA 3QVYA 3ZTZA 5JLIA 1YYJA 1LM3B 4WGYA 5JVEA 5JS5A 2BC5A 1CGOA 3NMKA 2XL6A 3ZQVA 3IQ5A 2YKZA 2YLDA 2XLVA 2QLAA 3NMJA 2YL0A 3FOPA 4N4WA 1QQ3A 4CJGA 3C62A 5JRAA 1A7VA 4CX9A 5JT4A 4JKVA 2YL1A 4JEBA 4JEAA 1GQAA 4U9EA 2J9BA 2XLMA 3TOMA 3QW1A 1E83A 4CJOA 2XLWA 1YYXA 2XLHA 3VRCA 4WGZA 3FOOA 1QPUA 2XL8A 1JAFA 1CGNA 3HNLA 3ZWIA 4CDAA 1E86A 1S05A 2XLOA 4JE9A 3NMIA 4ER9A 1RCPA 4D4XA 256BA 4U9DA 5JP7A 1CPQA 3U8PA 4CDVA 4L6RA 1E84A 5JSLA 1YZCA 3ZQYA 4EIYA 3DE8A 2YL7A 3ZTMA 1CPRA 4CDYA 1EKYA 2XM0A 4NC3A 1E85A 4CIPA 4IARA 5JUAA 3M4BA 2YLIA 4ULVA 5B3IA 3M15A 1M6TA 1BBHA 3QW0A 1MQVA 3DE9A 3M79A 4N6HA 4IB4A 3IQ6A 2YLGA 4D4NA 5AGFA 3HNIA 3M4CA 4IAQA 3TOLA 1NBBA 2XLEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YL3 A;  2XM4 A;  3HNJ A;  1YZA A;  2J8W A;  3HNK A;  3L1M A;  1APC A;  2XLD A;  2CCY A;  3C63 A;  3QVZ A;  3QVY A;  3ZTZ A;  5JLI A;  1YYJ A;  1LM3 B;  4WGY A;  5JVE A;  5JS5 A;  2BC5 A;  1CGO A;  3NMK A;  2XL6 A;  3ZQV A;  3IQ5 A;  2YKZ A;  2YLD A;  2XLV A;  2QLA A;  3NMJ A;  2YL0 A;  3FOP A;  4N4W A;  1QQ3 A;  4CJG A;  3C62 A;  5JRA A;  1A7V A;  4CX9 A;  5JT4 A;  4JKV A;  2YL1 A;  4JEB A;  4JEA A;  1GQA A;  4U9E A;  2J9B A;  2XLM A;  3TOM A;  3QW1 A;  1E83 A;  4CJO A;  2XLW A;  1YYX A;  2XLH A;  3VRC A;  4WGZ A;  3FOO A;  1QPU A;  2XL8 A;  1JAF A;  1CGN A;  3HNL A;  3ZWI A;  4CDA A;  1E86 A;  1S05 A;  2XLO A;  4JE9 A;  3NMI A;  4ER9 A;  1RCP A;  4D4X A;  256B A;  4U9D A;  5JP7 A;  1CPQ A;  3U8P A;  4CDV A;  4L6R A;  1E84 A;  5JSL A;  1YZC A;  3ZQY A;  4EIY A;  3DE8 A;  2YL7 A;  3ZTM A;  1CPR A;  4CDY A;  1EKY A;  2XM0 A;  4NC3 A;  1E85 A;  4CIP A;  4IAR A;  5JUA A;  3M4B A;  2YLI A;  4ULV A;  5B3I A;  3M15 A;  1M6T A;  1BBH A;  3QW0 A;  1MQV A;  3DE9 A;  3M79 A;  4N6H A;  4IB4 A;  3IQ6 A;  2YLG A;  4D4N A;  5AGF A;  3HNI A;  3M4C A;  4IAQ A;  3TOL A;  1NBB A;  2XLE A; 
#chains in the Genus database with same CATH topology
 1I4Z A;  2ICW G;  2MWQ A;  3HNJ A;  3TUL A;  2DGJ A;  5A6B D;  4U5G A;  3RQF A;  3EJN A;  3N0T A;  3S9O A;  1TFK B;  3RF3 A;  4BJ5 C;  1OXK A;  4JTD B;  1ZHW A;  3T6B A;  2CCY A;  2VCB A;  2PNO A;  3US6 A;  2NUP A;  1K04 A;  2H7O A;  2XXA A;  3FHD A;  2LCH A;  1HE9 A;  2CGE A;  5DVW A;  1FFT C;  2YWA A;  1U89 A;  2JPU A;  3DAF A;  3QMK A;  1OXB A;  5CI9 A;  1PD1 A;  2M4E A;  3LEO A;  3B9Q A;  2XL4 A;  4IRU A;  2A6E F;  4HEA J;  1Q0F A;  1RMV A;  5F5H A;  2BC5 A;  1HY5 A;  3EHM A;  2P6V A;  2FGY A;  3DMD A;  3RKO F;  3OEO A;  1M57 C;  3M1C B;  2W4B A;  2L9J A;  4Q7C A;  4EHP A;  4RD9 A;  3W4Y A;  2H7B A;  3DM9 B;  3EH1 A;  3GM2 A;  1FTS A;  3O39 A;  2MYS A;  4J32 B;  3U3B A;  2R7R A;  2Q4F A;  4KC9 A;  2YKZ A;  1T9K A;  4BJ6 A;  2L81 A;  2Y3G A;  3OA1 A;  1YAR O;  3C8Z A;  2IYL D;  5COM A;  4CIH A;  1D1C A;  3NMJ A;  3EPV A;  2YL0 A;  1EA8 A;  1G5Z A;  2R05 A;  2EIJ C;  1BDJ B;  1SYQ A;  3MYF A;  1NLX A;  3KMI A;  4C3B A;  4QI2 A;  4G7Z F;  3QZC A;  3BEH A;  1ZU5 A;  5B1A C;  1S7Z A;  3DM5 A;  4JKV A;  4CSA A;  4OIQ F;  1GQA A;  4MVU A;  3NDB B;  2A0B A;  5EGY A;  3WHN A;  1KNY A;  4XLP F;  4JJF A;  1JRA A;  1LVK A;  2R7V A;  5KYY B;  1ORS C;  1VLT A;  4CJO A;  1YDI A;  3K7D A;  3N24 A;  1BZ4 A;  4N06 A;  4MVS A;  3RVY A;  3FOO A;  2LQG A;  2QTV A;  1N1C A;  1QPU A;  2NUP B;  4GEH A;  2XL8 A;  1WTY A;  1YVI A;  3SXM A;  1JR8 A;  5B3S C;  3QTH A;  3F46 A;  4OD5 A;  1HE1 A;  5BQI A;  4DBQ A;  3H2V A;  2R7X A;  3FAJ A;  3ZSU A;  4JE9 A;  2IXO A;  3NMI A;  2KGO A;  1MMN A;  2P0N A;  4XWJ A;  2MHR A;  4H54 A;  3UNG C;  2G3K A;  3W2W A;  4CS9 C;  4QI0 A;  3ZIB A;  4LLE A;  2PP4 A;  2HFI A;  256B A;  1EI7 A;  3GAN A;  1V55 C;  3PCV A;  3FVY A;  4MVR A;  3NRH A;  3EH2 A;  2X51 A;  1AVO B;  2OU6 A;  3ABL C;  4L6R A;  1G8X A;  3T6J A;  1QZX A;  5JSL A;  1YZC A;  4JTC B;  2ZXP A;  4U5F E;  5A6K A;  1LS4 A;  1ZW2 A;  5L3Q A;  3S29 A;  4NTF A;  2YL7 A;  1OR3 A;  5D92 A;  4Z9J A;  4EBB A;  2R02 A;  1OCR C;  1V54 C;  1SZI A;  2WZL A;  3HLZ A;  3CEX A;  4XPX A;  3LEV A;  2FAP B;  3S28 A;  2E87 A;  4GQH A;  1I4Y A;  2TMV P;  1V74 B;  3IEE A;  3RIP A;  2C04 A;  2QUP A;  3K6B A;  1O3U A;  3BRJ A;  3C7J A;  2ZPA A;  3EGD A;  5A6A A;  1IW7 F;  3AGU A;  2YLI A;  4JRZ A;  5A6B A;  3S84 A;  2HMZ A;  4E0H A;  2L6H A;  3M15 A;  4I44 A;  1U6H A;  2NSG A;  2NUT B;  2RSE B;  3E9V A;  3AQB A;  4JCH A;  1Q0G A;  3K33 A;  3E70 C;  3V5Y A;  5E3C A;  1T6I A;  1BBH A;  3JT1 A;  3DE9 A;  4JZA A;  2LD6 A;  4PJM A;  3ATP A;  4PAC A;  4U5C E;  1C02 A;  1M2O A;  2LP4 A;  1NFN A;  3JSZ A;  1T6U A;  2I15 A;  3GOR A;  3AQC A;  4IB4 A;  3O6X A;  4IAO A;  4MVO A;  1WN0 A;  4P9T A;  2Q7R A;  4CS7 A;  2R7U A;  1D0Z A;  3VYW A;  1PCX A;  3DJU B;  4BPM A;  2R03 A;  1FMW A;  3HNI A;  4MW8 A;  2HKV A;  2J9V A;  4NY3 A;  4PFP A;  4CBE A;  1E2X A;  3L0I A;  3H2U A;  1Z7Q c;  1OKK D;  3W2V A;  1HW2 A;  4PJL A;  2XM4 A;  2D4U A;  3L34 A;  3OWT A;  4XPY A;  2YZS A;  1VTM P;  2J8W A;  3B0P A;  4BJ6 C;  1DOV A;  2R7S A;  5HV9 A;  2B0J A;  4OD4 A;  3QVZ A;  1O5H A;  1OW7 A;  4HFK B;  4MND A;  1SR2 A;  2L6G A;  2J7P D;  2EIK C;  4AL0 A;  4J7T A;  4XLN F;  2XSE A;  5DS5 A;  2J45 A;  1LM3 B;  2HJM A;  1UFB A;  3AGT A;  4RBN A;  1MMD A;  4CSA C;  1CGO A;  1M2V A;  4MTG A;  4PJN A;  2C03 A;  5KYU A;  1D1A A;  2KJG A;  2G3V A;  2NPU A;  3FAP B;  3UMK A;  2HV6 A;  5CIV A;  3DWW A;  3N2Z B;  1MNE A;  3C8G A;  3CQZ A;  1RJ9 B;  2PFD A;  4B6I A;  4MTO A;  3KH2 A;  3V5X A;  4G7H F;  2HSQ A;  2IOQ A;  2LFD A;  3EFO B;  3L8J A;  4PK4 A;  1NSG B;  3UGO A;  2YLD A;  4XEV A;  1OCO C;  2WB7 A;  4O7G A;  4DVZ A;  4K1O A;  3U9M A;  1OW8 A;  5B1B C;  3ECS A;  2UUH A;  1Q0M A;  2J9U A;  4GYT A;  1QVX A;  5F28 E;  4C3E A;  4G7O F;  1ZHX A;  2WZF A;  1NFO A;  1NG1 A;  4CX9 A;  3B29 A;  4LER A;  4EUK B;  1VOM A;  3X2Q C;  1QSP A;  2CNW A;  4BG0 A;  4X0R A;  5EHH A;  4JEB A;  4M63 A;  3WAQ A;  2J9B A;  2L6F A;  1ZU4 A;  1A7D A;  3QW1 A;  1OR2 A;  3ITF A;  2FFH A;  1YYX A;  4XEF A;  4Z9H A;  4XQ1 A;  4U5D E;  2PBE A;  2XS8 A;  4A4A A;  2A69 F;  5KYX B;  1MMA A;  2J9W A;  4PFO A;  2BE5 F;  3JRM O;  2GAQ A;  1CGN A;  3F47 A;  4LAC B;  1ZHT A;  3V7O A;  4BEM J;  3TD7 A;  3ZG1 A;  2AP3 A;  2GDC A;  3DZA A;  4E17 A;  1LE2 A;  5L0H A;  2R7T A;  3ZDL A;  2NG1 A;  1M2V B;  1D1B A;  1F1M A;  5BUO A;  3ZVR A;  1ZW3 A;  2W9Y A;  1JOG A;  2UUI A;  3WG7 C;  4K7B A;  5T3W A;  2KYH A;  1W2W A;  2ASR A;  3C8G B;  4WAB A;  2HMQ A;  2AWC A;  4HE8 D;  4YK5 A;  4U9D A;  1YA9 A;  5JP7 A;  4DRH B;  4JTA B;  4JVS A;  3S27 A;  3GOD A;  3H65 A;  1WAT A;  2WL8 A;  4O79 A;  4CS8 C;  2CW0 F;  4C3D A;  3CSK A;  1CGM E;  4OIR F;  3DE8 A;  4F4B A;  4ANJ A;  4O6M A;  1CPR A;  4DJ9 A;  2XXA B;  1R5I D;  5DLJ A;  2AVK A;  2J0W A;  2KQ9 A;  2Y39 A;  3KKB A;  4R32 A;  5DS4 A;  1AUE A;  1SMY F;  2HV7 A;  3JYY A;  4J7Y A;  4U5E E;  4YN0 B;  5JUA A;  3I5P A;  1H7I A;  1FFH A;  2BL2 A;  4JW1 A;  4ULV A;  4U5B E;  5F5F A;  1ZHY A;  4I1M A;  1WWP A;  1TR2 A;  1M6T A;  1TKN A;  3TJ5 A;  3POV A;  1RKE A;  2J0X A;  3QW0 A;  2VCC A;  4AL1 A;  2DYR C;  3MFN A;  2M64 A;  4E18 A;  4EWC A;  1VK5 A;  4JCZ A;  4IGG A;  3EQL F;  2EPK X;  2R25 A;  4I3M A;  2EIN C;  2EIM C;  2Y3D A;  2W45 A;  1LE4 A;  4H4K C;  4D4N A;  3EZH A;  3TOL A;  3AJM A;  1NBB A;  2VH3 A;  3GWN A;  4J30 B;  5FCL A;  4BJ5 A;  3S0X A;  2LIG A;  4UDV A;  1H6G A;  1FR0 A;  5L0F A;  1YZA A;  4C7O A;  2O9X A;  1ZHZ A;  1APC A;  1HMD A;  2XLD A;  3LLK A;  4XTK A;  3AG3 C;  3C63 A;  3A9C A;  1BR2 A;  1OCC C;  2QY9 A;  3IPM O;  5E3A A;  1Q0D A;  3GM3 A;  4ULW A;  3W8I A;  5JLI A;  1GM5 A;  4BJT A;  2J46 A;  1Z63 A;  2ZD9 A;  4YL1 A;  4YL3 A;  1J8Y F;  1K05 A;  3G4Z A;  3DXJ F;  4WGY A;  5JVE A;  3O55 A;  2JD3 A;  5JS5 A;  3A11 A;  3G4X A;  3T6G B;  5L0D A;  4OIO F;  2P1A A;  1AEP A;  1QLE C;  1FNT c;  2P7V A;  3UMH A;  1L7C A;  1T01 A;  4U5H A;  3U2L A;  3RVZ A;  1Y6D A;  1ST6 A;  2ZXO A;  1BR4 A;  3PMR A;  4QDL A;  5KYW A;  5CI8 A;  4YWQ A;  4DOZ A;  4KNV A;  2OOC A;  3B0V C;  2OJE D;  1LS1 A;  3CAX A;  1SF8 A;  2QLA A;  3I4U A;  3J06 A;  4N4W A;  1LPE A;  1QQ3 A;  1LI7 A;  3C62 A;  5FZT A;  1ZVZ A;  3AG1 C;  1XZP A;  1VMA A;  1A7V A;  2OG2 A;  1H9T A;  1OW6 A;  2Y3H A;  2Q9B A;  3KYJ A;  3MYI A;  4U9E A;  4ZLC A;  2OCC C;  2YQY A;  4AK9 A;  1VYI A;  4CJG A;  1E83 A;  2I8B A;  4C7O B;  3VM6 A;  2XLW A;  4Q5S F;  2XLH A;  3X1O A;  4G0H A;  4WGZ A;  2R7Q A;  1FMV A;  4FX5 A;  3W8H A;  5L0I A;  2KC3 A;  2EPL X;  3EGD B;  2EPO A;  3RH3 A;  4K0D A;  1YLM A;  2L7A A;  1HMO A;  5COG A;  3TJ6 A;  1LKX A;  3U8V A;  1WGW A;  2W4M A;  4AX2 A;  3ZWI A;  3K66 A;  4CDA A;  2IBF A;  3LAY A;  4LDR A;  2YEV A;  4CS9 A;  4NTA A;  4ER9 A;  4DRJ B;  3SXK A;  2WVO A;  1DOW A;  3EHN A;  3MX3 A;  2CDQ A;  3KL4 A;  4D4X A;  5KYW B;  3KYI A;  2A0U A;  1JPN A;  4FWV A;  4O6N A;  2IXM A;  2QNL A;  2AWY A;  2ZXW C;  1CPQ A;  3SXZ A;  3U5S A;  1ORJ A;  1Z3I X;  3U8P A;  4CDV A;  4EKW A;  5AC4 A;  2HUJ A;  1E84 A;  1Z23 A;  3ZQY A;  1KU2 A;  3Q6N A;  3DKA A;  3U9J A;  2R7W A;  3Q7L A;  1BR1 A;  2KK1 A;  5L3V A;  5TJ5 E;  4EBJ A;  1RXQ A;  3HTK C;  2EPN A;  1OQC A;  2NSF A;  1I5N A;  3DJN B;  4NTB A;  4E7S A;  5KYN A;  3EGX A;  1PD0 A;  2QE9 A;  1IZM A;  4Q4Z F;  1YJG A;  2WVN A;  5KYY A;  1EKY A;  3DD7 A;  4MVM A;  3VF0 A;  1TWA A;  4JC7 A;  3AOU A;  2V26 A;  3M4B A;  4MQ9 F;  4YT4 A;  2A6H F;  1HW1 A;  4ZLD A;  1V4A A;  2VB6 A;  4W8P A;  3R2P A;  2GWW A;  1OCZ C;  5KYU B;  1LI5 A;  1G4U S;  5L0J A;  2HJ3 A;  5BQH A;  1NU9 C;  2JX0 A;  2PF4 E;  2Q3T A;  2XRH A;  1A41 A;  1LIH A;  2DB4 A;  3M79 A;  1G4W R;  1TQG A;  4N6C A;  4N6H A;  5L0C A;  3ASO C;  3LLI A;  4MVQ A;  3EG9 A;  5AC5 A;  3TQO A;  1XWJ A;  3GWL A;  5A6J A;  1D0X A;  3K1H A;  2CYD A;  3M4C A;  3NKE A;  4IAQ A;  3VAY A;  2OJQ A;  3UMI A;  2YHS A;  1VB5 A;  1TWC A;  2XLE A;  2YL3 A;  4ONS A;  2X0C A;  5HSW A;  4G78 A;  2LK4 A;  3HNK A;  2GA0 A;  2OKU A;  3L1M A;  4XEK A;  2XS1 A;  3S90 A;  3LS0 A;  3NYM A;  3T4R A;  1VYK A;  1OKK A;  1NU7 D;  2Q00 A;  1L3P A;  3DI5 A;  4JUR I;  2Q9A A;  5DQZ A;  5IY5 C;  2EPM X;  4O6Y A;  3QVY A;  3LNR A;  4JJG A;  3JZ0 A;  3ZTZ A;  3GEI A;  5A69 A;  1C03 A;  1C17 M;  2DYS C;  2VAS A;  1XZQ A;  1YYJ A;  2WZG A;  3EGX B;  1T6Q A;  1A7E A;  3GEH A;  3C18 A;  3R7C A;  3U2M A;  4MVZ A;  3K1I A;  3Q6M A;  2WVQ A;  3C8G D;  5T1D B;  2J7P A;  4FAP B;  3JSE O;  3V5Z A;  4KNW A;  3NMK A;  3JCU Q;  2YRF A;  3KPH A;  3MLG A;  5BQG A;  1J8M F;  4YJW A;  3WOD F;  2XL6 A;  2OEX A;  3NYL A;  1FAP B;  3NKD A;  1D0Y A;  2NUT A;  5T3T A;  3ZQV A;  4RDA A;  3UR3 C;  3U0C A;  2Z15 A;  3ABM C;  3IQ5 A;  3RW0 A;  1KTM A;  1ORY A;  2PX0 A;  4BEJ A;  1PV3 A;  2LSE A;  3ZC4 A;  3FXH A;  4JIO A;  1VLS A;  5E2Q A;  4DXW A;  2XLV A;  3EZI A;  3FOP A;  2VC9 A;  1MMG A;  2CNW D;  1Q0K A;  2P61 A;  3T9O A;  3ASN C;  5DS6 A;  5JRA A;  3EG9 B;  1YAU O;  3G50 A;  3O10 A;  3RQG A;  3SP1 A;  5JT4 A;  2R7O A;  3HJC A;  2IXP A;  3JRT A;  3FDQ A;  1EQ1 A;  2YL1 A;  4JEA A;  3NYJ A;  4E0I A;  2R9R B;  3TK0 A;  3UGP A;  3I5Q A;  1TFO B;  3SYN A;  2XLM A;  3HKK A;  3SZR A;  3TOM A;  4W8K A;  4PJJ A;  3VRC A;  4AE4 A;  4DBR A;  2V3C C;  3DAG A;  4LDQ A;  4Z9I A;  2PX3 A;  1B68 A;  2KNH A;  5GPG B;  3AG4 C;  1JAF A;  4XPW A;  4MS2 A;  1TWG A;  2D5R B;  3LS1 A;  3MBG A;  3LES A;  3HNL A;  3NG1 A;  4BJ1 A;  2LFF A;  1RKE B;  3GM1 A;  1O87 A;  3CZ6 A;  1E86 A;  2H7V C;  2HZ8 A;  1R4T A;  1S05 A;  2ZXR A;  2XLO A;  3JTL O;  3IQC A;  3PDM P;  1RKC A;  2KSF A;  1Y4C A;  1QKR A;  2YVK A;  1U0B B;  1RJ9 A;  4YT2 A;  3AG2 C;  3SEO A;  5D91 A;  1T5O A;  3PHF 2;  1RCP A;  2A68 F;  3LJB A;  1Z5Z A;  3EFO A;  2G62 A;  4YT5 A;  4CS8 A;  4YT8 A;  4NQF A;  2EIL C;  2Q9C A;  2IXN A;  2HSB A;  1WOL A;  4IJJ A;  1M56 C;  4KBL A;  1ZZP A;  1TWH A;  3IHU A;  4MTF A;  1H9G A;  1UG7 A;  1JPJ A;  2B0H A;  5E33 A;  4OIN F;  2OQM A;  4EIY A;  3RYL A;  2ETS A;  4FES A;  4LLC A;  5COF A;  2A1D D;  5EK0 A;  3ZTM A;  2VCA A;  4P9F A;  4CDY A;  4LDK A;  4YL0 A;  4PR9 A;  2Y3B A;  1GS9 A;  5DQT A;  2XM0 A;  3Q7G A;  4NC3 A;  3IQT A;  2AU5 A;  5L0G A;  1E85 A;  2H8A A;  4CIP A;  4IAR A;  4MW3 A;  1MND A;  5KYX A;  2OEV A;  4AE4 B;  2HS5 A;  1WAS A;  3FMS A;  5B3I A;  3B0U X;  3B71 A;  2F22 A;  4A2N B;  3RFY A;  4OIP F;  1NZE A;  1YA7 O;  2Y69 C;  3SNH A;  3U3F A;  4NCQ A;  4E7Z A;  5K0I A;  3JYH A;  1MQV A;  2RD9 A;  3L8I A;  4I1O B;  1JMW A;  2GFH A;  4DRI B;  4EBK A;  2IM8 A;  4IWB A;  3LUT B;  4HFF B;  1K40 A;  3IQ6 A;  3K1I C;  3LNM B;  1A0B A;  3SXY A;  1Z6A A;  1ZYR F;  4KI2 A;  2YLG A;  5AGF A;  3ABK C;  1GGQ A;  4P6I C;  2KW3 C;  4WJ0 A;  3GEE A;  3RQE A;  4DVY P;  2DI3 A; 
#chains in the Genus database with same CATH homology
 2YL3 A;  2XM4 A;  3HNJ A;  1YZA A;  2J8W A;  3HNK A;  3L1M A;  1APC A;  2XLD A;  2CCY A;  3C63 A;  3QVZ A;  3QVY A;  3ZTZ A;  5JLI A;  1YYJ A;  1LM3 B;  4WGY A;  5JVE A;  5JS5 A;  2BC5 A;  1CGO A;  3NMK A;  2XL6 A;  3ZQV A;  3IQ5 A;  2YKZ A;  2YLD A;  2XLV A;  2QLA A;  3NMJ A;  2YL0 A;  3FOP A;  4N4W A;  1QQ3 A;  4CJG A;  3C62 A;  5JRA A;  1A7V A;  4CX9 A;  5JT4 A;  4JKV A;  2YL1 A;  4JEB A;  4JEA A;  1GQA A;  4U9E A;  2J9B A;  2XLM A;  3TOM A;  3QW1 A;  1E83 A;  4CJO A;  2XLW A;  1YYX A;  2XLH A;  3VRC A;  4WGZ A;  3FOO A;  1QPU A;  2XL8 A;  1JAF A;  1CGN A;  3HNL A;  3ZWI A;  4CDA A;  1E86 A;  1S05 A;  2XLO A;  4JE9 A;  3NMI A;  4ER9 A;  1RCP A;  4D4X A;  256B A;  4U9D A;  5JP7 A;  1CPQ A;  3U8P A;  4CDV A;  4L6R A;  1E84 A;  5JSL A;  1YZC A;  3ZQY A;  4EIY A;  3DE8 A;  2YL7 A;  3ZTM A;  1CPR A;  4CDY A;  1EKY A;  2XM0 A;  4NC3 A;  1E85 A;  4CIP A;  4IAR A;  5JUA A;  3M4B A;  2YLI A;  4ULV A;  5B3I A;  3M15 A;  1M6T A;  1BBH A;  3QW0 A;  1MQV A;  3DE9 A;  3M79 A;  4N6H A;  4IB4 A;  3IQ6 A;  2YLG A;  4D4N A;  5AGF A;  3HNI A;  3M4C A;  4IAQ A;  3TOL A;  1NBB A;  2XLE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...