4JEDA

Crystal structure of glutathione s-transferase mrad2831_1084 (target efi-507060) from methylobacterium radiotolerans jcm 2831, complex with glutathione sulfonate
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
212
structure length
212
Chain Sequence
TRYRLISATPSPYARKVRIALAEKGLPFELVTEVPWDSATTVPRHNPLEKLPVLLLPAGGSVYESSYILQWLELKHPDPPLLPPDPDGVLAARRYEVLCDGICDAVVLTFFERQRDEAGRSAPWLARQRRKIEGGLAEIARLLGDRDWTVGDRFTLGDIAAGTVTGYLSVRFPELDWRARHPNLARLSDRLEARPSFADSVPYAQTITDRVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Crystal structure of glutathione S-transferase (TARGET EFI-507060) from Methylobacterium radiotolerans
rcsb
source organism Methylobacterium radiotolerans
molecule tags Transferase
total genus 68
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2013-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4jedA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4jedA01
1MDIA 4E8HA 3ZVJD 4G0LA 4CW9A 2AHEA 2FGXA 4F03A 4KDUA 4N0ZA 3G7JA 5DALA 1Z9HA 1PN9A 5E4WA 1SKWB 4L0UA 3BCIA 1EEMA 1DSBA 1BAYA 1ERUA 1XPVA 2V41A 5CRGA 2I81A 1JZDA 5FT3A 2DJ1A 3FR3A 4F2IA 2XPEA 1A24A 2DMMA 3P90A 2KOKA 1SU9A 2MMNA 1A8YA 1BJXA 2FD3A 1HNCA 4BL7A 3F6FA 4KCEA 3KP8A 2YJHA 2O85A 1KBNA 4ACSA 4WKWA 5ELAA 3UMAA 3FZ5A 4V1Ag 1WOUA 5G31A 3IOSA 4AF2A 5J4UA 4IN0A 4TR4A 3GA4A 1FW1A 2KUCA 3MWHA 3VI5A 3IXRA 3UOMA 2IFQB 2H72A 2VCTA 3GUSA 3TJBA 2X8GA 5JWRB 4OCEA 5F05A 4ILFA 4PQIA 2IMEA 3IBHA 3RHCA 2WS2A 1EP7A 2O89A 1JLVA 2L57A 1AC1A 1A2LA 1PSQA 6GSSA 1ST9A 4HU9A 4KSMA 2HT9A 2OJLA 1SYRA 4MJCA 1AXDA 3GSSA 1M9BA 1THXA 5DAKA 3VPTA 1DE1A 1M2DA 1VF4A 1TW9A 5F06A 1V58A 4X43A 1PX7A 4EO3A 2GZPA 5J41A 1OC8A 1SYXA 4Z7XA 3CSJA 4FYBA 4MMMA 4TKYA 3TDGA 2C80A 3C7MA 1F6MC 3PR8A 1XZOA 4FO5A 4GQCA 4OMVA 2IPAA 5JWQB 1TI1A 5IMCA 4GF0A 5IMDA 3GL5A 2LRTA 1GTAA 4MDCA 2CA8A 2VL2A 6GSWA 2GDRA 1GWCA 5B8AA 5FWGA 4NMUA 4DSQA 2PVOC 2DC5A 3ZIVA 1XOAA 2X64A 3UARA 2YANA 1WP0A 2B7JA 1TI3A 5ECOB 2H6ZA 3NOFA 2VD1A 2BMXA 1PGTA 2ZCTA 1I5GA 2ES7A 1GULA 2CT6A 2YP6A 4FYCA 3E9JB 3QFBC 4ECCA 3D4MA 2A2SA 1IYHA 5GSSA 1NM3A 8GSSA 3FK8A 3BD2A 1F9MA 5EPFA 1WRYA 4BWQA 4KA0A 1TP9A 1YKAA 4QL7A 1XW6A 1T1VA 1MDKA 4TR1A 5D9XA 4LA1A 1Z6NA 4BVXA 3GKKA 3ME8A 3FZ4A 3EE2A 3I6AA 4TXOA 4XS1A 2M46A 3LXTA 2E7PA 3HHVA 2DJKA 2CVKA 3WGXA 2QC7A 2HQTA 1B9XC 2VCWA 2IMIA 2NPBA 4DEJA 2FLSA 1G6YA 1XW5A 2VD0A 5AIVA 1HD2A 3KIJA 3UIWA 2GQLA 2WULA 1AUCA 3QPMA 1MEKA 2VL9A 4DSSB 3H93A 2VAFA 5AIXA 2MMAA 1B9YC 3UJ1A 4MZBA 1PQNA 2GZYA 4XHMA 3C8EA 2R4VA 2B5YA 2MZCA 4K7OA 4WEYA 4IKHA 1MDJA 1O85A 2KP1A 3TKQA 4QL9A 1K3YA 3EYTA 4OD7A 4PQ1A 2ALBA 3WT1A 4BPYA 3ZFLA 1GTBA 1OC9B 1X5CA 3GURA 5ECKB 3HZ8A 1N2AA 5J9CA 1XXUA 1QMVA 3HZ4A 4PNGA 5HR0A 1ZYQB 4ZL9A 1R4WA 1EGRA 3DYRA 1GTIA 3W6GA 2LKUA 3KEBA 4J2FA 3RHBA 3E0UA 4PNFA 1TU8A 3HJOA 1A2JA 4JRRA 4KDXA 2GLRA 2A4VA 3ED3A 4IQAA 3C71A 1SK1A 2FA8A 2OBIA 3D21A 1GNEA 17GSA 4XRAA 4JZQA 2L5LA 3P8WA 1T00A 3P7XA 5G5EA 4PUAA 3WGEA 1EV4A 5JWOB 4ZXGA 2JADA 3APSA 18GSA 4TOPA 1PD21 2F8FA 4EKZA 2XHFA 5GSTA 2GT6A 5G30A 4KF9A 2YWNA 4LL1B 1JZOA 6GSUA 4TVEA 2JZSA 2LTKA 3IA1A 1PL2A 4RQRA 4XS4B 3TRPA 2PMTA 2DIZA 2WFCA 4K9ZA 4KGIA 4MCUA 2IJYA 3F4RA 1AQXA 3R3EA 4BA7A 2FA4A 5E59A 4I2TA 4NHWA 2L4QA 4OO4A 3W8SA 2TRXA 2V1MA 4PQHA 5ECSA 4ECBA 3M1GA 5A4WA 4EC0A 1PKZA 3KP9A 2UZ8A 1Z5YE 4ULXA 3M8NA 5G5FA 1SD8A 1V98A 1MD3A 1OC3A 1A0RP 5DQSA 3CRUA 1N8JA 2E2MA 2LNTA 3M9KA 1GUHA 2E2GA 1OE7A 3KD0A 1M0UA 4POLA 3EINA 4ZB9A 1GSSA 3LGCA 1TU7A 4WF5A 1TTZA 4GXZA 4EVMA 3L4NA 4GWRA 3FZ9A 1YDKA 1F37A 4E8EA 2KP2A 4IP6A 3TOTA 1TDIA 4Q5FA 5AGYA 1B48A 5IMZA 1ZGNA 4ZL8A 2GTUA 5CNWA 1GTUA 3LSZA 3O6TA 1MTCA 3ME7A 1BX9A 1ZZYA 4OFTA 4AJ7A 4HEA2 1K0BA 3SWLA 4OWYA 1ZOFA 3CSIA 2HYXA 3ZYWA 2O8VB 3WGDA 3G7IA 16GSA 3FRCA 2TIRA 5JCGA 4IW9A 2B5XA 5IMFA 4ZIJA 3VURA 3CRTA 3Q6OA 2CVDA 4WR5A 5D96A 3I43A 2CQ9A 2GSQA 4L5OA 5H5QA 5ECLB 4IS0A 3FR6A 2PUKC 3KTBA 2H01A 3S9FA 5AISA 1X9SB 3AY8A 1GSUA 4K0NA 2YCDA 3TKPA 4ZB6A 3GNJA 1K0NA 1SK2A 2OACA 2K18A 2VLVA 5D93A 1RK4A 1O73A 2DJ3A 4WR4A 2PU9C 3LQ7A 2YPMA 2F3MA 1X5EA 2HZEB 3QCPA 2WGRA 5D73A 5ECIB 2OE1A 2LS5A 2C1YA 1JLWA 2PGTA 2X8HA 1BQ7A 2X99A 2NBSA 2GSSA 4F9ZA 3G7YA 1THOA 2MBSA 4NHZA 4TXVA 4L5LA 2H1BA 4HOJA 1EV9A 4TR3A 5GZZB 4PTSA 5F07A 2FUG2 4I5QA 4X1UA 1ERWA 3HVXA 3ZLPA 5JCUA 4K1FA 2IWTA 3D4TA 2ZUPA 3F8UA 2HZFA 2VLUA 4V2LA 3QR6A 5DQYA 5DALB 2FWGA 3QAVA 3HVVA 3JCML 1DE2A 2ON7A 4K7IA 5IOWA 2RUEA 3ZTLA 4HJMA 5DVBA 2YOIA 2AUVA 1JFUA 3KGKA 1UN2A 4YH2A 2VL2C 4F82A 2YV7A 4JE1A 2H6YA 1YEPA 2IMFA 1J9BA 4AGSA 2VL3A 1MD4A 2C8UA 1SJZA 2LQQA 4IP1A 1WMJA 1HNBA 4BL7B 2B1KA 3TJGA 1PRXA 5CRDA 4HS1A 1WJKA 1XVQA 2RIIA 3QMXA 4G2EA 5A5KA 4MZWA 3EU4A 1BG5A 2HSMA 4I8BA 4ZBDA 1R5PA 3VWVA 5ECPB 2VIMA 1ML6A 1KNGA 2H19A 3BOAA 3RAZA 3OR5A 1U6TA 2PERA 1QQ2A 3GX8A 2CX3A 1J0FA 3L0HA 4OFMA 2I1UA 1A8LA 3MAKA 5KN3A 3LXZA 2DLXA 3VFIA 4KDYA 4V2NA 3WYWA 2AB6A 2VM1A 4GCIA 2R37A 2YZHA 4JR6A 3QFAC 3LG6A 3TCOA 2I3YA 2IMDA 1T7PB 1FHEA 5G2ZA 4ZBBA 2M80A 1GUKA 1T4YA 2VO4A 5ELGA 5DAKB 1PKWA 3A2VA 1U3AA 1Z7PA 1WE0A 2YZUA 1PL1A 4GSNA 4GTUA 3EVIA 3F4TA 2LQOA 2RM5A 4N30A 1QGVA 4Q5QA 3SBCA 4TRXA 5G1KA 1O8XA 1TJDA 2HRKA 1DBYA 3GTUA 1Q98A 1SL1B 5CRWA 2PPTA 4DSRA 4ML6A 3GL3A 1SKSB 4ECIA 1GSYA 1VRSD 4O32A 3DD3A 2QSIA 3UBKA 4D73A 3HDCA 2C0FA 4MH2A 4G9HA 1OYJA 1ERVA 2V6OA 3H4KA 2H6XA 4FQUA 4EE0A 1U3IA 4XRDA 6GSVA 3KZQA 3EMPA 3UEMA 4HDEA 2GT5A 2YWMA 2FCHA 5CREA 1V2AA 3DWVA 3HY2A 3MDKA 3EWLA 5IM9A 2CX4A 1AW9A 1GP1A 4ECJA 1NSWA 4TR1B 2HRFA 1XWGA 3TRXA 2ON5A 1SKRB 5F8BA 4BVXB 2L5OA 4KW6A 3R2QA 4WF4A 4TXOB 1SJIA 1XCCA 4OFNA 3TRQA 3P2AA 4IBPA 4USSA 3IPZA 3N9JA 4EDYA 4IQ1A 4IGJA 2G2QA 4HQZA 5G1LA 3IAS2 3LFLA 1ZYEA 3GH9A 2TRCP 2VCZA 4G19A 1T8EB 2QGVA 3NZNA 4MLYA 1FVJA 1FVKA 1T3BA 2AAWA 2N5FA 3FYGA 4JEDA 3A3TA 3HYPA 4AJ8A 3A5WA 3ERFA 5ENUA 2EC4A 4HUAA 5EL8A 2H74A 3D5JA 4YQUA 4POKA 4O5RA 4NWYA 2GQKA 6GSYA 7GSSA 2DJ0A 1LU4A 1U88A 1FOVA 1OE8A 2FY6A 3L9SA 1Z3EA 1UA5A 2LJAA 4HZ4A 1YF1A 1M9AA 1ACVA 1E6BA 3A2WA 3US3A 2IL3A 3LJRA 5KN0A 1EOGA 2H1DA 4N10A 1OVNA 1I9DA 4IJIA 4BVYA 3VLNA 4NAXA 3E3EA 3IE3A 3IC4A 1YEXA 1YKCA 3APQA 3CMIA 1QUWA 3G9BA 2BTOT 5CRHA 3TGZA 4K2DA 2C3NA 5INYA 1M2BA 3GMFA 4EL1A 1KEBA 4MPFA 3UAPA 2I4AA 1G0TA 2LSTA 1CQGA 3F63A 1B4QA 1NHOA 2DBCA 4EDZA 4K7NA 1EGOA 5ECHB 3CSHA 3BJ5A 2H76A 2JZTA 4F0BA 3KH9A 3KJYA 3UVHA 1K0DA 1R5AA 3FY7A 1TKDB 2H1GA 1F3AA 2RM6A 3DVWA 4GLTA 2R3XA 1R7HA 3IHQA 1XWAA 2LNSA 2YN1A 1C72A 1ZL9A 1O8WA 1G7OA 4FIWA 5ECRB 1YZXA 3VWWA 1Z6MA 3DVXA 3D22A 3KH7A 5A4VA 1JZRA 3KTLA 2R6KA 2VM2A 3TKSA 4EUYA 2MBTA 2K8SA 4L8EA 1URMA 1PA3A 3DMLA 3IAM2 5HQPA 4LMVA 3HKRA 1AQVA 2EIQA 2VUPA 3GH6A 1TK8B 1BYEA 2CZ3A 1X5DA 1X0RA 1M99A 1EOHA 2PVQA 5LNKe 2F9SA 3GKXA 1GSFA 1DUGA 2HE3A 4MPGA 4WBRD 3Q74A 2O87A 2OADA 4KUNA 2JSZA 3HD5A 2M72A 1WPIA 4PURA 5ID2A 1WIKA 3TOUA 1FB6A 4MJBA 1YJ6A 3TB2A 2FWFA 2VCVA 3UBLA 1TRVA 2B3SA 3UVTA 1SJ6A 3QOUA 3TJKA 5BMUA 2IIYA 4L0WA 19GSA 2F51A 5JCWA 4LL4B 2I9HA 3IC8A 3H1NA 4X0XA 3KMOA 1ZMAA 2HRAA 5ECMB 2B6MA 3L9UA 4HI7A 2YWIA 3IK9A 5D9VA 2B7KA 4GRFA 1O6JA 2YJ7A 2GS3A 4H86A 2MYGA 1RW1A 4KCAA 2H30A 1B4PA 2H0IA 2KHPA 3QD9A 1S3CA 5L71A 4ISDA 3KM6A 4HZ2A 5IMVA 4WXTA 1G7EA 3ERWA 2FWEA 2EIOA 4JBBA 3LWAA 2L6CA 4JU5A 3GKMA 3ZREA 5C00A 1X9MB 1PMTA 4PXOA 5A4UA 5IQYA 4IHUA 1YF0A 2XBIA 2H71A 5CO3A 5DCGA 3F4SA 3TUEA 1K0MA 1XIYA 1SK0A 3WD6A 2F8AA 2PBJA 3C1RA 1K0CA 6GSXA 3DEXA 4V1Ap 1UC7A 3O76A 2N5BA 4RI6A 3WT2A 4ZILA 14GSA 2K8VA 1X9WB 2GSRA 4G10A 4I97A 2QKEA 1OKTA 2J23A 4NPBA 3RPPA 2DJJA 2AJQB 3LYKA 3ZRDA 3HA9A 2K9FA 3QDNA 2IFQA 5GAND 2CVBA 1GLQA 1GNWA 13GSA 4IELA 1XWBA 4HQSA 4AJ6A 2V32A 3K8NA 2HRNA 1HQOA 4J57E 2H1AA 3APOA 5HFIA 3GX0A 4N11A 5B6NA 1XOBA 1NHYA 2RUFA 1WWJA 1NW2A 3GIXA 3LEFA 1SL2B 2P5QA 3FHKA 3KMNA 1U87A 3QAGA 4ZB8A 2DMLA 3EU3A 2HSMB 4LLRA 1VF3A 2B5EA 3VK9A 3TJFA 3A2XA 2OE0A 4J56E 1R26A 3RDWA 1VF1A 4OCFA 4XCSA 1AIUA 4P3YB 3GRXA 3IK7A 3GV1A 3HVSA 1EEJA 1XWKA 4BWSA 1G6WA 9GSSA 3J7Yb 2JU5A 4MJAA 5IIZA 4TW5A 2JACA 3IV4A 1F2EA 1TK5B 4HU7A 2O7KA 1E2YA 2HSHA 5ECQB 2VOCA 1IYIA 2HSYA 1OKDA 3HJPA 4IVFA 4FH8A 4POBA 5CAXA 4FYUA 4TR0A 2E0QA 5B7CA 3DKSA 3PGTA 1M7TA 3UL3A 5IPHA 1A2MA 2J9HA 2LRCA 2L6DA 1W4VA 4RI7A 5D9WA 5H5SA 1EP8A 4MJEA 4MF6A 5IO2A 1FG4A 3ZITA 1JZWA 3CYNA 1RQMA 1ERTA 2GVPA 2P0GA 3ZIJA 2LV3A 3FZAA 1XW9A 5KN1A 2A2RA 5F0GA 1GSQA 1B8XA 1H75A 2L59A 1F3BA 5LCZA 3EMXA 1ABAA 2OE3A 2Z9SA 4MA9A 2HRKB 4O7HA 3CTFA 2WZ9A 4HJ2A 3GTUB 3NIVA 20GSA 2H0HA 3L9VA 3W8JA 4K6XA 2IN3A 2VCXA 4RQXA 1Q4JA 2R2JA 1O7UA 2CZ2A 3ZMLA 1KTEA 2C3TA 1K0OA 4D73B 2P31A 4MF7A 4OO5A 4MABA 2JZRA 4KSOA 2OBKA 1TRSA 2V2GA 2ZNMA 5IPGA 4XS6A 2WRTA 5DJLA 3C73A 3GYKA 4QQ7A 2V6KA 4O92A 2XBQA 3C1SA 2HI7A 5ECNB 1SENA 1H4OA 4EXJA 4ML1A 4KX4A 4DSSA 1LBKA 2CAQA 4Q5RA 4I2UA 5EY6A 2XC2A 5KN2A 5LD0A 2WJUA 3N5OA 3FKFA 2C4JA 5D9TA 5IO0A 1GH2A 3MSZA 2DSAA 2YNXA 3CBUA 5IOXA 3TKSE 1AQWA 3KXOA 4WETA 1A23A 3VPQA 2PWJA 1USBA 3HXSA 4PGTA 1LJRA 2C0DA 2HLSA 4K8MA 3PPUA 4NXIA 5HR1A 3M9JA 1FB0A 3EC3A 1TRUA 2LJKA 1HYUA 3TJJA 4Q5NA 1OC9A 5DBQA 3FR9A 5HFKA 1J08A 1QXHA 3H8QA 1BEDA 2P5RA 4XTSA 1VF2A 2AYTA 4EF0A 3DGQA 3D0ZA 1XVWA 1K0AA 1K3OA 4GQFA 4KE3A 1SL0B 5KEJA 3FEUA 1HNAA 1GRXA 5AN1A 2C0GA 3LORA 2VLTA 3D6IA 3VWXA 1GLPA 1XBSA 2NTOA 3RPNA 3RBTA 4POMA 1O81A 1YY7A 2GZZA 3GSTA 3CXGA 5HR2A 1OAZA 5B6MA 3VI7A 2H8LA 4LMWA 5FHIA 3TKSC 3VWUA 1PX6A 2C0EA 1ZCPA 1JHBA 3I69A 2XPDA 22GSA 3IR4A 1CQHA 5B8BA 2JL4A 1K3LA 2D2ZA 1V9WA 2WDUA 1EWXA 5IMAA 5DDLA 5H5RA 4CHSA 2B1LA 1FAAA 4G0IA 3MNGA 1XWCA 1ILOA 5GAPD 2R5GA 4BVYB 3L78A 2PN8A 4I6XA 3CTGA 3ZFBA 2C3QA 3F3RA 3GHAA 5D8IA 1FO5A 4XS4A 2LRNA 1GSDA 3ZL5A 2FHEA 2LJRA 10GSA 3ZVJA 4MP4A 2HXKA 2DIYA 3DXBA 3O3TA 3FW2A 1EZKA 2L4CA 2GSTA 2FNOA 4KB3A 2LEGA 3F9UA 2OKAA 1S3DA 3ERGA 2NDOA 3J7Yk 12GSA 5CYYA 4KNDA 2RLIA 3BBYA 4RUVA 5COHA 4XIHA 2H70A 2H73A 3M0FA 4ZL7A 3TKRA 2HFDA 4KH7A 4NV2A 3U6VA 3GKNA 1QK8A 1AAZA 1YQ1A 2GGTA 4GSTA 4ID0A 3HJMA 3DRNA 4PX1A 2BJXA 1V57A 4N0VA 5DCHA 3F0IA 5CP1A 1M2AA 4ZBAA 5J5NA 3EURA 3BCKA 4NV5A 2HNLA 3I9V2 5HR3A 1TXXA 1TRWA 2VCQA 1TOFA 5J3RA 1GL8A 11GSA 1VGLA 2YWOA 2IMKA 3GN3A 2WCIA 5J9BA 1UVZA 1W89A 3LYPA 4DVCA 4KAEA 4WBJA 4MH3A 2X8CA 2H66A 5DJMA 4PUFC 3F3QA 1TK0B 4MK3A 1A0FA 2CAIA 2G0FA 2MMOA 4IJ3A 1GUMA 3IDVA 2N5AA 2OA7A 2CV4A 1GSEA 3DIEA 6GSTA 3IRAA 4F0CA 2REMA 1Z7RA 1Y6EA 3F6DA 3ZZXA 2YV9A 2H75A 2DJ2A 5ID2B 5HFGA 3V1WA 2FWHA 5ABRA 4G0KA 1V40A 4YAPA 2LUSA 3KCMA 3ZMKA 3M3MA 3ISOA 1ON4A 4CDOA 2MMZA 3Q18A 4YQMA 3HCZA 4JR4A 3PINA 2EIRA 4V2MA 2HZEA 4GSSA 4K0GA 1Y25A 3PH9A 4MF5A 2NVLA 4MZCA 3QAWA 1T4ZA 2WB9A 1SD9A 3Q19A 3U5RE 2H0GA 1S3AA 1XFLA 2K6VA 2GQMA 4TN8A 5C04A 3H79A 2JSYA 2KLXA 2AV4A 4YQVA 1QFNA 3GFKA 4YAVA 5EVOA 2HSNB
chains in the Genus database with same CATH superfamily
1MDIA 4E8HA 3ZVJD 4G0LA 2WVXA 4CW9A 2AHEA 2FGXA 1N25A 4F03A 4ICYA 4KDUA 4N0ZA 3G7JA 5DALA 1Z9HA 1PN9A 5E4WA 1SKWB 4L0UA 3BCIA 1EEMA 1DSBA 1BAYA 1Y1UA 1ERUA 1XPVA 2V41A 5CRGA 2I81A 1JZDA 5FT3A 2DJ1A 3FR3A 4F2IA 2XPEA 1A24A 2DMMA 3P90A 2KOKA 1SU9A 2MMNA 1A8YA 1BJXA 2FD3A 1HNCA 4BL7A 3F6FA 4KCEA 3KP8A 2YJHA 2O85A 4N3ZA 1KBNA 2O3EA 4ACSA 4WKWA 5ELAA 3UMAA 3FZ5A 4V1Ag 1WOUA 5G31A 3IOSA 4AF2A 5J4UA 4IN0A 4TR4A 3GA4A 1FW1A 2KUCA 3MWHA 3A5IA 4E68A 3VI5A 4CY6A 3IXRA 3UOMA 2IFQB 2H72A 2VCTA 3GUSA 3TJBA 2X8GA 5JWRB 4OCEA 5F05A 4ILFA 4PQIA 2IMEA 3IBHA 4Z2UA 3RHCA 2WS2A 1EP7A 2O89A 1JLVA 2L57A 1AC1A 1A2LA 1PSQA 6GSSA 1ST9A 4HU9A 4KSMA 2HT9A 2OJLA 1SYRA 4MJCA 1AXDA 3GSSA 3HVNA 1M9BA 1THXA 5DAKA 3VPTA 1DE1A 1M2DA 1VF4A 1TW9A 5F06A 1V58A 4X43A 1PX7A 4EO3A 2GZPA 5J41A 1OC8A 1SYXA 4Z7XA 1M3JA 3CSJA 4FYBA 4MMMA 4TKYA 3TDGA 2C80A 3C7MA 1F6MC 4YKGA 3PR8A 1XZOA 4FO5A 4GQCA 4OMVA 2IPAA 5JWQB 1TI1A 5IMCA 4GF0A 5IMDA 5J40A 3GL5A 2LRTA 1GTAA 4MDCA 2CA8A 2VL2A 6GSWA 2GDRA 1GWCA 5B8AA 5FWGA 4NMUA 4DSQA 2PVOC 2DC5A 3ZIVA 1XOAA 2X64A 3UARA 2YANA 1WP0A 2B7JA 1TI3A 5ECOB 2H6ZA 3NOFA 2VD1A 2BMXA 1PGTA 2ZCTA 1I5GA 2ES7A 1GULA 2CT6A 2YP6A 4FYCA 3E9JB 3QFBC 4ECCA 2WZSA 3D4MA 2A2SA 1IYHA 5GSSA 1NM3A 8GSSA 3FK8A 3BD2A 1F9MA 5EPFA 1WRYA 4BWQA 4KA0A 1TP9A 1YKAA 4QL7A 2WVYA 1XW6A 1T1VA 1MDKA 3LW9A 4TR1A 5D9XA 2WW3A 4LA1A 2WW2A 1Z6NA 4BVXA 3GKKA 3ME8A 4HSCX 3FZ4A 3EE2A 3I6AA 4TXOA 4XS1A 2M46A 3LXTA 2E7PA 3HHVA 2DJKA 2CVKA 3WGXA 2QC7A 2HQTA 1B9XC 2VCWA 2IMIA 2NPBA 2EFHA 4DEJA 2FLSA 1G6YA 1XW5A 2VD0A 5AIVA 4PHZC 1HD2A 3KIJA 3UIWA 2GQLA 2WULA 1AUCA 3QPMA 2X4AA 1MEKA 2VL9A 4DSSB 3H93A 2VAFA 5AIXA 2MMAA 1B9YC 4BIKA 3UJ1A 4MZBA 1PQNA 2GZYA 4XHMA 3C8EA 2R4VA 2B5YA 2MZCA 4K7OA 4WEYA 4IKHA 1MDJA 1O85A 2KP1A 3TKQA 4QL9A 1K3YA 3EYTA 4OD7A 4PQ1A 2ALBA 3WT1A 4BPYA 3ZFLA 1GTBA 1OC9B 1X5CA 3GURA 5ECKB 3HZ8A 1N2AA 5J9CA 1XXUA 1QMVA 3HZ4A 4PNGA 2EFEA 5HR0A 4FXYP 1ZYQB 4ZL9A 1R4WA 1EGRA 3DYRA 1GTIA 3W6GA 2LKUA 3KEBA 4J2FA 3RHBA 3E0UA 4PNFA 1TU8A 3HJOA 4CY8A 1A2JA 2O36A 4JRRA 4KDXA 2GLRA 2A4VA 3ED3A 4IQAA 3C71A 1SK1A 2FA8A 2OBIA 3D21A 1GNEA 17GSA 4XRAA 4JZQA 2L5LA 3P8WA 1T00A 3P7XA 4O5QA 5G5EA 4PUAA 3WGEA 1EV4A 5JWOB 4ZXGA 2JADA 3APSA 18GSA 4TOPA 1PD21 2F8FA 4EKZA 2XHFA 5GSTA 2GT6A 5G30A 4KF9A 2YWNA 4AKIA 4LL1B 1JZOA 6GSUA 4TVEA 2JZSA 2LTKA 3IA1A 1PL2A 4RQRA 4XS4B 3TRPA 2PMTA 3RGBC 2DIZA 2WFCA 4K9ZA 4KGIA 4MCUA 2IJYA 3F4RA 1AQXA 3R3EA 4BA7A 2FA4A 5E59A 4I2TA 4NHWA 2L4QA 4OO4A 3W8SA 2TRXA 2V1MA 4PQHA 5ECSA 4ECBA 3M1GA 5A4WA 4EC0A 1PKZA 3KP9A 2UZ8A 1Z5YE 4ULXA 5BRTA 3M8NA 5G5FA 1SD8A 5A34A 1V98A 4G01A 1MD3A 1OC3A 1A0RP 5DQSA 3CRUA 1N8JA 2E2MA 2LNTA 3M9KA 1GUHA 2E2GA 1OE7A 2R0PA 1M0UA 3KD0A 4POLA 3EINA 4ZB9A 1GSSA 4ZB7A 3LGCA 1TU7A 4WF5A 1TTZA 4GXZA 4EVMA 3L4NA 4GWRA 3FZ9A 1YDKA 1F37A 4E8EA 2KP2A 4IP6A 3TOTA 1TDIA 4Q5FA 5AGYA 1B48A 1ZYNA 5IMZA 1ZGNA 4ZL8A 2GTUA 5CNWA 1GTUA 3LSZA 3O6TA 1MTCA 3ME7A 1BX9A 1ZZYA 4OFTA 4AJ7A 4HEA2 1K0BA 3SWLA 4OWYA 1ZOFA 3CSIA 2HYXA 3ZYWA 2O8VB 3WGDA 3G7IA 16GSA 3FRCA 2TIRA 5JCGA 4IW9A 3HMJG 2B5XA 5IMFA 4ZIJA 3VURA 3CRTA 3Q6OA 2CVDA 4WR5A 5D96A 3I43A 2CQ9A 2GSQA 4L5OA 5H5QA 5ECLB 4IS0A 3FR6A 2PUKC 3KTBA 2H01A 3S9FA 5AISA 1X9SB 3AY8A 1GSUA 4K0NA 3CWGA 2YCDA 3TKPA 4ZB6A 3GNJA 4EIQA 1K0NA 1SK2A 2OACA 2K18A 5A1NA 2VLVA 2O5VA 5D93A 1RK4A 2WW1A 1O73A 2DJ3A 4WR4A 4K5RA 2PU9C 3LQ7A 2YPMA 2F3MA 1X5EA 2HZEB 3QCPA 2WGRA 5D73A 5ECIB 2OE1A 2LS5A 2C1YA 1JLWA 2PGTA 2X8HA 2H1LA 1BQ7A 2X99A 2NBSA 2GSSA 4F9ZA 3G7YA 1THOA 2MBSA 4NHZA 4TXVA 4L5LA 2H1BA 4HOJA 1EV9A 4TR3A 5GZZB 4PTSA 5F07A 2FUG2 4I5QA 4X1UA 1ERWA 3HVXA 3ZLPA 5JCUA 4K1FA 2IWTA 3D4TA 2ZUPA 3F8UA 2HZFA 2WVXB 2VLUA 4V2LA 3QR6A 5DQYA 5DALB 2FWGA 3QAVA 3HVVA 3JCML 1DE2A 2ON7A 4K7IA 5IOWA 2RUEA 3ZTLA 4HJMA 5DVBA 2YOIA 4MNNA 2AUVA 1JFUA 3KGKA 1UN2A 4YH2A 2VL2C 4F82A 2YV7A 4JE1A 2H6YA 1YEPA 2IMFA 1J9BA 4AGSA 2VL3A 1MD4A 2C8UA 1SJZA 2LQQA 4IP1A 1WMJA 1HNBA 4BL7B 2B1KA 3TJGA 1PRXA 5CRDA 4HS1A 1WJKA 1XVQA 2RIIA 3QMXA 4G2EA 5A5KA 4MZWA 3EU4A 1BG5A 1S4BP 2HSMA 4PI0C 4I8BA 4ZBDA 1R5PA 3VWVA 5ECPB 2VIMA 1ML6A 1KNGA 2H19A 3BOAA 3RAZA 3OR5A 4PI2C 1U6TA 2PERA 1QQ2A 3GX8A 2CX3A 1J0FA 3L0HA 4OFMA 2I1UA 1A8LA 3MAKA 5KN3A 3LXZA 2DLXA 3VFIA 4KDYA 4V2NA 3WYWA 2AB6A 2VM1A 4GCIA 2R37A 2YZHA 4JR6A 3QFAC 3LG6A 3TCOA 2I3YA 2IMDA 1T7PB 1FHEA 5G2ZA 4ZBBA 2M80A 1GUKA 1T4YA 2VO4A 5ELGA 5DAKB 1PKWA 3A2VA 1U3AA 1Z7PA 1WE0A 2YZUA 1PL1A 4GSNA 4GTUA 3EVIA 3F4TA 2LQOA 2RM5A 4N30A 1QGVA 4Q5QA 3SBCA 4TRXA 5G1KA 1O8XA 1TJDA 2HRKA 1DBYA 3GTUA 1Q98A 1SL1B 5CRWA 5J4VA 2PPTA 4DSRA 4ML6A 3GL3A 3CHXC 1SKSB 4ECIA 1GSYA 1VRSD 4O32A 3DD3A 2QSIA 3UBKA 4D73A 3HDCA 2C0FA 4MH2A 4G9HA 1OYJA 1ERVA 2V6OA 3H4KA 2H6XA 4FQUA 4EE0A 1U3IA 4XRDA 6GSVA 4EIPA 3KZQA 1YEWC 3EMPA 3UEMA 4HDEA 2GT5A 4YKFA 2YWMA 2FCHA 5CREA 1V2AA 3DWVA 3HY2A 3MDKA 3EWLA 2VKZG 2DKIA 5IM9A 2CX4A 1AW9A 1GP1A 4ECJA 1NSWA 4TR1B 2HRFA 1XWGA 3TRXA 2ON5A 1SKRB 5F8BA 4BVXB 2L5OA 3MIXA 4KW6A 3R2QA 4WF4A 4TXOB 1SJIA 1XCCA 4OFNA 3TRQA 3P2AA 4IBPA 4USSA 3IPZA 3N9JA 1S3RA 4EDYA 4IQ1A 4IGJA 2G2QA 4HQZA 5G1LA 1PN0A 3IAS2 3LFLA 1ZYEA 1TXUA 3GH9A 2TRCP 2VCZA 4G19A 1T8EB 3EPTA 2QGVA 3NZNA 4MLYA 1FVJA 1BF5A 1FVKA 1T3BA 2AAWA 2N5FA 3FYGA 4JEDA 3A3TA 3HYPA 4Z2RA 4AJ8A 3A5WA 3ERFA 5ENUA 2EC4A 4HUAA 5EL8A 2H74A 3D5JA 4YQUA 4POKA 4O5RA 3MYDA 4NWYA 2GQKA 6GSYA 7GSSA 2DJ0A 1LU4A 1U88A 1FOVA 1OE8A 2FY6A 3L9SA 1Z3EA 5KOXA 1UA5A 2LJAA 4HZ4A 1YF1A 1M9AA 1ACVA 1E6BA 3A2WA 3US3A 2IL3A 3LJRA 5KN0A 1EOGA 1FOHA 2H1DA 4N10A 1OVNA 1I9DA 2R0CA 4IJIA 4BVYA 3VLNA 4NAXA 3E3EA 3IE3A 3IC4A 1YEXA 1YKCA 3APQA 3CMIA 1QUWA 3G9BA 2BTOT 5CRHA 3TGZA 4K2DA 2C3NA 5INYA 1M2BA 4W66A 3GMFA 4EL1A 1KEBA 4MPFA 3UAPA 2I4AA 1G0TA 2LSTA 1CQGA 3F63A 1B4QA 1NHOA 2DBCA 4EDZA 4K7NA 1EGOA 5ECHB 3CSHA 3BJ5A 2H76A 2JZTA 4F0BA 2QA2A 3KH9A 3KJYA 3UVHA 1K0DA 1R5AA 3FY7A 1TKDB 2H1GA 1F3AA 2RM6A 3DVWA 4GLTA 2R3XA 1R7HA 3IHQA 1XWAA 2LNSA 2YN1A 1C72A 1ZL9A 1O8WA 1G7OA 4FIWA 5ECRB 1YZXA 4O5UA 3VWWA 1Z6MA 3DVXA 3D22A 3KH7A 5A4VA 1JZRA 3KTLA 2R6KA 1M3IA 2VM2A 3TKSA 4EUYA 2MBTA 2K8SA 4L8EA 1URMA 1PA3A 3DMLA 2R0GA 3IAM2 2X49A 4LMVA 3HKRA 5HQPA 1AQVA 2EIQA 4A5PA 2VUPA 3GH6A 1SVOA 1TK8B 1BYEA 2CZ3A 1X5DA 1X0RA 1M99A 1EOHA 2PVQA 5LNKe 2F9SA 3GKXA 1GSFA 1DUGA 2HE3A 4MPGA 4WBRD 3Q74A 2O87A 2OADA 4KUNA 2JSZA 3HD5A 2M72A 1WPIA 4PURA 4AKXB 5ID2A 1WIKA 3TOUA 1FB6A 4MJBA 4AKGA 5A5HA 1YJ6A 3TB2A 2FWFA 2VCVA 3UBLA 1TRVA 2B3SA 3UVTA 1SJ6A 3QOUA 3TJKA 5BMUA 2IIYA 4L0WA 19GSA 2F51A 5JCWA 4LL4B 2I9HA 3IC8A 3H1NA 4X0XA 3KMOA 1ZMAA 2HRAA 5ECMB 2B6MA 3L9UA 4HI7A 2YWIA 3IK9A 3TU3B 5D9VA 2B7KA 4GRFA 1O6JA 2YJ7A 2GS3A 4H86A 2MYGA 1RW1A 4KCAA 2H30A 1B4PA 2H0IA 2KHPA 3QD9A 1S3CA 2HSNA 4ISDA 5L71A 5A1NB 3KM6A 4HZ2A 5IMVA 4WXTA 1G7EA 3ERWA 2FWEA 2EIOA 4JBBA 3LWAA 2L6CA 4JU5A 3GKMA 3ZREA 5C00A 1X9MB 1PMTA 4PXOA 5A4UA 5IQYA 4IHUA 1YF0A 2XBIA 2H71A 5CO3A 5DCGA 3F4SA 3TUEA 1K0MA 1XIYA 1SK0A 3WD6A 2F8AA 2PBJA 3C1RA 1K0CA 6GSXA 3DEXA 4V1Ap 1UC7A 3O76A 2N5BA 4RI6A 3WT2A 4ZILA 14GSA 4GDFA 2K8VA 1X9WB 2GSRA 4G10A 4I97A 2QKEA 1OKTA 2J23A 3FMWA 4NPBA 3RPPA 2DJJA 2AJQB 3LYKA 3ZRDA 3HA9A 2K9FA 3QDNA 2IFQA 5GAND 2CVBA 1GLQA 1GNWA 13GSA 4IELA 1XWBA 4HQSA 4AJ6A 2V32A 3K8NA 2HRNA 1HQOA 4J57E 2H1AA 3APOA 5HFIA 3GX0A 4N11A 5B6NA 1XOBA 1NHYA 2RUFA 1WWJA 1NW2A 3GIXA 1I1IP 2A4HA 3LEFA 1SL2B 2P5QA 1ZYPA 3FHKA 3KMNA 1U87A 3QAGA 4ZB8A 2DMLA 3EU3A 2HSMB 4LLRA 1VF3A 2B5EA 3VK9A 3TJFA 3A2XA 2OE0A 1R26A 4J56E 3RDWA 1VF1A 4OCFA 4XCSA 1AIUA 4P3YB 3GRXA 3IK7A 3GV1A 3HVSA 1EEJA 1XWKA 5J4YA 4BWSA 1G6WA 9GSSA 3J7Yb 2JU5A 4MJAA 5IIZA 4TW5A 2JACA 3IV4A 1F2EA 1SVMA 1TK5B 4HU7A 2O7KA 1E2YA 2HSHA 5ECQB 2VOCA 1IYIA 2HSYA 1OKDA 3HJPA 4IVFA 4FH8A 4POBA 5CAXA 4FYUA 4TR0A 2E0QA 5B7CA 3DKSA 3PGTA 1M7TA 3UL3A 5IPHA 1A2MA 2J9HA 2LRCA 2L6DA 1W4VA 4RI7A 5D9WA 5H5SA 1EP8A 4MJEA 4MF6A 5IO2A 1FG4A 3ZITA 1JZWA 3CYNA 1RQMA 1ERTA 2GVPA 2P0GA 3ZIJA 2LV3A 3FZAA 1XW9A 5KN1A 2A2RA 5F0GA 1GSQA 1B8XA 1H75A 2L59A 1F3BA 5LCZA 3EMXA 1ABAA 2OE3A 2Z9SA 4MA9A 2HRKB 4O7HA 3CTFA 2WZ9A 4HJ2A 3GTUB 3NIVA 20GSA 2H0HA 3L9VA 3W8JA 4K6XA 2IN3A 2VCXA 4RQXA 1Q4JA 2R2JA 1O7UA 2CZ2A 3ZMLA 1XG8A 2OT3A 1KTEA 2C3TA 1K0OA 4D73B 2DKHA 2P31A 4MF7A 4OO5A 4MABA 2JZRA 4KSOA 2OBKA 1TRSA 2V2GA 4Z2TA 2ZNMA 5IPGA 4XS6A 2WRTA 5DJLA 4AKHA 3C73A 3GYKA 4QQ7A 2V6KA 4O92A 2XBQA 3C1SA 2HI7A 5ECNB 1SENA 1H4OA 4EXJA 4ML1A 4KX4A 4DSSA 1LBKA 2CAQA 4Q5RA 4I2UA 5EY6A 2XC2A 5KN2A 5LD0A 2WJUA 3N5OA 3FKFA 2C4JA 5D9TA 5IO0A 1GH2A 3MSZA 2DSAA 2YNXA 1YVLA 3CBUA 5IOXA 3TKSE 1AQWA 3KXOA 2A2PA 4WETA 1A23A 2QA1A 3VPQA 2PWJA 1USBA 3HXSA 4PGTA 1LJRA 2C0DA 2HLSA 4K8MA 3PPUA 4NXIA 5HR1A 3M9JA 1FB0A 3EC3A 1TRUA 2LJKA 1HYUA 3TJJA 2WVZA 4Q5NA 1OC9A 3IHGA 5DBQA 3FR9A 5HFKA 1J08A 1QXHA 3H8QA 1BEDA 2P5RA 4XTSA 1VF2A 2AYTA 4EF0A 3DGQA 3D0ZA 1XVWA 1BG1A 1K0AA 1K3OA 4GQFA 4KE3A 5J47A 1SL0B 5KEJA 3FEUA 1HNAA 1GRXA 5AN1A 2C0GA 3LORA 2VLTA 3D6IA 3VWXA 1GLPA 1XBSA 2NTOA 3RPNA 3RBTA 4POMA 1O81A 1YY7A 2GZZA 3GSTA 3CXGA 5HR2A 1OAZA 5B6MA 3VI7A 2H8LA 4LMWA 5FHIA 3TKSC 3VWUA 1PX6A 2C0EA 1ZCPA 1JHBA 3I69A 2XPDA 22GSA 3IR4A 1CQHA 5B8BA 2JL4A 1K3LA 2D2ZA 1SVLA 2WDUA 1EWXA 1V9WA 5IMAA 5DDLA 5H5RA 4CHSA 5KOWA 2B1LA 1FAAA 4G0IA 3MNGA 1XWCA 1ILOA 5GAPD 2R5GA 4BVYB 3L78A 2PN8A 4I6XA 2EFDA 3CTGA 3ZFBA 2C3QA 3F3RA 3GHAA 5D8IA 1FO5A 4XS4A 2LRNA 1GSDA 3ZL5A 2FHEA 2LJRA 2WW0A 10GSA 3ZVJA 4MP4A 2HXKA 2DIYA 3DXBA 3O3TA 3FW2A 1EZKA 2L4CA 2GSTA 2FNOA 4KB3A 2LEGA 3F9UA 2OKAA 1S3DA 3ERGA 2NDOA 3J7Yk 12GSA 5CYYA 4KNDA 2RLIA 3BBYA 4RUVA 5COHA 4XIHA 2H70A 2H73A 3M0FA 4ZL7A 3TKRA 2HFDA 4KH7A 4NV2A 3U6VA 3GKNA 1QK8A 1AAZA 1YQ1A 2GGTA 4GSTA 4K2XA 4ID0A 3HJMA 3DRNA 4PX1A 3CQFA 5A34B 4AI6A 2BJXA 1V57A 4N0VA 5DCHA 3F0IA 5CP1A 1M2AA 4ZBAA 5J5NA 3EURA 3BCKA 4NV5A 3RFRC 2HNLA 3I9V2 5HR3A 1TXXA 1TRWA 2VCQA 1TOFA 5J3RA 1GL8A 11GSA 1VGLA 2YWOA 2IMKA 3GN3A 2WCIA 5J9BA 1UVZA 1W89A 3LYPA 4DVCA 4KAEA 4WBJA 4MH3A 2X8CA 2H66A 5DJMA 4PUFC 1PFOA 3F3QA 1TK0B 2UV8G 4MK3A 1A0FA 2CAIA 2G0FA 2MMOA 4K5SA 4IJ3A 1GUMA 3IDVA 2N5AA 2OA7A 2CV4A 1GSEA 3DIEA 6GSTA 3IRAA 4F0CA 2REMA 1Z7RA 1Y6EA 3F6DA 3ZZXA 2YV9A 2H75A 2DJ2A 5ID2B 5HFGA 3V1WA 2FWHA 5ABRA 4G0KA 1V40A 4YAPA 2LUSA 5A5HB 4QMKA 3KCMA 3ZMKA 3M3MA 3ISOA 1ON4A 4CDOA 2MMZA 5BMUB 3Q18A 4YQMA 3HCZA 4JR4A 3PINA 2EIRA 4V2MA 2HZEA 4GSSA 4K0GA 1Y25A 3PH9A 4MF5A 4X4JA 2NVLA 4MZCA 3QAWA 1T4ZA 2WB9A 1SD9A 3Q19A 3U5RE 2H0GA 1S3AA 1XFLA 2K6VA 2GQMA 4TN8A 5C04A 3H79A 2EFCA 2JSYA 2KLXA 2AV4A 4YQVA 1QFNA 3GFKA 4YAVA 5EVOA 2HSNB
chains in the Genus database with same CATH topology
1MDIA 4E8HA 3ZVJD 4G0LA 4CW9A 2AHEA 2FGXA 1N25A 4F03A 4ICYA 4KDUA 4N0ZA 3G7JA 5DALA 1Z9HA 1PN9A 5E4WA 1SKWB 4L0UA 3BCIA 1EEMA 1DSBA 1BAYA 1Y1UA 1ERUA 1XPVA 2V41A 5CRGA 2I81A 1JZDA 5FT3A 2DJ1A 3FR3A 4F2IA 2XPEA 1A24A 2DMMA 3P90A 2KOKA 1SU9A 2MMNA 1A8YA 1BJXA 2FD3A 1HNCA 4BL7A 3F6FA 4KCEA 3KP8A 2YJHA 2O85A 4N3ZA 1KBNA 4ACSA 4WKWA 5ELAA 3UMAA 3FZ5A 4V1Ag 1WOUA 5G31A 3IOSA 4AF2A 5J4UA 4IN0A 4TR4A 3GA4A 1FW1A 2KUCA 3MWHA 3A5IA 4E68A 3VI5A 4CY6A 3IXRA 3UOMA 2IFQB 2H72A 2VCTA 3GUSA 3TJBA 2X8GA 5JWRB 4OCEA 5F05A 4ILFA 4PQIA 2IMEA 3IBHA 4Z2UA 3RHCA 2WS2A 1EP7A 2O89A 1JLVA 2L57A 1AC1A 1A2LA 1PSQA 6GSSA 1ST9A 4HU9A 4KSMA 2HT9A 2OJLA 1SYRA 4MJCA 1AXDA 3GSSA 1M9BA 1THXA 5DAKA 3VPTA 1DE1A 1M2DA 1VF4A 1TW9A 5F06A 1V58A 4X43A 1PX7A 4EO3A 2GZPA 5J41A 1OC8A 1SYXA 4Z7XA 3CSJA 4FYBA 4MMMA 4TKYA 3TDGA 2C80A 3C7MA 1F6MC 4YKGA 3PR8A 1XZOA 4FO5A 4GQCA 4OMVA 2IPAA 5JWQB 1TI1A 5IMCA 4GF0A 5IMDA 5J40A 3GL5A 2LRTA 1GTAA 4MDCA 2CA8A 2VL2A 6GSWA 2GDRA 1GWCA 5B8AA 5FWGA 4NMUA 4DSQA 2PVOC 2DC5A 3ZIVA 1XOAA 2X64A 3UARA 2YANA 1WP0A 2B7JA 1TI3A 5ECOB 2H6ZA 3NOFA 2VD1A 2BMXA 1PGTA 2ZCTA 1I5GA 2ES7A 1GULA 2CT6A 2YP6A 4FYCA 3E9JB 3QFBC 4ECCA 3D4MA 2A2SA 1IYHA 5GSSA 1NM3A 8GSSA 3FK8A 3BD2A 1F9MA 5EPFA 1WRYA 4BWQA 4KA0A 1TP9A 1YKAA 4QL7A 1XW6A 1T1VA 1MDKA 3LW9A 4TR1A 5D9XA 4LA1A 1Z6NA 4BVXA 3GKKA 3ME8A 3FZ4A 3EE2A 3I6AA 4TXOA 4XS1A 2M46A 3LXTA 2E7PA 3HHVA 2DJKA 2CVKA 3WGXA 2QC7A 2HQTA 1B9XC 2VCWA 2IMIA 2NPBA 2EFHA 4DEJA 2FLSA 1G6YA 1XW5A 2VD0A 5AIVA 1HD2A 3KIJA 3UIWA 2GQLA 2WULA 1AUCA 3QPMA 2X4AA 1MEKA 2VL9A 4DSSB 3H93A 2VAFA 5AIXA 2MMAA 1B9YC 3UJ1A 4MZBA 1PQNA 2GZYA 4XHMA 3C8EA 2R4VA 2B5YA 2MZCA 4K7OA 4WEYA 4IKHA 1MDJA 1O85A 2KP1A 3TKQA 4QL9A 1K3YA 3EYTA 4OD7A 4PQ1A 2ALBA 3WT1A 4BPYA 3ZFLA 1GTBA 1OC9B 1X5CA 3GURA 5ECKB 3HZ8A 1N2AA 5J9CA 1XXUA 1QMVA 3HZ4A 4PNGA 2EFEA 5HR0A 1ZYQB 4ZL9A 1R4WA 1EGRA 3DYRA 1GTIA 3W6GA 2LKUA 3KEBA 4J2FA 3RHBA 3E0UA 4PNFA 1TU8A 3HJOA 4CY8A 1A2JA 4JRRA 4KDXA 2GLRA 2A4VA 3ED3A 4IQAA 3C71A 1SK1A 2FA8A 2OBIA 3D21A 1GNEA 17GSA 4XRAA 4JZQA 2L5LA 3P8WA 1T00A 3P7XA 4O5QA 5G5EA 4PUAA 3WGEA 1EV4A 5JWOB 4ZXGA 2JADA 3APSA 18GSA 4TOPA 1PD21 2F8FA 4EKZA 2XHFA 5GSTA 2GT6A 5G30A 4KF9A 2YWNA 4AKIA 4LL1B 1JZOA 6GSUA 4TVEA 2JZSA 2LTKA 3IA1A 1PL2A 4RQRA 4XS4B 3TRPA 2PMTA 2DIZA 2WFCA 4K9ZA 4KGIA 4MCUA 2IJYA 3F4RA 1AQXA 3R3EA 4BA7A 2FA4A 5E59A 4I2TA 4NHWA 2L4QA 4OO4A 3W8SA 2TRXA 2V1MA 4PQHA 5ECSA 4ECBA 3M1GA 5A4WA 4EC0A 1PKZA 3KP9A 2UZ8A 1Z5YE 4ULXA 5BRTA 3M8NA 5G5FA 1SD8A 5A34A 1V98A 4G01A 1MD3A 1OC3A 1A0RP 5DQSA 3CRUA 1N8JA 2E2MA 2LNTA 3M9KA 1GUHA 2E2GA 1OE7A 2R0PA 1M0UA 3KD0A 4POLA 3EINA 4ZB9A 1GSSA 4ZB7A 3LGCA 1TU7A 4WF5A 1TTZA 4GXZA 4EVMA 3L4NA 4GWRA 3FZ9A 1YDKA 1F37A 4E8EA 2KP2A 4IP6A 3TOTA 1TDIA 4Q5FA 5AGYA 1B48A 1ZYNA 5IMZA 1ZGNA 4ZL8A 2GTUA 5CNWA 1GTUA 3LSZA 3O6TA 1MTCA 3ME7A 1BX9A 1ZZYA 4OFTA 4AJ7A 4HEA2 1K0BA 3SWLA 4OWYA 1ZOFA 3CSIA 2HYXA 3ZYWA 2O8VB 3WGDA 3G7IA 16GSA 3FRCA 2TIRA 5JCGA 4IW9A 3HMJG 2B5XA 5IMFA 4ZIJA 3VURA 3CRTA 3Q6OA 2CVDA 4WR5A 5D96A 3I43A 2CQ9A 2GSQA 4L5OA 5H5QA 5ECLB 4IS0A 3FR6A 2PUKC 3KTBA 2H01A 3S9FA 5AISA 1X9SB 3AY8A 1GSUA 4K0NA 3CWGA 2YCDA 3TKPA 4ZB6A 3GNJA 4EIQA 1K0NA 1SK2A 2OACA 2K18A 5A1NA 2VLVA 2O5VA 5D93A 1RK4A 1O73A 2DJ3A 4WR4A 4K5RA 2PU9C 3LQ7A 2YPMA 2F3MA 1X5EA 2HZEB 3QCPA 2WGRA 5D73A 5ECIB 2OE1A 2LS5A 2C1YA 1JLWA 2PGTA 2X8HA 2H1LA 1BQ7A 2X99A 2NBSA 2GSSA 4F9ZA 3G7YA 1THOA 2MBSA 4NHZA 4TXVA 4L5LA 2H1BA 4HOJA 1EV9A 4TR3A 5GZZB 4PTSA 5F07A 2FUG2 4I5QA 4X1UA 1ERWA 3HVXA 3ZLPA 5JCUA 4K1FA 2IWTA 3D4TA 2ZUPA 3F8UA 2HZFA 2VLUA 4V2LA 3QR6A 5DQYA 5DALB 2FWGA 3QAVA 3HVVA 3JCML 1DE2A 2ON7A 4K7IA 5IOWA 2RUEA 3ZTLA 4HJMA 5DVBA 2YOIA 4MNNA 2AUVA 1JFUA 3KGKA 1UN2A 4YH2A 2VL2C 4F82A 2YV7A 4JE1A 2H6YA 1YEPA 2IMFA 1J9BA 4AGSA 2VL3A 1MD4A 2C8UA 1SJZA 2LQQA 4IP1A 1WMJA 1HNBA 4BL7B 2B1KA 3TJGA 1PRXA 5CRDA 4HS1A 1WJKA 1XVQA 2RIIA 3QMXA 4G2EA 5A5KA 4MZWA 3EU4A 1BG5A 2HSMA 4I8BA 4ZBDA 1R5PA 3VWVA 5ECPB 2VIMA 1ML6A 1KNGA 2H19A 3BOAA 3RAZA 3OR5A 1U6TA 2PERA 1QQ2A 3GX8A 2CX3A 1J0FA 3L0HA 4OFMA 2I1UA 1A8LA 3MAKA 5KN3A 3LXZA 2DLXA 3VFIA 4KDYA 4V2NA 3WYWA 2AB6A 2VM1A 4GCIA 2R37A 2YZHA 4JR6A 3QFAC 3LG6A 3TCOA 2I3YA 2IMDA 1T7PB 1FHEA 5G2ZA 4ZBBA 2M80A 1GUKA 1T4YA 2VO4A 5ELGA 5DAKB 1PKWA 3A2VA 1U3AA 1Z7PA 1WE0A 2YZUA 1PL1A 4GSNA 4GTUA 3EVIA 3F4TA 2LQOA 2RM5A 4N30A 1QGVA 4Q5QA 3SBCA 4TRXA 5G1KA 1O8XA 1TJDA 2HRKA 1DBYA 3GTUA 1Q98A 1SL1B 5CRWA 5J4VA 2PPTA 4DSRA 4ML6A 3GL3A 1SKSB 4ECIA 1GSYA 1VRSD 4O32A 3DD3A 2QSIA 3UBKA 4D73A 3HDCA 2C0FA 4MH2A 4G9HA 1OYJA 1ERVA 2V6OA 3H4KA 2H6XA 4FQUA 4EE0A 1U3IA 4XRDA 6GSVA 4EIPA 3KZQA 3EMPA 3UEMA 4HDEA 2GT5A 4YKFA 2YWMA 2FCHA 5CREA 1V2AA 3DWVA 3HY2A 3MDKA 3EWLA 2VKZG 2DKIA 5IM9A 2CX4A 1AW9A 1GP1A 4ECJA 1NSWA 4TR1B 2HRFA 1XWGA 3TRXA 2ON5A 1SKRB 5F8BA 4BVXB 2L5OA 3MIXA 4KW6A 3R2QA 4WF4A 4TXOB 1SJIA 1XCCA 4OFNA 3TRQA 3P2AA 4IBPA 4USSA 3IPZA 3N9JA 4EDYA 4IQ1A 4IGJA 2G2QA 4HQZA 5G1LA 1PN0A 3IAS2 3LFLA 1ZYEA 1TXUA 3GH9A 2TRCP 2VCZA 4G19A 1T8EB 3EPTA 2QGVA 3NZNA 4MLYA 1FVJA 1BF5A 1FVKA 1T3BA 2AAWA 2N5FA 3FYGA 4JEDA 3A3TA 3HYPA 4Z2RA 4AJ8A 3A5WA 3ERFA 5ENUA 2EC4A 4HUAA 5EL8A 2H74A 3D5JA 4YQUA 4POKA 4O5RA 3MYDA 4NWYA 2GQKA 6GSYA 7GSSA 2DJ0A 1LU4A 1U88A 1FOVA 1OE8A 2FY6A 3L9SA 1Z3EA 5KOXA 1UA5A 2LJAA 4HZ4A 1YF1A 1M9AA 1ACVA 1E6BA 3A2WA 3US3A 2IL3A 3LJRA 5KN0A 1EOGA 1FOHA 2H1DA 4N10A 1OVNA 1I9DA 2R0CA 4IJIA 4BVYA 3VLNA 4NAXA 3E3EA 3IE3A 3IC4A 1YEXA 1YKCA 3APQA 3CMIA 1QUWA 3G9BA 2BTOT 5CRHA 3TGZA 4K2DA 2C3NA 5INYA 1M2BA 4W66A 3GMFA 4EL1A 1KEBA 4MPFA 3UAPA 2I4AA 1G0TA 2LSTA 1CQGA 3F63A 1B4QA 1NHOA 2DBCA 4EDZA 4K7NA 1EGOA 5ECHB 3CSHA 3BJ5A 2H76A 2JZTA 4F0BA 2QA2A 3KH9A 3KJYA 3UVHA 1K0DA 1R5AA 3FY7A 1TKDB 2H1GA 1F3AA 2RM6A 3DVWA 4GLTA 2R3XA 1R7HA 3IHQA 1XWAA 2LNSA 2YN1A 1C72A 1ZL9A 1O8WA 1G7OA 4FIWA 5ECRB 1YZXA 4O5UA 3VWWA 1Z6MA 3DVXA 3D22A 3KH7A 5A4VA 1JZRA 3KTLA 2R6KA 2VM2A 3TKSA 4EUYA 2MBTA 2K8SA 4L8EA 1URMA 1PA3A 3DMLA 2R0GA 3IAM2 2X49A 4LMVA 3HKRA 5HQPA 1AQVA 2EIQA 4A5PA 2VUPA 3GH6A 1SVOA 1TK8B 1BYEA 2CZ3A 1X5DA 1X0RA 1M99A 1EOHA 2PVQA 5LNKe 2F9SA 3GKXA 1GSFA 1DUGA 2HE3A 4MPGA 4WBRD 3Q74A 2O87A 2OADA 4KUNA 2JSZA 3HD5A 2M72A 1WPIA 4PURA 4AKXB 5ID2A 1WIKA 3TOUA 1FB6A 4MJBA 4AKGA 5A5HA 1YJ6A 3TB2A 2FWFA 2VCVA 3UBLA 1TRVA 2B3SA 3UVTA 1SJ6A 3QOUA 3TJKA 5BMUA 2IIYA 4L0WA 19GSA 2F51A 5JCWA 4LL4B 2I9HA 3IC8A 3H1NA 4X0XA 3KMOA 1ZMAA 2HRAA 5ECMB 2B6MA 3L9UA 4HI7A 2YWIA 3IK9A 3TU3B 5D9VA 2B7KA 4GRFA 1O6JA 2YJ7A 2GS3A 4H86A 2MYGA 1RW1A 4KCAA 2H30A 1B4PA 2H0IA 2KHPA 3QD9A 1S3CA 2HSNA 4ISDA 5L71A 5A1NB 3KM6A 4HZ2A 5IMVA 4WXTA 1G7EA 3ERWA 2FWEA 2EIOA 4JBBA 3LWAA 2L6CA 4JU5A 3GKMA 3ZREA 5C00A 1X9MB 1PMTA 4PXOA 5A4UA 5IQYA 4IHUA 1YF0A 2XBIA 2H71A 5CO3A 5DCGA 3F4SA 3TUEA 1K0MA 1XIYA 1SK0A 3WD6A 2F8AA 2PBJA 3C1RA 1K0CA 6GSXA 3DEXA 4V1Ap 1UC7A 3O76A 2N5BA 4RI6A 3WT2A 4ZILA 14GSA 4GDFA 2K8VA 1X9WB 2GSRA 4G10A 4I97A 2QKEA 1OKTA 2J23A 3FMWA 4NPBA 3RPPA 2DJJA 2AJQB 3LYKA 3ZRDA 3HA9A 2K9FA 3QDNA 2IFQA 5GAND 2CVBA 1GLQA 1GNWA 13GSA 4IELA 1XWBA 4HQSA 4AJ6A 2V32A 3K8NA 2HRNA 1HQOA 4J57E 2H1AA 3APOA 5HFIA 3GX0A 4N11A 5B6NA 1XOBA 1NHYA 2RUFA 1WWJA 1NW2A 3GIXA 2A4HA 3LEFA 1SL2B 2P5QA 1ZYPA 3FHKA 3KMNA 1U87A 3QAGA 4ZB8A 2DMLA 3EU3A 2HSMB 4LLRA 1VF3A 2B5EA 3VK9A 3TJFA 3A2XA 2OE0A 1R26A 4J56E 3RDWA 1VF1A 4OCFA 4XCSA 1AIUA 4P3YB 3GRXA 3IK7A 3GV1A 3HVSA 1EEJA 1XWKA 5J4YA 4BWSA 1G6WA 9GSSA 3J7Yb 2JU5A 4MJAA 5IIZA 4TW5A 2JACA 3IV4A 1F2EA 1SVMA 1TK5B 4HU7A 2O7KA 1E2YA 2HSHA 5ECQB 2VOCA 1IYIA 2HSYA 1OKDA 3HJPA 4IVFA 4FH8A 4POBA 5CAXA 4FYUA 4TR0A 2E0QA 5B7CA 3DKSA 3PGTA 1M7TA 3UL3A 5IPHA 1A2MA 2J9HA 2LRCA 2L6DA 1W4VA 4RI7A 5D9WA 5H5SA 1EP8A 4MJEA 4MF6A 5IO2A 1FG4A 3ZITA 1JZWA 3CYNA 1RQMA 1ERTA 2GVPA 2P0GA 3ZIJA 2LV3A 3FZAA 1XW9A 5KN1A 2A2RA 5F0GA 1GSQA 1B8XA 1H75A 2L59A 1F3BA 5LCZA 3EMXA 1ABAA 2OE3A 2Z9SA 4MA9A 2HRKB 4O7HA 3CTFA 2WZ9A 4HJ2A 3GTUB 3NIVA 20GSA 2H0HA 3L9VA 3W8JA 4K6XA 2IN3A 2VCXA 4RQXA 1Q4JA 2R2JA 1O7UA 2CZ2A 3ZMLA 2OT3A 1KTEA 2C3TA 1K0OA 4D73B 2DKHA 2P31A 4MF7A 4OO5A 4MABA 2JZRA 4KSOA 2OBKA 1TRSA 2V2GA 4Z2TA 2ZNMA 5IPGA 4XS6A 2WRTA 5DJLA 4AKHA 3C73A 3GYKA 4QQ7A 2V6KA 4O92A 2XBQA 3C1SA 2HI7A 5ECNB 1SENA 1H4OA 4EXJA 4ML1A 4KX4A 4DSSA 1LBKA 2CAQA 4Q5RA 4I2UA 5EY6A 2XC2A 5KN2A 5LD0A 2WJUA 3N5OA 3FKFA 2C4JA 5D9TA 5IO0A 1GH2A 3MSZA 2DSAA 2YNXA 1YVLA 3CBUA 5IOXA 3TKSE 1AQWA 3KXOA 2A2PA 4WETA 1A23A 2QA1A 3VPQA 2PWJA 1USBA 3HXSA 4PGTA 1LJRA 2C0DA 2HLSA 4K8MA 3PPUA 4NXIA 5HR1A 3M9JA 1FB0A 3EC3A 1TRUA 2LJKA 1HYUA 3TJJA 4Q5NA 1OC9A 3IHGA 5DBQA 3FR9A 5HFKA 1J08A 1QXHA 3H8QA 1BEDA 2P5RA 4XTSA 1VF2A 2AYTA 4EF0A 3DGQA 3D0ZA 1XVWA 1BG1A 1K0AA 1K3OA 4GQFA 4KE3A 5J47A 1SL0B 5KEJA 3FEUA 1HNAA 1GRXA 5AN1A 2C0GA 3LORA 2VLTA 3D6IA 3VWXA 1GLPA 1XBSA 2NTOA 3RPNA 3RBTA 4POMA 1O81A 1YY7A 2GZZA 3GSTA 3CXGA 5HR2A 1OAZA 5B6MA 3VI7A 2H8LA 4LMWA 5FHIA 3TKSC 3VWUA 1PX6A 2C0EA 1ZCPA 1JHBA 3I69A 2XPDA 22GSA 3IR4A 1CQHA 5B8BA 2JL4A 1K3LA 2D2ZA 1SVLA 2WDUA 1EWXA 1V9WA 5IMAA 5DDLA 5H5RA 4CHSA 5KOWA 2B1LA 1FAAA 4G0IA 3MNGA 1XWCA 1ILOA 5GAPD 2R5GA 4BVYB 3L78A 2PN8A 4I6XA 2EFDA 3CTGA 3ZFBA 2C3QA 3F3RA 3GHAA 5D8IA 1FO5A 4XS4A 2LRNA 1GSDA 3ZL5A 2FHEA 2LJRA 10GSA 3ZVJA 4MP4A 2HXKA 2DIYA 3DXBA 3O3TA 3FW2A 1EZKA 2L4CA 2GSTA 2FNOA 4KB3A 2LEGA 3F9UA 2OKAA 1S3DA 3ERGA 2NDOA 3J7Yk 12GSA 5CYYA 4KNDA 2RLIA 3BBYA 4RUVA 5COHA 4XIHA 2H70A 2H73A 3M0FA 4ZL7A 3TKRA 2HFDA 4KH7A 4NV2A 3U6VA 3GKNA 1QK8A 1AAZA 1YQ1A 2GGTA 4GSTA 4K2XA 4ID0A 3HJMA 3DRNA 4PX1A 5A34B 4AI6A 2BJXA 1V57A 4N0VA 5DCHA 3F0IA 5CP1A 1M2AA 4ZBAA 5J5NA 3EURA 3BCKA 4NV5A 2HNLA 3I9V2 5HR3A 1TXXA 1TRWA 2VCQA 1TOFA 5J3RA 1GL8A 11GSA 1VGLA 2YWOA 2IMKA 3GN3A 2WCIA 5J9BA 1UVZA 1W89A 3LYPA 4DVCA 4KAEA 4WBJA 4MH3A 2X8CA 2H66A 5DJMA 4PUFC 3F3QA 1TK0B 2UV8G 4MK3A 1A0FA 2CAIA 2G0FA 2MMOA 4K5SA 4IJ3A 1GUMA 3IDVA 2N5AA 2OA7A 2CV4A 1GSEA 3DIEA 6GSTA 3IRAA 4F0CA 2REMA 1Z7RA 1Y6EA 3F6DA 3ZZXA 2YV9A 2H75A 2DJ2A 5ID2B 5HFGA 3V1WA 2FWHA 5ABRA 4G0KA 1V40A 4YAPA 2LUSA 5A5HB 4QMKA 3KCMA 3ZMKA 3M3MA 3ISOA 1ON4A 4CDOA 2MMZA 5BMUB 3Q18A 4YQMA 3HCZA 4JR4A 3PINA 2EIRA 4V2MA 2HZEA 4GSSA 4K0GA 1Y25A 3PH9A 4MF5A 4X4JA 2NVLA 4MZCA 3QAWA 1T4ZA 2WB9A 1SD9A 3Q19A 3U5RE 2H0GA 1S3AA 1XFLA 2K6VA 2GQMA 4TN8A 5C04A 3H79A 2EFCA 2JSYA 2KLXA 2AV4A 4YQVA 1QFNA 3GFKA 4YAVA 5EVOA 2HSNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MDI A;  4E8H A;  3ZVJ D;  4G0L A;  4CW9 A;  2AHE A;  2FGX A;  4F03 A;  4KDU A;  4N0Z A;  3G7J A;  5DAL A;  1Z9H A;  1PN9 A;  5E4W A;  1SKW B;  4L0U A;  3BCI A;  1EEM A;  1DSB A;  1BAY A;  1ERU A;  1XPV A;  2V41 A;  5CRG A;  2I81 A;  1JZD A;  5FT3 A;  2DJ1 A;  3FR3 A;  4F2I A;  2XPE A;  1A24 A;  2DMM A;  3P90 A;  2KOK A;  1SU9 A;  2MMN A;  1A8Y A;  1BJX A;  2FD3 A;  1HNC A;  4BL7 A;  3F6F A;  4KCE A;  3KP8 A;  2YJH A;  2O85 A;  1KBN A;  4ACS A;  4WKW A;  5ELA A;  3UMA A;  3FZ5 A;  4V1A g;  1WOU A;  5G31 A;  3IOS A;  4AF2 A;  5J4U A;  4IN0 A;  4TR4 A;  3GA4 A;  1FW1 A;  2KUC A;  3MWH A;  3VI5 A;  3IXR A;  3UOM A;  2IFQ B;  2H72 A;  2VCT A;  3GUS A;  3TJB A;  2X8G A;  5JWR B;  4OCE A;  5F05 A;  4ILF A;  4PQI A;  2IME A;  3IBH A;  3RHC A;  2WS2 A;  1EP7 A;  2O89 A;  1JLV A;  2L57 A;  1AC1 A;  1A2L A;  1PSQ A;  6GSS A;  1ST9 A;  4HU9 A;  4KSM A;  2HT9 A;  2OJL A;  1SYR A;  4MJC A;  1AXD A;  3GSS A;  1M9B A;  1THX A;  5DAK A;  3VPT A;  1DE1 A;  1M2D A;  1VF4 A;  1TW9 A;  5F06 A;  1V58 A;  4X43 A;  1PX7 A;  4EO3 A;  2GZP A;  5J41 A;  1OC8 A;  1SYX A;  4Z7X A;  3CSJ A;  4FYB A;  4MMM A;  4TKY A;  3TDG A;  2C80 A;  3C7M A;  1F6M C;  3PR8 A;  1XZO A;  4FO5 A;  4GQC A;  4OMV A;  2IPA A;  5JWQ B;  1TI1 A;  5IMC A;  4GF0 A;  5IMD A;  3GL5 A;  2LRT A;  1GTA A;  4MDC A;  2CA8 A;  2VL2 A;  6GSW A;  2GDR A;  1GWC A;  5B8A A;  5FWG A;  4NMU A;  4DSQ A;  2PVO C;  2DC5 A;  3ZIV A;  1XOA A;  2X64 A;  3UAR A;  2YAN A;  1WP0 A;  2B7J A;  1TI3 A;  5ECO B;  2H6Z A;  3NOF A;  2VD1 A;  2BMX A;  1PGT A;  2ZCT A;  1I5G A;  2ES7 A;  1GUL A;  2CT6 A;  2YP6 A;  4FYC A;  3E9J B;  3QFB C;  4ECC A;  3D4M A;  2A2S A;  1IYH A;  5GSS A;  1NM3 A;  8GSS A;  3FK8 A;  3BD2 A;  1F9M A;  5EPF A;  1WRY A;  4BWQ A;  4KA0 A;  1TP9 A;  1YKA A;  4QL7 A;  1XW6 A;  1T1V A;  1MDK A;  4TR1 A;  5D9X A;  4LA1 A;  1Z6N A;  4BVX A;  3GKK A;  3ME8 A;  3FZ4 A;  3EE2 A;  3I6A A;  4TXO A;  4XS1 A;  2M46 A;  3LXT A;  2E7P A;  3HHV A;  2DJK A;  2CVK A;  3WGX A;  2QC7 A;  2HQT A;  1B9X C;  2VCW A;  2IMI A;  2NPB A;  4DEJ A;  2FLS A;  1G6Y A;  1XW5 A;  2VD0 A;  5AIV A;  1HD2 A;  3KIJ A;  3UIW A;  2GQL A;  2WUL A;  1AUC A;  3QPM A;  1MEK A;  2VL9 A;  4DSS B;  3H93 A;  2VAF A;  5AIX A;  2MMA A;  1B9Y C;  3UJ1 A;  4MZB A;  1PQN A;  2GZY A;  4XHM A;  3C8E A;  2R4V A;  2B5Y A;  2MZC A;  4K7O A;  4WEY A;  4IKH A;  1MDJ A;  1O85 A;  2KP1 A;  3TKQ A;  4QL9 A;  1K3Y A;  3EYT A;  4OD7 A;  4PQ1 A;  2ALB A;  3WT1 A;  4BPY A;  3ZFL A;  1GTB A;  1OC9 B;  1X5C A;  3GUR A;  5ECK B;  3HZ8 A;  1N2A A;  5J9C A;  1XXU A;  1QMV A;  3HZ4 A;  4PNG A;  5HR0 A;  1ZYQ B;  4ZL9 A;  1R4W A;  1EGR A;  3DYR A;  1GTI A;  3W6G A;  2LKU A;  3KEB A;  4J2F A;  3RHB A;  3E0U A;  4PNF A;  1TU8 A;  3HJO A;  1A2J A;  4JRR A;  4KDX A;  2GLR A;  2A4V A;  3ED3 A;  4IQA A;  3C71 A;  1SK1 A;  2FA8 A;  2OBI A;  3D21 A;  1GNE A;  17GS A;  4XRA A;  4JZQ A;  2L5L A;  3P8W A;  1T00 A;  3P7X A;  5G5E A;  4PUA A;  3WGE A;  1EV4 A;  5JWO B;  4ZXG A;  2JAD A;  3APS A;  18GS A;  4TOP A;  1PD2 1;  2F8F A;  4EKZ A;  2XHF A;  5GST A;  2GT6 A;  5G30 A;  4KF9 A;  2YWN A;  4LL1 B;  1JZO A;  6GSU A;  4TVE A;  2JZS A;  2LTK A;  3IA1 A;  1PL2 A;  4RQR A;  4XS4 B;  3TRP A;  2PMT A;  2DIZ A;  2WFC A;  4K9Z A;  4KGI A;  4MCU A;  2IJY A;  3F4R A;  1AQX A;  3R3E A;  4BA7 A;  2FA4 A;  5E59 A;  4I2T A;  4NHW A;  2L4Q A;  4OO4 A;  3W8S A;  2TRX A;  2V1M A;  4PQH A;  5ECS A;  4ECB A;  3M1G A;  5A4W A;  4EC0 A;  1PKZ A;  3KP9 A;  2UZ8 A;  1Z5Y E;  4ULX A;  3M8N A;  5G5F A;  1SD8 A;  1V98 A;  1MD3 A;  1OC3 A;  1A0R P;  5DQS A;  3CRU A;  1N8J A;  2E2M A;  2LNT A;  3M9K A;  1GUH A;  2E2G A;  1OE7 A;  3KD0 A;  1M0U A;  4POL A;  3EIN A;  4ZB9 A;  1GSS A;  3LGC A;  1TU7 A;  4WF5 A;  1TTZ A;  4GXZ A;  4EVM A;  3L4N A;  4GWR A;  3FZ9 A;  1YDK A;  1F37 A;  4E8E A;  2KP2 A;  4IP6 A;  3TOT A;  1TDI A;  4Q5F A;  5AGY A;  1B48 A;  5IMZ A;  1ZGN A;  4ZL8 A;  2GTU A;  5CNW A;  1GTU A;  3LSZ A;  3O6T A;  1MTC A;  3ME7 A;  1BX9 A;  1ZZY A;  4OFT A;  4AJ7 A;  4HEA 2;  1K0B A;  3SWL A;  4OWY A;  1ZOF A;  3CSI A;  2HYX A;  3ZYW A;  2O8V B;  3WGD A;  3G7I A;  16GS A;  3FRC A;  2TIR A;  5JCG A;  4IW9 A;  2B5X A;  5IMF A;  4ZIJ A;  3VUR A;  3CRT A;  3Q6O A;  2CVD A;  4WR5 A;  5D96 A;  3I43 A;  2CQ9 A;  2GSQ A;  4L5O A;  5H5Q A;  5ECL B;  4IS0 A;  3FR6 A;  2PUK C;  3KTB A;  2H01 A;  3S9F A;  5AIS A;  1X9S B;  3AY8 A;  1GSU A;  4K0N A;  2YCD A;  3TKP A;  4ZB6 A;  3GNJ A;  1K0N A;  1SK2 A;  2OAC A;  2K18 A;  2VLV A;  5D93 A;  1RK4 A;  1O73 A;  2DJ3 A;  4WR4 A;  2PU9 C;  3LQ7 A;  2YPM A;  2F3M A;  1X5E A;  2HZE B;  3QCP A;  2WGR A;  5D73 A;  5ECI B;  2OE1 A;  2LS5 A;  2C1Y A;  1JLW A;  2PGT A;  2X8H A;  1BQ7 A;  2X99 A;  2NBS A;  2GSS A;  4F9Z A;  3G7Y A;  1THO A;  2MBS A;  4NHZ A;  4TXV A;  4L5L A;  2H1B A;  4HOJ A;  1EV9 A;  4TR3 A;  5GZZ B;  4PTS A;  5F07 A;  2FUG 2;  4I5Q A;  4X1U A;  1ERW A;  3HVX A;  3ZLP A;  5JCU A;  4K1F A;  2IWT A;  3D4T A;  2ZUP A;  3F8U A;  2HZF A;  2VLU A;  4V2L A;  3QR6 A;  5DQY A;  5DAL B;  2FWG A;  3QAV A;  3HVV A;  3JCM L;  1DE2 A;  2ON7 A;  4K7I A;  5IOW A;  2RUE A;  3ZTL A;  4HJM A;  5DVB A;  2YOI A;  2AUV A;  1JFU A;  3KGK A;  1UN2 A;  4YH2 A;  2VL2 C;  4F82 A;  2YV7 A;  4JE1 A;  2H6Y A;  1YEP A;  2IMF A;  1J9B A;  4AGS A;  2VL3 A;  1MD4 A;  2C8U A;  1SJZ A;  2LQQ A;  4IP1 A;  1WMJ A;  1HNB A;  4BL7 B;  2B1K A;  3TJG A;  1PRX A;  5CRD A;  4HS1 A;  1WJK A;  1XVQ A;  2RII A;  3QMX A;  4G2E A;  5A5K A;  4MZW A;  3EU4 A;  1BG5 A;  2HSM A;  4I8B A;  4ZBD A;  1R5P A;  3VWV A;  5ECP B;  2VIM A;  1ML6 A;  1KNG A;  2H19 A;  3BOA A;  3RAZ A;  3OR5 A;  1U6T A;  2PER A;  1QQ2 A;  3GX8 A;  2CX3 A;  1J0F A;  3L0H A;  4OFM A;  2I1U A;  1A8L A;  3MAK A;  5KN3 A;  3LXZ A;  2DLX A;  3VFI A;  4KDY A;  4V2N A;  3WYW A;  2AB6 A;  2VM1 A;  4GCI A;  2R37 A;  2YZH A;  4JR6 A;  3QFA C;  3LG6 A;  3TCO A;  2I3Y A;  2IMD A;  1T7P B;  1FHE A;  5G2Z A;  4ZBB A;  2M80 A;  1GUK A;  1T4Y A;  2VO4 A;  5ELG A;  5DAK B;  1PKW A;  3A2V A;  1U3A A;  1Z7P A;  1WE0 A;  2YZU A;  1PL1 A;  4GSN A;  4GTU A;  3EVI A;  3F4T A;  2LQO A;  2RM5 A;  4N30 A;  1QGV A;  4Q5Q A;  3SBC A;  4TRX A;  5G1K A;  1O8X A;  1TJD A;  2HRK A;  1DBY A;  3GTU A;  1Q98 A;  1SL1 B;  5CRW A;  2PPT A;  4DSR A;  4ML6 A;  3GL3 A;  1SKS B;  4ECI A;  1GSY A;  1VRS D;  4O32 A;  3DD3 A;  2QSI A;  3UBK A;  4D73 A;  3HDC A;  2C0F A;  4MH2 A;  4G9H A;  1OYJ A;  1ERV A;  2V6O A;  3H4K A;  2H6X A;  4FQU A;  4EE0 A;  1U3I A;  4XRD A;  6GSV A;  3KZQ A;  3EMP A;  3UEM A;  4HDE A;  2GT5 A;  2YWM A;  2FCH A;  5CRE A;  1V2A A;  3DWV A;  3HY2 A;  3MDK A;  3EWL A;  5IM9 A;  2CX4 A;  1AW9 A;  1GP1 A;  4ECJ A;  1NSW A;  4TR1 B;  2HRF A;  1XWG A;  3TRX A;  2ON5 A;  1SKR B;  5F8B A;  4BVX B;  2L5O A;  4KW6 A;  3R2Q A;  4WF4 A;  4TXO B;  1SJI A;  1XCC A;  4OFN A;  3TRQ A;  3P2A A;  4IBP A;  4USS A;  3IPZ A;  3N9J A;  4EDY A;  4IQ1 A;  4IGJ A;  2G2Q A;  4HQZ A;  5G1L A;  3IAS 2;  3LFL A;  1ZYE A;  3GH9 A;  2TRC P;  2VCZ A;  4G19 A;  1T8E B;  2QGV A;  3NZN A;  4MLY A;  1FVJ A;  1FVK A;  1T3B A;  2AAW A;  2N5F A;  3FYG A;  4JED A;  3A3T A;  3HYP A;  4AJ8 A;  3A5W A;  3ERF A;  5ENU A;  2EC4 A;  4HUA A;  5EL8 A;  2H74 A;  3D5J A;  4YQU A;  4POK A;  4O5R A;  4NWY A;  2GQK A;  6GSY A;  7GSS A;  2DJ0 A;  1LU4 A;  1U88 A;  1FOV A;  1OE8 A;  2FY6 A;  3L9S A;  1Z3E A;  1UA5 A;  2LJA A;  4HZ4 A;  1YF1 A;  1M9A A;  1ACV A;  1E6B A;  3A2W A;  3US3 A;  2IL3 A;  3LJR A;  5KN0 A;  1EOG A;  2H1D A;  4N10 A;  1OVN A;  1I9D A;  4IJI A;  4BVY A;  3VLN A;  4NAX A;  3E3E A;  3IE3 A;  3IC4 A;  1YEX A;  1YKC A;  3APQ A;  3CMI A;  1QUW A;  3G9B A;  2BTO T;  5CRH A;  3TGZ A;  4K2D A;  2C3N A;  5INY A;  1M2B A;  3GMF A;  4EL1 A;  1KEB A;  4MPF A;  3UAP A;  2I4A A;  1G0T A;  2LST A;  1CQG A;  3F63 A;  1B4Q A;  1NHO A;  2DBC A;  4EDZ A;  4K7N A;  1EGO A;  5ECH B;  3CSH A;  3BJ5 A;  2H76 A;  2JZT A;  4F0B A;  3KH9 A;  3KJY A;  3UVH A;  1K0D A;  1R5A A;  3FY7 A;  1TKD B;  2H1G A;  1F3A A;  2RM6 A;  3DVW A;  4GLT A;  2R3X A;  1R7H A;  3IHQ A;  1XWA A;  2LNS A;  2YN1 A;  1C72 A;  1ZL9 A;  1O8W A;  1G7O A;  4FIW A;  5ECR B;  1YZX A;  3VWW A;  1Z6M A;  3DVX A;  3D22 A;  3KH7 A;  5A4V A;  1JZR A;  3KTL A;  2R6K A;  2VM2 A;  3TKS A;  4EUY A;  2MBT A;  2K8S A;  4L8E A;  1URM A;  1PA3 A;  3DML A;  3IAM 2;  5HQP A;  4LMV A;  3HKR A;  1AQV A;  2EIQ A;  2VUP A;  3GH6 A;  1TK8 B;  1BYE A;  2CZ3 A;  1X5D A;  1X0R A;  1M99 A;  1EOH A;  2PVQ A;  5LNK e;  2F9S A;  3GKX A;  1GSF A;  1DUG A;  2HE3 A;  4MPG A;  4WBR D;  3Q74 A;  2O87 A;  2OAD A;  4KUN A;  2JSZ A;  3HD5 A;  2M72 A;  1WPI A;  4PUR A;  5ID2 A;  1WIK A;  3TOU A;  1FB6 A;  4MJB A;  1YJ6 A;  3TB2 A;  2FWF A;  2VCV A;  3UBL A;  1TRV A;  2B3S A;  3UVT A;  1SJ6 A;  3QOU A;  3TJK A;  5BMU A;  2IIY A;  4L0W A;  19GS A;  2F51 A;  5JCW A;  4LL4 B;  2I9H A;  3IC8 A;  3H1N A;  4X0X A;  3KMO A;  1ZMA A;  2HRA A;  5ECM B;  2B6M A;  3L9U A;  4HI7 A;  2YWI A;  3IK9 A;  5D9V A;  2B7K A;  4GRF A;  1O6J A;  2YJ7 A;  2GS3 A;  4H86 A;  2MYG A;  1RW1 A;  4KCA A;  2H30 A;  1B4P A;  2H0I A;  2KHP A;  3QD9 A;  1S3C A;  5L71 A;  4ISD A;  3KM6 A;  4HZ2 A;  5IMV A;  4WXT A;  1G7E A;  3ERW A;  2FWE A;  2EIO A;  4JBB A;  3LWA A;  2L6C A;  4JU5 A;  3GKM A;  3ZRE A;  5C00 A;  1X9M B;  1PMT A;  4PXO A;  5A4U A;  5IQY A;  4IHU A;  1YF0 A;  2XBI A;  2H71 A;  5CO3 A;  5DCG A;  3F4S A;  3TUE A;  1K0M A;  1XIY A;  1SK0 A;  3WD6 A;  2F8A A;  2PBJ A;  3C1R A;  1K0C A;  6GSX A;  3DEX A;  4V1A p;  1UC7 A;  3O76 A;  2N5B A;  4RI6 A;  3WT2 A;  4ZIL A;  14GS A;  2K8V A;  1X9W B;  2GSR A;  4G10 A;  4I97 A;  2QKE A;  1OKT A;  2J23 A;  4NPB A;  3RPP A;  2DJJ A;  2AJQ B;  3LYK A;  3ZRD A;  3HA9 A;  2K9F A;  3QDN A;  2IFQ A;  5GAN D;  2CVB A;  1GLQ A;  1GNW A;  13GS A;  4IEL A;  1XWB A;  4HQS A;  4AJ6 A;  2V32 A;  3K8N A;  2HRN A;  1HQO A;  4J57 E;  2H1A A;  3APO A;  5HFI A;  3GX0 A;  4N11 A;  5B6N A;  1XOB A;  1NHY A;  2RUF A;  1WWJ A;  1NW2 A;  3GIX A;  3LEF A;  1SL2 B;  2P5Q A;  3FHK A;  3KMN A;  1U87 A;  3QAG A;  4ZB8 A;  2DML A;  3EU3 A;  2HSM B;  4LLR A;  1VF3 A;  2B5E A;  3VK9 A;  3TJF A;  3A2X A;  2OE0 A;  4J56 E;  1R26 A;  3RDW A;  1VF1 A;  4OCF A;  4XCS A;  1AIU A;  4P3Y B;  3GRX A;  3IK7 A;  3GV1 A;  3HVS A;  1EEJ A;  1XWK A;  4BWS A;  1G6W A;  9GSS A;  3J7Y b;  2JU5 A;  4MJA A;  5IIZ A;  4TW5 A;  2JAC A;  3IV4 A;  1F2E A;  1TK5 B;  4HU7 A;  2O7K A;  1E2Y A;  2HSH A;  5ECQ B;  2VOC A;  1IYI A;  2HSY A;  1OKD A;  3HJP A;  4IVF A;  4FH8 A;  4POB A;  5CAX A;  4FYU A;  4TR0 A;  2E0Q A;  5B7C A;  3DKS A;  3PGT A;  1M7T A;  3UL3 A;  5IPH A;  1A2M A;  2J9H A;  2LRC A;  2L6D A;  1W4V A;  4RI7 A;  5D9W A;  5H5S A;  1EP8 A;  4MJE A;  4MF6 A;  5IO2 A;  1FG4 A;  3ZIT A;  1JZW A;  3CYN A;  1RQM A;  1ERT A;  2GVP A;  2P0G A;  3ZIJ A;  2LV3 A;  3FZA A;  1XW9 A;  5KN1 A;  2A2R A;  5F0G A;  1GSQ A;  1B8X A;  1H75 A;  2L59 A;  1F3B A;  5LCZ A;  3EMX A;  1ABA A;  2OE3 A;  2Z9S A;  4MA9 A;  2HRK B;  4O7H A;  3CTF A;  2WZ9 A;  4HJ2 A;  3GTU B;  3NIV A;  20GS A;  2H0H A;  3L9V A;  3W8J A;  4K6X A;  2IN3 A;  2VCX A;  4RQX A;  1Q4J A;  2R2J A;  1O7U A;  2CZ2 A;  3ZML A;  1KTE A;  2C3T A;  1K0O A;  4D73 B;  2P31 A;  4MF7 A;  4OO5 A;  4MAB A;  2JZR A;  4KSO A;  2OBK A;  1TRS A;  2V2G A;  2ZNM A;  5IPG A;  4XS6 A;  2WRT A;  5DJL A;  3C73 A;  3GYK A;  4QQ7 A;  2V6K A;  4O92 A;  2XBQ A;  3C1S A;  2HI7 A;  5ECN B;  1SEN A;  1H4O A;  4EXJ A;  4ML1 A;  4KX4 A;  4DSS A;  1LBK A;  2CAQ A;  4Q5R A;  4I2U A;  5EY6 A;  2XC2 A;  5KN2 A;  5LD0 A;  2WJU A;  3N5O A;  3FKF A;  2C4J A;  5D9T A;  5IO0 A;  1GH2 A;  3MSZ A;  2DSA A;  2YNX A;  3CBU A;  5IOX A;  3TKS E;  1AQW A;  3KXO A;  4WET A;  1A23 A;  3VPQ A;  2PWJ A;  1USB A;  3HXS A;  4PGT A;  1LJR A;  2C0D A;  2HLS A;  4K8M A;  3PPU A;  4NXI A;  5HR1 A;  3M9J A;  1FB0 A;  3EC3 A;  1TRU A;  2LJK A;  1HYU A;  3TJJ A;  4Q5N A;  1OC9 A;  5DBQ A;  3FR9 A;  5HFK A;  1J08 A;  1QXH A;  3H8Q A;  1BED A;  2P5R A;  4XTS A;  1VF2 A;  2AYT A;  4EF0 A;  3DGQ A;  3D0Z A;  1XVW A;  1K0A A;  1K3O A;  4GQF A;  4KE3 A;  1SL0 B;  5KEJ A;  3FEU A;  1HNA A;  1GRX A;  5AN1 A;  2C0G A;  3LOR A;  2VLT A;  3D6I A;  3VWX A;  1GLP A;  1XBS A;  2NTO A;  3RPN A;  3RBT A;  4POM A;  1O81 A;  1YY7 A;  2GZZ A;  3GST A;  3CXG A;  5HR2 A;  1OAZ A;  5B6M A;  3VI7 A;  2H8L A;  4LMW A;  5FHI A;  3TKS C;  3VWU A;  1PX6 A;  2C0E A;  1ZCP A;  1JHB A;  3I69 A;  2XPD A;  22GS A;  3IR4 A;  1CQH A;  5B8B A;  2JL4 A;  1K3L A;  2D2Z A;  1V9W A;  2WDU A;  1EWX A;  5IMA A;  5DDL A;  5H5R A;  4CHS A;  2B1L A;  1FAA A;  4G0I A;  3MNG A;  1XWC A;  1ILO A;  5GAP D;  2R5G A;  4BVY B;  3L78 A;  2PN8 A;  4I6X A;  3CTG A;  3ZFB A;  2C3Q A;  3F3R A;  3GHA A;  5D8I A;  1FO5 A;  4XS4 A;  2LRN A;  1GSD A;  3ZL5 A;  2FHE A;  2LJR A;  10GS A;  3ZVJ A;  4MP4 A;  2HXK A;  2DIY A;  3DXB A;  3O3T A;  3FW2 A;  1EZK A;  2L4C A;  2GST A;  2FNO A;  4KB3 A;  2LEG A;  3F9U A;  2OKA A;  1S3D A;  3ERG A;  2NDO A;  3J7Y k;  12GS A;  5CYY A;  4KND A;  2RLI A;  3BBY A;  4RUV A;  5COH A;  4XIH A;  2H70 A;  2H73 A;  3M0F A;  4ZL7 A;  3TKR A;  2HFD A;  4KH7 A;  4NV2 A;  3U6V A;  3GKN A;  1QK8 A;  1AAZ A;  1YQ1 A;  2GGT A;  4GST A;  4ID0 A;  3HJM A;  3DRN A;  4PX1 A;  2BJX A;  1V57 A;  4N0V A;  5DCH A;  3F0I A;  5CP1 A;  1M2A A;  4ZBA A;  5J5N A;  3EUR A;  3BCK A;  4NV5 A;  2HNL A;  3I9V 2;  5HR3 A;  1TXX A;  1TRW A;  2VCQ A;  1TOF A;  5J3R A;  1GL8 A;  11GS A;  1VGL A;  2YWO A;  2IMK A;  3GN3 A;  2WCI A;  5J9B A;  1UVZ A;  1W89 A;  3LYP A;  4DVC A;  4KAE A;  4WBJ A;  4MH3 A;  2X8C A;  2H66 A;  5DJM A;  4PUF C;  3F3Q A;  1TK0 B;  4MK3 A;  1A0F A;  2CAI A;  2G0F A;  2MMO A;  4IJ3 A;  1GUM A;  3IDV A;  2N5A A;  2OA7 A;  2CV4 A;  1GSE A;  3DIE A;  6GST A;  3IRA A;  4F0C A;  2REM A;  1Z7R A;  1Y6E A;  3F6D A;  3ZZX A;  2YV9 A;  2H75 A;  2DJ2 A;  5ID2 B;  5HFG A;  3V1W A;  2FWH A;  5ABR A;  4G0K A;  1V40 A;  4YAP A;  2LUS A;  3KCM A;  3ZMK A;  3M3M A;  3ISO A;  1ON4 A;  4CDO A;  2MMZ A;  3Q18 A;  4YQM A;  3HCZ A;  4JR4 A;  3PIN A;  2EIR A;  4V2M A;  2HZE A;  4GSS A;  4K0G A;  1Y25 A;  3PH9 A;  4MF5 A;  2NVL A;  4MZC A;  3QAW A;  1T4Z A;  2WB9 A;  1SD9 A;  3Q19 A;  3U5R E;  2H0G A;  1S3A A;  1XFL A;  2K6V A;  2GQM A;  4TN8 A;  5C04 A;  3H79 A;  2JSY A;  2KLX A;  2AV4 A;  4YQV A;  1QFN A;  3GFK A;  4YAV A;  5EVO A;  2HSN B; 
#chains in the Genus database with same CATH topology
 1MDI A;  4E8H A;  3ZVJ D;  4G0L A;  2WVX A;  4CW9 A;  2AHE A;  2FGX A;  1N25 A;  4F03 A;  4ICY A;  4KDU A;  4N0Z A;  3G7J A;  5DAL A;  1Z9H A;  1PN9 A;  5E4W A;  1SKW B;  4L0U A;  3BCI A;  1EEM A;  1DSB A;  1BAY A;  1Y1U A;  1ERU A;  1XPV A;  2V41 A;  5CRG A;  2I81 A;  1JZD A;  5FT3 A;  2DJ1 A;  3FR3 A;  4F2I A;  2XPE A;  1A24 A;  2DMM A;  3P90 A;  2KOK A;  1SU9 A;  2MMN A;  1A8Y A;  1BJX A;  2FD3 A;  1HNC A;  4BL7 A;  3F6F A;  4KCE A;  3KP8 A;  2YJH A;  2O85 A;  4N3Z A;  1KBN A;  2O3E A;  4ACS A;  4WKW A;  5ELA A;  3UMA A;  3FZ5 A;  4V1A g;  1WOU A;  5G31 A;  3IOS A;  4AF2 A;  5J4U A;  4IN0 A;  4TR4 A;  3GA4 A;  1FW1 A;  2KUC A;  3MWH A;  3A5I A;  4E68 A;  3VI5 A;  4CY6 A;  3IXR A;  3UOM A;  2IFQ B;  2H72 A;  2VCT A;  3GUS A;  3TJB A;  2X8G A;  5JWR B;  4OCE A;  5F05 A;  4ILF A;  4PQI A;  2IME A;  3IBH A;  4Z2U A;  3RHC A;  2WS2 A;  1EP7 A;  2O89 A;  1JLV A;  2L57 A;  1AC1 A;  1A2L A;  1PSQ A;  6GSS A;  1ST9 A;  4HU9 A;  4KSM A;  2HT9 A;  2OJL A;  1SYR A;  4MJC A;  1AXD A;  3GSS A;  3HVN A;  1M9B A;  1THX A;  5DAK A;  3VPT A;  1DE1 A;  1M2D A;  1VF4 A;  1TW9 A;  5F06 A;  1V58 A;  4X43 A;  1PX7 A;  4EO3 A;  2GZP A;  5J41 A;  1OC8 A;  1SYX A;  4Z7X A;  1M3J A;  3CSJ A;  4FYB A;  4MMM A;  4TKY A;  3TDG A;  2C80 A;  3C7M A;  1F6M C;  4YKG A;  3PR8 A;  1XZO A;  4FO5 A;  4GQC A;  4OMV A;  2IPA A;  5JWQ B;  1TI1 A;  5IMC A;  4GF0 A;  5IMD A;  5J40 A;  3GL5 A;  2LRT A;  1GTA A;  4MDC A;  2CA8 A;  2VL2 A;  6GSW A;  2GDR A;  1GWC A;  5B8A A;  5FWG A;  4NMU A;  4DSQ A;  2PVO C;  2DC5 A;  3ZIV A;  1XOA A;  2X64 A;  3UAR A;  2YAN A;  1WP0 A;  2B7J A;  1TI3 A;  5ECO B;  2H6Z A;  3NOF A;  2VD1 A;  2BMX A;  1PGT A;  2ZCT A;  1I5G A;  2ES7 A;  1GUL A;  2CT6 A;  2YP6 A;  4FYC A;  3E9J B;  3QFB C;  4ECC A;  2WZS A;  3D4M A;  2A2S A;  1IYH A;  5GSS A;  1NM3 A;  8GSS A;  3FK8 A;  3BD2 A;  1F9M A;  5EPF A;  1WRY A;  4BWQ A;  4KA0 A;  1TP9 A;  1YKA A;  4QL7 A;  2WVY A;  1XW6 A;  1T1V A;  1MDK A;  3LW9 A;  4TR1 A;  5D9X A;  2WW3 A;  4LA1 A;  2WW2 A;  1Z6N A;  4BVX A;  3GKK A;  3ME8 A;  4HSC X;  3FZ4 A;  3EE2 A;  3I6A A;  4TXO A;  4XS1 A;  2M46 A;  3LXT A;  2E7P A;  3HHV A;  2DJK A;  2CVK A;  3WGX A;  2QC7 A;  2HQT A;  1B9X C;  2VCW A;  2IMI A;  2NPB A;  2EFH A;  4DEJ A;  2FLS A;  1G6Y A;  1XW5 A;  2VD0 A;  5AIV A;  4PHZ C;  1HD2 A;  3KIJ A;  3UIW A;  2GQL A;  2WUL A;  1AUC A;  3QPM A;  2X4A A;  1MEK A;  2VL9 A;  4DSS B;  3H93 A;  2VAF A;  5AIX A;  2MMA A;  1B9Y C;  4BIK A;  3UJ1 A;  4MZB A;  1PQN A;  2GZY A;  4XHM A;  3C8E A;  2R4V A;  2B5Y A;  2MZC A;  4K7O A;  4WEY A;  4IKH A;  1MDJ A;  1O85 A;  2KP1 A;  3TKQ A;  4QL9 A;  1K3Y A;  3EYT A;  4OD7 A;  4PQ1 A;  2ALB A;  3WT1 A;  4BPY A;  3ZFL A;  1GTB A;  1OC9 B;  1X5C A;  3GUR A;  5ECK B;  3HZ8 A;  1N2A A;  5J9C A;  1XXU A;  1QMV A;  3HZ4 A;  4PNG A;  2EFE A;  5HR0 A;  4FXY P;  1ZYQ B;  4ZL9 A;  1R4W A;  1EGR A;  3DYR A;  1GTI A;  3W6G A;  2LKU A;  3KEB A;  4J2F A;  3RHB A;  3E0U A;  4PNF A;  1TU8 A;  3HJO A;  4CY8 A;  1A2J A;  2O36 A;  4JRR A;  4KDX A;  2GLR A;  2A4V A;  3ED3 A;  4IQA A;  3C71 A;  1SK1 A;  2FA8 A;  2OBI A;  3D21 A;  1GNE A;  17GS A;  4XRA A;  4JZQ A;  2L5L A;  3P8W A;  1T00 A;  3P7X A;  4O5Q A;  5G5E A;  4PUA A;  3WGE A;  1EV4 A;  5JWO B;  4ZXG A;  2JAD A;  3APS A;  18GS A;  4TOP A;  1PD2 1;  2F8F A;  4EKZ A;  2XHF A;  5GST A;  2GT6 A;  5G30 A;  4KF9 A;  2YWN A;  4AKI A;  4LL1 B;  1JZO A;  6GSU A;  4TVE A;  2JZS A;  2LTK A;  3IA1 A;  1PL2 A;  4RQR A;  4XS4 B;  3TRP A;  2PMT A;  3RGB C;  2DIZ A;  2WFC A;  4K9Z A;  4KGI A;  4MCU A;  2IJY A;  3F4R A;  1AQX A;  3R3E A;  4BA7 A;  2FA4 A;  5E59 A;  4I2T A;  4NHW A;  2L4Q A;  4OO4 A;  3W8S A;  2TRX A;  2V1M A;  4PQH A;  5ECS A;  4ECB A;  3M1G A;  5A4W A;  4EC0 A;  1PKZ A;  3KP9 A;  2UZ8 A;  1Z5Y E;  4ULX A;  5BRT A;  3M8N A;  5G5F A;  1SD8 A;  5A34 A;  1V98 A;  4G01 A;  1MD3 A;  1OC3 A;  1A0R P;  5DQS A;  3CRU A;  1N8J A;  2E2M A;  2LNT A;  3M9K A;  1GUH A;  2E2G A;  1OE7 A;  2R0P A;  1M0U A;  3KD0 A;  4POL A;  3EIN A;  4ZB9 A;  1GSS A;  4ZB7 A;  3LGC A;  1TU7 A;  4WF5 A;  1TTZ A;  4GXZ A;  4EVM A;  3L4N A;  4GWR A;  3FZ9 A;  1YDK A;  1F37 A;  4E8E A;  2KP2 A;  4IP6 A;  3TOT A;  1TDI A;  4Q5F A;  5AGY A;  1B48 A;  1ZYN A;  5IMZ A;  1ZGN A;  4ZL8 A;  2GTU A;  5CNW A;  1GTU A;  3LSZ A;  3O6T A;  1MTC A;  3ME7 A;  1BX9 A;  1ZZY A;  4OFT A;  4AJ7 A;  4HEA 2;  1K0B A;  3SWL A;  4OWY A;  1ZOF A;  3CSI A;  2HYX A;  3ZYW A;  2O8V B;  3WGD A;  3G7I A;  16GS A;  3FRC A;  2TIR A;  5JCG A;  4IW9 A;  3HMJ G;  2B5X A;  5IMF A;  4ZIJ A;  3VUR A;  3CRT A;  3Q6O A;  2CVD A;  4WR5 A;  5D96 A;  3I43 A;  2CQ9 A;  2GSQ A;  4L5O A;  5H5Q A;  5ECL B;  4IS0 A;  3FR6 A;  2PUK C;  3KTB A;  2H01 A;  3S9F A;  5AIS A;  1X9S B;  3AY8 A;  1GSU A;  4K0N A;  3CWG A;  2YCD A;  3TKP A;  4ZB6 A;  3GNJ A;  4EIQ A;  1K0N A;  1SK2 A;  2OAC A;  2K18 A;  5A1N A;  2VLV A;  2O5V A;  5D93 A;  1RK4 A;  2WW1 A;  1O73 A;  2DJ3 A;  4WR4 A;  4K5R A;  2PU9 C;  3LQ7 A;  2YPM A;  2F3M A;  1X5E A;  2HZE B;  3QCP A;  2WGR A;  5D73 A;  5ECI B;  2OE1 A;  2LS5 A;  2C1Y A;  1JLW A;  2PGT A;  2X8H A;  2H1L A;  1BQ7 A;  2X99 A;  2NBS A;  2GSS A;  4F9Z A;  3G7Y A;  1THO A;  2MBS A;  4NHZ A;  4TXV A;  4L5L A;  2H1B A;  4HOJ A;  1EV9 A;  4TR3 A;  5GZZ B;  4PTS A;  5F07 A;  2FUG 2;  4I5Q A;  4X1U A;  1ERW A;  3HVX A;  3ZLP A;  5JCU A;  4K1F A;  2IWT A;  3D4T A;  2ZUP A;  3F8U A;  2HZF A;  2WVX B;  2VLU A;  4V2L A;  3QR6 A;  5DQY A;  5DAL B;  2FWG A;  3QAV A;  3HVV A;  3JCM L;  1DE2 A;  2ON7 A;  4K7I A;  5IOW A;  2RUE A;  3ZTL A;  4HJM A;  5DVB A;  2YOI A;  4MNN A;  2AUV A;  1JFU A;  3KGK A;  1UN2 A;  4YH2 A;  2VL2 C;  4F82 A;  2YV7 A;  4JE1 A;  2H6Y A;  1YEP A;  2IMF A;  1J9B A;  4AGS A;  2VL3 A;  1MD4 A;  2C8U A;  1SJZ A;  2LQQ A;  4IP1 A;  1WMJ A;  1HNB A;  4BL7 B;  2B1K A;  3TJG A;  1PRX A;  5CRD A;  4HS1 A;  1WJK A;  1XVQ A;  2RII A;  3QMX A;  4G2E A;  5A5K A;  4MZW A;  3EU4 A;  1BG5 A;  1S4B P;  2HSM A;  4PI0 C;  4I8B A;  4ZBD A;  1R5P A;  3VWV A;  5ECP B;  2VIM A;  1ML6 A;  1KNG A;  2H19 A;  3BOA A;  3RAZ A;  3OR5 A;  4PI2 C;  1U6T A;  2PER A;  1QQ2 A;  3GX8 A;  2CX3 A;  1J0F A;  3L0H A;  4OFM A;  2I1U A;  1A8L A;  3MAK A;  5KN3 A;  3LXZ A;  2DLX A;  3VFI A;  4KDY A;  4V2N A;  3WYW A;  2AB6 A;  2VM1 A;  4GCI A;  2R37 A;  2YZH A;  4JR6 A;  3QFA C;  3LG6 A;  3TCO A;  2I3Y A;  2IMD A;  1T7P B;  1FHE A;  5G2Z A;  4ZBB A;  2M80 A;  1GUK A;  1T4Y A;  2VO4 A;  5ELG A;  5DAK B;  1PKW A;  3A2V A;  1U3A A;  1Z7P A;  1WE0 A;  2YZU A;  1PL1 A;  4GSN A;  4GTU A;  3EVI A;  3F4T A;  2LQO A;  2RM5 A;  4N30 A;  1QGV A;  4Q5Q A;  3SBC A;  4TRX A;  5G1K A;  1O8X A;  1TJD A;  2HRK A;  1DBY A;  3GTU A;  1Q98 A;  1SL1 B;  5CRW A;  5J4V A;  2PPT A;  4DSR A;  4ML6 A;  3GL3 A;  3CHX C;  1SKS B;  4ECI A;  1GSY A;  1VRS D;  4O32 A;  3DD3 A;  2QSI A;  3UBK A;  4D73 A;  3HDC A;  2C0F A;  4MH2 A;  4G9H A;  1OYJ A;  1ERV A;  2V6O A;  3H4K A;  2H6X A;  4FQU A;  4EE0 A;  1U3I A;  4XRD A;  6GSV A;  4EIP A;  3KZQ A;  1YEW C;  3EMP A;  3UEM A;  4HDE A;  2GT5 A;  4YKF A;  2YWM A;  2FCH A;  5CRE A;  1V2A A;  3DWV A;  3HY2 A;  3MDK A;  3EWL A;  2VKZ G;  2DKI A;  5IM9 A;  2CX4 A;  1AW9 A;  1GP1 A;  4ECJ A;  1NSW A;  4TR1 B;  2HRF A;  1XWG A;  3TRX A;  2ON5 A;  1SKR B;  5F8B A;  4BVX B;  2L5O A;  3MIX A;  4KW6 A;  3R2Q A;  4WF4 A;  4TXO B;  1SJI A;  1XCC A;  4OFN A;  3TRQ A;  3P2A A;  4IBP A;  4USS A;  3IPZ A;  3N9J A;  1S3R A;  4EDY A;  4IQ1 A;  4IGJ A;  2G2Q A;  4HQZ A;  5G1L A;  1PN0 A;  3IAS 2;  3LFL A;  1ZYE A;  1TXU A;  3GH9 A;  2TRC P;  2VCZ A;  4G19 A;  1T8E B;  3EPT A;  2QGV A;  3NZN A;  4MLY A;  1FVJ A;  1BF5 A;  1FVK A;  1T3B A;  2AAW A;  2N5F A;  3FYG A;  4JED A;  3A3T A;  3HYP A;  4Z2R A;  4AJ8 A;  3A5W A;  3ERF A;  5ENU A;  2EC4 A;  4HUA A;  5EL8 A;  2H74 A;  3D5J A;  4YQU A;  4POK A;  4O5R A;  3MYD A;  4NWY A;  2GQK A;  6GSY A;  7GSS A;  2DJ0 A;  1LU4 A;  1U88 A;  1FOV A;  1OE8 A;  2FY6 A;  3L9S A;  1Z3E A;  5KOX A;  1UA5 A;  2LJA A;  4HZ4 A;  1YF1 A;  1M9A A;  1ACV A;  1E6B A;  3A2W A;  3US3 A;  2IL3 A;  3LJR A;  5KN0 A;  1EOG A;  1FOH A;  2H1D A;  4N10 A;  1OVN A;  1I9D A;  2R0C A;  4IJI A;  4BVY A;  3VLN A;  4NAX A;  3E3E A;  3IE3 A;  3IC4 A;  1YEX A;  1YKC A;  3APQ A;  3CMI A;  1QUW A;  3G9B A;  2BTO T;  5CRH A;  3TGZ A;  4K2D A;  2C3N A;  5INY A;  1M2B A;  4W66 A;  3GMF A;  4EL1 A;  1KEB A;  4MPF A;  3UAP A;  2I4A A;  1G0T A;  2LST A;  1CQG A;  3F63 A;  1B4Q A;  1NHO A;  2DBC A;  4EDZ A;  4K7N A;  1EGO A;  5ECH B;  3CSH A;  3BJ5 A;  2H76 A;  2JZT A;  4F0B A;  2QA2 A;  3KH9 A;  3KJY A;  3UVH A;  1K0D A;  1R5A A;  3FY7 A;  1TKD B;  2H1G A;  1F3A A;  2RM6 A;  3DVW A;  4GLT A;  2R3X A;  1R7H A;  3IHQ A;  1XWA A;  2LNS A;  2YN1 A;  1C72 A;  1ZL9 A;  1O8W A;  1G7O A;  4FIW A;  5ECR B;  1YZX A;  4O5U A;  3VWW A;  1Z6M A;  3DVX A;  3D22 A;  3KH7 A;  5A4V A;  1JZR A;  3KTL A;  2R6K A;  1M3I A;  2VM2 A;  3TKS A;  4EUY A;  2MBT A;  2K8S A;  4L8E A;  1URM A;  1PA3 A;  3DML A;  2R0G A;  3IAM 2;  2X49 A;  4LMV A;  3HKR A;  5HQP A;  1AQV A;  2EIQ A;  4A5P A;  2VUP A;  3GH6 A;  1SVO A;  1TK8 B;  1BYE A;  2CZ3 A;  1X5D A;  1X0R A;  1M99 A;  1EOH A;  2PVQ A;  5LNK e;  2F9S A;  3GKX A;  1GSF A;  1DUG A;  2HE3 A;  4MPG A;  4WBR D;  3Q74 A;  2O87 A;  2OAD A;  4KUN A;  2JSZ A;  3HD5 A;  2M72 A;  1WPI A;  4PUR A;  4AKX B;  5ID2 A;  1WIK A;  3TOU A;  1FB6 A;  4MJB A;  4AKG A;  5A5H A;  1YJ6 A;  3TB2 A;  2FWF A;  2VCV A;  3UBL A;  1TRV A;  2B3S A;  3UVT A;  1SJ6 A;  3QOU A;  3TJK A;  5BMU A;  2IIY A;  4L0W A;  19GS A;  2F51 A;  5JCW A;  4LL4 B;  2I9H A;  3IC8 A;  3H1N A;  4X0X A;  3KMO A;  1ZMA A;  2HRA A;  5ECM B;  2B6M A;  3L9U A;  4HI7 A;  2YWI A;  3IK9 A;  3TU3 B;  5D9V A;  2B7K A;  4GRF A;  1O6J A;  2YJ7 A;  2GS3 A;  4H86 A;  2MYG A;  1RW1 A;  4KCA A;  2H30 A;  1B4P A;  2H0I A;  2KHP A;  3QD9 A;  1S3C A;  2HSN A;  4ISD A;  5L71 A;  5A1N B;  3KM6 A;  4HZ2 A;  5IMV A;  4WXT A;  1G7E A;  3ERW A;  2FWE A;  2EIO A;  4JBB A;  3LWA A;  2L6C A;  4JU5 A;  3GKM A;  3ZRE A;  5C00 A;  1X9M B;  1PMT A;  4PXO A;  5A4U A;  5IQY A;  4IHU A;  1YF0 A;  2XBI A;  2H71 A;  5CO3 A;  5DCG A;  3F4S A;  3TUE A;  1K0M A;  1XIY A;  1SK0 A;  3WD6 A;  2F8A A;  2PBJ A;  3C1R A;  1K0C A;  6GSX A;  3DEX A;  4V1A p;  1UC7 A;  3O76 A;  2N5B A;  4RI6 A;  3WT2 A;  4ZIL A;  14GS A;  4GDF A;  2K8V A;  1X9W B;  2GSR A;  4G10 A;  4I97 A;  2QKE A;  1OKT A;  2J23 A;  3FMW A;  4NPB A;  3RPP A;  2DJJ A;  2AJQ B;  3LYK A;  3ZRD A;  3HA9 A;  2K9F A;  3QDN A;  2IFQ A;  5GAN D;  2CVB A;  1GLQ A;  1GNW A;  13GS A;  4IEL A;  1XWB A;  4HQS A;  4AJ6 A;  2V32 A;  3K8N A;  2HRN A;  1HQO A;  4J57 E;  2H1A A;  3APO A;  5HFI A;  3GX0 A;  4N11 A;  5B6N A;  1XOB A;  1NHY A;  2RUF A;  1WWJ A;  1NW2 A;  3GIX A;  1I1I P;  2A4H A;  3LEF A;  1SL2 B;  2P5Q A;  1ZYP A;  3FHK A;  3KMN A;  1U87 A;  3QAG A;  4ZB8 A;  2DML A;  3EU3 A;  2HSM B;  4LLR A;  1VF3 A;  2B5E A;  3VK9 A;  3TJF A;  3A2X A;  2OE0 A;  1R26 A;  4J56 E;  3RDW A;  1VF1 A;  4OCF A;  4XCS A;  1AIU A;  4P3Y B;  3GRX A;  3IK7 A;  3GV1 A;  3HVS A;  1EEJ A;  1XWK A;  5J4Y A;  4BWS A;  1G6W A;  9GSS A;  3J7Y b;  2JU5 A;  4MJA A;  5IIZ A;  4TW5 A;  2JAC A;  3IV4 A;  1F2E A;  1SVM A;  1TK5 B;  4HU7 A;  2O7K A;  1E2Y A;  2HSH A;  5ECQ B;  2VOC A;  1IYI A;  2HSY A;  1OKD A;  3HJP A;  4IVF A;  4FH8 A;  4POB A;  5CAX A;  4FYU A;  4TR0 A;  2E0Q A;  5B7C A;  3DKS A;  3PGT A;  1M7T A;  3UL3 A;  5IPH A;  1A2M A;  2J9H A;  2LRC A;  2L6D A;  1W4V A;  4RI7 A;  5D9W A;  5H5S A;  1EP8 A;  4MJE A;  4MF6 A;  5IO2 A;  1FG4 A;  3ZIT A;  1JZW A;  3CYN A;  1RQM A;  1ERT A;  2GVP A;  2P0G A;  3ZIJ A;  2LV3 A;  3FZA A;  1XW9 A;  5KN1 A;  2A2R A;  5F0G A;  1GSQ A;  1B8X A;  1H75 A;  2L59 A;  1F3B A;  5LCZ A;  3EMX A;  1ABA A;  2OE3 A;  2Z9S A;  4MA9 A;  2HRK B;  4O7H A;  3CTF A;  2WZ9 A;  4HJ2 A;  3GTU B;  3NIV A;  20GS A;  2H0H A;  3L9V A;  3W8J A;  4K6X A;  2IN3 A;  2VCX A;  4RQX A;  1Q4J A;  2R2J A;  1O7U A;  2CZ2 A;  3ZML A;  1XG8 A;  2OT3 A;  1KTE A;  2C3T A;  1K0O A;  4D73 B;  2DKH A;  2P31 A;  4MF7 A;  4OO5 A;  4MAB A;  2JZR A;  4KSO A;  2OBK A;  1TRS A;  2V2G A;  4Z2T A;  2ZNM A;  5IPG A;  4XS6 A;  2WRT A;  5DJL A;  4AKH A;  3C73 A;  3GYK A;  4QQ7 A;  2V6K A;  4O92 A;  2XBQ A;  3C1S A;  2HI7 A;  5ECN B;  1SEN A;  1H4O A;  4EXJ A;  4ML1 A;  4KX4 A;  4DSS A;  1LBK A;  2CAQ A;  4Q5R A;  4I2U A;  5EY6 A;  2XC2 A;  5KN2 A;  5LD0 A;  2WJU A;  3N5O A;  3FKF A;  2C4J A;  5D9T A;  5IO0 A;  1GH2 A;  3MSZ A;  2DSA A;  2YNX A;  1YVL A;  3CBU A;  5IOX A;  3TKS E;  1AQW A;  3KXO A;  2A2P A;  4WET A;  1A23 A;  2QA1 A;  3VPQ A;  2PWJ A;  1USB A;  3HXS A;  4PGT A;  1LJR A;  2C0D A;  2HLS A;  4K8M A;  3PPU A;  4NXI A;  5HR1 A;  3M9J A;  1FB0 A;  3EC3 A;  1TRU A;  2LJK A;  1HYU A;  3TJJ A;  2WVZ A;  4Q5N A;  1OC9 A;  3IHG A;  5DBQ A;  3FR9 A;  5HFK A;  1J08 A;  1QXH A;  3H8Q A;  1BED A;  2P5R A;  4XTS A;  1VF2 A;  2AYT A;  4EF0 A;  3DGQ A;  3D0Z A;  1XVW A;  1BG1 A;  1K0A A;  1K3O A;  4GQF A;  4KE3 A;  5J47 A;  1SL0 B;  5KEJ A;  3FEU A;  1HNA A;  1GRX A;  5AN1 A;  2C0G A;  3LOR A;  2VLT A;  3D6I A;  3VWX A;  1GLP A;  1XBS A;  2NTO A;  3RPN A;  3RBT A;  4POM A;  1O81 A;  1YY7 A;  2GZZ A;  3GST A;  3CXG A;  5HR2 A;  1OAZ A;  5B6M A;  3VI7 A;  2H8L A;  4LMW A;  5FHI A;  3TKS C;  3VWU A;  1PX6 A;  2C0E A;  1ZCP A;  1JHB A;  3I69 A;  2XPD A;  22GS A;  3IR4 A;  1CQH A;  5B8B A;  2JL4 A;  1K3L A;  2D2Z A;  1SVL A;  2WDU A;  1EWX A;  1V9W A;  5IMA A;  5DDL A;  5H5R A;  4CHS A;  5KOW A;  2B1L A;  1FAA A;  4G0I A;  3MNG A;  1XWC A;  1ILO A;  5GAP D;  2R5G A;  4BVY B;  3L78 A;  2PN8 A;  4I6X A;  2EFD A;  3CTG A;  3ZFB A;  2C3Q A;  3F3R A;  3GHA A;  5D8I A;  1FO5 A;  4XS4 A;  2LRN A;  1GSD A;  3ZL5 A;  2FHE A;  2LJR A;  2WW0 A;  10GS A;  3ZVJ A;  4MP4 A;  2HXK A;  2DIY A;  3DXB A;  3O3T A;  3FW2 A;  1EZK A;  2L4C A;  2GST A;  2FNO A;  4KB3 A;  2LEG A;  3F9U A;  2OKA A;  1S3D A;  3ERG A;  2NDO A;  3J7Y k;  12GS A;  5CYY A;  4KND A;  2RLI A;  3BBY A;  4RUV A;  5COH A;  4XIH A;  2H70 A;  2H73 A;  3M0F A;  4ZL7 A;  3TKR A;  2HFD A;  4KH7 A;  4NV2 A;  3U6V A;  3GKN A;  1QK8 A;  1AAZ A;  1YQ1 A;  2GGT A;  4GST A;  4K2X A;  4ID0 A;  3HJM A;  3DRN A;  4PX1 A;  3CQF A;  5A34 B;  4AI6 A;  2BJX A;  1V57 A;  4N0V A;  5DCH A;  3F0I A;  5CP1 A;  1M2A A;  4ZBA A;  5J5N A;  3EUR A;  3BCK A;  4NV5 A;  3RFR C;  2HNL A;  3I9V 2;  5HR3 A;  1TXX A;  1TRW A;  2VCQ A;  1TOF A;  5J3R A;  1GL8 A;  11GS A;  1VGL A;  2YWO A;  2IMK A;  3GN3 A;  2WCI A;  5J9B A;  1UVZ A;  1W89 A;  3LYP A;  4DVC A;  4KAE A;  4WBJ A;  4MH3 A;  2X8C A;  2H66 A;  5DJM A;  4PUF C;  1PFO A;  3F3Q A;  1TK0 B;  2UV8 G;  4MK3 A;  1A0F A;  2CAI A;  2G0F A;  2MMO A;  4K5S A;  4IJ3 A;  1GUM A;  3IDV A;  2N5A A;  2OA7 A;  2CV4 A;  1GSE A;  3DIE A;  6GST A;  3IRA A;  4F0C A;  2REM A;  1Z7R A;  1Y6E A;  3F6D A;  3ZZX A;  2YV9 A;  2H75 A;  2DJ2 A;  5ID2 B;  5HFG A;  3V1W A;  2FWH A;  5ABR A;  4G0K A;  1V40 A;  4YAP A;  2LUS A;  5A5H B;  4QMK A;  3KCM A;  3ZMK A;  3M3M A;  3ISO A;  1ON4 A;  4CDO A;  2MMZ A;  5BMU B;  3Q18 A;  4YQM A;  3HCZ A;  4JR4 A;  3PIN A;  2EIR A;  4V2M A;  2HZE A;  4GSS A;  4K0G A;  1Y25 A;  3PH9 A;  4MF5 A;  4X4J A;  2NVL A;  4MZC A;  3QAW A;  1T4Z A;  2WB9 A;  1SD9 A;  3Q19 A;  3U5R E;  2H0G A;  1S3A A;  1XFL A;  2K6V A;  2GQM A;  4TN8 A;  5C04 A;  3H79 A;  2EFC A;  2JSY A;  2KLX A;  2AV4 A;  4YQV A;  1QFN A;  3GFK A;  4YAV A;  5EVO A;  2HSN B; 
#chains in the Genus database with same CATH homology
 1MDI A;  4E8H A;  3ZVJ D;  4G0L A;  4CW9 A;  2AHE A;  2FGX A;  1N25 A;  4F03 A;  4ICY A;  4KDU A;  4N0Z A;  3G7J A;  5DAL A;  1Z9H A;  1PN9 A;  5E4W A;  1SKW B;  4L0U A;  3BCI A;  1EEM A;  1DSB A;  1BAY A;  1Y1U A;  1ERU A;  1XPV A;  2V41 A;  5CRG A;  2I81 A;  1JZD A;  5FT3 A;  2DJ1 A;  3FR3 A;  4F2I A;  2XPE A;  1A24 A;  2DMM A;  3P90 A;  2KOK A;  1SU9 A;  2MMN A;  1A8Y A;  1BJX A;  2FD3 A;  1HNC A;  4BL7 A;  3F6F A;  4KCE A;  3KP8 A;  2YJH A;  2O85 A;  4N3Z A;  1KBN A;  4ACS A;  4WKW A;  5ELA A;  3UMA A;  3FZ5 A;  4V1A g;  1WOU A;  5G31 A;  3IOS A;  4AF2 A;  5J4U A;  4IN0 A;  4TR4 A;  3GA4 A;  1FW1 A;  2KUC A;  3MWH A;  3A5I A;  4E68 A;  3VI5 A;  4CY6 A;  3IXR A;  3UOM A;  2IFQ B;  2H72 A;  2VCT A;  3GUS A;  3TJB A;  2X8G A;  5JWR B;  4OCE A;  5F05 A;  4ILF A;  4PQI A;  2IME A;  3IBH A;  4Z2U A;  3RHC A;  2WS2 A;  1EP7 A;  2O89 A;  1JLV A;  2L57 A;  1AC1 A;  1A2L A;  1PSQ A;  6GSS A;  1ST9 A;  4HU9 A;  4KSM A;  2HT9 A;  2OJL A;  1SYR A;  4MJC A;  1AXD A;  3GSS A;  1M9B A;  1THX A;  5DAK A;  3VPT A;  1DE1 A;  1M2D A;  1VF4 A;  1TW9 A;  5F06 A;  1V58 A;  4X43 A;  1PX7 A;  4EO3 A;  2GZP A;  5J41 A;  1OC8 A;  1SYX A;  4Z7X A;  3CSJ A;  4FYB A;  4MMM A;  4TKY A;  3TDG A;  2C80 A;  3C7M A;  1F6M C;  4YKG A;  3PR8 A;  1XZO A;  4FO5 A;  4GQC A;  4OMV A;  2IPA A;  5JWQ B;  1TI1 A;  5IMC A;  4GF0 A;  5IMD A;  5J40 A;  3GL5 A;  2LRT A;  1GTA A;  4MDC A;  2CA8 A;  2VL2 A;  6GSW A;  2GDR A;  1GWC A;  5B8A A;  5FWG A;  4NMU A;  4DSQ A;  2PVO C;  2DC5 A;  3ZIV A;  1XOA A;  2X64 A;  3UAR A;  2YAN A;  1WP0 A;  2B7J A;  1TI3 A;  5ECO B;  2H6Z A;  3NOF A;  2VD1 A;  2BMX A;  1PGT A;  2ZCT A;  1I5G A;  2ES7 A;  1GUL A;  2CT6 A;  2YP6 A;  4FYC A;  3E9J B;  3QFB C;  4ECC A;  3D4M A;  2A2S A;  1IYH A;  5GSS A;  1NM3 A;  8GSS A;  3FK8 A;  3BD2 A;  1F9M A;  5EPF A;  1WRY A;  4BWQ A;  4KA0 A;  1TP9 A;  1YKA A;  4QL7 A;  1XW6 A;  1T1V A;  1MDK A;  3LW9 A;  4TR1 A;  5D9X A;  4LA1 A;  1Z6N A;  4BVX A;  3GKK A;  3ME8 A;  3FZ4 A;  3EE2 A;  3I6A A;  4TXO A;  4XS1 A;  2M46 A;  3LXT A;  2E7P A;  3HHV A;  2DJK A;  2CVK A;  3WGX A;  2QC7 A;  2HQT A;  1B9X C;  2VCW A;  2IMI A;  2NPB A;  2EFH A;  4DEJ A;  2FLS A;  1G6Y A;  1XW5 A;  2VD0 A;  5AIV A;  1HD2 A;  3KIJ A;  3UIW A;  2GQL A;  2WUL A;  1AUC A;  3QPM A;  2X4A A;  1MEK A;  2VL9 A;  4DSS B;  3H93 A;  2VAF A;  5AIX A;  2MMA A;  1B9Y C;  3UJ1 A;  4MZB A;  1PQN A;  2GZY A;  4XHM A;  3C8E A;  2R4V A;  2B5Y A;  2MZC A;  4K7O A;  4WEY A;  4IKH A;  1MDJ A;  1O85 A;  2KP1 A;  3TKQ A;  4QL9 A;  1K3Y A;  3EYT A;  4OD7 A;  4PQ1 A;  2ALB A;  3WT1 A;  4BPY A;  3ZFL A;  1GTB A;  1OC9 B;  1X5C A;  3GUR A;  5ECK B;  3HZ8 A;  1N2A A;  5J9C A;  1XXU A;  1QMV A;  3HZ4 A;  4PNG A;  2EFE A;  5HR0 A;  1ZYQ B;  4ZL9 A;  1R4W A;  1EGR A;  3DYR A;  1GTI A;  3W6G A;  2LKU A;  3KEB A;  4J2F A;  3RHB A;  3E0U A;  4PNF A;  1TU8 A;  3HJO A;  4CY8 A;  1A2J A;  4JRR A;  4KDX A;  2GLR A;  2A4V A;  3ED3 A;  4IQA A;  3C71 A;  1SK1 A;  2FA8 A;  2OBI A;  3D21 A;  1GNE A;  17GS A;  4XRA A;  4JZQ A;  2L5L A;  3P8W A;  1T00 A;  3P7X A;  4O5Q A;  5G5E A;  4PUA A;  3WGE A;  1EV4 A;  5JWO B;  4ZXG A;  2JAD A;  3APS A;  18GS A;  4TOP A;  1PD2 1;  2F8F A;  4EKZ A;  2XHF A;  5GST A;  2GT6 A;  5G30 A;  4KF9 A;  2YWN A;  4AKI A;  4LL1 B;  1JZO A;  6GSU A;  4TVE A;  2JZS A;  2LTK A;  3IA1 A;  1PL2 A;  4RQR A;  4XS4 B;  3TRP A;  2PMT A;  2DIZ A;  2WFC A;  4K9Z A;  4KGI A;  4MCU A;  2IJY A;  3F4R A;  1AQX A;  3R3E A;  4BA7 A;  2FA4 A;  5E59 A;  4I2T A;  4NHW A;  2L4Q A;  4OO4 A;  3W8S A;  2TRX A;  2V1M A;  4PQH A;  5ECS A;  4ECB A;  3M1G A;  5A4W A;  4EC0 A;  1PKZ A;  3KP9 A;  2UZ8 A;  1Z5Y E;  4ULX A;  5BRT A;  3M8N A;  5G5F A;  1SD8 A;  5A34 A;  1V98 A;  4G01 A;  1MD3 A;  1OC3 A;  1A0R P;  5DQS A;  3CRU A;  1N8J A;  2E2M A;  2LNT A;  3M9K A;  1GUH A;  2E2G A;  1OE7 A;  2R0P A;  1M0U A;  3KD0 A;  4POL A;  3EIN A;  4ZB9 A;  1GSS A;  4ZB7 A;  3LGC A;  1TU7 A;  4WF5 A;  1TTZ A;  4GXZ A;  4EVM A;  3L4N A;  4GWR A;  3FZ9 A;  1YDK A;  1F37 A;  4E8E A;  2KP2 A;  4IP6 A;  3TOT A;  1TDI A;  4Q5F A;  5AGY A;  1B48 A;  1ZYN A;  5IMZ A;  1ZGN A;  4ZL8 A;  2GTU A;  5CNW A;  1GTU A;  3LSZ A;  3O6T A;  1MTC A;  3ME7 A;  1BX9 A;  1ZZY A;  4OFT A;  4AJ7 A;  4HEA 2;  1K0B A;  3SWL A;  4OWY A;  1ZOF A;  3CSI A;  2HYX A;  3ZYW A;  2O8V B;  3WGD A;  3G7I A;  16GS A;  3FRC A;  2TIR A;  5JCG A;  4IW9 A;  3HMJ G;  2B5X A;  5IMF A;  4ZIJ A;  3VUR A;  3CRT A;  3Q6O A;  2CVD A;  4WR5 A;  5D96 A;  3I43 A;  2CQ9 A;  2GSQ A;  4L5O A;  5H5Q A;  5ECL B;  4IS0 A;  3FR6 A;  2PUK C;  3KTB A;  2H01 A;  3S9F A;  5AIS A;  1X9S B;  3AY8 A;  1GSU A;  4K0N A;  3CWG A;  2YCD A;  3TKP A;  4ZB6 A;  3GNJ A;  4EIQ A;  1K0N A;  1SK2 A;  2OAC A;  2K18 A;  5A1N A;  2VLV A;  2O5V A;  5D93 A;  1RK4 A;  1O73 A;  2DJ3 A;  4WR4 A;  4K5R A;  2PU9 C;  3LQ7 A;  2YPM A;  2F3M A;  1X5E A;  2HZE B;  3QCP A;  2WGR A;  5D73 A;  5ECI B;  2OE1 A;  2LS5 A;  2C1Y A;  1JLW A;  2PGT A;  2X8H A;  2H1L A;  1BQ7 A;  2X99 A;  2NBS A;  2GSS A;  4F9Z A;  3G7Y A;  1THO A;  2MBS A;  4NHZ A;  4TXV A;  4L5L A;  2H1B A;  4HOJ A;  1EV9 A;  4TR3 A;  5GZZ B;  4PTS A;  5F07 A;  2FUG 2;  4I5Q A;  4X1U A;  1ERW A;  3HVX A;  3ZLP A;  5JCU A;  4K1F A;  2IWT A;  3D4T A;  2ZUP A;  3F8U A;  2HZF A;  2VLU A;  4V2L A;  3QR6 A;  5DQY A;  5DAL B;  2FWG A;  3QAV A;  3HVV A;  3JCM L;  1DE2 A;  2ON7 A;  4K7I A;  5IOW A;  2RUE A;  3ZTL A;  4HJM A;  5DVB A;  2YOI A;  4MNN A;  2AUV A;  1JFU A;  3KGK A;  1UN2 A;  4YH2 A;  2VL2 C;  4F82 A;  2YV7 A;  4JE1 A;  2H6Y A;  1YEP A;  2IMF A;  1J9B A;  4AGS A;  2VL3 A;  1MD4 A;  2C8U A;  1SJZ A;  2LQQ A;  4IP1 A;  1WMJ A;  1HNB A;  4BL7 B;  2B1K A;  3TJG A;  1PRX A;  5CRD A;  4HS1 A;  1WJK A;  1XVQ A;  2RII A;  3QMX A;  4G2E A;  5A5K A;  4MZW A;  3EU4 A;  1BG5 A;  2HSM A;  4I8B A;  4ZBD A;  1R5P A;  3VWV A;  5ECP B;  2VIM A;  1ML6 A;  1KNG A;  2H19 A;  3BOA A;  3RAZ A;  3OR5 A;  1U6T A;  2PER A;  1QQ2 A;  3GX8 A;  2CX3 A;  1J0F A;  3L0H A;  4OFM A;  2I1U A;  1A8L A;  3MAK A;  5KN3 A;  3LXZ A;  2DLX A;  3VFI A;  4KDY A;  4V2N A;  3WYW A;  2AB6 A;  2VM1 A;  4GCI A;  2R37 A;  2YZH A;  4JR6 A;  3QFA C;  3LG6 A;  3TCO A;  2I3Y A;  2IMD A;  1T7P B;  1FHE A;  5G2Z A;  4ZBB A;  2M80 A;  1GUK A;  1T4Y A;  2VO4 A;  5ELG A;  5DAK B;  1PKW A;  3A2V A;  1U3A A;  1Z7P A;  1WE0 A;  2YZU A;  1PL1 A;  4GSN A;  4GTU A;  3EVI A;  3F4T A;  2LQO A;  2RM5 A;  4N30 A;  1QGV A;  4Q5Q A;  3SBC A;  4TRX A;  5G1K A;  1O8X A;  1TJD A;  2HRK A;  1DBY A;  3GTU A;  1Q98 A;  1SL1 B;  5CRW A;  5J4V A;  2PPT A;  4DSR A;  4ML6 A;  3GL3 A;  1SKS B;  4ECI A;  1GSY A;  1VRS D;  4O32 A;  3DD3 A;  2QSI A;  3UBK A;  4D73 A;  3HDC A;  2C0F A;  4MH2 A;  4G9H A;  1OYJ A;  1ERV A;  2V6O A;  3H4K A;  2H6X A;  4FQU A;  4EE0 A;  1U3I A;  4XRD A;  6GSV A;  4EIP A;  3KZQ A;  3EMP A;  3UEM A;  4HDE A;  2GT5 A;  4YKF A;  2YWM A;  2FCH A;  5CRE A;  1V2A A;  3DWV A;  3HY2 A;  3MDK A;  3EWL A;  2VKZ G;  2DKI A;  5IM9 A;  2CX4 A;  1AW9 A;  1GP1 A;  4ECJ A;  1NSW A;  4TR1 B;  2HRF A;  1XWG A;  3TRX A;  2ON5 A;  1SKR B;  5F8B A;  4BVX B;  2L5O A;  3MIX A;  4KW6 A;  3R2Q A;  4WF4 A;  4TXO B;  1SJI A;  1XCC A;  4OFN A;  3TRQ A;  3P2A A;  4IBP A;  4USS A;  3IPZ A;  3N9J A;  4EDY A;  4IQ1 A;  4IGJ A;  2G2Q A;  4HQZ A;  5G1L A;  1PN0 A;  3IAS 2;  3LFL A;  1ZYE A;  1TXU A;  3GH9 A;  2TRC P;  2VCZ A;  4G19 A;  1T8E B;  3EPT A;  2QGV A;  3NZN A;  4MLY A;  1FVJ A;  1BF5 A;  1FVK A;  1T3B A;  2AAW A;  2N5F A;  3FYG A;  4JED A;  3A3T A;  3HYP A;  4Z2R A;  4AJ8 A;  3A5W A;  3ERF A;  5ENU A;  2EC4 A;  4HUA A;  5EL8 A;  2H74 A;  3D5J A;  4YQU A;  4POK A;  4O5R A;  3MYD A;  4NWY A;  2GQK A;  6GSY A;  7GSS A;  2DJ0 A;  1LU4 A;  1U88 A;  1FOV A;  1OE8 A;  2FY6 A;  3L9S A;  1Z3E A;  5KOX A;  1UA5 A;  2LJA A;  4HZ4 A;  1YF1 A;  1M9A A;  1ACV A;  1E6B A;  3A2W A;  3US3 A;  2IL3 A;  3LJR A;  5KN0 A;  1EOG A;  1FOH A;  2H1D A;  4N10 A;  1OVN A;  1I9D A;  2R0C A;  4IJI A;  4BVY A;  3VLN A;  4NAX A;  3E3E A;  3IE3 A;  3IC4 A;  1YEX A;  1YKC A;  3APQ A;  3CMI A;  1QUW A;  3G9B A;  2BTO T;  5CRH A;  3TGZ A;  4K2D A;  2C3N A;  5INY A;  1M2B A;  4W66 A;  3GMF A;  4EL1 A;  1KEB A;  4MPF A;  3UAP A;  2I4A A;  1G0T A;  2LST A;  1CQG A;  3F63 A;  1B4Q A;  1NHO A;  2DBC A;  4EDZ A;  4K7N A;  1EGO A;  5ECH B;  3CSH A;  3BJ5 A;  2H76 A;  2JZT A;  4F0B A;  2QA2 A;  3KH9 A;  3KJY A;  3UVH A;  1K0D A;  1R5A A;  3FY7 A;  1TKD B;  2H1G A;  1F3A A;  2RM6 A;  3DVW A;  4GLT A;  2R3X A;  1R7H A;  3IHQ A;  1XWA A;  2LNS A;  2YN1 A;  1C72 A;  1ZL9 A;  1O8W A;  1G7O A;  4FIW A;  5ECR B;  1YZX A;  4O5U A;  3VWW A;  1Z6M A;  3DVX A;  3D22 A;  3KH7 A;  5A4V A;  1JZR A;  3KTL A;  2R6K A;  2VM2 A;  3TKS A;  4EUY A;  2MBT A;  2K8S A;  4L8E A;  1URM A;  1PA3 A;  3DML A;  2R0G A;  3IAM 2;  2X49 A;  4LMV A;  3HKR A;  5HQP A;  1AQV A;  2EIQ A;  4A5P A;  2VUP A;  3GH6 A;  1SVO A;  1TK8 B;  1BYE A;  2CZ3 A;  1X5D A;  1X0R A;  1M99 A;  1EOH A;  2PVQ A;  5LNK e;  2F9S A;  3GKX A;  1GSF A;  1DUG A;  2HE3 A;  4MPG A;  4WBR D;  3Q74 A;  2O87 A;  2OAD A;  4KUN A;  2JSZ A;  3HD5 A;  2M72 A;  1WPI A;  4PUR A;  4AKX B;  5ID2 A;  1WIK A;  3TOU A;  1FB6 A;  4MJB A;  4AKG A;  5A5H A;  1YJ6 A;  3TB2 A;  2FWF A;  2VCV A;  3UBL A;  1TRV A;  2B3S A;  3UVT A;  1SJ6 A;  3QOU A;  3TJK A;  5BMU A;  2IIY A;  4L0W A;  19GS A;  2F51 A;  5JCW A;  4LL4 B;  2I9H A;  3IC8 A;  3H1N A;  4X0X A;  3KMO A;  1ZMA A;  2HRA A;  5ECM B;  2B6M A;  3L9U A;  4HI7 A;  2YWI A;  3IK9 A;  3TU3 B;  5D9V A;  2B7K A;  4GRF A;  1O6J A;  2YJ7 A;  2GS3 A;  4H86 A;  2MYG A;  1RW1 A;  4KCA A;  2H30 A;  1B4P A;  2H0I A;  2KHP A;  3QD9 A;  1S3C A;  2HSN A;  4ISD A;  5L71 A;  5A1N B;  3KM6 A;  4HZ2 A;  5IMV A;  4WXT A;  1G7E A;  3ERW A;  2FWE A;  2EIO A;  4JBB A;  3LWA A;  2L6C A;  4JU5 A;  3GKM A;  3ZRE A;  5C00 A;  1X9M B;  1PMT A;  4PXO A;  5A4U A;  5IQY A;  4IHU A;  1YF0 A;  2XBI A;  2H71 A;  5CO3 A;  5DCG A;  3F4S A;  3TUE A;  1K0M A;  1XIY A;  1SK0 A;  3WD6 A;  2F8A A;  2PBJ A;  3C1R A;  1K0C A;  6GSX A;  3DEX A;  4V1A p;  1UC7 A;  3O76 A;  2N5B A;  4RI6 A;  3WT2 A;  4ZIL A;  14GS A;  4GDF A;  2K8V A;  1X9W B;  2GSR A;  4G10 A;  4I97 A;  2QKE A;  1OKT A;  2J23 A;  3FMW A;  4NPB A;  3RPP A;  2DJJ A;  2AJQ B;  3LYK A;  3ZRD A;  3HA9 A;  2K9F A;  3QDN A;  2IFQ A;  5GAN D;  2CVB A;  1GLQ A;  1GNW A;  13GS A;  4IEL A;  1XWB A;  4HQS A;  4AJ6 A;  2V32 A;  3K8N A;  2HRN A;  1HQO A;  4J57 E;  2H1A A;  3APO A;  5HFI A;  3GX0 A;  4N11 A;  5B6N A;  1XOB A;  1NHY A;  2RUF A;  1WWJ A;  1NW2 A;  3GIX A;  2A4H A;  3LEF A;  1SL2 B;  2P5Q A;  1ZYP A;  3FHK A;  3KMN A;  1U87 A;  3QAG A;  4ZB8 A;  2DML A;  3EU3 A;  2HSM B;  4LLR A;  1VF3 A;  2B5E A;  3VK9 A;  3TJF A;  3A2X A;  2OE0 A;  1R26 A;  4J56 E;  3RDW A;  1VF1 A;  4OCF A;  4XCS A;  1AIU A;  4P3Y B;  3GRX A;  3IK7 A;  3GV1 A;  3HVS A;  1EEJ A;  1XWK A;  5J4Y A;  4BWS A;  1G6W A;  9GSS A;  3J7Y b;  2JU5 A;  4MJA A;  5IIZ A;  4TW5 A;  2JAC A;  3IV4 A;  1F2E A;  1SVM A;  1TK5 B;  4HU7 A;  2O7K A;  1E2Y A;  2HSH A;  5ECQ B;  2VOC A;  1IYI A;  2HSY A;  1OKD A;  3HJP A;  4IVF A;  4FH8 A;  4POB A;  5CAX A;  4FYU A;  4TR0 A;  2E0Q A;  5B7C A;  3DKS A;  3PGT A;  1M7T A;  3UL3 A;  5IPH A;  1A2M A;  2J9H A;  2LRC A;  2L6D A;  1W4V A;  4RI7 A;  5D9W A;  5H5S A;  1EP8 A;  4MJE A;  4MF6 A;  5IO2 A;  1FG4 A;  3ZIT A;  1JZW A;  3CYN A;  1RQM A;  1ERT A;  2GVP A;  2P0G A;  3ZIJ A;  2LV3 A;  3FZA A;  1XW9 A;  5KN1 A;  2A2R A;  5F0G A;  1GSQ A;  1B8X A;  1H75 A;  2L59 A;  1F3B A;  5LCZ A;  3EMX A;  1ABA A;  2OE3 A;  2Z9S A;  4MA9 A;  2HRK B;  4O7H A;  3CTF A;  2WZ9 A;  4HJ2 A;  3GTU B;  3NIV A;  20GS A;  2H0H A;  3L9V A;  3W8J A;  4K6X A;  2IN3 A;  2VCX A;  4RQX A;  1Q4J A;  2R2J A;  1O7U A;  2CZ2 A;  3ZML A;  2OT3 A;  1KTE A;  2C3T A;  1K0O A;  4D73 B;  2DKH A;  2P31 A;  4MF7 A;  4OO5 A;  4MAB A;  2JZR A;  4KSO A;  2OBK A;  1TRS A;  2V2G A;  4Z2T A;  2ZNM A;  5IPG A;  4XS6 A;  2WRT A;  5DJL A;  4AKH A;  3C73 A;  3GYK A;  4QQ7 A;  2V6K A;  4O92 A;  2XBQ A;  3C1S A;  2HI7 A;  5ECN B;  1SEN A;  1H4O A;  4EXJ A;  4ML1 A;  4KX4 A;  4DSS A;  1LBK A;  2CAQ A;  4Q5R A;  4I2U A;  5EY6 A;  2XC2 A;  5KN2 A;  5LD0 A;  2WJU A;  3N5O A;  3FKF A;  2C4J A;  5D9T A;  5IO0 A;  1GH2 A;  3MSZ A;  2DSA A;  2YNX A;  1YVL A;  3CBU A;  5IOX A;  3TKS E;  1AQW A;  3KXO A;  2A2P A;  4WET A;  1A23 A;  2QA1 A;  3VPQ A;  2PWJ A;  1USB A;  3HXS A;  4PGT A;  1LJR A;  2C0D A;  2HLS A;  4K8M A;  3PPU A;  4NXI A;  5HR1 A;  3M9J A;  1FB0 A;  3EC3 A;  1TRU A;  2LJK A;  1HYU A;  3TJJ A;  4Q5N A;  1OC9 A;  3IHG A;  5DBQ A;  3FR9 A;  5HFK A;  1J08 A;  1QXH A;  3H8Q A;  1BED A;  2P5R A;  4XTS A;  1VF2 A;  2AYT A;  4EF0 A;  3DGQ A;  3D0Z A;  1XVW A;  1BG1 A;  1K0A A;  1K3O A;  4GQF A;  4KE3 A;  5J47 A;  1SL0 B;  5KEJ A;  3FEU A;  1HNA A;  1GRX A;  5AN1 A;  2C0G A;  3LOR A;  2VLT A;  3D6I A;  3VWX A;  1GLP A;  1XBS A;  2NTO A;  3RPN A;  3RBT A;  4POM A;  1O81 A;  1YY7 A;  2GZZ A;  3GST A;  3CXG A;  5HR2 A;  1OAZ A;  5B6M A;  3VI7 A;  2H8L A;  4LMW A;  5FHI A;  3TKS C;  3VWU A;  1PX6 A;  2C0E A;  1ZCP A;  1JHB A;  3I69 A;  2XPD A;  22GS A;  3IR4 A;  1CQH A;  5B8B A;  2JL4 A;  1K3L A;  2D2Z A;  1SVL A;  2WDU A;  1EWX A;  1V9W A;  5IMA A;  5DDL A;  5H5R A;  4CHS A;  5KOW A;  2B1L A;  1FAA A;  4G0I A;  3MNG A;  1XWC A;  1ILO A;  5GAP D;  2R5G A;  4BVY B;  3L78 A;  2PN8 A;  4I6X A;  2EFD A;  3CTG A;  3ZFB A;  2C3Q A;  3F3R A;  3GHA A;  5D8I A;  1FO5 A;  4XS4 A;  2LRN A;  1GSD A;  3ZL5 A;  2FHE A;  2LJR A;  10GS A;  3ZVJ A;  4MP4 A;  2HXK A;  2DIY A;  3DXB A;  3O3T A;  3FW2 A;  1EZK A;  2L4C A;  2GST A;  2FNO A;  4KB3 A;  2LEG A;  3F9U A;  2OKA A;  1S3D A;  3ERG A;  2NDO A;  3J7Y k;  12GS A;  5CYY A;  4KND A;  2RLI A;  3BBY A;  4RUV A;  5COH A;  4XIH A;  2H70 A;  2H73 A;  3M0F A;  4ZL7 A;  3TKR A;  2HFD A;  4KH7 A;  4NV2 A;  3U6V A;  3GKN A;  1QK8 A;  1AAZ A;  1YQ1 A;  2GGT A;  4GST A;  4K2X A;  4ID0 A;  3HJM A;  3DRN A;  4PX1 A;  5A34 B;  4AI6 A;  2BJX A;  1V57 A;  4N0V A;  5DCH A;  3F0I A;  5CP1 A;  1M2A A;  4ZBA A;  5J5N A;  3EUR A;  3BCK A;  4NV5 A;  2HNL A;  3I9V 2;  5HR3 A;  1TXX A;  1TRW A;  2VCQ A;  1TOF A;  5J3R A;  1GL8 A;  11GS A;  1VGL A;  2YWO A;  2IMK A;  3GN3 A;  2WCI A;  5J9B A;  1UVZ A;  1W89 A;  3LYP A;  4DVC A;  4KAE A;  4WBJ A;  4MH3 A;  2X8C A;  2H66 A;  5DJM A;  4PUF C;  3F3Q A;  1TK0 B;  2UV8 G;  4MK3 A;  1A0F A;  2CAI A;  2G0F A;  2MMO A;  4K5S A;  4IJ3 A;  1GUM A;  3IDV A;  2N5A A;  2OA7 A;  2CV4 A;  1GSE A;  3DIE A;  6GST A;  3IRA A;  4F0C A;  2REM A;  1Z7R A;  1Y6E A;  3F6D A;  3ZZX A;  2YV9 A;  2H75 A;  2DJ2 A;  5ID2 B;  5HFG A;  3V1W A;  2FWH A;  5ABR A;  4G0K A;  1V40 A;  4YAP A;  2LUS A;  5A5H B;  4QMK A;  3KCM A;  3ZMK A;  3M3M A;  3ISO A;  1ON4 A;  4CDO A;  2MMZ A;  5BMU B;  3Q18 A;  4YQM A;  3HCZ A;  4JR4 A;  3PIN A;  2EIR A;  4V2M A;  2HZE A;  4GSS A;  4K0G A;  1Y25 A;  3PH9 A;  4MF5 A;  4X4J A;  2NVL A;  4MZC A;  3QAW A;  1T4Z A;  2WB9 A;  1SD9 A;  3Q19 A;  3U5R E;  2H0G A;  1S3A A;  1XFL A;  2K6V A;  2GQM A;  4TN8 A;  5C04 A;  3H79 A;  2EFC A;  2JSY A;  2KLX A;  2AV4 A;  4YQV A;  1QFN A;  3GFK A;  4YAV A;  5EVO A;  2HSN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...