4JENA

Structure of clostridium botulinum cmp n-glycosidase, bcmb
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
143
structure length
119
Chain Sequence
b'KRVFLAAIMKEQEKKRIEDLILFLEEKGWEVDNNFMSPDQCTKLDYDAIKECDLFIAFPGVPVSPGTHIEIGWASAMGKKIILLLAEYAYLIRGLHTVSNVHYIIYNKEKEYLQKLDLY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CMP N-GLYCOSIDASE
molecule tags Hydrolase
source organism Clostridium botulinum a
publication title Reversal of the substrate specificity of CMP N-glycosidase to dCMP.
pubmed doi rcsb
total genus 40
structure length 119
sequence length 143
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4jenA00
4U1RA 2F62A 4JENA 4KXMA 4PFKA 1WEKA 2IZ6A 4KXLA 3MAJA 3GH1A 1S2LA 4I7EA 2Q4OA 4OHRA 4A3SA 3QUAA 5AJTA 4KXNA 4WL0A 1S2GA 1WEHA 1S3FA 4FYHA 2A0KA 6PFKA 4FYKA 1S2DA 2IZ7A 3U39A 4LJLA 4LJRA 3BQ9A 4P5EA 1MTOA 3O8OB 4NPAA 4MEJA 5ITSA 2IZ5A 3UQZA 2F67A 5AJUA 1F8XA 2HIGA 1T35A 2Q4DA 4JEMA 2F48A 3EHDA 4OHBA 3OPYB 1PFKA 3O8OA 2PMBA 1RCUA 4RH3A 3IMKA 4MCJA 2KHZA 3O8LA 3F5MA 3O8NA 2F64A 2PFKA 2F2TA 1KZHA 1F8YA 1S2IA 1YDHA 2KLHA 3HNOA 4P5DA 2NX2A 3OPYA 3SBXA 1ZXXA 4HX9A 2A33A 4I4IA 3PFKA 4I36A 4FYIA 3K2QA 4LJKA 4JELA
chains in the Genus database with same CATH superfamily
2WJHA 2ZIWB 2JGLA 4JH0A 1WVMA 1QZUA 4OK3A 1V1RA 2EIHA 2AK2A 1N6KA 2VLBA 2WTBA 3RNOA 3HXTA 4FEAA 1IM8A 1Q0LA 2JI8A 1U0GA 2OWDA 3KOWA 4G0PA 3LE8A 4GSYA 4CETA 1S1MA 3NAZA 2XWSA 2QJFA 3TOVA 2ZZKA 2BGIA 4BWGA 1SKUA 4C22A 1J5EB 1P19A 2OY0A 4RHXA 2D6FA 5FOQA 3E9EA 3NHZA 4QDTA 3IIMA 2DUMA 4C6TA 1P8AA 4KQJA 2DBQA 2ZWIA 1JE1A 1E8MA 2Z09A 4YB8A 4LGMA 1SHUX 4TTQA 1PF7E 2PX0A 4NRDA 3H5NA 3LT4A 3MCZA 1JDTA 1WZUA 3NHFA 4BU0A 4B33A 5AM5A 1QR2A 2WD9A 2GEDA 4JJAA 2ID7A 3VYWA 1JEJA 1T1RA 5H8WA 3VV2A 3JCZA 3E35A 3JQGB 4HI0E 1RMYA 5JZBA 5ALKA 4NMHA 4RLHA 3DEYX 4LDZA 2PSJA 3LK7A 3AHHA 3OZIA 1G9SA 2HSDA 3M4YA 1D2AA 3RS3A 3STXA 4MP8A 1BNCA 5JE8A 2COUA 1GRQA 4I50B 4Q4AA 4ESOA 4J4TA 4KR3A 3MJSA 1FDRA 5KWJA 3OQBA 5F9FA 1RWOA 1NW5A 5U4QA 1BCSB 1DIRA 1K6EA 1VI6A 2BHTA 2F3PA 1G7TA 1CFZA 1ZLYA 2JGEA 3EODA 3QSGA 5FKJA 3GLIA 1QTQA 3KD3A 2DHRA 4KU4A 4K3VA 2B61A 1TIPA 4RPIA 2H29A 1EM8B 1BX1A 2QI9F 1E6UA 2V5VA 1V5IA 3R0JA 5BRJA 3LCCA 4ZGGA 1E69A 3FGPA 1ZA1A 4PRKA 3MGKA 1S96A 1W2GA 1XZAA 4RANA 3R41A 1E4OA 4LK3A 1MU0A 1EK1A 1F8FA 1VMIA 1ZH2A 4UNNA 3PXEA 4KG7A 4TZKA 1L7OA 3BAFA 1WRBA 3BS4A 4FBMA 4BNVA 2XGMA 1QKIA 1LVUA 5D00A 5CM8B 3V33A 1EGQA 1TTTA 1F0YA 1D1PA 1TAGA 5CU7A 4N7RA 5KOJB 4R83A 4JD5A 1T26A 5EKDA 1KC3A 1R0SA 2R5WA 2AEFA 3SYRA 4RHUA 5HOQA 2WMYA 1IATA 4K9DA 5HJ5A 4P3KA 4Y6LA 3O75A 4GX5A 4EKYA 1AQJA 4EGSA 1L8QA 1WJGA 5IT5A 4B1FA 2V9CA 1YCHA 3N0VA 3RSSA 3VAAA 4LF4B 1B0PA 1HETA 1B73A 1PVVA 3RDPA 1R88A 1UXOA 1M66A 2HDWA 3X43A 5I6DA 2IHJA 1NMSA 5JYCA 5CB4A 1WF3A 4EMTA 3ISVA 1ODSA 3TB4A 2DEUA 4IMJB 4G8BA 2C03A 3AEQA 3LRPA 4LDQA 4TS3A 4H7EA 3MB8A 2O5VA 3W9UA 3S8YA 2O4UX 1ZMXA 4G25A 5HKBA 1OLUA 5LMCA 5LCXA 3DS8A 1M8FA 1DBRA 1O57A 1SCIA 1O6CA 4TMYA 2NSLA 3LECA 3OD5A 3PD1A 1XLTA 4GKVA 5F5XA 2OXTA 2XLCA 3WB1A 2G82A 3KFLA 4PZDA 4FFRA 3RVNA 2QPAA 2H2AA 2O4CA 1NYQA 1J21A 1DIOB 2DULA 3O74A 4RL4A 4D79A 2J0VA 3PCRB 1XCGB 1GG5A 1NW6A 2LD4A 1ICIA 5AKIA 1FOEB 1GPAA 1Z34A 5DULA 1RC1A 4PPNA 5IPFA 1Z6GA 2OZEA 3F2VA 4JT2A 4M38A 4UXHA 2VQSA 1PFWA 2X86A 3N6VA 5E95A 1QMGA 1KI9A 1T9BA 4PXYA 1C41A 4LV8B 4F3NA 3PWTA 2HJGA 1XZBA 1X38A 3L8GA 1Y1LA 2HCTA 3GLGE 4ISCA 3KR2A 3TW0A 3PK0A 3UJPA 2CE7A 4ZVLA 3TCXB 3WFJA 4REQA 1SUSA 2PMWB 4JC4A 4QXAA 1IJBA 2NU6A 1USWA 4YBZA 1NJ1A 4HQKA 3QW2A 1EDZA 2P30A 2ZIAA 4EKNB 1YMVA 4KXNA 4D42A 1JP7A 1B00A 5AD1A 2NV0A 5BMVF 2ZJZA 1E4VA 4MWZA 3MMSA 4TVBA 3G7NA 2DERA 2BFCB 4PLYA 3OJ0A 3WXMA 3OZCA 1E6EA 4LDPA 4JBIA 3TL2A 4CM5A 3V6MA 2QSUA 2FUNB 4X20B 1QYVA 3G9TA 3P96A 5E4YA 3A9WA 3SYMA 3W8NA 1FFGA 3WTBA 1SD2A 2EGGA 1FXSA 3ZW9A 1DBSA 5F1PA 4R0NA 5LZ9A 3M6LA 3TD6A 1E0SA 1MXFA 1Y6FA 1JG3A 2Z6VA 3K70B 3EZ7A 3OEYA 1XNRB 1VHJA 2QGNA 4G2NA 3BMOA 3EZFA 3G8CA 3M5DA 2O7QA 4Q00A 4HDNA 3UH0A 1XVIA 1VZ3A 4P1ZA 3DZJA 3KL4A 1UWCA 4PCVA 2QDKA 3QI2A 2YV4A 1YQXA 1U8XX 3L8EA 4EY5A 1FDSA 2EVWX 4BX0A 4EZBA 1CB7A 1YQWA 5AHXA 2P3OA 5E6RB 1T0IA 4FZVA 5HILA 2CL5A 2FW0A 2AC2A 2PV0A 4KO1S 1CNMA 3RTDA 1XRJA 1JIUA 3L41A 1PL8A 2FEMA 4EA6A 1LC3A 4HJRA 1TF5A 2DWCA 4G5XA 3ANYB 2XQKA 3Q0TA 4ZCLA 4EAAA 1WXXA 3V4OA 1W5FA 4O0MA 3U26A 2ODEA 2XQVA 3CWZA 5BR1A 3I01M 3OKPA 1XZ8A 2H1RA 2VDUE 1YRYE 4PTLA 4FCWA 3EEQA 5TVKA 3R8XA 4NCBA 1YMUA 4J94A 4X8MA 1PG5A 5C8YF 2HMYB 4Y6OA 4S12A 4OXXA 4ND2A 3R9IA 4B6JA 4NK5A 1P3JA 3FR8A 2FDXA 1TMKA 2W8BB 5E4TA 5BN3B 2VP0A 2Z2YA 5LQDA 3BSYA 1E8NA 2QSJA 1DFHA 4ENQA 2V8BA 2DLNA 4TRJA 1R6AA 2QW8A 1I5RA 2FSVA 1WUTA 2EXXA 2WQZA 1AXGA 4LPSA 5FBKA 3SKYA 3CSUA 3U7QA 2HQBA 3NCTA 5A05A 2JGJA 2PGOA 4CN9A 1OR8A 3CN9A 4Q4CA 3FYSA 1QU3A 2E5LB 4OFBA 2BMEA 2W6ZA 3F7MA 5DBGA 3UJ9A 3KKQA 4IQ8A 4MULA 3MWGA 3WFIA 1XA3A 3CJRA 3QKRB 2J0QA 2C3MA 4YCSA 1Y4DE 2RC5A 1UBCA 1ZUHA 1NMZA 3WHKA 3L49A 2EBUA 3CEHA 5FEMA 3REQA 4KDRA 4MYTA 4N8SA 3NT4A 3DEHA 3RVRA 3GCGA 3I53A 4LHSA 2OGWA 3GVCA 3I2GA 3SYNA 4ZDKA 5DNAA 5K0ZA 3L9WA 4S2EA 2F62A 4RHTA 4UBMA 2CMHA 1YQDA 1NDQA 5AJXA 2C2WA 4HDSB 2YXPX 2V6MA 1B6TA 2GASA 3ZCPA 3P71T 4P82A 2Z8ZA 2E7ZA 4UCFA 4AKHA 1JRLA 3TRKA 3EJ6A 4ERXA 3PTZA 1HTWA 3PZBA 3KQWA 4ETNA 4LZAA 2PGNA 3O4GA 1EK6A 3V1YA 2FJPA 2VQDA 2BE7A 2HFJA 2ZE6A 3GRFA 1VKJA 3PTLA 4XLTA 5IAGA 3LLSA 3NP7A 1I14A 2ZBUA 4QOJA 1L5KA 1Q0TA 5ALRA 3K92A 1RP1A 2CVZA 2FG6C 3F5QA 3L9XA 4QQ8A 5AI4A 3WB0A 3HP4A 4LMRA 4JVLA 1Z4NA 1PEAA 3K70C 3CX7A 3BCRA 4OH7A 4G67A 5JJLA 1JPJA 4INPA 1VTKA 3H1AA 2XADA 3ZJVA 1HLPA 3FRJA 3RVLA 2XDWA 3H5OA 1RHRA 4NZMA 5HGXA 1CUEA 5SICE 3LW7A 3U44B 1ZESA 4BQEA 3I9V1 2KBEA 3ABQB 1RR6A 1KMIY 3EGWA 1HTBA 5FNVB 2IIQA 3IHWA 3O3MB 4JA2A 3OLCX 4IX9A 4OL9A 1KH2A 1F2UA 1VECA 2AZMA 1P9NA 1UKBA 3CZ5A 4KYTA 4TSFD 4C14A 4C4SA 4DAEA 4F4JA 3HCRA 1I94B 1NE7A 1CUJA 2VATA 3EB9A 3GJZA 3M3DA 1D6NA 1M2WA 4D8XA 1PFYA 1YDWA 3CLSC 4TMKA 4OHKA 2HC9A 3IURA 4KO3S 3DMNA 5EIHA 2ONYA 4EF6A 4KSBA 3DBLB 2R1UA 1WDLA 2FCAA 3I8OA 3O4FA 4CR6A 1E8DA 2RDMA 2FFHA 3BMNA 3IIKA 4O59O 3ZYZA 3VPXA 5AKKA 3ZDRA 2JJ2A 3KTDA 5CXQA 3A6KA 3CW8X 4M3NA 3X2EA 3TSYA 2P91A 1A5TA 1PX2A 1Z8NA 2AJLI 3RE1A 4BFYA 4WXPA 2ZUUA 5F12A 1ZAKA 4MR7A 3PGJA 4RHCA 1S89A 1ORRA 4N82A 2CKDA 1OI4A 2ACVA 2XA2A 4ZQIA 5E6SB 2HHHB 1XZGA 1TAHA 4RTLA 1VE7A 1E63A 4P34A 2CCKA 4TOIA 3AWDA 1SIUA 2O6LA 1VIAA 2Q49A 1ZN9A 2CLHB 4QATA 4YJ2F 3DEZA 4JUAA 2ZK7A 2KHZA 1OC4A 2BMWA 3LKZA 3RHTA 1VKZA 4X20A 4ENRA 1P91A 2VHTA 2C9MA 4KB5A 5AVWA 3LHIA 1TQHA 4X7MA 1F1BA 1KDPA 2YBEA 4COOA 2OYRA 3TLZA 2J59A 4MKXA 5CP8A 4BP1A 4N01A 2BMJA 3PD0A 1QO7A 4ZMBA 3E9RA 1EGAA 2XB4A 1U8EA 1UXJA 5AW9A 3WK9A 4MS1B 2NYRA 1RD4A 3FJOA 5B2FA 4EBFA 3IRUA 3V4PB 5HP4A 1ECLA 5CDGA 4QUKA 3AUXA 5F9MA 2PSSA 3AERA 5EXTA 3PPWA 3DGFC 2DHDA 2C4KA 4YJFA 3V97A 3WWCA 5I3CA 2QL7A 4CTOA 5BSUA 2V96A 1VE3A 4PS1A 1NW9B 5DIFA 3PDIA 3WBBA 4FS3A 5JNUA 3BE5A 2WSBA 3EY4A 5K2MA 4DYHA 1N5OX 3QITA 2ZDHA 4H3VA 1P6QA 3DF9A 4LVNA 1N2BA 2EFGA 3T0IA 1OAKA 4ZZIA 4NPCA 5KOIA 2NO9A 2D2EA 3UJ7A 2YDXA 3VDNB 5K3EA 1X7HA 3E4CA 2C96A 1HDXA 1LF5A 3N2LA 3P52A 4UCWA 5I9SA 2JL1A 1TT5A 3LT0A 3B7GA 3HXMA 1KI6B 1Z88A 1R7RA 1JEYB 2UYYA 2Y1DA 2JK1A 1DL5A 4AVYA 1NY6A 4HAYA 4Q1BA 5AM4A 4PRZA 4C1BA 5J47A 1KY4A 1X8KA 2OHHA 1SRRA 4B9AA 4C4OA 1B74A 1NGSA 1HE2A 3KZKA 1U7WA 2E4UA 2WYUA 1GZ4A 3GRUA 1VCHA 3QMVA 4F0JA 4HYQA 1QZTA 3DUFA 2ETXA 4NICA 5JFTA 1EFRD 3EXIA 5GM2A 4C4RA 3UPTA 3NIBA 1BQ4A 2PM8A 1Y89A 2PXXA 3QEOA 1WCYA 2G8LA 3ED5A 4H9GA 4PZPA 1DRWA 4GLJA 1YB1A 1SG0A 5DHSA 2L17A 2R4UA 4D56A 4E5MA 3GZJA 3VR5A 3U80A 4CQMD 3OAAA 2R4TA 2XTJA 1R0CA 1F4PA 1P5RA 3N2IA 2ZSIA 1CUWA 4NHEA 1OW3B 2G1AA 3E9NA 1E7QA 3H2YA 3QE3A 1C9YA 3KTFA 2C5LA 2QUZA 3CLRD 4KO8A 4NDZA 5HEKA 1GRRA 1SUAA 3AFNA 2I78A 3ZIDA 2FKAA 1KERA 2CF6A 4BFTA 3BGWA 4ARBA 2Q5EA 2A5LA 3UIEA 1HPLA 1XD2B 3BXZA 4QUGA 1WPRA 4JZYA 1ESNA 2GBPA 4NPHA 3L01A 4FMPA 1X7WA 4ND1A 3EUWA 3KEGA 3FYHA 2BUBA 2PBLA 3TQHA 4KN9S 3H6GA 3O4JA 3OCWA 2IW1A 3I23A 2JHCA 2WPDD 1OV6A 3UG7A 4EEXA 1RIIA 3U48A 2JCSA 2QUKA 4QTYA 2XVYA 4DLBA 1L5LA 2H3EA 2GF9A 3D2LA 1JQKA 1MDBA 2AMLA 1JBKA 4QNRA 4RJTA 3M81A 1NM5A 1RCFA 1PZHA 2AOWA 1BCRB 4FFVA 3ZNQA 4XRGA 3DDOA 3REOA 3SCZA 3CKMA 2V45A 3GD5A 4RF5A 2W70A 1NVGA 3U37A 1SXQA 3S29A 4GNKA 4UMEA 3EG5A 1FTYA 2R6GA 1JJVA 1RLOA 2G4LA 2ZJ6A 3HJBA 1SPBS 4GWLA 4YQZA 3QM1A 2GPAA 3VNSA 3OY2A 4U2CA 2R79A 4AZTA 4E22A 1BWSA 4LYJA 2W2OA 2YHIA 3Q87B 3L82B 3W79A 5CMLA 3UYKA 1FMFA 4TRMA 1GJRA 2FVXA 4FN4A 1KKUA 2ZWVA 3B1KA 3T9AA 3E3AA 4TSRA 4BVHA 3H8VA 3RO7A 2AOUA 4HX2A 3TS1A 4F86A 5KJCA 2HT6A 3IKMB 2HQSA 4WERA 2V3WA 3HDTA 1L8LA 1SIOA 5MFZA 4OI1A 3FX2A 1ECFA 1PSZA 4HH4A 4HNAA 4KK4A 3V3TA 2GBGA 3LSTA 4HPXB 4XA8A 2IZ1A 1TUIA 4KWHA 5LD2B 2IEZA 4UAVA 3AEUA 4OA8A 4D82A 2QBYA 1PFVA 3FLEA 1A77A 2HCJB 1RQPA 4FGSA 1DHTA 1BXZA 4DKJA 4F4UA 1N7IA 2FPPB 2GT1A 5ED0A 4ZK2A 4WN3A 4W82A 1Y5MA 3LSYA 5HF8A 1SC9A 5I7OA 4P08A 4IRUB 5D5HA 4DV4B 1HEUA 3IHKA 1IBMB 1J49A 2FN9A 3O0DA 1AN9A 4YI5A 4DQ0A 2R6ZA 5EMHA 3UVEA 1R8QA 4DS3A 3A4IA 5LA6B 4WZAE 2WM9B 3TTYA 4PLCA 1JH8A 4CF4A 2A7QA 3ZU4A 3WGGA 5BQFA 1NBIA 1Q1NA 4TRRA 1HXHA 2E9SA 1TADA 2IH4A 4D81A 2IYTA 1DAIA 1TNDA 1NF2A 1M5RA 1MZPA 1LPSA 3I2HA 1U2RA 1BVYF 5KKNB 3HEBA 1GLNA 1HYBA 2W0MA 3COZA 3H1PA 3TOSA 4HEA1 3EDRA 1RJFA 4K2AA 1UJ4A 1W5AA 2GN6A 2G9UA 4GPD1 1YZ3A 2AHOA 3G2QA 4JJZA 2OBNA 2WWVD 3RIGA 4IQGA 4DC9A 1SUPA 4QOFA 1OPRA 4ND8A 4MW5A 4Q93A 4U9HS 4PLTA 5EMJA 1N0WA 3OC0A 3TZHA 1UMDA 3BL8A 5NULA 1VIDA 5AQEA 4DXHA 3CVXA 4S1PA 2BM1A 4U39A 3VQTA 1VI5A 6PFKA 1VFNA 4XUDA 1S2DA 2YX1A 4W7HA 4CV0A 4YUAA 1OA1A 3SXUA 3AONB 4X7RA 3AUJB 4FCCA 1XTSA 2FWAA 3Q72A 3TG8A 3H5VA 5BQPA 5JPCA 1U0EA 3EIHA 4M1KA 2O8NA 1AV7A 4YP0A 2H1HA 2J5QA 1AZWA 1AKVA 4UTNA 4YAUA 4EVQA 1L8AA 3GGJA 1MQAA 3DAGA 4K87A 1RJ9B 4LI0A 4W9NC 1AKMA 4DEVA 4HGNA 2PRZA 4QFCA 1QH8A 3A4YA 5EQFA 2R68A 5LOVA 2AR7A 1DQSA 2O20A 2ZJ5A 3PHHA 5DYTA 1T2FA 5BMOA 3VI4B 3V4SA 4UULA 4EY8A 3C39A 2VZ8A 5JPIA 5IASA 5EWLA 3ANTA 2LKDA 3H5WA 3RARA 3H5IA 3I5MA 4XVRA 2IEBA 2OBYA 4KQFA 4OQDA 4V3BA 4GKBA 3RAJA 5KU1A 1ZM3A 3H2GA 1RXUA 1IXSB 1CD5A 5K3BA 1N2OA 3BAZA 1J00A 5DW3A 2WNSA 3OZEA 4BO4A 5DNEA 2C5BA 1A9TA 3WDLA 2XIQA 1NXWA 2AN9A 2XPCA 3KVRA 3KVOA 3JD2A 5C8YB 3Q7SA 4K9SA 5KI6A 2X9QA 3AWIA 4FDLA 2HJHA 1XMXA 5ENVA 1FYEA 1PO7A 1Z62A 4L7VA 2RHCA 5L45A 1GLGA 2P4EA 3AUSA 3EK2A 3CX8A 3NOXA 5CFOA 2MYUA 3ZWAA 2FQYA 4G0QA 4LQLA 1NW7A 2C8VA 3NBXX 4KLNA 4WCFC 2WVJA 4WTOA 2Z57A 3LDHA 1J0BA 1RWQA 3FPAA 1W59A 4IGIA 1PP4A 3H18A 2ASVA 4DBZA 5HOEA 4LXXA 4XYEA 3NWBA 3RR2A 2ACWA 1OBFO 2RK6A 1Y7PA 2XCIA 3EFOB 5FWYB 4A0GA 4XIJA 1KJQA 3B7PA 5EOVA 4BECA 4WXYB 4N76A 5F5LA 4HXYA 1SOMA 2YZ7A 4O5OA 2OC4A 3RUIA 2QN9A 4M0EA 1ADFA 1KK1A 4TKUB 4Q3OA 3K4PA 1ZJ5A 4J29A 1WHTA 1Z07A 3DZKA 2Z6QA 1ZOOA 3QP9A 1VJRA 3NVAA 2H1LA 1RRFA 1VG9B 5BN4B 5GGXA 1WMDA 4BCBA 1NF8A 5CLIA 1LVHA 1V2HE 4A6XA 3U62A 2H1OA 1SXIA 2R8XA 2XNHA 1MJGA 3L4KA 2AKAB 5GPBA 4B79A 2JLCA 3BILA 5IBQA 3PWSA 5T4EA 3OPQA 4KH1A 4H1VA 5EHXA 2G1JA 5HIAA 3TGLA 2NG1A 2QG6A 3PC2A 4L4UA 4JL8A 1X1SA 1C30A 3QUTA 3L7OA 4RAQA 1ODCA 3EXHB 4WZAA 5FUQA 1LWNA 2VOJA 1WW8A 1N4AA 5F9HA 1DG9A 2FPWA 4LJYA 2ICAA 1U5CA 1KI7A 5CDSA 4IG4A 4FYHA 2VT3A 2EQBA 3A0UA 5K3FB 3ZVNA 2IYVA 4G36A 5FA5A 3PE4A 1B43A 3HLKA 4ZOLA 4E4TA 1M34A 2I66A 4YCCA 2VXYA 1JIQA 3PNSA 1XU4A 4Q3CA 4CM8B 1EXMA 1ZUD1 2R96A 2YIMA 3WYAA 1BDBA 4HAIA 3QH4A 4OIMA 2C4NA 4XPIB 1R8XA 2LGJA 1VL1A 1WLYA 3UXYA 3UY4A 3RIXA 3GAZA 5G3YA 4UNRA 5B3LA 1LBEA 4AAYA 4ONEA 3QHAA 4RETA 1KEEB 5F2NA 5KOHA 5J2TA 1A95A 2BTEA 1JTFA 4DTIA 5CVEA 1FFWA 4RVHA 4JLUA 3EGDB 1U4SA 1R5JA 3DULA 1P4AA 3DZGA 1LFDB 1CETA 1JAXA 2X2PA 4TTIA 5FP0A 4ZZ1A 2DCMA 1B1AA 2IE0A 1TTQB 1KRHA 2OT3B 1GU7A 1W29A 2R8PA 3IDSA 1W85A 3IODA 2YMPA 3L0YA 3BGSA 4G5HA 4M6WA 4Q1VA 3AEXA 2WR8A 2ISQA 3A70A 2FSHA 2HYIC 2PGJA 4PLFA 4AZ3B 1UKAA 3GPLA 2GPYA 4WKGA 4OBBA 1HQCA 4LYEA 4L0CA 1KF0A 4JC5A 1W19A 2NXWA 4ZU1X 3DOFA 3X1WA 1YU9A 1LVGA 1AGYA 1LJ8A 1O6BA 1O9GA 3H99A 3Q7RA 2GA8A 4TQGA 4WXRA 4CJXA 3OE1A 2UYHA 3EZ2A 1IY1A 1Y3AA 3ZXUB 2QMEA 1WVIA 1CP3A 1I5OA 1IJFA 2VT2A 1FP4A 2WAYA 3QX9A 5TSDA 2GBLC 2J9FA 3W3AH 3UUWA 1D7OA 1NL3A 3VKWA 2HHAA 4UUBA 2JC3A 3W06A 3RSQA 1GFWA 4I4TA 1PJRA 2QROA 4YDHB 3AL2A 3RLIA 4B6EA 4HZUA 2X23A 4ZGWA 5B36A 1C4WA 2PN1A 3CEAA 5IJXA 4JT8A 4Q7EA 3WBFA 1PGQA 2HDHA 4QT0A 3WYBA 4XGIA 2QTNA 1T4BA 2OAQ1 3O92A 4N6NA 2BEVB 1HM5A 1R10A 1Z7BA 2VSFA 1OBHA 2XTMA 4XFKA 4C21A 1U04A 2BZ1A 2JRCA 2GF2A 3UMVA 1UJ2A 1PR3A 2Q2OA 4YJ3B 4E03A 2ZSJA 5LZ5A 3JYHA 1VKOA 4MIKA 4NS4A 3KV1A 2M2IA 1E3QA 4A8PA 2ZYDA 4P4UA 5BV8A 3IMGA 3G8BA 1H2ZA 3MIZA 1SHLA 1FNNA 1TQ6A 1Z6AA 3P4XA 1MOQA 3TLEA 5HZHA 2QAJA 3L46A 4G9BA 3PLAE 4F72A 2NU9A 5HS6A 2QRZA 4YAGA 1UJ5A 3MM4A 5DM1A 2NVOA 5I9BA 5A0VA 4YT2A 1GZ7A 3SHOA 1XHEA 3PC7A 2QJOA 3W2EA 3BWYA 3QMMA 3WLSA 1M5TA 1MNQA 2EERA 2XXJA 1U28C 2CXXA 2J0EA 3KP1A 3ZE8A 1QPZA 2WUGA 1ICEA 4FOSA 1HMYA 2XBMA 1TKBA 4PG8A 1A4UA 2ZJ7A 2ZTSA 5T8KC 5CHYA 5KNDA 4WK6A 1Z5ZA 2GN0A 2AE1A 4V0QA 5I9LA 2O8FA 3HY3A 2BEWB 5ENDA 2QRQA 1RLMA 4N7MA 1KO1A 2E85A 3GYGA 1ZLXA 3KX2A 1IN4A 1Q0PA 1P2GA 4NDAA 4B4KA 3NNNA 2I33A 2C1EA 1N2ZA 1NVDA 3N8GA 5I7UA 3PBKA 1JHQA 3E5NA 3OHSX 5I51A 1O9HA 1SIBE 4RXMA 4FE4A 1MQSA 1ACMA 4NZYA 2Q5HA 3SLGA 5JADA 4HDAA 1RHKA 4JP5A 1K5DA 1ZU5A 5B1IA 2XE6A 3OAAD 2CB9A 1E2IA 3DVSX 1QHNA 4IHJF 1KFBB 4ZVRA 5AUPB 1O87A 2J6HA 2QM7A 5I5GA 2LV8A 3O5AA 5CDFE 3CA8A 2HT1A 1KSJA 1LTQA 2RHOA 3NYQA 4FMBB 4Y2XA 5J40A 5BN3A 1L7VC 4ZOAA 2ZETA 4H18A 3V8VA 4B7XA 3LKDA 2XCQA 1X13A 4MO2A 4Y1EA 4F9GA 3L4BC 1I0ZA 3FMVA 3MS4A 4RPCA 4PTYA 3FMOB 3RAGA 1PU2A 1YZLA 2C0QA 3SDZA 3HM9A 2Y9MB 5FXMA 1N3LA 3IP1A 2PH3A 2HU5A 2P1RA 1KETA 4P83A 1B8UA 2PYDA 5BSGA 1U2GA 2FW8A 2DBYA 3DSRA 4K0RA 4S1VA 1RXSA 2IIPA 2ZQZA 4OQMA 3B9PA 3DVRX 1TM3E 4MRAA 4ZICA 5BORA 3UB3A 2ZPTX 3JYNA 2MMGA 3NWJA 3WIVA 4UNQA 1DC8A 1JGTA 4RJIA 4E46A 1OIXA 4ZVNA 3STVA 3JTMA 3JU3A 4C7XA 3AU9A 4EJSB 4CU5A 1UBFA 4YGXB 5EPUA 1LNQA 2Z56A 4Y6RA 1OBOA 1L5GB 1GDTA 3DE6X 1DTEA 4EUNA 4KXYA 2IKQA 5JR3A 1G8MA 1SUWA 3NNSA 3PDUA 3B1XA 4CGZA 1NFFA 4RVSA 4MCJA 1TCAA 4A2QA 1MJHA 4I55F 3HO1A 1Z0FA 4P31A 4OB8A 4WLOA 2WZQA 1Y7TA 4K9RA 3BJZA 2PU5A 3E22B 1O77A 2E0IA 5DX8A 5EC8A 3LYLA 3V46A 1C2TA 4GXNA 1PKXA 2WHQA 4BZZA 3SDBA 1YJAA 2J45A 3F6SA 3H87A 3UBMA 3DVAA 2CBGA 1ZL0A 2JFVA 3GA7A 3K6SA 1LV8A 4BWFB 1PFUA 2FP3A 4QDZA 1Q3TA 1DZIA 1PEDA 3HCDA 1UKYA 2C98A 5AVQA 3BXFA 5EIBD 3E0QA 2V3VA 1U0JA 3BPSA 1GZSA 4RDCA 2YWEA 2DZDA 1AS0A 4AD8A 4D96A 1GAQA 3K72B 1TZCA 3Q7QA 4ZRMA 2BGGA 4BIIA 3IELA 1RKBA 1HV8A 4JDUA 1K8RA 4E2XA 1E3WA 1M8GA 1BKDR 3AR8A 4NZOA 4RS3A 4X6UA 1V5WA 2XNKA 2GJSA 3O1IC 1Y1SA 1YBMA 1LLCA 5HMMA 1ZJ4A 3RYCA 1QJCA 4RW0A 2O2JA 3BE6A 3W5IA 1P44A 2FNAA 5JNSA 3ZOZA 4CM4B 3O9MA 1BTOA 2VCHA 2FPGA 5JHHB 3QEAZ 2X5OA 1NPDA 2H9YA 3BMCA 1K6JA 4FDUA 4L5CA 1P1JA 1U8FO 3AOGA 4BO6A 2J5BA 2JJ1D 2XVXA 3L7DA 1GQSA 4GRAA 1Y37A 1SK9A 3BSWA 4EHBA 4LS3A 3VOSA 4MGZR 1KJYA 3OCVA 2GKOA 3U0BA 1OI2A 4JSRA 4M9RA 2VHVA 4LISA 3H9GA 2DFNA 4CV3A 3H1TA 5G1OA 4DCCA 3HTXA 1YUMA 1SQFA 2E89A 4MR7B 3BQMB 3RU7A 2QM0A 4FFMA 5KSWB 1T3TA 1T0BA 2ORIA 3F0TA 1T8RA 3W7AA 4CIVA 4F9FA 1IN1A 3EGXA 2YCLA 5K05A 1VPWA 2GNOA 1Y6RA 4RC9A 5ALHA 3G9XA 4BFLA 4CKYA 5ICCA 5L4LA 4ZPJA 2PZLA 2Q4TA 1JALA 3AQIA 3CKYA 3R6GA 5I01A 5JS7A 3VR5H 1NV9A 1U3DA 2O9JA 4LXGA 3CV3A 3HVKA 1AO0A 1VIVA 1JQLB 3QVLA 5K6AA 1I7DA 4LF6B 3NHWA 4J3FA 1CUHA 3E9DA 2NNWB 4TS1A 5H4GA 1SXJD 3UM9A 4J91A 4NFSA 2NQ8A 2VRCA 2FUKA 1ADGA 2DWPA 4NZNA 4CL8A 5BN5A 3ERCA 4YDRA 1GYQA 1JR3E 1KYXA 3TIVA 2QORA 1JDBB 4KQ6A 4ZRNA 5EHQA 4TWRA 2X0DA 5EJ4A 1CS4C 3ZK7A 2J33A 3EMBA 5LZ2A 1RFLA 2CMDA 2YXBA 3T5PA 3NATA 3URMA 2J5RA 3U5TA 2C2BA 4KVGA 3OZSA 1PIWA 4LJAA 4BNIA 4AQDA 4IDHA 2NT3A 3HG7A 2WQ7A 5JS2A 5JQGA 1N8SA 3CY6A 4QDKA 1AGXA 2ZVPX 3DE0X 2JIMA 5DBOA 4AP9A 1NVAA 2W2VA 4N3GA 3TPFA 5AESA 1D6MA 5AWFC 3KKLA 4PZCA 1NQ5A 4HX5A 2OGSA 3JARA 1I3OA 2XMDA 4MPJA 1R2QA 3W5UA 5AKZA 4A6PA 2AMFA 4YR7A 1SR8A 1ZH6A 1ZRSA 1AUOA 3KWFA 4H16A 3WGZA 2PQ0A 3UAXA 3GRPA 3T34A 4D8YA 1E2BA 3FZNA 3ZHZA 4Z1MD 2Q8QA 5E6UB 1TK3A 1FFEA 4ECEA 4UXJA 4EP1A 5HUJA 2ZKIA 2P77A 3RC3A 2WKQA 4PPFA 3R75A 5AK0A 3ROTA 3S55A 4QHYA 1DAPA 3T1YB 3BG5A 2NADA 4J49A 3MQFA 1A72A 4OATA 1XEXA 1G8KA 4TWAA 2Q5JA 4WZZA 1F12A 3TSAA 2BM0A 5ENZA 4K5QA 3KE8A 1XX6A 1T6ZA 2Z3VA 3PFKA 4DB2A 2JHPA 1E2MA 3HSSA 2ZUSA 3ECSA 3Q8LA 4CKWB 1JR6A 3ELUA 2W48A 2V6BA 3PYLA 3WLRA 8OHMA 1EJ0A 1H4TA 2ZR9A 3MUOA 5ERXA 2C9DA 2Q8PA 2Y1FA 4IVNA 4X1IB 5IKOA 3EXAA 1FQWA 4OFXA 4D8TA 5JNTA 2P4QA 2R00C 3NETA 2C5FA 2JHAA 2EBHX 2ZSDA 5ALQA 1QHIA 4NL4H 4L5JA 5IRCD 4C5BA 3M6MD 3MXOA 2WI8A 3QVMA 1LY1A 4JJEA 2WF5A 3TL3A 3QIVA 4B85A 3AM3A 4RXUA 4IO0A 4K9KA 4NULA 2EW2A 5GV7A 1GA1A 2IYQA 1M33A 1H2FA 2QLNA 1LDEA 5BSTA 1MEEA 1NLYA 1T3HA 4WINA 4EPXA 1IB0A 5CLHA 3MF4A 3GLUA 3KZXA 4BQPA 1VHLA 2CDNA 4LK2A 5T67A 4AY2A 3KKMA 4ZVSA 3IEPA 2IY9A 3IV6A 3M1LA 2PEZA 3HJAA 4LVCA 1PDWA 1WZIA 2C9OA 4EENA 2FRVA 1PYDA 4DIMA 4GZ5A 4MP3A 1PGOA 2AZXA 4EG3A 2YXDA 4QQFA 3BKXA 5IARA 2C3YA 2IP1A 4IPTA 5DCWA 5H16A 4DSAA 3BH0A 3FKSA 1KH1A 3ZQ6A 1XBTA 1LPMA 3D8HA 1UCFA 2OXFA 2YIVX 2WV9A 4Q4DA 6NULA 2OSVA 4J0CA 2HAEA 2KLBA 1U4NA 2WWRA 2I99A 1F7VA 4GP9A 2NU8A 2YZNA 4J1QA 4YH1A 4E1AA 4ZK6A 4YMUA 3CB4A 4DE5A 3CPHA 3RKUA 4G23A 3JQEA 5ITWA 1JSLA 3DTVB 2G40A 3TOXA 4EG4A 4YRMA 5KOJA 1O58A 3FTQA 4EO9A 2XWPA 4YCMA 1VPLA 3JRNA 1V71A 1P2TA 3OQIB 4IHAA 5DI3A 4FTWA 3ESBA 3RRMA 4ZWNA 1XXLA 1E2FA 5D3QA 5DTJA 5THQA 3N39C 1VLJA 2H59A 1G21E 1X92A 2WD7B 3VNRA 1O94C 1CX9B 2IU4A 5A2GA 5TMPA 3OY7A 3KHTA 1BW9A 4QRDA 3AINA 4LCJA 3QPAA 2WICA 2PV7A 4QPPA 3SZGA 3NBKA 4D57A 4KXWA 4IZIA 1Y9ZA 3EVAA 4I3GA 1O97C 4BFXA 3HKBA 2O8VA 4PNZA 2NZWA 3H2JA 3PPVA 2OESA 1TCUA 2ZYWX 1BCSA 1QPGA 1CW2B 3NRBA 2NTJA 4LMBA 5DYIA 2O19A 2HM7A 3CBGA 1GSIA 3T7DA 1JHOA 5BYBA 2Q3LA 1NMEA 3ICVA 1SXJB 1PR9A 5B3JA 1GPMA 2D13A 3BDIA 2GETA 3OE4A 4M7PA 5DGDA 3RROA 2XGSA 4PHTA 5D2CA 1FL9A 4D0SA 3O03A 1ZH0A 4RD1A 1SB8A 1B6SA 1W0JD 1DIGA 1G20A 4QSHA 5G53C 1GAWA 3EXG2 3AFOA 1FNSA 2I7XA 2P69A 3RU3A 4C6SA 5AM3A 1WXGA 2Q3FA 4YRGA 3WMEA 4GPBA 2RGAA 2IHKA 2GCOB 2DHQA 2R3SA 4OMUA 3SEFA 2WDZA 4MPRA 4KRXA 4MYDA 3AYZB 4NJEB 1VKRA 4LTDA 3T5DA 1Y1QA 1XNQB 1DQPA 1QX3A 1YJXA 1Z0SA 3OCJA 1COWD 3MJRA 4IIVA 1IONA 3VC7A 5EWMA 1E92A 5GM1A 1G4HA 3Q0IA 3C8ZA 1M5UA 4LRYA 4Q02A 1C7QA 2DPYA 3RVBA 5BUQA 3JQAB 3ZKAA 2CZGA 2AI3A 2HH9A 3EMKA 2D0OB 3TNLA 1EQ2A 3TL6A 4IZOA 4JENA 4ZO4A 1RRGA 1A82A 2YC2C 2YWCA 3FTPA 1ISMA 1OWPA 5DBHX 3NHRA 4GRDA 1ZH8A 3O94A 1Z0AA 3LPLA 4A8TA 1ZS9A 3QX3A 2WJGA 5LIRA 3D6NB 4GX2A 4M0CA 2VAXA 4B6GA 4WD3A 1FFBA 2IS2A 5GWXA 4ZMRA 2VRBA 4K9PA 3L02A 4LKOA 1I6LA 3ABIA 4O4JF 4RD3A 3ZCVA 2WHRA 4DC1A 4EJ2A 1VSVA 2AOVA 3FCEA 5E6UA 3L8ZA 5DB4A 2D3TA 2XUZA 1NJGA 2VKTA 4XUGB 5JFGA 1MH1A 3FF1A 3VM6A 2NW6A 1QH8B 3V1LA 2GPWA 2XKAA 3IP7A 1UC4B 1LS1A 4WJZA 4MKFA 4RMJA 1LH0A 4G1VA 3VKUA 4P9NA 2QLFA 1TVEA 2BKXA 3FCXA 3B3JA 4IJWA 1I4OA 5LB2A 3SN6A 1DUVG 2BBTA 1DIHA 4UQPA 2FE4A 3UUGA 4C0WA 4HH3C 3DM9B 4ACAA 2FLVA 4WDRA 5TQ0A 3CPJB 5DHTA 1TKCA 4M1MA 2ATCA 1G3IA 3TUIC 3DMGA 2H17A 3QOYA 4L85A 1IM5A 1B0AA 4LNAA 2CV2A 2HSWA 1CR0A 1DAEA 2RGCA 3CNLA 2BZ0A 4MMZB 4EDHA 2Q1SA 3IOBA 2PTHA 1J2EA 3UKJA 1KBZA 3UA4A 5BSHA 2IP2A 1TW2A 3KLPX 1UP6A 4QUHA 3LMKA 1T4DA 2HK6A 1E99A 2PBRA 2PXCA 4JBHA 4JYZA 1H3EA 1K86A 3N7TA 2WU0A 3AKCA 4B4VA 3I2FA 1NXPA 4OHVA 4X45A 1XF9A 4DMRA 1NP3A 5K0TA 1H0HA 1IL0A 5E9QA 4WLUA 1D9ZA 2BSQA 3MLBA 3OOWA 1O97D 4QJ3A 1PS8A 3C3YA 4J9VA 3TI7A 1W0JA 2TRSB 4JLBA 3GELA 1J0DA 4IDBA 3ST7A 3EPKA 5CYPA 2B20A 3D3JA 3CVYA 3DKVA 1AM4D 1FU4A 2VYNA 4ARCA 3DHWC 3TTXA 4PXAA 1WG8A 3A27A 3R1IA 4NJMB 3B85A 3CRVA 4PVDA 121PA 2HY7A 4BVJA 4ZYUA 2H2IA 4Z4HA 5DSXA 5LVAA 2ST1A 5EESA 2X1VA 3GFTA 3SIPA 2B92A 1XRMA 4GO1A 3IQXA 4BC1A 1ZK1A 4D98A 5PNTA 1UZUA 4GUAA 4L6AA 1ONBA 1WSWA 1TT7A 3FLMA 5K0LA 1U7HA 1JB1A 2H4HA 2PSEA 4CMJA 5LU8A 4LVUA 2ZRAA 5A9RA 5A6VA 2FXIA 4K1XA 2C5GA 2P40A 3AC0A 2ZI9A 3UXHA 2V7VA 1CHNA 4BDSA 4BVEA 5CEJA 1VCOA 3W4KA 3HCAA 3HN2A 5JJKA 3D6MA 4P7FA 3IERA 4NEQA 3VU3A 2EWWA 3AR9A 4XDYA 4JELA 3QOFA 3E7FA 2FN7A 2WF7A 4NBVA 2ODAA 5MN4A 3WMXA 1WAMA 4V1CI 5J2TB 4IDPA 2B98A 4K6FA 1GTL1 4JODA 5LQRA 3WKEA 1LK5A 1YJBA 2OZLA 1ZVVA 3P20A 1QJ4A 3HWWA 2DUNA 1NAIA 3K32A 3IR7A 3G5UA 2PIDA 2BFEB 3RS8A 5AW4A 5EZQA 4F8EA 4MLCA 3HCWA 3QSYA 3MTEA 5ALUA 2Y0BA 3UOWA 2PMCA 1C3EA 2QE7A 2WD7A 2B8TA 4J3NA 2J07A 1XALA 3ZHSA 2A3NA 2VUIB 1MJGM 1E6LA 4KLCA 2QW0X 2FWIA 2JNWA 3K73O 4IH4A 4IV5A 3C5VA 3I4FA 1ZFNA 4NOJA 4C78A 4C4ZA 1DKPA 2X3FA 4MGHA 3QUAA 2Y2UA 4RGYA 4JP2A 1Q7TA 1XAGA 3PGKA 2QP9X 3VZCA 3AT1A 5GV8A 3HC7A 4DLLA 1P1CA 3ZDQA 4HAWA 1RYZA 1PCXA 3U7IA 3UW1A 2Z9CA 1YHZA 2H63A 2ZSKA 3FWNA 1PD1A 3R3XA 3D43A 1J07A 2A0KA 4O2AB 10MHA 1GP2A 2QD3A 1AK9A 1RI3A 1SK8A 4JUBA 1MAHA 1PNOA 2HN9A 1JHMA 1ZCZA 2HWYA 1VJ0A 2DR0A 3IAS6 3UJNA 3I12A 1SKYE 2QVLA 4GMKA 3IJRA 2YRFA 4G24A 1DIAA 1HZJA 4O0LA 4TYMA 3GLQA 3BTVA 4ASUD 5AM2A 3PE3A 4UHKA 4F6CA 3JTEA 2Q4BA 3QVGA 1FW8A 3E8SA 2WHPB 3GCZA 1CJVC 3IP5A 1T5BA 2L0XA 3WLEA 4RGBA 2WNHA 2ZVDA 3DV9A 4BP3A 3M8KA 3TCKA 4MS1A 5HCNA 4ZOBA 1TJPB 2P3LA 2QLTA 1Z6ZA 2WWYA 2ZZNA 1D4FA 1EUCA 2P41A 3MYRA 4Z5XA 3CT4A 1XP8A 4EEKA 2HA2A 3KAJA 1DO8A 1QH1B 3K7EA 4IJUA 4PW0A 3BSFA 4G0WA 2JARA 3RSLA 1AS3A 1E2LA 4MI6A 2VNIA 4X65B 3EHDA 3H84A 4NU5A 4NH0A 2PE5A 3Q8MA 3RHSA 2OQIA 3K09A 2OXIA 2C5AA 3G82C 3LX5A 4XGRA 4D99A 3V7UA 4AP6A 3SY8A 2FEWB 1ZINA 5ARDA 4MDHA 1M2GA 2A59A 2PY6A 3B9RA 3E5HA 4NEHB 3V8RA 4CEHB 4UUNA 2JLWA 1GILA 4EPWA 4EY3A 1VIMA 4IHJA 4YP6A 2XMPA 4FVTA 5LKAA 2VF5X 3QX8A 3BMNB 1U63A 1P62B 3IAHA 3T38A 4RTNA 1HYQA 2ZAYA 4R7ZA 4JAVC 4O2RA 2FQXA 3MWEB 4UTOA 5JSZB 2AA3A 2OFXA 4JVNA 1ADJA 1OZFA 4S24A 3PC3A 3GUCA 3MWJA 1QVAA 2CL7X 3L8FA 4PBRA 4ZU3A 4R8VA 3VSBA 1H4QA 4FHGA 5TIIA 4PIVA 2PH7A 1ZUNB 2W58A 4UEKA 3WK4A 2R1TB 4JI8B 3MJHA 3T5AA 3BZWA 4FGJA 1XDUA 3TLKA 5J1SB 4ZEVA 1XROA 2W6QA 2Q6VA 3QHPA 4GECA 4M2LA 1M7GA 3DTYA 3G9UA 1NXOA 1RZVA 4I8XA 4OHCA 1P4JA 4A2PA 3DZHA 1FLAA 1TFRA 2X58A 4LXUA 2WSSD 1E7RA 2LR0A 1NQVA 3VZSA 4ZYZA 5ALFA 2D7CA 4GXRA 5AO9A 2P5SA 5HCUA 2SKEA 2WJ6A 3RTBA 5J3JA 3ZIUA 4LYYA 3PJEA 3D8NA 4AYTA 1GGHA 3IPRA 3GT0A 1IUNA 3NDJA 3BYZA 5DNYB 4JI3B 2EZ8A 3ESRA 3NTVA 3EQ7A 3LQ1A 3N2YA 1T4MA 3OC6A 5IAKA 3OMXA 4EFMA 2DUJA 1S2LA 4B4OA 3EGVA 4PYJA 4ZI7B 1UPBA 4FW9A 5JH7B 4QPJC 2X4LA 5DX1A 3R44A 3X1DA 4IIYA 1HDEA 5C8VA 2NO1A 4XGKA 3SZUA 3VU1A 5IULC 5KUTA 2QAIA 4FEGA 1IUOA 1XRLA 2C2HA 1V5EA 1G2QA 1RYHA 2QENA 1MQ8B 2RARA 3P9QA 3UMCA 1YZQA 1VE5A 3U7GA 4DMHA 4FCTA 4M0PA 1JDUA 3ENKA 1CR1A 4TTPA 5INTA 3TW8A 4OXKA 3DKPA 2Z3ZA 1QS0B 1I6KA 1W6RA 4MK4A 3TQIA 1V8FA 1JFVA 4WESA 3OD1A 1XK7A 2FWBA 3OIFA 1C9JA 1DKNA 5HNKA 1T2CA 1RYFA 1SZDA 1CYDA 3VUFA 1YT5A 2IH5A 4AKEA 1N7HA 5IYZA 1C1DA 4WH0A 3VZBA 3QUQA 4MICA 3OX2A 3OPYI 4M1QA 1E32A 1JEOA 3ILXA 4RK5A 2WE8A 4BNUA 2ZJFA 3MUNA 5F7JA 1I4WA 2ZIFA 2D5IA 3T3NA 1MO4A 2GVNA 3GRZA 3KAKA 4K9NA 2BRUA 2WJZB 3CW9A 4AROA 1QLWA 3DZCA 3UFXB 3EPJA 1ZKMA 3H4TA 2XR1A 4BMXA 1SVIA 5EA2A 4UOEA 4X00A 1AMUA 3TAXA 3PXDA 3K20A 2GK7A 4QJ4A 5HTKA 3WNDA 3WLOA 2H00A 3UK1A 1N6PA 1SG6A 3NT2A 4GMDA 4TMVA 1AGRA 3CCCA 5KSZA 3EXHC 4N5NA 5B64A 2P2YA 4EG8A 1HOTA 2IYWA 2ZUBA 3R7FA 4C4PA 2JEYA 1NJFA 2FZGA 4RU1A 1UK7A 2XXAB 1GFSA 3GDWA 4KQWA 1TZBA 3ZIAD 2YMLA 3D6VA 4JMPA 1CUZA 1CY1A 4CI0B 4CEJA 1T5HX 4QXOA 4OQXA 3RF6A 3OT1A 1Z16A 5H9WA 3RD5A 3U60B 2CNWA 1AD2A 2DFLA 2QVBA 4IINA 1GQRA 4G0ZA 4GYYA 4K46A 5AUNB 4OYHA 5BSVA 5TJHA 1R6TA 3GWGA 1NLFA 5K0EA 4D9HA 4EX6A 2Y1EA 3O47A 2NZUG 2ONKA 3LC0A 3T5MA 3QU7A 3I6YA 2AD1A 4H27A 3L7KA 4WHMA 3HXKA 3PIDA 1U7PA 2PX5A 4X8HA 4BQQA 2F17A 3HXQA 2C84A 2PBZA 4EYQA 5AI5A 1SUFA 1W46A 3K0CA 4FXOA 1T1JA 4HQOA 2XMBA 3GU3A 3PHBE 4K6KA 3TSZA 5B30A 5KWVA 4HZIA 1CUVA 3GPIA 4MSUA 4LWOA 1ZJWA 2JLRA 3T15A 1MAVA 4QG3A 5M5BA 1TZKA 1TL7C 4LI3X 4A0RA 2XV1A 2CK3A 2CYAA 3MGGA 2C2XA 3NC1C 4IGFA 1I3CA 3BJMA 1DG1G 3GJ7A 2YY6A 1CRQA 2Q1UA 1L4HA 2BTOA 5JVDB 4GOND 5T4FA 4A03A 2OYCA 3Q1LA 4PG5A 1JA0A 1G8SA 2HJVA 2Q0XA 3GLHB 1Z73A 4G5QA 4GVXA 4GOLD 3H2IA 4OYLA 3DNMA 1PL6A 5AFSA 3WQBA 4C7OB 2H5EA 1GRVA 2BRUC 4GM1A 4NYJR 4LXHA 3RS7A 4FUTA 4P84A 3ZH2A 4JY7A 1P9LA 4MWDA 5CURA 2ZB2A 3FB4A 1G6HA 4HH1A 1XC7A 5F3WB 2GN9A 4YNBA 4A7PA 1A04A 2ZBEA 2VO1A 3DOCA 4F9EA 5DP2A 3LUGA 1DOZA 2Q3BA 3D02A 1E5DA 2B4YA 1NOKA 2VHZA 4RQBA 2RAFA 3DBVO 4YMWA 2PO7A 5C32A 4HL6A 1OSNA 4EPYA 2WEKA 2R48A 1KDYA 4UPEA 4KNWA 5BNTA 4OX9Y 1OFTA 1JFSA 3BDVA 1OQAA 4H59A 5EQJB 2QN7A 2XHEA 1L4GA 4C87A 4XGNA 2DC1A 1JG2A 2IYPA 5IBCA 2Q3DA 5LM3A 6REQB 2DG2A 3IJEB 3WBKA 4I5DA 2OOKA 2YYYA 5JTTA 4EO7A 4HBGA 3DDHA 1Z8FA 2MINB 3NBZC 3BRQA 4M37A 3EA5A 2E4YA 2QUBA 2O50A 2PJUA 4TVOA 4JI4B 3U13A 4BMYA 1Z35A 4H0CA 4DIEA 4L0QA 4V3CA 1SZCA 1ABEA 2HBRA 4E5DA 4ZGBA 3IX7A 4IUDS 5L40A 2B8WA 4N39A 4P54A 2R7NA 3ZGVA 3A2LA 5ITZB 2DLDA 3D3QA 3CGGA 3LLCA 4FI3F 5KO2A 3TW6A 1PR6A 4A91A 3DWFA 4URFA 2XT0A 3JYQA 2HPVA 1TRHA 1ZM7A 2DPHA 2I1WA 1XVLA 3AHDA 1MZVA 1A7JA 4GYKA 2FPKA 3TLBA 2IFTA 2XKKA 1HFKA 4R05A 4UUQA 4QICA 4U2BA 1MLDA 2V5UA 4QFMA 4R3NA 3QFTA 5LDHA 4Q9LA 2DY1A 1PLJA 1PD0A 5IT0A 1P7CA 2BM8A 2EW8A 3B7WA 2G5CA 5AJWA 5CFLA 5IKMA 4L73A 1KK2A 1JXAA 1YR7A 2WRZA 2H57A 3G17A 2A7XA 3OPYB 4GL2A 4AS1A 1J1ZA 1KMNA 4FZJA 4D74A 1GN8A 1KQFA 4RMHA 1G2PA 4A1FA 1IWPB 5LP1A 2BDEA 1WHSB 2RB4A 3SF8A 3NYWA 5A7FA 3OCYA 4XGQA 3IOYA 4D4JA 1U94A 1P60A 4L4RA 5LLDA 3EE6A 2XYRA 5JJBA 2DFKB 3AFGA 4V0OA 5DO9A 1MXHA 1KSHA 2QOEA 3E1GA 3IAAA 1N6IA 2V7EA 5CD1A 1I10A 2Z83A 4KFCA 3VZDA 1ZONA 3UATA 2Y68A 3RIEA 2IDZA 4M1EA 4R3UC 3U9TA 3PIRA 4YUXA 3DB2A 1XB2A 2VL7A 1LDBA 3PNOA 1IDN1 2O14A 5KNCA 1J25A 1Q11A 2A33A 2UAGA 3ZW7A 1HQYE 1C7FA 2DPLA 2E3JA 4TXMA 4CEHA 3EN0A 2HZBA 1RHQA 2NSYA 3I9JA 1YZYA 3M9LA 4U8HA 4DNFA 2ZG6A 4P4SB 1Q2XA 1SHZA 3TEMA 1NNUA 2R8ZA 4WLNA 4XCVA 1RXWA 3F96A 2F43B 1JDNA 4RAOA 4MDFA 1JYFA 3EXG1 4EEZA 3SNKA 2PG3A 1OWOA 2BVNA 1VHTA 3SOZA 1ELOA 1HSOA 4AI6A 8ATCA 1XEWX 3Q7TA 4HB2A 5IVPA 1KBQA 4DUYB 2OORA 1H94A 1GNPA 3LWDA 1V25A 2PH1A 4UZSA 7REQA 4ER3A 2NU7B 1U11A 3ZWOA 4AZ0B 3AK4A 3ANLA 4N0EA 3RJTA 2DQZA 1O95C 2EX1A 4OAPA 4YPOA 2BEUA 1UBEA 4ZI5A 2XOKA 4RHEA 2Y1XA 2ZRDA 3AHFA 4OAQA 3KPVA 4IH9A 1TA0A 4BLWA 4D3FA 2ZRBA 2IYLD 3EEYA 5HFNA 3KR0A 4X84A 1N8KA 2FOLA 2XJ4A 3UHFA 4A3SA 1E3SA 2YYAA 3LBFA 1NZJA 1W4RA 3N3AC 5CEEA 2DHEA 4KR7A 3VMMA 2BJVA 3FDXA 2E87A 3PXGA 1KOGA 2NXCA 3GZ4A 4RK1A 7ADHA 4KR0A 2CXRA 1OB5A 3ADDA 3A9VA 3VGJA 2I7VA 3RLFA 1QZZA 1YQEA 2J9GA 4RKEA 2PANA 2RCYA 3K5PA 3Q5DA 4AMVA 1NNEA 1B93A 3HH8A 4MHSA 2GEKA 4QQKA 2D1SA 4HZUB 4KX5A 4MQMA 5H83A 1WW3A 2AEJA 4IVPA 4WBNA 3P94A 3R7SA 1GYPA 3STUA 2JDID 3PJFA 4RKRA 3FD8A 2XBUA 4Z9XA 3V4LA 4ZJZA 4D9CA 1IHPA 1U7TA 2GYWA 4BX8A 1E4YA 1I2AA 1UXKA 4HPJB 2FPXA 3B78A 4JJGA 1X80B 4LDJA 2B4KA 5DHAA 5ALZA 1RPAA 3V1UA 4X95A 5HRAA 2QTHA 5LXTF 3EEIA 4MWBA 4YASA 2GJ9A 4MRMA 2QVGA 3IQFA 3PNVA 3DNFA 4H6WA 4REOA 1QGOA 2F67A 3OQNA 2O8CA 1T0JB 2A9PA 4JUDX 5TY0A 3WG9A 2AFRA 2VP9A 1I33A 1UWKA 1GRNA 5IW8A 1TECE 3NAMA 2SICE 1G8YA 5H02A 1JI0A 2W43A 2Z95A 3HBJA 3ICOA 4JQZA 3O95A 6YASA 4JMLA 5HXAA 2GVDC 1R6DA 1MA3A 1Y3HA 1AS2A 2BLLA 2VDLB 3AF2A 1AUXA 3C5EA 3DTVA 3GCDA 3HYCA 1YVDA 4KFUA 1DKQA 3H4VA 5BSMA 5LYJA 1FDOA 3FYDA 1NJ8A 2Z8XA 4GBJA 4XLZA 3ER8A 1OLXB 1RSZA 5JSQA 4PG7A 3GOHA 3DJFA 2CEKA 3KQYA 5DHRA 1DXHA 2C8LA 3AF0A 3S8MA 1U9CA 4M9ZA 3MMNA 3D64A 2I2WA 3GVHA 1YZUA 5BW6B 5T6MA 5KTSA 2YFHA 3L2OB 2VIIA 3EUEA 2HEIA 1J7KA 1OX4A 2IKSA 4G3XA 2P6PA 4YECA 3IOEA 5D1NA 3IB3A 3JQFA 4QLBA 1RXIA 2FX3A 5JI2E 3FWZA 1F2DA 4PANA 5IVKA 3SQOA 4N0DA 2HDOA 2PXHA 4FINA 3A2KA 4NV0A 1YI1A 1JEYA 1PR0A 3TTSA 2GZ2A 1O6GA 1WP4A 2BEWA 3A1NA 4HEJA 5EP4A 1M2FA 3W4JA 1JDBC 4Z1OA 1DEXA 2BDUA 3CF0A 3V8BA 3KQTA 4LOJA 1A5SB 3DHYA 5CX1A 4O25A 2GD6A 2XYHA 5FOXA 3TZKA 2J67A 2Y93A 4ARUA 1F6BA 3LPNA 4HLUA 3VU9A 2JFWA 2O3QA 4DXAA 1X0VA 2C2MA 3ZR4B 1MD9A 5E4FA 3C5WP 1NW4A 1KVSA 4RDIA 2X0NA 1JAHA 4P0PB 2X8JA 3Q2OA 4CQMB 4IDAA 3VHXA 3ZVKA 1H66A 4J76A 1HQDA 3IYLW 1OFUX 4GS5A 5GJBA 2XNSA 1DNPA 4HDQB 2OCDA 4NYIQ 5B6PA 3JAKB 4NV1A 4Z4GA 5K3AA 2R5NA 2Q6OA 3GEDA 4DARA 2JGDA 5L51A 4FXPA 3I2IA 3UMMA 1QUEA 1T36B 3CINA 1SQ5A 3DG9A 1SVUA 3HJNA 3I32A 2I3DA 2WWIA 3C5CA 1ECBA 1FTWA 2BGRA 3FLAA 1QCZA 4FHFA 4OYYA 1MPTA 4G5GA 2W2MA 4KPEC 3GLIB 2QM8A 4NJMA 4JIGA 1QE3A 5AW3A 1WZ2A 2FWMX 2VG8A 4I3FA 3NJ4A 4Q7KA 1U81A 1L6IA 1GKYA 2B5WA 3K1AA 2PMEA 1XKXA 3B6EA 1ZVJA 2PJZA 1C1HA 3JR7A 3ZDEA 1KFJB 1WV0A 1E6WA 1Z4MA 3IT1A 4JLKA 3B6IA 4ABYA 4B3IA 4D3ZA 4DT1A 3N6RA 4RO0A 1EGMB 4UVDA 4Y2VA 4E4RA 4W7IA 3NOOA 3PDCA 3PC6A 3FM9A 3FN4A 1VYVA 4YAFA 5CT8A 4EATA 1JVSA 4G9EA 4UHDA 2BGNA 5FI0B 1U0NA 3S1AA 1B15A 1S1CA 4M7RA 1KAHA 2A58A 2PUDA 1SN7A 3JD1A 3PU6A 4AJIA 2XOKD 4UEQA 2J7KA 4WEOA 4F38A 5IJ0A 3PT5A 4TXHA 3LP8A 3LVBA 4BEBA 2WG1A 3EDOA 2HYDA 3R7AA 4QARA 1C9EA 2B82A 5ELMA 3OTOB 1LK0A 1M6YA 1WMEA 3AZPA 3BHMA 1NLMA 3EWNA 3WGHA 2HIAA 4IEFB 4TLDA 4I1PA 1ZMTA 1MBZA 2BZGA 4GH5A 1J8FA 1R16A 2B78A 2G6TA 2YHIB 5J59A 2GXAA 3QV2A 3LQKA 1C0IA 3HXPA 4Q34A 3E82A 1V3VA 4OHBA 4YT8A 4X90A 5CFRA 1NRWA 2R1VB 5KYWA 1W36C 4BKMA 1MIOA 5JASA 4FIZA 3FF4A 4RZXA 4TMWA 4D3SA 5I4CA 4Q3KA 4F8JA 4F2PA 4J6FA 4FOOA 4MVJE 4RFLA 2AWNA 4BXOA 1X42A 5L6MB 1PHRA 1O03A 2IXDA 5DTRA 2PWAA 1PR4A 1TE2A 4AIIA 4DUPA 5M04A 4NCNA 4V0MA 5F51A 2BGJA 1ONNA 3ZJYA 5J4KA 4UARA 4GL4A 3RUCA 5IM4A 1CQPA 3NEYA 2FSPA 5I5EA 5LQJA 5G3ZA 1XZLA 1PJCA 4MRNA 4B40A 2Q62A 2C5SA 3SLKA 2GARA 4X85A 3CLRC 2PUEA 7MDHA 2CBZA 4UATA 3B2NA 4OK5A 2X8AA 2QRGA 2AZDA 2VYQA 2BHLA 3KSZO 3BREA 1XD2A 5JWRA 4QM6A 1QNFA 2I6QA 3U56A 1MTZA 1XUOA 3PQ7A 4LF8B 1MFPA 4YRNA 4UTRA 3PRYA 3S6JA 1S3SA 4MGYR 2G7ZA 1MV8A 4IFBA 2VPTA 2JH3A 3RVMA 3JAMA 3ASYA 2A35A 5P21A 1VP3A 4HOYA 4BMDA 1XTZA 4QO7A 1M2NA 4R8RA 3W34A 2GXUA 3D6FA 1JH9A 3PSAA 8GPBA 3LQYA 2IF0A 3LA8A 4QRHA 3TLGA 3GNQA 2X3YA 2C2GA 1Z4IA 4MB6A 3FSJX 1GTRA 4QM7A 1C0LA 3LBNA 4YN3A 5HZMA 1VE1A 1KZ7B 1OX6A 1JVBA 3INRA 4MRMB 4W8GA 3V5NA 3CUKA 2WILA 3IMFA 3UWOA 1TYCA 2O5RA 2XHZA 4EW6A 4DDUA 3OCZA 5IAAA 2J9ZB 2IYYA 3BC1A 4EJ0A 1I0IA 1ST2A 3GFFA 1GKIA 4FHZA 1I5EA 3GUZA 4N18A 4ZZ2A 3C45A 4MUBA 4F06A 4B74A 3BXEA 5A06A 1AKEA 1CQZA 4FNAA 3EZYA 4RVNA 4O3MA 4MTCA 1PG0A 5J4YA 4ZQGA 2WHPA 3IILA 3EBLA 2WIDA 4GEKA 1RKQA 4OSEA 2VPZA 3P8ZA 3RBXA 4WCFA 5IZCC 1WKVA 1YIDA 3KC2A 5CIQA 4E94A 3NC0C 4EHIA 2EWMA 2OZLB 3CX6A 3TZLA 5LOVB 3ICCA 3KBOA 4OXRA 3HPRA 1M1YB 2J0UB 1G5HA 4PF1A 1OAOA 3R5XA 2NXNA 3ZLTA 3DYIA 2FZLA 1HORA 1L8XA 4FONA 3IEXA 2AKYA 2R7AA 5EJ8A 4YX9A 2V6GA 4TTTS 3RC2A 1A9ZA 4FT2A 5DM60 2Q3CA 5BYAA 2ENWA 1T0HB 2NV2B 3AEUB 3I76A 4GBED 4FYVA 4JJIA 1GTVA 2EX4A 1V45E 5JSZA 3TO5A 2DSNA 4ZCIA 1SXHA 5AM0A 4F7DA 3H7IA 3TJRA 4I5IA 3ORQA 4JGGA 3K09C 4M83A 3VH3A 2FW9A 2RGDA 4PZEA 5F4BA 1DKUA 2AH5A 4IJVA 3R0IA 5E9WA 1S3GA 3FWYA 3O83A 3ZHRA 1IG3A 1N7GA 1ODFA 1ZK0A 4FFPA 5THXA 1XZJA 1D2MA 3QPDA 4FFLA 4FZ5A 4EITA 4EX7A 2CD9A 3Q7IA 3PUKA 3DYVA 4AMZA 5AKXA 3I6ZA 1X1AA 5DMXA 2GYUA 3UXMA 2P2DA 1IRXA 2H4WA 1H23A 3KB2A 2J9XB 4LXIA 5K5EA 3OCXA 5ESWA 2XUHA 5FRDA 4QD3A 3A1EA 4LZJA 1JG7A 4D4HA 2OG1A 2X2FA 1OBCA 3LPCA 3UPDA 4B3JA 2H4JA 1H42A 1A88A 1H05A 3KM0A 2H4ZA 2PU7A 2YJ5A 4X24A 3CR8A 3O3NB 4OOFA 3ZTTA 2EFJA 2Q27A 3UWMA 3RRZA 1LUAA 4FFBB 1I7NA 3VMFA 4S3MA 2B4AA 2EGUA 2FWPA 1NVKA 2R65A 2ZBDA 3FVQA 3HA3A 4Y3UA 5EY5B 2KLHA 3ZJ4A 1MVOA 5LN1A 1C2YA 3FFAA 3DFZA 4TQ9A 3S99A 1C8KA 2PS9A 4BFVA 2F1OA 3ZLBA 5F98A 4JP3A 4XLLA 4E30A 2QIPA 3VYTB 4GE0A 4V0ME 4RFVA 1XI2A 5HKLA 1NVXQ 1Q0QA 5BNZA 1Y9AA 1RZRA 1ENPA 1XZPA 2QKYA 4HQ6A 4RK7A 3ASVA 1QGED 1W8IA 2O0HA 1GDHA 3KOYA 1NXSA 4PQYA 4L8VA 4LX8A 3TQOA 3M6VA 1YZKA 1GNLA 2Q8NA 2LIPA 5MN5A 1YS9A 1YC5A 1DAMA 1PSDA 1QLHA 3BRWD 3BDAA 4DIFA 4RLQA 4EG5A 2NU8B 2DKOA 2Y1LA 4HN2A 4ARSA 5AOVA 1E58A 4WRRA 3K70D 2LZ0A 3Q40A 4F5DA 3IDZA 4F56A 1LC0A 3LHFA 2WIKA 3SYLA 2KB0A 3WMRA 2AJ8A 5JFOA 2NACA 3QVSA 3T7JA 5DNUA 2VZ0A 2G08A 3ONFA 2ECKA 1ZD8A 3LY8A 1JLHA 2BMFA 3LD9A 3PHLA 2GR9A 5U4XA 4DLXA 4HNVA 2GFIA 1BXRA 2P75A 4HNSA 3E9ZA 3U09A 1K6XA 1TM7E 1TJNA 1ZSVA 1J56A 3GEBA 1G3UA 1QGDA 1URPA 3KOZA 5KYXB 1G8JA 2ZYIA 1E5TA 1FLDA 2HA4A 2HF8A 2HMVA 3N8KA 2P35A 4OQ4A 4G37A 1F3OA 4D6YA 5BUSA 1F9AA 2VPXA 3LDFA 2CJPA 2V7QD 4BJ1A 5CJ2A 5E9JA 2WFLB 3HKBB 4XJSA 1MAAA 1NJSA 3CQ9A 2JJ2D 2ZRKA 1JSZA 1XDWA 2EZTA 2IQIA 3ETEA 4RQUA 1W30A 4DBVO 4F7WA 3AVTA 3SXPA 1IIBA 2V6JA 2BFBB 4FMCB 1MEJA 4GZ6A 3I5AA 1DKRA 3C3PA 1FDIA 1G9XA 1LPAB 1L5SA 2V97A 3B1JA 4G5SA 3PFHA 4KCGA 1PNVA 3KS9A 1JQBA 1Q6ZA 2GI4A 3TRHA 4E2FA 4GDMA 4MXDA 5IT4A 2O2XA 3S2UA 2XYVA 4V24A 2P9YA 1I3MA 1EU1A 2ZEJA 2PZAA 1CDOA 3SEQA 3RRYA 4EPTA 3S2FA 5I8PA 3DOUA 1HEIA 1YV9A 4XYMA 2GCOA 1QOPB 2PKQP 1D4ZA 2FQ1A 1IUPA 4TKVB 3V42A 3EVFA 2EG5A 1EWYA 4OLHA 4PAMA 1XDBA 3L1KA 3AIIA 3MTQA 5T5QA 1KSGA 1KK0A 1TZJA 4QTTB 3ZNNA 3K1AB 1XZQA 4MROA 4Q19A 2ZITA 1UH5A 3CG0A 4W1RA 5EIOA 3TR5A 4I2VA 4RVUA 1M34B 4DJ5X 5BR4A 2CL6X 4QGAA 3ML1A 4QOSA 1P9OA 3ZEIA 3EGCA 3PC8A 4PC3A 3TOZA 3OQOA 4MARA 4HNTA 2X5JO 3BGIA 1IDOA 1K8ZB 5BO5A 3H5RA 2YFKA 2HU2A 4L4YA 3O8BA 4OMFG 1DQYA 4K6GA 3A3KA 3SXJA 2B1GA 3ZU5A 3V8EA 5I7WA 2QX6A 1UPTA 2ZRIA 2VWGA 2BT4A 1U2PA 1DWQA 2O7SA 2X2OA 4XW2A 4EHLA 4YJFB 2CJFA 1V47A 2ZB7A 2Z2JA 2ZWMA 3FY4A 1SVSA 1BS2A 3W9BA 4A6DA 1R9NA 1L4YA 1XZIA 2AD5A 2VT6A 3IKTA 4ZAGA 2QMQA 2C97A 1GARA 3L4EA 2JAWA 3QXJA 5FUBA 4UPDA 5HBGA 4ZZ0A 3VVBA 2Q21A 3GI1A 1YBAA 5EHIA 3QKSB 3WRYC 3WDKA 3A3YA 1N2XA 2FWNA 4W1QA 1TB4A 4PU0A 1AV6A 2Q0QA 4BOYA 1R4AA 2FW1A 3FOBA 1T4CA 3WIUA 4AN4A 3THOA 2ZUCA 4YV0A 4QRIA 1DS6A 2VDKB 1GVNB 3GW8A 3H0EA 4Q4HA 3L07A 1XTVA 1FUIA 2ZE7A 2GYYA 4RQTA 2C3UA 3FYUC 3GLHE 1UZNA 4HYYA 4L57A 3AH8A 2ATVA 5FWXA 3DFUA 2JGNA 3H8WA 1HE8B 1DX4A 2R85A 3FNIA 4U1RA 3WICA 4Y9SA 4HWTA 3W6OA 3L0CA 3T5BA 5KMGA 3O7MA 2B8EA 5CK4A 1UBTS 1BMTA 1PAUA 4NBRA 4J2TA 3WZ2A 3WYNA 1XNJA 3FPBA 1T9DA 3NH9A 3TFQA 3RBVA 3SZOA 4CIWA 1H2EA 1L5QA 1HDCA 4AKIA 4FE7A 4B2LA 1S9HA 1GN9A 3WHPA 4DMCA 3LF2A 1WOYA 1RS0A 3SF0A 3T7IA 4F12A 1RHMA 1GM5A 5ALMA 1L7BA 2J09A 4F1KA 2IA5A 5AUOB 5JAUA 5D3MB 2H2FA 2VYCA 2AG1A 5K4AA 4B6FA 2V7UA 3C8DA 3EF3A 3M3HA 4QA9A 3OU2A 4CCYA 5AK5A 4OK6A 4BVAA 3MTAA 4N1AA 5AHOA 1VRCA 1TKRA 4C0JA 1VM6A 4Z6KA 2IXGA 1FXUA 3AG6A 4KMRA 5CR9A 5JEDA 4UC0A 1TVKA 2AJTA 3AF1A 3IULA 4JROA 1KP2A 4M4SA 1CEQA 3RIMA 5FAXA 4MQ6A 1IWBB 5IANA 3VDXA 4J3JA 2NUPB 3GG9A 3IAM1 3OMLA 2G9NA 1WB9A 5JWHA 2ZIGA 1PVOA 5EGSA 2B34A 2PQ2A 3EVEA 2J32A 1VSQA 4D8UA 3R3UA 5J2UA 4GP7A 4YMLA 2Q07A 5FBZA 1X87A 2DP4E 2KWIA 1EWRA 2XDQA 2EDAA 3RIYA 1RP7A 4GE3A 1LDMA 3KAPA 5IC5A 2XZPA 4BY9E 1VFPA 4BZXA 2VJMA 3I2KA 1N1EA 2WP0A 2HV8A 2D2IA 2VK4A 3F71A 3HKEA 3I1FA 3IUYA 5FULA 5ALOA 4P4TA 5HFAA 3T3GA 4Q9HA 3KELA 2I2AA 4C7MA 2FSSA 4EUKA 2FE1A 2VDPB 2C78A 1N4DA 4W6ZA 2X13A 4X7BA 4YTEA 2UZ3A 3E2MA 4JDPA 4DNQA 3WNVA 4WECA 3TDKA 3AHJA 1C7ZA 1VL8A 2WFLA 2A67A 3T7AA 3CPEA 3KYCB 2YCBA 4QULA 4LJSA 4RKYA 1EPUA 4PWYA 3VOBA 1J9ZA 5AW5A 4OG2A 4D2IA 1K2VN 3NONA 3SI7A 2AN1A 4X92A 2QYSA 1YQ9A 3PCTA 4XWWA 2DFVA 1JDVA 1EG2A 2WTAA 3R5HA 2C9BA 1IC6A 3A0RB 4MVJP 2ON6A 2YKGA 4KR2A 1Y81A 1DRUA 4NCKA 2EYQA 1VMKA 3G2PA 3PFGA 3DQQA 2UXCB 1YZVA 3VV3A 3LGSA 1KY5A 5LMZA 2EOAA 2P3SA 2JKZA 1LQUA 1QCYA 3CZAA 3OTHA 4UUOA 4HN4B 1Q44A 2PFGA 3EGOA 4R1MA 2X7XA 4R9UC 3G2MA 2C2ZA 4LZWA 1ECJA 1ZEJA 2AXNA 2WPNA 1R0ZA 2AXPA 1Z0KA 1II9A 4AMUA 4R84A 1PYOA 2MTBA 2AFVA 2I67A 4XB1A 1X7WB 5H3CA 2YHUA 1LSOA 4N4AA 2XCTB 1TCCA 2J3DA 4Q4JA 4WZ6A 4X6LA 3MUEA 2QTVA 4UMDA 1DRKA 2HKIA 2QUIA 2GN4A 5DLQC 2HLDD 3WKAA 3ONEA 2XCOA 3MB5A 4UU0A 3CT6A 1T8SA 4WJKB 1EFLA 2JPDA 1ORVA 1TRKA 4Y9UA 4EA9A 1AG9A 3BIJA 1M34E 2EHJA 5CYOA 4R31A 2Z6AA 1OE0A 3CH6A 3WADA 2DX7A 4BO8A 1KHHA 2V7WA 1MT3A 4UU1A 2XOEA 3RANA 3ZGLA 4JHLA 1A3CA 3FYUA 2IPOA 4R41A 3H9QA 4CM6A 2CUNA 4YJ3F 2OCYC 1GTG1 2IBSA 3NEAA 4NLLA 2AEEA 4Y6GB 3TW4A 3CBQA 3TI9A 1CUXA 1QM5A 2XTAA 2JAXA 4FJ0A 4MV8A 1YB4A 5FA8A 4ZYWA 1R74A 4M89A 4KR6A 1BCRA 3DTNA 1NQOA 1QVWA 4GBGA 1S2GA 4PZ9A 1KEPA 3GNLA 421PA 4CM9D 1L4EA 2MU1A 3RB8A 1HYEA 3ESXA 5KNDD 3IBTA 3LQRA 1KKLA 5DK4A 5AJZA 1UBUS 4GICA 4X1KA 1ISPA 2C95A 5M29A 3H75A 3MD9A 4WGGA 4ZV4A 2Y4NA 2Q50A 3I4CA 2I6XA 3A31A 1P1BA 1F20A 2QUJA 4P5EA 4CGYA 3QXGA 1GSOA 2HPZA 2XH8A 3MCUA 5IEBA 2C1XA 2Y1GA 1JMVA 2OWEA 3IRVA 5JAHA 1NXTA 1MFZA 1I9CA 1Y33E 4ZQFA 5EMKA 2QTCA 2IZ5A 1W5TA 2Q5FA 2BBOA 2VNKA 4INJA 4KE8A 4X60A 2X4IA 3KT8A 4HPWA 4A1OA 1DQZA 1RIFA 2A4MA 4IHJB 2X4DA 2NUAA 4DHWA 2ZVQX 1H2AS 2YZKA 2Q4DA 2W83A 2Z30A 3C6MA 1T13A 3PGLA 4A5SA 1T10A 1OILA 1XQ9A 1B8VA 1T6NA 2AFHE 3ROFA 1GUAA 1RI1A 3FCUB 4YGYA 1W94A 3O3CA 5JSYA 1NN3A 1TPZA 1G9TA 3IAS1 3RM3A 3S2SA 4F85A 1KTIA 2F8LA 2XF2A 3CH4B 4NBLA 4ZVKA 1U2DA 2RH8A 4AJEA 4POOA 1WSBA 4XEHA 4MVJF 4ND8B 2FFAA 4BMOB 2FH5B 3MFYA 4DWVA 3OQHA 1S8AA 4JR2A 4NC9A 2AUNA 1T8TA 4W5JA 1P5HA 1X3SA 2IOFK 3GL9A 3FNEA 1O9BA 2B9VA 4TKUA 4CKWA 2DBZA 3FHOA 2DCUA 1Z0IA 4G0UA 3R23A 1GA6A 1JLLA 1YI0A 2TSYB 4LRXA 5KPJA 4JKYA 1XAJA 1JA1A 1GG9A 2QAGA 3AV0B 4GWKA 3RRXA 2HTEA 3VKVA 2F59A 4P5DA 1L5WA 4XWKA 2W2XA 3FCCA 3ACDA 4GU5A 4L4XA 3T8YA 3WL5A 2UYCA 2AJBA 4YFYA 1SCBA 5TPWA 2MSNA 2Z5LA 3UJHA 1E1LA 3IKVA 1RT9A 3AFHA 3UGJA 2XZOA 2VN8A 3JZMA 1AGNA 2CXOA 2P9TA 3T5TA 4DPMA 1D2EA 1XD8A 2JZCA 1YIAA 2OILA 4M9UA 4RWEA 4WGFA 4YALA 4E09A 3R8FA 3NHBA 3Q9UA 4AY4A 2IY8A 2NO7A 4MWOA 2XYQA 3UK7A 3OWOA 2QT9A 5CXXA 5TDHA 6CHYA 4K6OA 1K3TA 1NPYA 2V9ZA 2PYIA 3RC9A 2WK1A 5B1SA 2WKPA 1W0KD 1CDZA 3PWZA 4I19A 1DUIA 4XH9B 3OPNA 3ZV5A 4BO0A 5K3FA 4CM7A 3PEWA 4RIEA 1E59A 1NI4A 1P39A 2X5KO 5ANRB 2PGIA 3R8CA 4TLLB 4BB0A 1XEXB 2W6JD 1QIMA 1K88A 3FDFA 1J1UA 3MSCA 1O1YA 3BCUA 4KUEA 4ZXFA 3CRQA 5EWLB 4B3MB 3S2IA 5AKJA 4EYGA 4KITB 2BW0A 1W93A 4NV3A 3L0SA 2O3TA 2FRXA 4DV3B 4HFJA 3WLHA 5I4IA 2MSCB 3UQYS 5IYZB 3P7MA 1MIOB 4E07A 4C4AA 3OKAA 2OCIA 5AJTA 2PZFA 4O4HF 1TJYA 3MGBA 1TJ5A 3R3ZA 4KZPA 4BRZA 4H7PA 2YDYA 1FFDA 1PUJA 1RPJA 2A8YA 3I3OA 4GOOD 4TSKA 3T06B 4DLNA 2W90A 2IJGX 4ALMA 4REMA 3C43A 2Q4EA 1ATIA 1PGJA 3M5WA 3MJDA 1DARA 1AOXA 4MR9A 4X1YA 5E1DA 5FV7A 3AOEA 4RACA 4ARZB 1MJNA 2QRMA 1MW8X 2QAGC 2UUCB 1KPHA 2Q1WA 3E3MA 3K6RA 2EJWA 3V4VB 1WHTB 5BXQC 4LJRA 1J4AA 1G6OA 4M9QA 2IEIA 3H13A 2ANCA 3QW4B 4DOMA 3O21A 1SZJG 3PQCA 4PE5B 1NULA 1JMKC 4URHA 1BOFA 3N75A 2OHGA 3PXAA 1C9MA 5FWYA 4NR0A 3U4CA 2FR8A 3BEDA 3K9CA 2BGMA 4HGQA 4BTEA 4CF7A 3HVRA 1XL1A 4BLOA 4FHCA 3UGKA 3ZW8A 1EWKA 2YW9A 3DW1X 5F73A 3F1LA 1UM8A 1QIIA 3I0ZA 1YJCA 2OZKA 2EKBA 1GCAA 3BWBA 2PX8A 2JIRA 3I6QA 4FMDB 3V2HA 3HMQA 1GFZA 1HY3A 4BP9A 4Q82A 4CL2A 4WPGA 1NC1A 1U2SA 4EUFA 3ZDCA 4GC9A 4AG6A 2VJYA 1JJ7A 2VLIA 2X1MA 4NYMR 1P3DA 1FDUA 3SHQA 2BHSA 5IDWA 1NV8A 3H83A 3HEAA 2GAAA 3ONVA 3WX0A 2IXBA 3ETDA 2OYSA 3C74A 3MCAA 4OHZA 3T6KA 4ZU6X 3MRVA 4DMKA 4UKDA 4AJJA 3NGLA 3H3XA 4B4DA 2HLNA 1AKUA 4LRTB 4IUYA 4P98A 4WACA 4HQRA 4R01A 2GD1O 3L40A 1AC5A 3A7DA 3PGXA 3B5JA 1LB1B 5AVRA 4Q47A 1KU0A 3AJDA 1NX9A 2GRJA 3H1GA 5A5GA 2C42A 4ZAXA 3PQDA 3DDZX 2HQRA 1UMCB 2R7KA 4RFSB 5KKCA 2AI1A 1YHYA 4BCDA 3QVVA 5KNBD 3DP9A 2GTHA 1G3MA 5BVHB 2VK1A 4YMSA 4KEAA 4EDFA 1EJ2A 1AZSC 3QBEA 1N77A 3X44A 3KR1A 4HXEB 1BDIA 4X3OA 4B81A 1BEUB 1S6YA 3PL5A 2PUGA 1UPCA 4PAOA 1V1MB 1XYYA 2GHRA 5EKXA 1KOFA 3WWDA 2Q6IA 4HVCA 2QJWA 2CLOB 2PYZA 3OIWA 1W73A 3I92A 2EJVA 3VBEA 4B7AA 1VMAA 3MUFA 1E6KA 3JQQA 1E9DA 1HLGA 7ABPA 1OFVA 2GHTA 3MC1A 2AVDA 4I9FA 3K35A 4FOLA 4NBUA 4RIFA 1DAOA 4F45A 2FN8A 5F77A 5FUVA 4ALKA 1ESMA 3GZTB 1WZEA 2XNCA 4L8GA 3O9ZA 2VAMA 4M8IA 1YNOA 4BAZA 1ZVQA 2BDTA 3D7MA 4Y0VA 1EBUA 3ICPA 1E6MA 3ZH9B 5JAZA 4AN0A 4TKMA 1WPXA 1XCOA 2G17A 3W6PA 1WCIA 4MR8B 2ZU0C 1WDWB 1Z6PA 2ODQA 1CFJA 4OYRA 5CNIA 4DA0A 4IVRA 5ELXA 4H3HB 2YJ6A 1VDMA 3SBEA 5SZKB 5TMEA 2QL5A 3V1KA 2BMDA 1O08A 5BW5A 4RSMA 2Z58A 2FSIA 3GDHA 1U3UA 5H5JA 2Y1OA 4GKKB 3KDSE 4PYIA 2NMVA 3VNAA 3TTUA 1UQTA 1BOOA 2FHSA 1M8KA 2JASA 2VUTA 4EGJA 3N05A 2YS7A 3WNBA 4URUR 2NXEA 1J24A 1N2CE 2A0WA 5EP3A 4BPBA 1V1JA 2A94A 1JHYA 2ZUWA 1YDMA 3GLSA 5KX5B 2D5LA 3Q4GA 2Z1DA 4GF5A 3N53A 1CZLA 4H3SA 3EG9B 2ZIXA 3CUSA 2JFFA 4BGEA 1ISRA 2P62A 3T7KA 1E20A 1QDUA 1TEVA 2IEGA 2VHEA 3T3DA 2ZBPA 1E2GA 4QJBA 1OFGA 3GRAA 4FFNA 3TLJA 3GQBA 1J2RA 2QTLA 3JV7A 4XUEA 2J0SA 1Z6QA 4FLMA 4QASA 4B47A 1EBBA 3D4NA 1I24A 4DNXA 1O0SA 3GJXC 4FOTA 4Q66C 2I29A 3TG2A 4OI0A 2WHYA 2B4TO 4LHWA 3BE8A 1FVXA 2AT1A 4R2LA 1FP6A 1M74A 1QHXA 4DMFA 4GLBA 3UWPA 1CY0A 2AW5A 4X8OA 2WMDA 4ZCTA 3JASB 4PHGA 3QYJA 3KKOA 1B8OA 3ADOA 2YY5A 1H6CA 3PF9A 3CTPA 5LL6P 3P1JA 4MV7A 5DGCA 4ZJPA 3SQWA 2QMZA 1U7DA 4B6SA 3ZPXA 1RADA 2NLOA 1PGNA 1CWUA 4YCNA 1PG2A 2VTBA 1GNSA 3RYHA 4AULA 2QL6A 3BWDD 4G84A 2VOEA 4JCOA 1V16B 4HK4A 3GMTA 5B4UA 3O4RA 1MX9A 3FUUA 3D7NA 3GRCA 5IM5A 1OGYA 2VPPA 3IP8A 3NM4A 4G8DA 4OKSA 4AJ4A 1N32B 2N42A 4L5YA 1G2IA 4J0IA 3SZ3A 3I9OA 3E84A 1IVYA 1NYLA 1D5WA 3HDYA 3N0TA 2H1CA 2X0KA 1K7SN 3JVIA 4IRMA 5A3VA 4B43A 1A98A 3Q0EA 3ZWVA 2R60A 1QB8A 3A3NA 4XIYA 3NOQA 4PHHA 3LOPA 2QN1A 3RW9A 3OUZA 3W5SA 3F67A 2PS0A 3GJTA 1R37A 1P7WA 2O3UA 1EZZA 5HF6A 1RQNA 5T7BA 2WQ6A 3OVMA 3FA2A 2Z9BA 1UPXA 2CXHA 3B6ZA 1BH6A 3AJRA 3L0BA 3P97A 4U00A 3TIFA 4TS4A 3PJDA 1D04A 4QFDA 1Y48E 4OHWA 1CUDA 2C20A 4XWAA 3T95A 5KYXA 2ZR7A 2ZRNA 3COPA 3IBCA 3K2IA 3RTEA 4CR8A 3V48A