4JEFA

Crystal structure of human thymidylate synthase y202a in inactive conformation.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
286
structure length
246
Chain Sequence
PPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSLGPVYGFQWRHFYSGQGVDQLQRVIDTIKTNPDDRRIIMAWNPRDLPLMALPPHALCQFAVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKMEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hotspots in an obligate homodimeric anticancer target. Structural and functional effects of interfacial mutations in human thymidylate synthase.
pubmed doi rcsb
molecule keywords Thymidylate synthase
molecule tags Transferase
source organism Homo sapiens
total genus 67
structure length 246
sequence length 286
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2013-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 4jefA00
1TVUA 1JMFA 2H2QA 3EBUA 4IQBA 1VZDA 1BKOA 1BQ1A 2FTOX 4FOGA 1SEJA 3H9KA 1EVGA 1JUTA 3K2HA 4KY8A 5J7WA 1EV5A 2A9WA 1TDUA 3CL9A 2TDDA 3N5EB 1F4GA 4E5OA 4FGTA 1F4FA 2ONBA 3ED7A 4H0RA 3UWLB 4EINA 1F4EA 2RDAA 1TRGA 1DNAA 4DQ1A 5H3AA 1RTSA 4EILA 1JU6A 1TSMA 1B02A 3KJSA 4LRRA 1YPVA 3OB7A 1J3KC 3NRRA 3GH0A 3BHLA 1AN5A 3B9HA 3EGYX 1HW3A 4G6WX 2KCEA 4DPDA 1FFLA 4TMSA 3N5GA 2FTQA 1AXWA 2G8XA 1JMIA 1TSNA 3BNZA 1NJCA 2G86A 3INVA 3JSUA 3QJ7A 1EVFA 1TSYA 1BJGA 1HVYA 4O1XD 1LCBA 1EV8A 1TDCA 1HZWA 1VZCA 1QZFA 2G8AA 1TVVA 3C0AA 4IRRA 1JTQA 3DG8C 1BDUA 1AJMA 1BKPA 5FCTA 4FOXA 2G89A 4EB4A 4IQQA 3IRNA 1KZJA 3V8HA 3C06A 1TVWA 1TLSA 1B5DA 1B5EA 4GYHA 3BHRA 1BO7A 1TSWA 1TSDA 3DL5A 3IJZA 4PSGA 1TYSA 1FWMA 1NCEA 4XSCA 1NJAA 3B5BA 1TSVA 1BSPA 3EHIX 4UP1A 3DGAC 2TSCA 3DL6A 1F4DA 3BZ0A 3GG5A 2VETA 1AIQA 3IK0A 1J3IC 4KYAA 3I3RA 1QQQA 4H0UA 2BBQA 3HJ3A 4Q0EA 1DDUA 3KJRA 3UM5A 1KZIA 4XSEA 1JG0A 1J3JC 4GEVA 4H1IA 5H38A 3IROA 1THYA 1TLCA 3EJLA 4ISWA 4EZ8A 4KNZA 1TDBA 2AAZA 1KCEA 1JUJA 1BPJA 1F4BA 2FTNA 2TDMA 4XSDA 4GD7A 4KPWA 3IRMA 3QG2A 3HBBA 4ISKA 4O1UA 4Q0DA 1BQ2A 1JTUA 1JMHA 1NJDA 3HB8A 1VZAA 1BSFA 2TSRA 3IX6A 3KGBA 3CLBA 1TSZA 3BYXA 5WRNA 1ZPRA 3IHIA 4DPHA 2RD8B 3UM6A 1VZEA 2VF0A 3UM8A 3BGXA 3TMSA 1HW4A 1LCEA 1B49A 2G8DA 2RD8A 1TSLA 4ECKA 4G2OX 1AOBA 1F4CA 1SYNA 1CI7A 1NJEA 1F28A 4KY4A 4JEFA 1TISA 4E28A 4O1XA 1BO8A 3EAWX 1NJBA 1TSXA 3EDWX 1BIDA 5BY6A 5HS3A 3IK1A 2OIPA 1I00A 1TJSA 1BP0A 3N5EA 4FQSA 3GH2X 1JMGA 4FOAA 3UWLA 4DP3A 4O7UA 3BFIA 1BP6A 1TDAA 3QGTA 1VZBA 5H39A 3EF9A 4F2VA 1LCAA
chains in the Genus database with same CATH superfamily
1TVUA 1JMFA 2H2QA 3EBUA 4IQBA 1VZDA 1BKOA 1BQ1A 2FTOX 4FOGA 1SEJA 3H9KA 1EVGA 1JUTA 3K2HA 4KY8A 5J7WA 1EV5A 2A9WA 1TDUA 3CL9A 2TDDA 3N5EB 1F4GA 4E5OA 4FGTA 1F4FA 2ONBA 3ED7A 4H0RA 3UWLB 4EINA 1F4EA 2RDAA 1TRGA 1DNAA 4DQ1A 5H3AA 1RTSA 4EILA 1JU6A 1TSMA 1B02A 3KJSA 4LRRA 1YPVA 3OB7A 1J3KC 3NRRA 3GH0A 3BHLA 1AN5A 3B9HA 3EGYX 1HW3A 4G6WX 2KCEA 4DPDA 1FFLA 4TMSA 3N5GA 2FTQA 1AXWA 2G8XA 1JMIA 1TSNA 3BNZA 1NJCA 2G86A 3INVA 3JSUA 3QJ7A 1EVFA 1TSYA 1BJGA 1HVYA 4O1XD 1LCBA 1EV8A 1TDCA 1HZWA 1VZCA 1QZFA 2G8AA 1TVVA 3C0AA 4IRRA 1JTQA 3DG8C 1BDUA 1AJMA 1BKPA 5FCTA 4FOXA 2G89A 4EB4A 4IQQA 3IRNA 1KZJA 3V8HA 3C06A 1TVWA 1TLSA 1B5DA 1B5EA 4GYHA 3BHRA 1BO7A 1TSWA 1TSDA 3DL5A 3IJZA 4PSGA 1TYSA 1FWMA 1NCEA 4XSCA 1NJAA 3B5BA 1TSVA 1BSPA 3EHIX 4UP1A 3DGAC 2TSCA 3DL6A 1F4DA 3BZ0A 3GG5A 2VETA 1AIQA 3IK0A 1J3IC 4KYAA 3I3RA 1QQQA 4H0UA 2BBQA 3HJ3A 4Q0EA 1DDUA 3KJRA 3UM5A 1KZIA 4XSEA 1JG0A 1J3JC 4GEVA 4H1IA 5H38A 3IROA 1THYA 1TLCA 3EJLA 4ISWA 4EZ8A 4KNZA 1TDBA 2AAZA 1KCEA 1JUJA 1BPJA 1F4BA 2FTNA 2TDMA 4XSDA 4GD7A 4KPWA 3IRMA 3QG2A 3HBBA 4ISKA 4O1UA 4Q0DA 1BQ2A 1JTUA 1JMHA 1NJDA 3HB8A 1VZAA 1BSFA 2TSRA 3IX6A 3KGBA 3CLBA 1TSZA 3BYXA 5WRNA 1ZPRA 3IHIA 4DPHA 2RD8B 3UM6A 1VZEA 2VF0A 3UM8A 3BGXA 3TMSA 1HW4A 1LCEA 1B49A 2G8DA 2RD8A 1TSLA 4ECKA 4G2OX 1AOBA 1F4CA 1SYNA 1CI7A 1NJEA 1F28A 4KY4A 4JEFA 1TISA 4E28A 4O1XA 1BO8A 3EAWX 1NJBA 1TSXA 3EDWX 1BIDA 5BY6A 5HS3A 3IK1A 2OIPA 1I00A 1TJSA 1BP0A 3N5EA 4FQSA 3GH2X 1JMGA 4FOAA 3UWLA 4DP3A 4O7UA 3BFIA 1BP6A 1TDAA 3QGTA 1VZBA 5H39A 3EF9A 4F2VA 1LCAA
chains in the Genus database with same CATH topology
1TVUA 1JMFA 2H2QA 3EBUA 4IQBA 1VZDA 1BKOA 1BQ1A 2FTOX 4FOGA 1SEJA 3H9KA 1EVGA 1JUTA 3K2HA 4KY8A 5J7WA 1EV5A 2A9WA 1TDUA 3CL9A 2TDDA 3N5EB 1F4GA 4E5OA 4FGTA 1F4FA 2ONBA 3ED7A 4H0RA 3UWLB 4EINA 1F4EA 2RDAA 1TRGA 1DNAA 4DQ1A 5H3AA 1RTSA 4EILA 1JU6A 1TSMA 1B02A 3KJSA 4LRRA 1YPVA 3OB7A 1J3KC 3NRRA 3GH0A 3BHLA 1AN5A 3B9HA 3EGYX 1HW3A 4G6WX 2KCEA 4DPDA 1FFLA 4TMSA 3N5GA 2FTQA 1AXWA 2G8XA 1JMIA 1TSNA 3BNZA 1NJCA 2G86A 3INVA 3JSUA 3QJ7A 1EVFA 1TSYA 1BJGA 1HVYA 4O1XD 1LCBA 1EV8A 1TDCA 1HZWA 1VZCA 1QZFA 2G8AA 1TVVA 3C0AA 4IRRA 1JTQA 3DG8C 1BDUA 1AJMA 1BKPA 5FCTA 4FOXA 2G89A 4EB4A 4IQQA 3IRNA 1KZJA 3V8HA 3C06A 1TVWA 1TLSA 1B5DA 1B5EA 4GYHA 3BHRA 1BO7A 1TSWA 1TSDA 3DL5A 3IJZA 4PSGA 1TYSA 1FWMA 1NCEA 4XSCA 1NJAA 3B5BA 1TSVA 1BSPA 3EHIX 4UP1A 3DGAC 2TSCA 3DL6A 1F4DA 3BZ0A 3GG5A 2VETA 1AIQA 3IK0A 1J3IC 4KYAA 3I3RA 1QQQA 4H0UA 2BBQA 3HJ3A 4Q0EA 1DDUA 3KJRA 3UM5A 1KZIA 4XSEA 1JG0A 1J3JC 4GEVA 4H1IA 5H38A 3IROA 1THYA 1TLCA 3EJLA 4ISWA 4EZ8A 4KNZA 1TDBA 2AAZA 1KCEA 1JUJA 1BPJA 1F4BA 2FTNA 2TDMA 4XSDA 4GD7A 4KPWA 3IRMA 3QG2A 3HBBA 4ISKA 4O1UA 4Q0DA 1BQ2A 1JTUA 1JMHA 1NJDA 3HB8A 1VZAA 1BSFA 2TSRA 3IX6A 3KGBA 3CLBA 1TSZA 3BYXA 5WRNA 1ZPRA 3IHIA 4DPHA 2RD8B 3UM6A 1VZEA 2VF0A 3UM8A 3BGXA 3TMSA 1HW4A 1LCEA 1B49A 2G8DA 2RD8A 1TSLA 4ECKA 4G2OX 1AOBA 1F4CA 1SYNA 1CI7A 1NJEA 1F28A 4KY4A 4JEFA 1TISA 4E28A 4O1XA 1BO8A 3EAWX 1NJBA 1TSXA 3EDWX 1BIDA 5BY6A 5HS3A 3IK1A 2OIPA 1I00A 1TJSA 1BP0A 3N5EA 4FQSA 3GH2X 1JMGA 4FOAA 3UWLA 4DP3A 4O7UA 3BFIA 1BP6A 1TDAA 3QGTA 1VZBA 5H39A 3EF9A 4F2VA 1LCAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TVU A;  1JMF A;  2H2Q A;  3EBU A;  4IQB A;  1VZD A;  1BKO A;  1BQ1 A;  2FTO X;  4FOG A;  1SEJ A;  3H9K A;  1EVG A;  1JUT A;  3K2H A;  4KY8 A;  5J7W A;  1EV5 A;  2A9W A;  1TDU A;  3CL9 A;  2TDD A;  3N5E B;  1F4G A;  4E5O A;  4FGT A;  1F4F A;  2ONB A;  3ED7 A;  4H0R A;  3UWL B;  4EIN A;  1F4E A;  2RDA A;  1TRG A;  1DNA A;  4DQ1 A;  5H3A A;  1RTS A;  4EIL A;  1JU6 A;  1TSM A;  1B02 A;  3KJS A;  4LRR A;  1YPV A;  3OB7 A;  1J3K C;  3NRR A;  3GH0 A;  3BHL A;  1AN5 A;  3B9H A;  3EGY X;  1HW3 A;  4G6W X;  2KCE A;  4DPD A;  1FFL A;  4TMS A;  3N5G A;  2FTQ A;  1AXW A;  2G8X A;  1JMI A;  1TSN A;  3BNZ A;  1NJC A;  2G86 A;  3INV A;  3JSU A;  3QJ7 A;  1EVF A;  1TSY A;  1BJG A;  1HVY A;  4O1X D;  1LCB A;  1EV8 A;  1TDC A;  1HZW A;  1VZC A;  1QZF A;  2G8A A;  1TVV A;  3C0A A;  4IRR A;  1JTQ A;  3DG8 C;  1BDU A;  1AJM A;  1BKP A;  5FCT A;  4FOX A;  2G89 A;  4EB4 A;  4IQQ A;  3IRN A;  1KZJ A;  3V8H A;  3C06 A;  1TVW A;  1TLS A;  1B5D A;  1B5E A;  4GYH A;  3BHR A;  1BO7 A;  1TSW A;  1TSD A;  3DL5 A;  3IJZ A;  4PSG A;  1TYS A;  1FWM A;  1NCE A;  4XSC A;  1NJA A;  3B5B A;  1TSV A;  1BSP A;  3EHI X;  4UP1 A;  3DGA C;  2TSC A;  3DL6 A;  1F4D A;  3BZ0 A;  3GG5 A;  2VET A;  1AIQ A;  3IK0 A;  1J3I C;  4KYA A;  3I3R A;  1QQQ A;  4H0U A;  2BBQ A;  3HJ3 A;  4Q0E A;  1DDU A;  3KJR A;  3UM5 A;  1KZI A;  4XSE A;  1JG0 A;  1J3J C;  4GEV A;  4H1I A;  5H38 A;  3IRO A;  1THY A;  1TLC A;  3EJL A;  4ISW A;  4EZ8 A;  4KNZ A;  1TDB A;  2AAZ A;  1KCE A;  1JUJ A;  1BPJ A;  1F4B A;  2FTN A;  2TDM A;  4XSD A;  4GD7 A;  4KPW A;  3IRM A;  3QG2 A;  3HBB A;  4ISK A;  4O1U A;  4Q0D A;  1BQ2 A;  1JTU A;  1JMH A;  1NJD A;  3HB8 A;  1VZA A;  1BSF A;  2TSR A;  3IX6 A;  3KGB A;  3CLB A;  1TSZ A;  3BYX A;  5WRN A;  1ZPR A;  3IHI A;  4DPH A;  2RD8 B;  3UM6 A;  1VZE A;  2VF0 A;  3UM8 A;  3BGX A;  3TMS A;  1HW4 A;  1LCE A;  1B49 A;  2G8D A;  2RD8 A;  1TSL A;  4ECK A;  4G2O X;  1AOB A;  1F4C A;  1SYN A;  1CI7 A;  1NJE A;  1F28 A;  4KY4 A;  4JEF A;  1TIS A;  4E28 A;  4O1X A;  1BO8 A;  3EAW X;  1NJB A;  1TSX A;  3EDW X;  1BID A;  5BY6 A;  5HS3 A;  3IK1 A;  2OIP A;  1I00 A;  1TJS A;  1BP0 A;  3N5E A;  4FQS A;  3GH2 X;  1JMG A;  4FOA A;  3UWL A;  4DP3 A;  4O7U A;  3BFI A;  1BP6 A;  1TDA A;  3QGT A;  1VZB A;  5H39 A;  3EF9 A;  4F2V A;  1LCA A; 
#chains in the Genus database with same CATH topology
 1TVU A;  1JMF A;  2H2Q A;  3EBU A;  4IQB A;  1VZD A;  1BKO A;  1BQ1 A;  2FTO X;  4FOG A;  1SEJ A;  3H9K A;  1EVG A;  1JUT A;  3K2H A;  4KY8 A;  5J7W A;  1EV5 A;  2A9W A;  1TDU A;  3CL9 A;  2TDD A;  3N5E B;  1F4G A;  4E5O A;  4FGT A;  1F4F A;  2ONB A;  3ED7 A;  4H0R A;  3UWL B;  4EIN A;  1F4E A;  2RDA A;  1TRG A;  1DNA A;  4DQ1 A;  5H3A A;  1RTS A;  4EIL A;  1JU6 A;  1TSM A;  1B02 A;  3KJS A;  4LRR A;  1YPV A;  3OB7 A;  1J3K C;  3NRR A;  3GH0 A;  3BHL A;  1AN5 A;  3B9H A;  3EGY X;  1HW3 A;  4G6W X;  2KCE A;  4DPD A;  1FFL A;  4TMS A;  3N5G A;  2FTQ A;  1AXW A;  2G8X A;  1JMI A;  1TSN A;  3BNZ A;  1NJC A;  2G86 A;  3INV A;  3JSU A;  3QJ7 A;  1EVF A;  1TSY A;  1BJG A;  1HVY A;  4O1X D;  1LCB A;  1EV8 A;  1TDC A;  1HZW A;  1VZC A;  1QZF A;  2G8A A;  1TVV A;  3C0A A;  4IRR A;  1JTQ A;  3DG8 C;  1BDU A;  1AJM A;  1BKP A;  5FCT A;  4FOX A;  2G89 A;  4EB4 A;  4IQQ A;  3IRN A;  1KZJ A;  3V8H A;  3C06 A;  1TVW A;  1TLS A;  1B5D A;  1B5E A;  4GYH A;  3BHR A;  1BO7 A;  1TSW A;  1TSD A;  3DL5 A;  3IJZ A;  4PSG A;  1TYS A;  1FWM A;  1NCE A;  4XSC A;  1NJA A;  3B5B A;  1TSV A;  1BSP A;  3EHI X;  4UP1 A;  3DGA C;  2TSC A;  3DL6 A;  1F4D A;  3BZ0 A;  3GG5 A;  2VET A;  1AIQ A;  3IK0 A;  1J3I C;  4KYA A;  3I3R A;  1QQQ A;  4H0U A;  2BBQ A;  3HJ3 A;  4Q0E A;  1DDU A;  3KJR A;  3UM5 A;  1KZI A;  4XSE A;  1JG0 A;  1J3J C;  4GEV A;  4H1I A;  5H38 A;  3IRO A;  1THY A;  1TLC A;  3EJL A;  4ISW A;  4EZ8 A;  4KNZ A;  1TDB A;  2AAZ A;  1KCE A;  1JUJ A;  1BPJ A;  1F4B A;  2FTN A;  2TDM A;  4XSD A;  4GD7 A;  4KPW A;  3IRM A;  3QG2 A;  3HBB A;  4ISK A;  4O1U A;  4Q0D A;  1BQ2 A;  1JTU A;  1JMH A;  1NJD A;  3HB8 A;  1VZA A;  1BSF A;  2TSR A;  3IX6 A;  3KGB A;  3CLB A;  1TSZ A;  3BYX A;  5WRN A;  1ZPR A;  3IHI A;  4DPH A;  2RD8 B;  3UM6 A;  1VZE A;  2VF0 A;  3UM8 A;  3BGX A;  3TMS A;  1HW4 A;  1LCE A;  1B49 A;  2G8D A;  2RD8 A;  1TSL A;  4ECK A;  4G2O X;  1AOB A;  1F4C A;  1SYN A;  1CI7 A;  1NJE A;  1F28 A;  4KY4 A;  4JEF A;  1TIS A;  4E28 A;  4O1X A;  1BO8 A;  3EAW X;  1NJB A;  1TSX A;  3EDW X;  1BID A;  5BY6 A;  5HS3 A;  3IK1 A;  2OIP A;  1I00 A;  1TJS A;  1BP0 A;  3N5E A;  4FQS A;  3GH2 X;  1JMG A;  4FOA A;  3UWL A;  4DP3 A;  4O7U A;  3BFI A;  1BP6 A;  1TDA A;  3QGT A;  1VZB A;  5H39 A;  3EF9 A;  4F2V A;  1LCA A; 
#chains in the Genus database with same CATH homology
 1TVU A;  1JMF A;  2H2Q A;  3EBU A;  4IQB A;  1VZD A;  1BKO A;  1BQ1 A;  2FTO X;  4FOG A;  1SEJ A;  3H9K A;  1EVG A;  1JUT A;  3K2H A;  4KY8 A;  5J7W A;  1EV5 A;  2A9W A;  1TDU A;  3CL9 A;  2TDD A;  3N5E B;  1F4G A;  4E5O A;  4FGT A;  1F4F A;  2ONB A;  3ED7 A;  4H0R A;  3UWL B;  4EIN A;  1F4E A;  2RDA A;  1TRG A;  1DNA A;  4DQ1 A;  5H3A A;  1RTS A;  4EIL A;  1JU6 A;  1TSM A;  1B02 A;  3KJS A;  4LRR A;  1YPV A;  3OB7 A;  1J3K C;  3NRR A;  3GH0 A;  3BHL A;  1AN5 A;  3B9H A;  3EGY X;  1HW3 A;  4G6W X;  2KCE A;  4DPD A;  1FFL A;  4TMS A;  3N5G A;  2FTQ A;  1AXW A;  2G8X A;  1JMI A;  1TSN A;  3BNZ A;  1NJC A;  2G86 A;  3INV A;  3JSU A;  3QJ7 A;  1EVF A;  1TSY A;  1BJG A;  1HVY A;  4O1X D;  1LCB A;  1EV8 A;  1TDC A;  1HZW A;  1VZC A;  1QZF A;  2G8A A;  1TVV A;  3C0A A;  4IRR A;  1JTQ A;  3DG8 C;  1BDU A;  1AJM A;  1BKP A;  5FCT A;  4FOX A;  2G89 A;  4EB4 A;  4IQQ A;  3IRN A;  1KZJ A;  3V8H A;  3C06 A;  1TVW A;  1TLS A;  1B5D A;  1B5E A;  4GYH A;  3BHR A;  1BO7 A;  1TSW A;  1TSD A;  3DL5 A;  3IJZ A;  4PSG A;  1TYS A;  1FWM A;  1NCE A;  4XSC A;  1NJA A;  3B5B A;  1TSV A;  1BSP A;  3EHI X;  4UP1 A;  3DGA C;  2TSC A;  3DL6 A;  1F4D A;  3BZ0 A;  3GG5 A;  2VET A;  1AIQ A;  3IK0 A;  1J3I C;  4KYA A;  3I3R A;  1QQQ A;  4H0U A;  2BBQ A;  3HJ3 A;  4Q0E A;  1DDU A;  3KJR A;  3UM5 A;  1KZI A;  4XSE A;  1JG0 A;  1J3J C;  4GEV A;  4H1I A;  5H38 A;  3IRO A;  1THY A;  1TLC A;  3EJL A;  4ISW A;  4EZ8 A;  4KNZ A;  1TDB A;  2AAZ A;  1KCE A;  1JUJ A;  1BPJ A;  1F4B A;  2FTN A;  2TDM A;  4XSD A;  4GD7 A;  4KPW A;  3IRM A;  3QG2 A;  3HBB A;  4ISK A;  4O1U A;  4Q0D A;  1BQ2 A;  1JTU A;  1JMH A;  1NJD A;  3HB8 A;  1VZA A;  1BSF A;  2TSR A;  3IX6 A;  3KGB A;  3CLB A;  1TSZ A;  3BYX A;  5WRN A;  1ZPR A;  3IHI A;  4DPH A;  2RD8 B;  3UM6 A;  1VZE A;  2VF0 A;  3UM8 A;  3BGX A;  3TMS A;  1HW4 A;  1LCE A;  1B49 A;  2G8D A;  2RD8 A;  1TSL A;  4ECK A;  4G2O X;  1AOB A;  1F4C A;  1SYN A;  1CI7 A;  1NJE A;  1F28 A;  4KY4 A;  4JEF A;  1TIS A;  4E28 A;  4O1X A;  1BO8 A;  3EAW X;  1NJB A;  1TSX A;  3EDW X;  1BID A;  5BY6 A;  5HS3 A;  3IK1 A;  2OIP A;  1I00 A;  1TJS A;  1BP0 A;  3N5E A;  4FQS A;  3GH2 X;  1JMG A;  4FOA A;  3UWL A;  4DP3 A;  4O7U A;  3BFI A;  1BP6 A;  1TDA A;  3QGT A;  1VZB A;  5H39 A;  3EF9 A;  4F2V A;  1LCA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...