4JEAA

Crystal structure of an engineered zn-ridc1 construct with four interfacial disulfide bonds
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
106
structure length
106
Chain Sequence
b'ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHDALHLANCGKVKEAQAAAEQLKCTCNACHQKYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords soluble cytochrome b562
publication title In Vitro and Cellular Self-Assembly of a Zn-Binding Protein Cryptand via Templated Disulfide Bonds.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 46
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4jeaA00
3ZQYA 3IQ6A 4ULVA 4U9EA 4CX9A 2J8WA 5JS5A 1JAFA 4CJGA 3QVZA 3ZQVA 2XLVA 4L6RA 3ZTMA 2XLWA 3ZWIA 5B3IA 3DE9A 3FOOA 4IAQA 1QQ3A 4CIPA 1APCA 3HNLA 1YZCA 1CPQA 2YLGA 2XL6A 3QW1A 5JRAA 2XLOA 2XLHA 3C62A 3QVYA 2XLEA 3VRCA 2YL0A 3M4CA 1NBBA 4D4XA 4CDVA 5AGFA 3TOMA 1GQAA 2CCYA 1CPRA 2YKZA 3C63A 4WGZA 2XM0A 2YL3A 3HNIA 1S05A 3IQ5A 4D4NA 1YYJA 1E84A 5JVEA 2QLAA 5JUAA 3HNJA 1E86A 5JP7A 5JSLA 1QPUA 1E83A 4NC3A 3M15A 256BA 1MQVA 3TOLA 4CJOA 1BBHA 2YL1A 1CGNA 3M79A 3NMJA 4CDYA 1LM3B 1E85A 2XL8A 3NMKA 5JLIA 2YLIA 3M4BA 4IB4A 3NMIA 4IARA 1CGOA 2BC5A 2XLMA 1A7VA 1YYXA 4JEAA 4EIYA 2XLDA 4ER9A 4N4WA 2J9BA 3HNKA 4WGYA 4CDAA 5JT4A 4U9DA 1EKYA 4JE9A 4JKVA 3ZTZA 2YLDA 4JEBA 1RCPA 2YL7A 3L1MA 2XM4A 3DE8A 1YZAA 3FOPA 3U8PA 3QW0A 4N6HA 1M6TA
chains in the Genus database with same CATH superfamily
2A68F 1OR3A 3GORA 3RFYA 5D92A 4E18A 4YT5A 1ZW3A 2KC3A 2P1AA 4HFKB 5B1BC 3AG4C 4P9FA 5HSWA 4CJGA 1D1AA 1UFBA 2V26A 4E0IA 5F28E 2XLVA 1LVKA 1EA8A 4NTBA 3GM2A 3UMHA 3B9QA 4A4AA 3JRMO 4EKWA 1FMVA 4RBNA 3ZWIA 1ORYA 3DE9A 3V5YA 4IAQA 2WVOA 1APCA 1LE2A 3KMIA 4NY3A 1EI7A 1YZCA 3W4YA 4JCHA 3ZC4A 4EHPA 5T3WA 1CPQA 4E17A 3W8HA 2R7XA 2YLGA 3LNMB 2XL6A 3M1CB 2YVKA 4N06A 1GGQA 2J7PD 1LE4A 2OQMA 1A41A 1D1BA 1K40A 1T6QA 1XZQA 1ZHWA 2P6VA 4JC7A 4QI2A 1EQ1A 2LFDA 3EG9B 4MVQA 4O6NA 4CS8A 4U5FE 5BQIA 1Y6DA 1TWAA 3K7DA 3MYIA 1HW2A 1OCCC 4XQ1A 3PDMP 3MBGA 2XRHA 3RVZA 4BJ5C 3EH1A 3SEOA 3CZ6A 5DQZA 3ATPA 4YT4A 1BR4A 1JR8A 1LI7A 4KNVA 2H7VC 3AG1C 2XM0A 3DJNB 3IQTA 2YL3A 1OW8A 1FFHA 1S05A 3A11A 3RKOF 1VTMP 3MYFA 3DJUB 3NYMA 1E84A 1TR2A 1YLMA 1XWJA 1NSGB 4M63A 1SMYF 3MLGA 3T6GB 2L81A 3LUTB 4C7OA 4BG0A 1I5NA 1H6GA 2EPKX 1E86A 3KL4A 1WASA 2NSGA 2PF4E 2RSEB 2VH3A 3SNHA 1HE9A 1RXQA 2DYSC 3AQCA 1PCXA 3DM9B 2Q9CA 5KYYA 2OOCA 5L0FA 2XS1A 3ASOC 1AUEA 2EPOA 2QE9A 2KK1A 3U2MA 2LK4A 1LIHA 1MQVA 1VLTA 1ZHZA 2YEVA 3TOLA 2A1DD 2X0CA 4CJOA 3LJBA 5CIVA 3SXZA 4Q5SF 1U89A 2R7SA 4BJ6A 4WJ0A 3W8IA 4FESA 4C3EA 3K1HA 3T9OA 2LD6A 1ZHYA 3DKAA 2XL4A 3UMKA 4AE4A 3FAJA 4N6CA 2XL8A 5JLIA 2NUPB 1HY5A 3ZSUA 2YLIA 1ZW2A 2PX0A 3KKBA 1IW7F 1V4AA 3O6XA 1OCOC 3JYYA 4MNDA 1D1CA 3EZHA 4JVSA 3U3FA 1OW7A 4JCZA 2DYRC 2GFHA 3DXJF 3H2UA 4FX5A 4PK4A 1PD1A 4WABA 4JEAA 2NG1A 2XLDA 2FFHA 1ZZPA 2LCHA 3FAPB 2Y69C 2CGEA 2EPNA 3HNKA 4U5CE 4DBQA 1IZMA 3KYJA 4WGYA 3RH3A 2D5RB 5JT4A 3C8ZA 1N1CA 2FAPB 3AQBA 1A7DA 1EKYA 1MMNA 3RW0A 3A9CA 1JOGA 1MMDA 1I4YA 2DGJA 2KW3C 3AGUA 4I1MA 2M64A 1D0XA 3N0TA 2R25A 4YL3A 4JEBA 5COFA 1RCPA 2WL8A 2O9XA 5B1AC 4MW3A 3N24A 2MYSA 3S9OA 4MVSA 1NG1A 3EPVA 2G62A 1YJGA 2IXPA 1LPEA 3C8GA 3V7OA 5L3VA 3TD7A 2HS5A 5BUOA 2ETSA 1VK5A 3AOUA 1KTMA 1PV3A 1YZAA 3C18A 4MVRA 3U8PA 3G50A 4N6HA 1VLSA 4PFPA 3EFOA 3VYWA 1WWPA 2YQYA 4PR9A 3ASNC 3ZG1A 3IQ6A 3CSKA 4U5GA 2J45A 2NUTB 2YZSA 3EHNA 4LLEA 4CX9A 1QVXA 1Z3IX 1LS4A 1VYKA 4YK5A 4YJWA 2UUHA 3K6BA 3QVZA 1NZEA 3LEOA 2R7WA 4L6RA 1RJ9A 4FAPB 5A6KA 2HMZA 1M2VB 4NQFA 2LIGA 3K1IC 2ZXOA 3EZIA 1FAPB 1T01A 2XXAA 4K1OA 5A6AA 5AC4A 3DMDA 4CIHA 5TJ5E 4CSAA 1GS9A 1VOMA 4IAOA 3QW1A 4YL0A 3EQLF 4MVOA 3WG7C 2MWQA 4CS9A 2XLHA 2P7VA 4JTAB 4BJ6C 1JRAA 2XLEA 3BRJA 1BZ4A 1TQGA 1Z63A 2YL0A 2IM8A 3M4CA 4Z9JA 1NBBA 1Q0FA 4DJ9A 2EIJC 2NPUA 4CDVA 1NLXA 1TFKB 2HSBA 3DI5A 3HKKA 4LDQA 3TOMA 1HMDA 1SZIA 3LLKA 2CCYA 3QZCA 2PFDA 5IY5C 3FVYA 5DS6A 5L0JA 2ASRA 5L0HA 5L0IA 5KYUB 3UGPA 4XEFA 5CI8A 3JZ0A 5COMA 5FZTA 4MVUA 3O10A 3GANA 4OD5A 3V5XA 3ABMC 4YL1A 4BEMJ 4BPMA 1BDJB 5E3CA 3J06A 4B6IA 2Y3HA 1T6UA 3US6A 2VCCA 1H7IA 3EJNA 1O3UA 2L9JA 2J9WA 2OEVA 3HLZA 4DOZA 2ZD9A 4IJJA 4JJFA 4XPXA 1Z23A 5JP7A 3DZAA 1QPUA 2NSFA 2TMVP 1E83A 1GM5A 1Q0KA 256BA 5GPGB 3DAFA 2W4BA 1SR2A 1JPJA 3RVYA 1NU9C 4J32B 3S84A 2YHSA 4I44A 5HV9A 4AK9A 3CQZA 5D91A 5E3AA 4DRIB 2GA0A 4K7BA 3IPMO 2IXMA 4OIRF 4CDYA 4NCQA 4BJTA 2R03A 3JSZA 2R7TA 1Q0MA 4R32A 2WVQA 1WTYA 4ONSA 3M4BA 1D0ZA 2DB4A 1O5HA 3VF0A 4Q4ZF 2OG2A 1LS1A 1HW1A 2HSQA 1R4TA 3I5PA 3RQEA 3ZIBA 3JYHA 5AC5A 4IARA 2R7VA 4JTDB 2BC5A 3KYIA 2XLMA 4IRUA 4MVMA 3K1IA 3AJMA 4MTFA 1TKNA 4O7GA 3S27A 4YT8A 5DS4A 4P6IC 2KGOA 4O79A 5A6BA 1E85A 3Q6MA 1LI5A 3X2QC 2GAQA 1M2OA 2A6HF 4CDAA 4U5HA 5F5HA 3QMKA 1OKKA 4IWBA 3TQOA 2VCBA 1Z6AA 3Q7GA 3SXMA 4A2NB 2EILC 1YAUO 2YLDA 4J30B 1CGME 1J8YF 1ZYRF 3SZRA 2H8AA 3OWTA 4ZLCA 3GWNA 3U9MA 1TWHA 3B71A 4CS9C 3TK0A 2LP4A 3L1MA 1TWGA 2XM4A 4G78A 4Z9IA 3I4UA 3DE8A 2LFFA 3H65A 3GWLA 3C8GD 4EBKA 4RD9A 2C04A 2OJED 1QKRA 2JD3A 3GEIA 2P61A 2EINC 4XEVA 3UMIA 1JMWA 2VC9A 3LEVA 4MVZA 5KYXB 1OW6A 2PBEA 2J8WA 2PNOA 1JAFA 2B0HA 1E2XA 3LESA 2P0NA 5A69A 5JS5A 5KYWB 4DRJB 3FDQA 2CNWD 1RKEA 1ST6A 2QNLA 4H4KC 4QDLA 2L6FA 3W2WA 4EUKB 1OQCA 2NUPA 2W45A 3NKEA 2XLWA 3OEOA 2LQGA 3HTKC 3U0CA 3CEXA 2HV6A 4EBJA 2W9YA 5BQHA 1XZPA 2R7UA 3FOOA 1QQ3A 2IXOA 2KJGA 3EGXB 2ZXPA 1C03A 1RKCA 4IGGA 4XEKA 3SXKA 1NFOA 3R2PA 2A0BA 3N2ZB 5L0GA 1F1MA 2Y3BA 4MTGA 1ORJA 2X51A 1WGWA 2IXNA 4KC9A 5JRAA 2XLOA 2KNHA 1VB5A 4PJJA 5DVWA 3U2LA 5EGYA 2VASA 2CNWA 5E33A 1YA7O 1SYQA 4NTFA 4D4XA 1G5ZA 3EFOB 4YN0B 3G4ZA 2HV7A 3CAXA 3EGDA 3IHUA 3Q6NA 4HEAJ 5A6JA 3B29A 3PMRA 1TWCA 1H9GA 1GQAA 3MX3A 3AG3C 4NTAA 2J0XA 1C02A 5COGA 1BR2A 2YKZA 4G0HA 2OEXA 2DI3A 2ZPAA 4WGZA 3QTHA 3DWWA 3HNIA 3S28A 2BL2A 3O55A 1AVOB 1J8MF 4MTOA 2ICWG 1BR1A 2J0WA 2XS8A 3DAGA 4D4NA 5JVEA 1TFOB 2QLAA 2NUTA 3V5ZA 5DLJA 4KBLA 2Q00A 1K05A 4MW8A 2E87A 4E0HA 3HNJA 2YWAA 4JTCB 2V3CC 1HE1A 3L0IA 2XXAB 4ANJA 3AG2C 3AGTA 4JURI 2KSFA 5JSLA 4NC3A 3M15A 3SYNA 4LDKA 4DVZA 2XSEA 3IQCA 4I1OB 3POVA 2IOQA 2R7QA 1LKXA 4LACB 1FNTc 3NKDA 3S90A 3K33A 1Q0GA 3ABLC 1M2VA 3TULA 3SP1A 1Q0DA 3RYLA 1Y4CA 3NYJA 1BBHA 2EIMC 2YL1A 3PCVA 2YRFA 4X0RA 4YT2A 3JT1A 4JJGA 3R7CA 2BE5F 1FR0A 2OCCC 2WB7A 1ZU5A 3MFNA 1YA9A 1U0BB 2CDQA 1LM3B 4J7YA 3OA1A 3JTLO 2AVKA 3NMKA 2FGYA 4MQ9F 3F46A 5EK0A 4F4BA 5EHHA 4HFFB 1C17M 3O39A 4J7TA 1QLEC 1W2WA 1S7ZA 2GWWA 3W2VA 4PFOA 2L6GA 3T4RA 2Q3TA 1OR2A 5T3TA 3RQGA 3S29A 4YWQA 4W8KA 2VB6A 1WATA 3B0PA 1ZU4A 2J9BA 3UGOA 1R5ID 5KYUA 4Q7CA 2KYHA 1I4ZA 2M4EA 4U9DA 1MMGA 2PP4A 3L8IA 4JE9A 4XLNF 2H7OA 2Q7RA 1AEPA 5A6BD 5FCLA 2I8BA 3C7JA 2R9RB 2R7RA 2AWCA 3T6BA 3F47A 4MS2A 1OKKD 2A6EF 1ORSC 2C03A 2RD9A 2Y3GA 1T5OA 2GDCA 3GEHA 3NG1A 1NU7D 2QY9A 1RMVA 5CI9A 3UNGC 4I3MA 1YVIA 2HFIA 3VM6A 1FTSA 2WZGA 3LS1A 1MNEA 3FOPA 5KYNA 3EG9A 1ZHXA 3FHDA 4LDRA 3QW0A 3JSEO 1YARO 2UUIA 4P9TA 1B68A 3WHNA 4G7ZF 4PJLA 3PHF2 3ZQYA 1L7CA 2HMQA 4U5BE 4ULVA 4U9EA 1HMOA 4AL0A 5B3SC 3BEHA 5K0IA 1UG7A 1ZVZA 1U6HA 4K0DA 4C7OB 2L6HA 3EH2A 4G7OF 1NFNA 3WAQA 4DXWA 2HZ8A 4U5EE 3ZQVA 3JCUQ 3U5SA 5KYYB 3GM3A 3ZTMA 2J46A 2R02A 2Q9BA 4OINF 3DD7A 4CS7A 5B3IA 2F22A 3I5QA 4JRZA 2G3KA 5BQGA 2OJQA 4CIPA 1WN0A 1Z7Qc 3ABKC 2AU5A 3HNLA 4GYTA 2J7PA 4FWVA 4ZLDA 1A7EA 4U5DE 2QTVA 3E9VA 2EIKC 4XPWA 5T1DB 2IYLD 3U3BA 1O87A 2ZXWC 4AE4B 4C3DA 5L3QA 2HJ3A 1DOWA 1QZXA 1OCZC 2W4MA 2KQ9A 3C62A 1L3PA 3WODF 4EBBA 2Y39A 3QVYA 4XPYA 2HJMA 3TJ5A 3VRCA 1OXBA 2B0JA 3LLIA 4QI0A 4BEJA 4LLCA 2HUJA 5DQTA 3Q7LA 5F5FA 3NYLA 1VMAA 3RF3A 2WZLA 2H7BA 3NRHA 2VCAA 5AGFA 1OCRC 3EHMA 4PACA 3DM5A 3RIPA 2R05A 4AX2A 2A0UA 1CPRA 4BJ1A 4CBEA 1WOLA 3JRTA 3C63A 1RKEB 2G3VA 2J9VA 4JW1A 1M57C 4XTKA 1QSPA 3SXYA 4DBRA 3ZDLA 4E7ZA 1D0YA 3IQ5A 5L0DA 1YYJA 2Y3DA 3GODA 3LNRA 4XLPF 2Q4FA 3KH2A 5JUAA 3X1OA 3HJCA 3FXHA 2ZXRA 1JPNA 5KYXA 3S0XA 4XWJA 2JX0A 1V54C 3C8GB 4OD4A 1SF8A 2Z15A 5KYWA 2R7OA 2QUPA 4UDVA 2AWYA 3G4XA 3ITFA 4JZAA 2EPLX 3U8VA 1Z5ZA 3LAYA 1G8XA 4Z9HA 1KNYA 5E2QA 2I15A 3LS0A 1OXKA 2PX3A 4PJNA 3EGXA 4EWCA 1CGNA 1H9TA 2D4UA 3ECSA 3EGDB 3GEEA 3M79A 4OIQF 3NMJA 2EPMX 1KU2A 3ZVRA 3L8JA 3UR3C 3NDBB 2OU6A 4CS8C 1RJ9B 1FFTC 1FMWA 3FMSA 1T6IA 3IEEA 4O6MA 4HE8D 3T6JA 2WVNA 4BJ5A 2WZFA 4DVYP 1G4WR 4IB4A 5DS5A 3NMIA 4JIOA 1YDIA 1T9KA 1VYIA 2Q9AA 1CGOA 4KNWA 4H54A 1A7VA 2IBFA 5L0CA 3KPHA 1G4US 1DOVA 4CSAC 1YYXA 4EIYA 3GM1A 2AP3A 4ER9A 4N4WA 2A69F 2CW0F 3TJ6A 3L34A 3B0VC 4ULWA 3K66A 4C3BA 2CYDA 1V74B 4GEHA 4JKVA 3E70C 4O6YA 3ZTZA 1A0BA 4G7HF 4PJMA 1PD0A 2L7AA 4RDAA 4W8PA 3VAYA 1MNDA 1M56C 2JPUA 2YL7A 2MHRA 3B0UX 1MMAA 4GQHA 3U9JA 4OIOF 1K04A 4AL1A 4E7SA 1ZHTA 2J9UA 2OKUA 4LERA 4DRHB 4OIPF 1V55C 3H2VA 2LSEA 4KI2A 1M6TA 2HKVA 3RQFA
chains in the Genus database with same CATH topology
3ZQYA 3IQ6A 4ULVA 4U9EA 4CX9A 2J8WA 5JS5A 1JAFA 4CJGA 3QVZA 3ZQVA 2XLVA 4L6RA 3ZTMA 2XLWA 3ZWIA 5B3IA 3DE9A 3FOOA 4IAQA 1QQ3A 4CIPA 1APCA 3HNLA 1YZCA 1CPQA 2YLGA 2XL6A 3QW1A 5JRAA 2XLOA 2XLHA 3C62A 3QVYA 2XLEA 3VRCA 2YL0A 3M4CA 1NBBA 4D4XA 4CDVA 5AGFA 3TOMA 1GQAA 2CCYA 1CPRA 2YKZA 3C63A 4WGZA 2XM0A 2YL3A 3HNIA 1S05A 3IQ5A 4D4NA 1YYJA 1E84A 5JVEA 2QLAA 5JUAA 3HNJA 1E86A 5JP7A 5JSLA 1QPUA 1E83A 4NC3A 3M15A 256BA 1MQVA 3TOLA 4CJOA 1BBHA 2YL1A 1CGNA 3M79A 3NMJA 4CDYA 1LM3B 1E85A 2XL8A 3NMKA 5JLIA 2YLIA 3M4BA 4IB4A 3NMIA 4IARA 1CGOA 2BC5A 2XLMA 1A7VA 1YYXA 4JEAA 4EIYA 2XLDA 4ER9A 4N4WA 2J9BA 3HNKA 4WGYA 4CDAA 5JT4A 4U9DA 1EKYA 4JE9A 4JKVA 3ZTZA 2YLDA 4JEBA 1RCPA 2YL7A 3L1MA 2XM4A 3DE8A 1YZAA 3FOPA 3U8PA 3QW0A 4N6HA 1M6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZQY A;  3IQ6 A;  4ULV A;  4U9E A;  4CX9 A;  2J8W A;  5JS5 A;  1JAF A;  4CJG A;  3QVZ A;  3ZQV A;  2XLV A;  4L6R A;  3ZTM A;  2XLW A;  3ZWI A;  5B3I A;  3DE9 A;  3FOO A;  4IAQ A;  1QQ3 A;  4CIP A;  1APC A;  3HNL A;  1YZC A;  1CPQ A;  2YLG A;  2XL6 A;  3QW1 A;  5JRA A;  2XLO A;  2XLH A;  3C62 A;  3QVY A;  2XLE A;  3VRC A;  2YL0 A;  3M4C A;  1NBB A;  4D4X A;  4CDV A;  5AGF A;  3TOM A;  1GQA A;  2CCY A;  1CPR A;  2YKZ A;  3C63 A;  4WGZ A;  2XM0 A;  2YL3 A;  3HNI A;  1S05 A;  3IQ5 A;  4D4N A;  1YYJ A;  1E84 A;  5JVE A;  2QLA A;  5JUA A;  3HNJ A;  1E86 A;  5JP7 A;  5JSL A;  1QPU A;  1E83 A;  4NC3 A;  3M15 A;  256B A;  1MQV A;  3TOL A;  4CJO A;  1BBH A;  2YL1 A;  1CGN A;  3M79 A;  3NMJ A;  4CDY A;  1LM3 B;  1E85 A;  2XL8 A;  3NMK A;  5JLI A;  2YLI A;  3M4B A;  4IB4 A;  3NMI A;  4IAR A;  1CGO A;  2BC5 A;  2XLM A;  1A7V A;  1YYX A;  4JEA A;  4EIY A;  2XLD A;  4ER9 A;  4N4W A;  2J9B A;  3HNK A;  4WGY A;  4CDA A;  5JT4 A;  4U9D A;  1EKY A;  4JE9 A;  4JKV A;  3ZTZ A;  2YLD A;  4JEB A;  1RCP A;  2YL7 A;  3L1M A;  2XM4 A;  3DE8 A;  1YZA A;  3FOP A;  3U8P A;  3QW0 A;  4N6H A;  1M6T A; 
#chains in the Genus database with same CATH topology
 2A68 F;  1OR3 A;  3GOR A;  3RFY A;  5D92 A;  4E18 A;  4YT5 A;  1ZW3 A;  2KC3 A;  2P1A A;  4HFK B;  5B1B C;  3AG4 C;  4P9F A;  5HSW A;  4CJG A;  1D1A A;  1UFB A;  2V26 A;  4E0I A;  5F28 E;  2XLV A;  1LVK A;  1EA8 A;  4NTB A;  3GM2 A;  3UMH A;  3B9Q A;  4A4A A;  3JRM O;  4EKW A;  1FMV A;  4RBN A;  3ZWI A;  1ORY A;  3DE9 A;  3V5Y A;  4IAQ A;  2WVO A;  1APC A;  1LE2 A;  3KMI A;  4NY3 A;  1EI7 A;  1YZC A;  3W4Y A;  4JCH A;  3ZC4 A;  4EHP A;  5T3W A;  1CPQ A;  4E17 A;  3W8H A;  2R7X A;  2YLG A;  3LNM B;  2XL6 A;  3M1C B;  2YVK A;  4N06 A;  1GGQ A;  2J7P D;  1LE4 A;  2OQM A;  1A41 A;  1D1B A;  1K40 A;  1T6Q A;  1XZQ A;  1ZHW A;  2P6V A;  4JC7 A;  4QI2 A;  1EQ1 A;  2LFD A;  3EG9 B;  4MVQ A;  4O6N A;  4CS8 A;  4U5F E;  5BQI A;  1Y6D A;  1TWA A;  3K7D A;  3MYI A;  1HW2 A;  1OCC C;  4XQ1 A;  3PDM P;  3MBG A;  2XRH A;  3RVZ A;  4BJ5 C;  3EH1 A;  3SEO A;  3CZ6 A;  5DQZ A;  3ATP A;  4YT4 A;  1BR4 A;  1JR8 A;  1LI7 A;  4KNV A;  2H7V C;  3AG1 C;  2XM0 A;  3DJN B;  3IQT A;  2YL3 A;  1OW8 A;  1FFH A;  1S05 A;  3A11 A;  3RKO F;  1VTM P;  3MYF A;  3DJU B;  3NYM A;  1E84 A;  1TR2 A;  1YLM A;  1XWJ A;  1NSG B;  4M63 A;  1SMY F;  3MLG A;  3T6G B;  2L81 A;  3LUT B;  4C7O A;  4BG0 A;  1I5N A;  1H6G A;  2EPK X;  1E86 A;  3KL4 A;  1WAS A;  2NSG A;  2PF4 E;  2RSE B;  2VH3 A;  3SNH A;  1HE9 A;  1RXQ A;  2DYS C;  3AQC A;  1PCX A;  3DM9 B;  2Q9C A;  5KYY A;  2OOC A;  5L0F A;  2XS1 A;  3ASO C;  1AUE A;  2EPO A;  2QE9 A;  2KK1 A;  3U2M A;  2LK4 A;  1LIH A;  1MQV A;  1VLT A;  1ZHZ A;  2YEV A;  3TOL A;  2A1D D;  2X0C A;  4CJO A;  3LJB A;  5CIV A;  3SXZ A;  4Q5S F;  1U89 A;  2R7S A;  4BJ6 A;  4WJ0 A;  3W8I A;  4FES A;  4C3E A;  3K1H A;  3T9O A;  2LD6 A;  1ZHY A;  3DKA A;  2XL4 A;  3UMK A;  4AE4 A;  3FAJ A;  4N6C A;  2XL8 A;  5JLI A;  2NUP B;  1HY5 A;  3ZSU A;  2YLI A;  1ZW2 A;  2PX0 A;  3KKB A;  1IW7 F;  1V4A A;  3O6X A;  1OCO C;  3JYY A;  4MND A;  1D1C A;  3EZH A;  4JVS A;  3U3F A;  1OW7 A;  4JCZ A;  2DYR C;  2GFH A;  3DXJ F;  3H2U A;  4FX5 A;  4PK4 A;  1PD1 A;  4WAB A;  4JEA A;  2NG1 A;  2XLD A;  2FFH A;  1ZZP A;  2LCH A;  3FAP B;  2Y69 C;  2CGE A;  2EPN A;  3HNK A;  4U5C E;  4DBQ A;  1IZM A;  3KYJ A;  4WGY A;  3RH3 A;  2D5R B;  5JT4 A;  3C8Z A;  1N1C A;  2FAP B;  3AQB A;  1A7D A;  1EKY A;  1MMN A;  3RW0 A;  3A9C A;  1JOG A;  1MMD A;  1I4Y A;  2DGJ A;  2KW3 C;  3AGU A;  4I1M A;  2M64 A;  1D0X A;  3N0T A;  2R25 A;  4YL3 A;  4JEB A;  5COF A;  1RCP A;  2WL8 A;  2O9X A;  5B1A C;  4MW3 A;  3N24 A;  2MYS A;  3S9O A;  4MVS A;  1NG1 A;  3EPV A;  2G62 A;  1YJG A;  2IXP A;  1LPE A;  3C8G A;  3V7O A;  5L3V A;  3TD7 A;  2HS5 A;  5BUO A;  2ETS A;  1VK5 A;  3AOU A;  1KTM A;  1PV3 A;  1YZA A;  3C18 A;  4MVR A;  3U8P A;  3G50 A;  4N6H A;  1VLS A;  4PFP A;  3EFO A;  3VYW A;  1WWP A;  2YQY A;  4PR9 A;  3ASN C;  3ZG1 A;  3IQ6 A;  3CSK A;  4U5G A;  2J45 A;  2NUT B;  2YZS A;  3EHN A;  4LLE A;  4CX9 A;  1QVX A;  1Z3I X;  1LS4 A;  1VYK A;  4YK5 A;  4YJW A;  2UUH A;  3K6B A;  3QVZ A;  1NZE A;  3LEO A;  2R7W A;  4L6R A;  1RJ9 A;  4FAP B;  5A6K A;  2HMZ A;  1M2V B;  4NQF A;  2LIG A;  3K1I C;  2ZXO A;  3EZI A;  1FAP B;  1T01 A;  2XXA A;  4K1O A;  5A6A A;  5AC4 A;  3DMD A;  4CIH A;  5TJ5 E;  4CSA A;  1GS9 A;  1VOM A;  4IAO A;  3QW1 A;  4YL0 A;  3EQL F;  4MVO A;  3WG7 C;  2MWQ A;  4CS9 A;  2XLH A;  2P7V A;  4JTA B;  4BJ6 C;  1JRA A;  2XLE A;  3BRJ A;  1BZ4 A;  1TQG A;  1Z63 A;  2YL0 A;  2IM8 A;  3M4C A;  4Z9J A;  1NBB A;  1Q0F A;  4DJ9 A;  2EIJ C;  2NPU A;  4CDV A;  1NLX A;  1TFK B;  2HSB A;  3DI5 A;  3HKK A;  4LDQ A;  3TOM A;  1HMD A;  1SZI A;  3LLK A;  2CCY A;  3QZC A;  2PFD A;  5IY5 C;  3FVY A;  5DS6 A;  5L0J A;  2ASR A;  5L0H A;  5L0I A;  5KYU B;  3UGP A;  4XEF A;  5CI8 A;  3JZ0 A;  5COM A;  5FZT A;  4MVU A;  3O10 A;  3GAN A;  4OD5 A;  3V5X A;  3ABM C;  4YL1 A;  4BEM J;  4BPM A;  1BDJ B;  5E3C A;  3J06 A;  4B6I A;  2Y3H A;  1T6U A;  3US6 A;  2VCC A;  1H7I A;  3EJN A;  1O3U A;  2L9J A;  2J9W A;  2OEV A;  3HLZ A;  4DOZ A;  2ZD9 A;  4IJJ A;  4JJF A;  4XPX A;  1Z23 A;  5JP7 A;  3DZA A;  1QPU A;  2NSF A;  2TMV P;  1E83 A;  1GM5 A;  1Q0K A;  256B A;  5GPG B;  3DAF A;  2W4B A;  1SR2 A;  1JPJ A;  3RVY A;  1NU9 C;  4J32 B;  3S84 A;  2YHS A;  4I44 A;  5HV9 A;  4AK9 A;  3CQZ A;  5D91 A;  5E3A A;  4DRI B;  2GA0 A;  4K7B A;  3IPM O;  2IXM A;  4OIR F;  4CDY A;  4NCQ A;  4BJT A;  2R03 A;  3JSZ A;  2R7T A;  1Q0M A;  4R32 A;  2WVQ A;  1WTY A;  4ONS A;  3M4B A;  1D0Z A;  2DB4 A;  1O5H A;  3VF0 A;  4Q4Z F;  2OG2 A;  1LS1 A;  1HW1 A;  2HSQ A;  1R4T A;  3I5P A;  3RQE A;  3ZIB A;  3JYH A;  5AC5 A;  4IAR A;  2R7V A;  4JTD B;  2BC5 A;  3KYI A;  2XLM A;  4IRU A;  4MVM A;  3K1I A;  3AJM A;  4MTF A;  1TKN A;  4O7G A;  3S27 A;  4YT8 A;  5DS4 A;  4P6I C;  2KGO A;  4O79 A;  5A6B A;  1E85 A;  3Q6M A;  1LI5 A;  3X2Q C;  2GAQ A;  1M2O A;  2A6H F;  4CDA A;  4U5H A;  5F5H A;  3QMK A;  1OKK A;  4IWB A;  3TQO A;  2VCB A;  1Z6A A;  3Q7G A;  3SXM A;  4A2N B;  2EIL C;  1YAU O;  2YLD A;  4J30 B;  1CGM E;  1J8Y F;  1ZYR F;  3SZR A;  2H8A A;  3OWT A;  4ZLC A;  3GWN A;  3U9M A;  1TWH A;  3B71 A;  4CS9 C;  3TK0 A;  2LP4 A;  3L1M A;  1TWG A;  2XM4 A;  4G78 A;  4Z9I A;  3I4U A;  3DE8 A;  2LFF A;  3H65 A;  3GWL A;  3C8G D;  4EBK A;  4RD9 A;  2C04 A;  2OJE D;  1QKR A;  2JD3 A;  3GEI A;  2P61 A;  2EIN C;  4XEV A;  3UMI A;  1JMW A;  2VC9 A;  3LEV A;  4MVZ A;  5KYX B;  1OW6 A;  2PBE A;  2J8W A;  2PNO A;  1JAF A;  2B0H A;  1E2X A;  3LES A;  2P0N A;  5A69 A;  5JS5 A;  5KYW B;  4DRJ B;  3FDQ A;  2CNW D;  1RKE A;  1ST6 A;  2QNL A;  4H4K C;  4QDL A;  2L6F A;  3W2W A;  4EUK B;  1OQC A;  2NUP A;  2W45 A;  3NKE A;  2XLW A;  3OEO A;  2LQG A;  3HTK C;  3U0C A;  3CEX A;  2HV6 A;  4EBJ A;  2W9Y A;  5BQH A;  1XZP A;  2R7U A;  3FOO A;  1QQ3 A;  2IXO A;  2KJG A;  3EGX B;  2ZXP A;  1C03 A;  1RKC A;  4IGG A;  4XEK A;  3SXK A;  1NFO A;  3R2P A;  2A0B A;  3N2Z B;  5L0G A;  1F1M A;  2Y3B A;  4MTG A;  1ORJ A;  2X51 A;  1WGW A;  2IXN A;  4KC9 A;  5JRA A;  2XLO A;  2KNH A;  1VB5 A;  4PJJ A;  5DVW A;  3U2L A;  5EGY A;  2VAS A;  2CNW A;  5E33 A;  1YA7 O;  1SYQ A;  4NTF A;  4D4X A;  1G5Z A;  3EFO B;  4YN0 B;  3G4Z A;  2HV7 A;  3CAX A;  3EGD A;  3IHU A;  3Q6N A;  4HEA J;  5A6J A;  3B29 A;  3PMR A;  1TWC A;  1H9G A;  1GQA A;  3MX3 A;  3AG3 C;  4NTA A;  2J0X A;  1C02 A;  5COG A;  1BR2 A;  2YKZ A;  4G0H A;  2OEX A;  2DI3 A;  2ZPA A;  4WGZ A;  3QTH A;  3DWW A;  3HNI A;  3S28 A;  2BL2 A;  3O55 A;  1AVO B;  1J8M F;  4MTO A;  2ICW G;  1BR1 A;  2J0W A;  2XS8 A;  3DAG A;  4D4N A;  5JVE A;  1TFO B;  2QLA A;  2NUT A;  3V5Z A;  5DLJ A;  4KBL A;  2Q00 A;  1K05 A;  4MW8 A;  2E87 A;  4E0H A;  3HNJ A;  2YWA A;  4JTC B;  2V3C C;  1HE1 A;  3L0I A;  2XXA B;  4ANJ A;  3AG2 C;  3AGT A;  4JUR I;  2KSF A;  5JSL A;  4NC3 A;  3M15 A;  3SYN A;  4LDK A;  4DVZ A;  2XSE A;  3IQC A;  4I1O B;  3POV A;  2IOQ A;  2R7Q A;  1LKX A;  4LAC B;  1FNT c;  3NKD A;  3S90 A;  3K33 A;  1Q0G A;  3ABL C;  1M2V A;  3TUL A;  3SP1 A;  1Q0D A;  3RYL A;  1Y4C A;  3NYJ A;  1BBH A;  2EIM C;  2YL1 A;  3PCV A;  2YRF A;  4X0R A;  4YT2 A;  3JT1 A;  4JJG A;  3R7C A;  2BE5 F;  1FR0 A;  2OCC C;  2WB7 A;  1ZU5 A;  3MFN A;  1YA9 A;  1U0B B;  2CDQ A;  1LM3 B;  4J7Y A;  3OA1 A;  3JTL O;  2AVK A;  3NMK A;  2FGY A;  4MQ9 F;  3F46 A;  5EK0 A;  4F4B A;  5EHH A;  4HFF B;  1C17 M;  3O39 A;  4J7T A;  1QLE C;  1W2W A;  1S7Z A;  2GWW A;  3W2V A;  4PFO A;  2L6G A;  3T4R A;  2Q3T A;  1OR2 A;  5T3T A;  3RQG A;  3S29 A;  4YWQ A;  4W8K A;  2VB6 A;  1WAT A;  3B0P A;  1ZU4 A;  2J9B A;  3UGO A;  1R5I D;  5KYU A;  4Q7C A;  2KYH A;  1I4Z A;  2M4E A;  4U9D A;  1MMG A;  2PP4 A;  3L8I A;  4JE9 A;  4XLN F;  2H7O A;  2Q7R A;  1AEP A;  5A6B D;  5FCL A;  2I8B A;  3C7J A;  2R9R B;  2R7R A;  2AWC A;  3T6B A;  3F47 A;  4MS2 A;  1OKK D;  2A6E F;  1ORS C;  2C03 A;  2RD9 A;  2Y3G A;  1T5O A;  2GDC A;  3GEH A;  3NG1 A;  1NU7 D;  2QY9 A;  1RMV A;  5CI9 A;  3UNG C;  4I3M A;  1YVI A;  2HFI A;  3VM6 A;  1FTS A;  2WZG A;  3LS1 A;  1MNE A;  3FOP A;  5KYN A;  3EG9 A;  1ZHX A;  3FHD A;  4LDR A;  3QW0 A;  3JSE O;  1YAR O;  2UUI A;  4P9T A;  1B68 A;  3WHN A;  4G7Z F;  4PJL A;  3PHF 2;  3ZQY A;  1L7C A;  2HMQ A;  4U5B E;  4ULV A;  4U9E A;  1HMO A;  4AL0 A;  5B3S C;  3BEH A;  5K0I A;  1UG7 A;  1ZVZ A;  1U6H A;  4K0D A;  4C7O B;  2L6H A;  3EH2 A;  4G7O F;  1NFN A;  3WAQ A;  4DXW A;  2HZ8 A;  4U5E E;  3ZQV A;  3JCU Q;  3U5S A;  5KYY B;  3GM3 A;  3ZTM A;  2J46 A;  2R02 A;  2Q9B A;  4OIN F;  3DD7 A;  4CS7 A;  5B3I A;  2F22 A;  3I5Q A;  4JRZ A;  2G3K A;  5BQG A;  2OJQ A;  4CIP A;  1WN0 A;  1Z7Q c;  3ABK C;  2AU5 A;  3HNL A;  4GYT A;  2J7P A;  4FWV A;  4ZLD A;  1A7E A;  4U5D E;  2QTV A;  3E9V A;  2EIK C;  4XPW A;  5T1D B;  2IYL D;  3U3B A;  1O87 A;  2ZXW C;  4AE4 B;  4C3D A;  5L3Q A;  2HJ3 A;  1DOW A;  1QZX A;  1OCZ C;  2W4M A;  2KQ9 A;  3C62 A;  1L3P A;  3WOD F;  4EBB A;  2Y39 A;  3QVY A;  4XPY A;  2HJM A;  3TJ5 A;  3VRC A;  1OXB A;  2B0J A;  3LLI A;  4QI0 A;  4BEJ A;  4LLC A;  2HUJ A;  5DQT A;  3Q7L A;  5F5F A;  3NYL A;  1VMA A;  3RF3 A;  2WZL A;  2H7B A;  3NRH A;  2VCA A;  5AGF A;  1OCR C;  3EHM A;  4PAC A;  3DM5 A;  3RIP A;  2R05 A;  4AX2 A;  2A0U A;  1CPR A;  4BJ1 A;  4CBE A;  1WOL A;  3JRT A;  3C63 A;  1RKE B;  2G3V A;  2J9V A;  4JW1 A;  1M57 C;  4XTK A;  1QSP A;  3SXY A;  4DBR A;  3ZDL A;  4E7Z A;  1D0Y A;  3IQ5 A;  5L0D A;  1YYJ A;  2Y3D A;  3GOD A;  3LNR A;  4XLP F;  2Q4F A;  3KH2 A;  5JUA A;  3X1O A;  3HJC A;  3FXH A;  2ZXR A;  1JPN A;  5KYX A;  3S0X A;  4XWJ A;  2JX0 A;  1V54 C;  3C8G B;  4OD4 A;  1SF8 A;  2Z15 A;  5KYW A;  2R7O A;  2QUP A;  4UDV A;  2AWY A;  3G4X A;  3ITF A;  4JZA A;  2EPL X;  3U8V A;  1Z5Z A;  3LAY A;  1G8X A;  4Z9H A;  1KNY A;  5E2Q A;  2I15 A;  3LS0 A;  1OXK A;  2PX3 A;  4PJN A;  3EGX A;  4EWC A;  1CGN A;  1H9T A;  2D4U A;  3ECS A;  3EGD B;  3GEE A;  3M79 A;  4OIQ F;  3NMJ A;  2EPM X;  1KU2 A;  3ZVR A;  3L8J A;  3UR3 C;  3NDB B;  2OU6 A;  4CS8 C;  1RJ9 B;  1FFT C;  1FMW A;  3FMS A;  1T6I A;  3IEE A;  4O6M A;  4HE8 D;  3T6J A;  2WVN A;  4BJ5 A;  2WZF A;  4DVY P;  1G4W R;  4IB4 A;  5DS5 A;  3NMI A;  4JIO A;  1YDI A;  1T9K A;  1VYI A;  2Q9A A;  1CGO A;  4KNW A;  4H54 A;  1A7V A;  2IBF A;  5L0C A;  3KPH A;  1G4U S;  1DOV A;  4CSA C;  1YYX A;  4EIY A;  3GM1 A;  2AP3 A;  4ER9 A;  4N4W A;  2A69 F;  2CW0 F;  3TJ6 A;  3L34 A;  3B0V C;  4ULW A;  3K66 A;  4C3B A;  2CYD A;  1V74 B;  4GEH A;  4JKV A;  3E70 C;  4O6Y A;  3ZTZ A;  1A0B A;  4G7H F;  4PJM A;  1PD0 A;  2L7A A;  4RDA A;  4W8P A;  3VAY A;  1MND A;  1M56 C;  2JPU A;  2YL7 A;  2MHR A;  3B0U X;  1MMA A;  4GQH A;  3U9J A;  4OIO F;  1K04 A;  4AL1 A;  4E7S A;  1ZHT A;  2J9U A;  2OKU A;  4LER A;  4DRH B;  4OIP F;  1V55 C;  3H2V A;  2LSE A;  4KI2 A;  1M6T A;  2HKV A;  3RQF A; 
#chains in the Genus database with same CATH homology
 3ZQY A;  3IQ6 A;  4ULV A;  4U9E A;  4CX9 A;  2J8W A;  5JS5 A;  1JAF A;  4CJG A;  3QVZ A;  3ZQV A;  2XLV A;  4L6R A;  3ZTM A;  2XLW A;  3ZWI A;  5B3I A;  3DE9 A;  3FOO A;  4IAQ A;  1QQ3 A;  4CIP A;  1APC A;  3HNL A;  1YZC A;  1CPQ A;  2YLG A;  2XL6 A;  3QW1 A;  5JRA A;  2XLO A;  2XLH A;  3C62 A;  3QVY A;  2XLE A;  3VRC A;  2YL0 A;  3M4C A;  1NBB A;  4D4X A;  4CDV A;  5AGF A;  3TOM A;  1GQA A;  2CCY A;  1CPR A;  2YKZ A;  3C63 A;  4WGZ A;  2XM0 A;  2YL3 A;  3HNI A;  1S05 A;  3IQ5 A;  4D4N A;  1YYJ A;  1E84 A;  5JVE A;  2QLA A;  5JUA A;  3HNJ A;  1E86 A;  5JP7 A;  5JSL A;  1QPU A;  1E83 A;  4NC3 A;  3M15 A;  256B A;  1MQV A;  3TOL A;  4CJO A;  1BBH A;  2YL1 A;  1CGN A;  3M79 A;  3NMJ A;  4CDY A;  1LM3 B;  1E85 A;  2XL8 A;  3NMK A;  5JLI A;  2YLI A;  3M4B A;  4IB4 A;  3NMI A;  4IAR A;  1CGO A;  2BC5 A;  2XLM A;  1A7V A;  1YYX A;  4JEA A;  4EIY A;  2XLD A;  4ER9 A;  4N4W A;  2J9B A;  3HNK A;  4WGY A;  4CDA A;  5JT4 A;  4U9D A;  1EKY A;  4JE9 A;  4JKV A;  3ZTZ A;  2YLD A;  4JEB A;  1RCP A;  2YL7 A;  3L1M A;  2XM4 A;  3DE8 A;  1YZA A;  3FOP A;  3U8P A;  3QW0 A;  4N6H A;  1M6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...