4JEUB

Crystal structure of munc18a and syntaxin1 with native n-terminus complex
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
242
structure length
225
Chain Sequence
KDRTQELRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Syntaxin1a variants lacking an N-peptide or bearing the LE mutation bind to Munc18a in a closed conformation.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis/exocytosis
molecule keywords Syntaxin-binding protein 1
total genus 90
structure length 225
sequence length 242
ec nomenclature
pdb deposition date 2013-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00804 Syntaxin Syntaxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4jeuB00
2XHEB 2DNXA 4JEHB 5LG4A 4TX5A 4JEUB 5M4YA 3C98B 1BR0A 1FIOA 1S94A 1FEWA 1HS7A 1G73A 1EZ3A 3LG7A
chains in the Genus database with same CATH superfamily
2BS3A 5AQGB 3OVUA 3ANWB 3EAMA 2CE7A 2LM2A 5AQTB 3TLVA 2WAUA 3Q5XA 4UVAB 5HCJA 3HA4A 2ZM8A 3HR0A 4GOUA 3C64A 4QH1A 2CLYB 4U3CA 3AE1A 1VRBA 2BVLA 4HWHA 4QWNB 3ZMSB 4JI2T 2CWOA 4H9NC 1J5WA 3AAIA 3ONXA 2K3WA 3Q5EA 1ZOYA 4ILCA 4TN7B 4WNKA 4I0UA 5DJQC 2DCFA 4Z91A 2BZBA 5IYZE 4EOZB 3KV4A 4EZHA 4AKHA 2Q9QA 2Y48B 2NW9A 1N33T 1Y64B 3D0TA 2L9QA 4KUMB 1E1HB 3OJAA 4I50E 2W4XA 1IBMT 4LF6T 2A72A 1DU2A 1UGOA 4EIWA 5HXEA 2MBGA 3SOLA 1OEDB 2V7KA 3AAAB 5AQOB 3MK7C 4H63H 5DABA 4K0KT 3MKDA 5BR8T 3CKDA 1FIOA 4KP3C 2ODUA 3PDYA 4HGAA 2YEVC 3ZT7A 5JREA 2BKOA 3LG7A 4AI6A 5ABFB 2UXBT 2OV9A 3U78A 3AE8A 3PV0F 1I94T 5LGUB 1J5ET 4V1Av 5E0OA 3B57A 3HKBE 4UXNB 3K1SA 4KHPT 2XTLA 3FXEB 4P0BA 5HEOA 2IMLA 2FJAA 2YKSA 4QXCB 3E0ZA 4WBOA 5LJMA 3LBXB 2LE8A 3QB5K 5LJNA 4H9OC 1WYBA 2IIUA 5AQFB 3EDUA 4O4HE 4TWDA 4AQGA 4A56A 1XWMA 3K3QC 4JLEA 3RIUA 5LA6E 3J7Yq 3BQKA 3QOFA 3K8PC 4PJJA 5CJ5A 4YTNA 4C91A 3CQCB 2K9AA 2V26A 3KBUA 4MALA 3SFEA 5DQVA 3PJAA 3T1YT 4B3TT 5FXVA 2J4GA 1HR0T 1NWMX 3AEEA 2CPTA 3CX6B 2LSYA 4FI5A 3IBPA 2CXDA 2M67A 4NUUA 4X1YE 3O9XA 3HKEE 4DMVA 2UUAT 4GK0E 5F8PA 3AXJB 3KDSE 2NR4A 4TWHA 4NIQA 3AA1B 1HNWT 2W61A 1G8XA 1HG5A 2LSKA 5JH7E 3RIAA 5TAOA 3KV5A 2JQQA 3AE5A 3DP7A 3P50A 4ISSA 2W62A 3Q2MA 4IE7A 3LFMA 3ONLC 4JI8T 2N2NA 4DVDA 1YKEB 4TX5A 2CEAA 2W66A 4DV2T 1ZP0A 2M6BA 4NXMT 1G73A 4U33A 3ZCJA 2HPLA 3GWHA 3RHWA 2GK9A 2J62A 4ISTA 4UVBB 3CVRA 5JTGA 4DV7T 2IUBA 1CUNA 2D0TA 4TV9E 2BKPA 1OEDE 4H9QC 5AQUB 3ZYKA 2ZM2A 3CMLA 5F3JA 2KWIB 1CHUA 3O1IA 2VWAA 4KHZF 4DV4T 3AVRA 2E9XB 3AE7A 4TV8E 5HCMA 3RYHE 2Z6EA 4BA9A 5JDNA 5CA1E 5IWAT 2BDEA 2PBIA 2CXFA 2BG9E 3RIUC 4IDZA 4TWFA 2E9XA 2CHOA 3MJXA 4DMWA 4IDOA 4MHCA 4EB6E 2RA1A 3PE0A 5L3DB 1T7SA 2LT3A 2XUEA 1KEYA 2YK0A 2I6HA 4UR9A 2XQ9A 4K0UA 5FVKA 1GQEA 3CIRA 2W0GA 1SUMB 3N9MA 4IL9A 4YHJA 4GYRA 2UXDT 4P0AA 2VQFT 2XM1A 4HFHA 3AA7B 3Q5WA 2V7MA 1IJ6A 1WFDA 4PFPA 3UT5E 4JI7T 3JAEA 2X0YA 3UFGA 3VRBA 2BS4A 3RF1A 2BKNA 4KX6A 1KF6A 1W0AA 3AB3B 4AKIA 1HX8A 3M3ZB 4ZI3D 3MA9A 4PW8A 5HEJA 1FMVA 4UEMA 3UFEA 3EI0A 4KMCA 4QHOA 5AQKB 3R84B 3RYFE 5LGTB 4LF9T 3SRZA 3B5MA 1JNZA 3AXJA 2IHR1 4IE5A 3E08A 4U2ZA 5AQQB 2PG8A 3S4UA 5LHGB 2D0UA 3F31A 3V5SA 5JDFA 3ZEFB 2B1EA 2VASA 3KVAA 4IE4A 4ZOLE 3UUBA 2Q9QC 5KX5E 5L3CB 4DV1T 3UQ4A 4IDPA 3C50A 4ZEYA 2CBIA 1T72A 5FYMA 2KMFA 3O4XE 2KT9A 4CZZB 3RC3A 4HFIA 2RP4A 3ZSTA 5KDMC 3AVSA 3VKGA 4JEUB 3O1JA 3LJCA 2E9XC 3PUAA 3PUZF 4HEAA 4DV0T 2VK9A 2W2UA 4GKKT 4EEDA 2QGSA 1VCTA 1H7CA 1SA0E 3FBZA 3AA6B 4UV9B 4Z8XA 1XMQT 2XQ7A 1SE7A 1KNRA 1SHZC 1YQ3A 4G63A 5CGMA 2X0LB 3ZMTB 3ZSSA 3FZKB 4I55E 3QNUA 3KFWX 4TUYE 2JPFA 3CQXC 3JC6D 2FBWA 4O4LE 4O2BE 4ANJA 2X9YA 4QH5A 2AXDS 2FJBA 2K48A 3MZKB 4ILUA 4OX9T 1D1AA 1M62A 4EV6A 4ZHQE 2XJ7A 2BBHA 1KNPA 2WSSV 3PUXF 2PTFA 2N9DA 2HN1A 4H9PC 5FY1A 3TLWA 4EYYR 5ABFA 3AEGA 5CB4E 3TLSA 4TNWA 2WMNA 4O8SA 3ZN1B 5LP6E 1V9DA 2XAHB 5LB7B 5A1LA 4ILAA 4JI1T 1MMNA 3UU5A 1OEDA 4IE0A 1NEKA 2NWBA 2NP9A 2SPCA 4LMLA 3RX6A 4CXXA 4DV5T 3AAEB 3CQGB 5EK3A 5ABHA 2KZ7B 3ZMUB 3ZC0A 3ZT6A 3ZJ2A 5LCYA 4GKJT 2JQKA 1U5PA 4AKGA 2Q9QB 4UIGA 5L4HA 1WR0A 2ACXA 3TLTA 5AQNB 5EK2A 4ZS2A 5JDQA 4DR3T 4UV8B 1EZ3A 4AIUA 2LKHA 3EDVA 4DUYT 3B13A 3N2KE 2KLQA 2WWUA 5LBQB 4UELA 4DV6T 5LNKA 3FZLB 4HWFA 3OPCA 2WDQA 3N9QA 4YLHA 5HXCA 3MXZA 3P4PA 3A8YC 5JDHA 1NAFA 3RC8A 3FHNA 2LEHA 1QUUA 3CWZB 4IT4A 2LHRA 3RGLA 5L4EA 2JRKA 4JI0T 3C4WA 3PU3A 2J1DG 3C51A 3ESLA 3ETUA 4EAHA 5J2TE 2KSRA 2UU9T 2H88A 2I59A 2X66A 2X51A 3C4XA 3UU4A 1MIVA 5AFUL 3IHRA 2NTXA 2V7JA 2BG9B 4AQFA 4EZ4A 2DHRA 2WS3A 2XQ4A 2X9XA 1X9BA 3ZKRA 2CRBA 2K5BB 4IDQA 4JEHB 3N2GE 2PJQA 2C5KT 2EHOA 4WYVA 5AQMB 2XAJB 4YHHT 1FEWA 3N9NA 2V6YB 2P9BA 3NRYA 2RPAA 3TKLB 2UUBT 4B3RT 2YDRA 3DTOA 4JUYA 3KV6A 2A3DA 2X9HA 3ZT5A 2DL1A 4X66T 1R8IA 1E2AA 4DR1T 5JR9B 5JRCA 3RRCA 2L3LA 3Q9DA 5JQGE 2AE9A 4HFDA 4EGWA 5HXHA 1IBLT 2XQ5A 2BVMA 4IREA 3QB5A 4WZXA 2VB6A 3RI5A 2JQHA 3W15B 2LOSA 1HFAA 1LVKA 2KNDA 2LKGA 4LMKA 5FL0A 1YW0A 4ZXLA 4YXDA 5JDLA 3QK6A 1HCIA 1US7B 2ZLYA 2DLRA 3P4WA 4HKAA 4EXTA 2C5JA 2XY8B 2J47A 5L3EB 5LHIB 4LF4T 2EHOD 2ES0A 4AQYT 3GA8A 2IC9A 2YINA 4I43B 5FP3A 3PTRB 3FZFB 5AQLB 5JR9A 5JRCB 4U74A 2JQ9A 4I4TE 4X1IE 2FJDA 3FZHB 3CX7B 3G06A 4O4IE 4DNDA 5L3GB 4JV5T 5CFBA 2YN6A 5HAXA 3EUHA 2BG9C 3LK42 1BR0A 4A97A 4A5XA 4YSXA 2HH7A 4HFEA 5L2LA 3ZCIA 5FY0A 4NPPA 1KK7A 1W0BA 3QUJA 3X1DA 4JI6T 1O3XA 4P1NA 1NENA 4GK5E 4HFCA 2D5UA 2WU2A 4N78D 1UUSA 3VU7H 1D0YA 2FUPA 2V1DB 2CXLA 3J9X1 2E5LT 4ZI2D 2XM2A 3OBVE 4YY3T 4WW0A 3RYIE 4F8HA 4X20E 4XZCA 3RQWA 4PK6A 3NVOA 3I0QA 5FXZA 1HG2A 4OK0A 2XQ3A 4QKNA 2LRKA 2MYSA 2CHNA 3HKCE 5EK4A 2XASB 1MNEA 3L8RA 4H9RC 2XAFB 4B6XA 3E22E 5HYAA 3VR9A 3OYZA 4PNIA 2MOZA 3UUMA 2E5VA 3P7IA 1T98A 1L0VA 1YQ4A 2K24A 4AXPA 5AQVB 4H9SE 3HKDE 4DO0A 2OLTA 4OYJA 4CXWA 4J2CA 3V5UA 4DR5T 1I6ZA 2VKJA 5FY7A 3LSVA 1BR4A 1XDPA 2H89A 2OA5A 3ZN0B 2CMRA 2WMOA 2IDOB 4L9IA 2N1GA 4DV3T 5HXRA 1ZHCA 3N9LA 2ODVA 3P4QA 4UF0A 1BR1A 1D1CA 2XSBA 4HWDA 3L09A 3HI2A 3GN5A 2UUCT 5FXXA 4B3MT 5FMNA 1S35A 4PAGA 2CLYC 3AEFA 4ZZCA 4JYAT 3PU8A 2V5CA 4ZI7E 3H3AA 3KVBA 4YFSA 4U72A 3K3OA 3KBTA 5ABGA 3RQUA 4DUZT 5AQJB 2Y8DA 4HFBA 5EZYE 2VKDA 2LJLA 5JDGA 4O2AE 4OHFA 4Z90A 3ZYMA 3A5XA 3AEAA 3LK3B 2XSAA 5C3JA 3AE3A 4ILBA 4ADZA 5LMNT 1XNQT 2YDSA 4QX7B 1OEDC 4F6RC 1IBKT 2LSGA 3UU3A 1WCRA 1Z8UA 4YSZA 2XQYA 3P8CD 1HF8A 1E7PA 1ZV4X 1N32T 1MMDA 2CBJA 5LGNB 4IHJE 2NOXA 3R6NA 4L0RA 3LDQB 4CI2B 1X79A 4JI4T 1LKXA 2VQET 4YJ3E 5AQSB 1N36T 4WBNE 3FB2A 2ZM0A 3AE4A 4BJMA 3EHZA 3PJAJ 5L47A 4X64T 2E9XD 4YSYA 3AEDA 3PUVF 2ZMAA 4ZS3A 4LF8T 4AKRB 4OFZA 4IDNA 4EYUA 4U7YA 2UXCT 4PJNA 5ETWA 5C8YE 1MNDA 5BMVE 2A9UA 2W00A 2WP9A 3I9YA 3NKZA 3VKHA 1J1JA 5AQHB 1WR6A 3NZPA 4H63V 3VR8A 2MPKA 3JC6C 3KINB 1D0XA 4UVCB 2VURA 2IW5B 3SS1A 3NWIA 4TZ4C 4G2AA 2QYWA 4HN9A 4U7IA 3LK2B 2HPJA 4ZZBA 3TLUA 3CK6A 5HEHA 2X0HA 2FJEA 1MIWA 2XQAA 2BS2A 4CQIA 1XZYA 3AE6A 1YKHB 4PK5A 5IUXA 4YTPA 2E8IA 1LVFA 2WDRA 3FBLA 4QXHB 2B76A 2XPKA 5AQIB 4Q25A 3RPUA 4X62T 3ZLIA 1KFYA 5H6QB 2XAQB 1XNRT 5JDMA 4YT0A 3NRXA 3RLFF 2JIWA 2VKOA 3SWHA 4CN4A 3WI3A 4LF7T 3ZC1A 4CN6A 4DIDB 4CXYA 2R6GF 3I9WA 2DI4A 4U2YA 1T8BA 3ZMZB 2YU1A 3H3MA 1B7TA 5HXSA 3UUNA 1M7KA 2D2SA 3RH3A 2YOEA 4LFCT 2V7LA 4GYSA 2LOPA 2XAGB 3IEEA 4AKLA 1N34T 2WBLA 3N2OA 2LSJA 1KNZA 2LRLA 2XQ8A 5ADXL 1FMWA 1MMGA 1WRDA 3PUYF 2E2AA 3SFDA 3VRAA 3DJBA 2WM9A 5KXJA 4MFRA 5L3BB 1FJGT 5LG3A 3AE2A 2LLYA 5LXTE 3L3PA 2A2FX 3ABVA 1UX4A 3CPZA 3M65A 3AA0B 3UTKA 1XDOA 4IE6A 4L5GA 4PFOA 2WB5A 3BQIA 2H7OA 1OXZA 4XAXB 3GN5B 5AQPB 5LBMA 4QH4A 3ZYLA 1IAPA 2IAKA 2V6XA 3KV9A 1HNXT 2ZM6T 4UF0B 1HNZT 4LMJA 2XQ6A 3WAKA 1ZEEA 4C90A 4DR4T 1OWAA 4DBRA 2JMHA 3UU8A 3OTOT 4CI1B 3CX8B 5FNVE 5HWYA 5KMGP 4JI3T 2LHNA 4LFAT 3RRWA 5HEGA 2QVAA 2JMKA 2HHHT 2F4VT 3MACA 2V8SV 1YXRA 2WZHA 1QSDA 5J0ZA 2QA7A 3UUXB 4ERRA 2NW7A 1MMAA 4HWIB 4X1KE 4COFA 5JVDE 2XHEB 4B3ST 2WY2A 4NXNT 1IJ5A 4HTEA 4PJMA 3NBXX 3ZPOA 3P4RA 4O4JE 1Z0PA 5F5WA 3RKGA 3O1HA 4AISA 2LM9A 4ZI3C 3LBXA 1Y01A 3K3NA 5JR9C 2H3RA 4LF5T 2VVSA 3N5LA 2M6IA 3UULA 1HX1B 2ACZA 3I0OA 3VHLA 3NZQA 3PUSA 2VVNA 3QC9A 2VL8A 3H37A 4KI0F 2MAWA 2C0SA 4EEBA 1W09A 1S94A 3JAFA 3P4SA 3PUWF 2EHOC 4HWCA 2WZIA 4DBQA 1LRZA 2D9DA 1ZKEA 3HL6A 4A98A 2UXNB 4IL4A 4DR6T 4HE8A 3N9OA 4P09A 4BJNA 2DNXA 3OYXA 1UK5A 2Q9QD 3WAJA 3A7MA 4LFBT 1VCSA 3FZMB 3IA3A 4ASKA 1BR2A 1HS7A 5FXWA 4AQFC 4PJLA 1VOMA 2BBJA 3JADA 3UQ7A 2IC6A 3AE9A 3RIFA 1WLXA 1QLBA 1U4QA 5M4YA 4XBFB 2CM0A 2WQYA 4JBWF 2Y6XA 4QXBB 4X5TA 2C5IT 5FVLA 4MLKA 2X67A 4OYKA 4IGUA 2CCQA 4TNVA 1UURA 4NUVA 2KINB 4M1PA 4CN1A 2DWKA 5CA0E 2YDQA 3AEBA 1XMOT 4BAYB 5FKYA 4ZI2C 5LHHB 4X65T 2WWVA 3BK9A 5C2TA 3RYCE 5FL1A 4KBMB 2WCAA 3I1AA 5AQRB 3PUGA 5J1GA 1IZNB 1WYCA 2I0MA 2VKHA 4QX8B 5HWXA 1W9RA 3EABA 1HTJF 2V7IA 3Q5DA 5LOVE 2W67A 1UCUA 2LSIA 3ANWA 5HEUA 3FXDB 2W63A 4YJ2E 4MBQA 2NW8A 2H7VC 3F57A 3IF8B 2PFVA 3OKQA 4YTMA 3N9PA 4FJOA 3BQLA 3ETVA 3U3IA 4HFVA 3GMIA 5DQWA 2XZEA 4U31A 5LMUT 3JCFA 4E7SA 2DWGA 5H6RB 1D1BA 5IHYA 2QRXA 2V6YA 1AJ3A 4GIWA 2KXPB 3T1HT 2EHOB 1MIYA 2KWHA 2UXXB 3L39A 2WU5A 4IIJE 2X9WA 3T8OA 2V5DA 3UU6A 5L3FB 3PURA 5LG4A 5LYJE 4DR7T 2G0UA 1D0ZA 3AECA 2MTQA 2YU2A 3C98B 3PUQA 4JI5T 5ABEA 1UX5A 2L8KA 2VL0A 3EVYA 3ZMVB 3ONJA 4DR2T 2BG9A 4CI3B 2X68A 5J2UE 2HN2A 2CWYA 1YD8G 4PK4A 2CA5A 3RKOA 5GONE 2JJ9A 3C4ZA 2NTYA 3ZJ1A 4E7ZA 1JNRA 3F2EA 2WDVA
chains in the Genus database with same CATH topology
3ANWB 2CE7A 2WAUA 3Q5XA 4UVAB 3HA4A 2ZM8A 3HR0A 4GOUA 3C64A 2CLYB 1VRBA 2BVLA 4QWNB 3ZMSB 2CWOA 4H9NC 3AAIA 4TN7B 3ONXA 4WNKA 5DJQC 5IYZE 4EOZB 2DCFA 4EZHA 2BZBA 3KV4A 4AKHA 2Q9QA 2Y48B 2NW9A 1Y64B 3D0TA 2L9QA 4KUMB 1E1HB 3OJAA 4I50E 2A72A 4EIWA 5HXEA 2MBGA 3SOLA 2V7KA 3AAAB 3MK7C 4H63H 5DABA 3MKDA 3CKDA 1FIOA 4KP3C 2ODUA 3PDYA 4HGAA 2YEVC 5JREA 4AI6A 3LG7A 3U78A 5LGUB 4V1Av 5E0OA 3B57A 3HKBE 4UXNB 2XTLA 3FXEB 4P0BA 4QXCB 3E0ZA 4WBOA 5LJMA 3LBXB 2LE8A 5LJNA 4H9OC 1WYBA 3EDUA 4O4HE 4AQGA 3J7Yq 4A56A 4JLEA 3K3QC 5LA6E 3BQKA 3K8PC 4PJJA 4C91A 3CQCB 2K9AA 2V26A 3KBUA 4MALA 5DQVA 5FXVA 1NWMX 3CX6B 4NUUA 2LSYA 4FI5A 3IBPA 2CXDA 2M67A 4X1YE 3O9XA 3HKEE 4DMVA 4GK0E 5F8PA 3KDSE 3AA1B 2W61A 1G8XA 1HG5A 2LSKA 5JH7E 5TAOA 3KV5A 2JQQA 4ISSA 3DP7A 2W62A 3Q2MA 4IE7A 3LFMA 2N2NA 4DVDA 1YKEB 4TX5A 2CEAA 1G73A 3ZCJA 2HPLA 3GWHA 2GK9A 4ISTA 4UVBB 3CVRA 1CUNA 2D0TA 4TV9E 3ZYKA 4H9QC 2ZM2A 3CMLA 5F3JA 2KWIB 3O1IA 2VWAA 3AVRA 2E9XB 5JDNA 4TV8E 3RYHE 2Z6EA 4BA9A 5CA1E 2BDEA 2PBIA 2CXFA 4IDZA 2E9XA 4EB6E 3MJXA 4DMWA 4MHCA 5L3DB 1AJ3A 2RA1A 3PE0A 2YK0A 2LT3A 2XUEA 4K0UA 3N9MA 2W0GA 4YHJA 4GYRA 4P0AA 3AA7B 3Q5WA 2V7MA 1IJ6A 4PFPA 3UT5E 3AB3B 4AKIA 1HX8A 4ZI3D 3MA9A 4PW8A 1FMVA 4UEMA 3UFEA 3R84B 4KMCA 4QHOA 5LGTB 3RYFE 3SRZA 4IE5A 3S4UA 3E08A 2PG8A 5LHGB 2D0UA 3F31A 3V5SA 5JDFA 3ZEFB 2B1EA 2VASA 3KVAA 4IE4A 4ZOLE 5KX5E 2Q9QC 5L3CB 3C50A 5FYMA 2KMFA 3O4XE 2KT9A 4CZZB 3RC3A 2RP4A 5KDMC 3AVSA 3VKGA 4JEUB 3O1JA 3LJCA 2E9XC 3PUAA 4HEAA 2VK9A 2QGSA 1H7CA 1SA0E 3FBZA 3AA6B 4UV9B 4Z8XA 1SHZC 4G63A 2X0LB 3ZMTB 4I55E 3KFWX 4TUYE 2JPFA 3CQXC 3JC6D 4O4LE 4O2BE 4ANJA 2X9YA 2K48A 3MZKB 4ILUA 1D1AA 4ZHQE 4H9PC 4EYYR 2WSSV 5FY1A 2N9DA 5CB4E 2WMNA 4O8SA 3ZN1B 5LP6E 1V9DA 2XAHB 5A1LA 1MMNA 4IE0A 2NWBA 2NP9A 2SPCA 3RX6A 4CXXA 3AAEB 3CQGB 5EK3A 3ZC0A 2KZ7B 3ZMUB 3ZJ2A 5LCYA 1U5PA 4AKGA 2Q9QB 4UIGA 2ACXA 5EK2A 5JDQA 4ZS2A 4UV8B 1EZ3A 3EDVA 3B13A 3N2KE 2KLQA 2WWUA 5LBQB 4UELA 5LNKA 4YLHA 3N9QA 5HXCA 3MXZA 5JDHA 1NAFA 3RC8A 3FHNA 2LEHA 1QUUA 3CWZB 2LHRA 2JRKA 3C4WA 3PU3A 2J1DG 3C51A 3ESLA 3ETUA 4EAHA 5J2TE 3C4XA 2I59A 2X66A 2X51A 1MIVA 5AFUL 3IHRA 2NTXA 2V7JA 4AQFA 4EZ4A 2DHRA 2X9XA 2K5BB 4JEHB 3N2GE 2PJQA 2C5KT 2EHOA 2XAJB 1FEWA 3N9NA 3NRYA 2P9BA 3TKLB 3DTOA 4JUYA 3KV6A 2A3DA 2X9HA 5JRCA 5JR9B 3RRCA 2L3LA 3Q9DA 5JQGE 5HXHA 2BVMA 2VB6A 3W15B 2LOSA 2KNDA 1HFAA 1LVKA 1YW0A 5JDLA 3QK6A 1HCIA 1US7B 2ZLYA 2DLRA 4EXTA 4HKAA 5L3EB 2C5JA 5LHIB 2EHOD 2ES0A 3GA8A 2IC9A 2YINA 4I43B 5FP3A 3PTRB 5JR9A 5JRCB 4U74A 4I4TE 4X1IE 3CX7B 4O4IE 4DNDA 5L3GB 5HAXA 3EUHA 3LK42 1BR0A 2HH7A 5L2LA 3ZCIA 5FY0A 1KK7A 3QUJA 1O3XA 4GK5E 2D5UA 4N78D 3VU7H 1D0YA 2V1DB 2CXLA 3J9X1 4ZI2D 3OBVE 4WW0A 3RYIE 4X20E 4XZCA 4PK6A 3I0QA 5FXZA 1HG2A 4OK0A 4QKNA 3HKCE 2MYSA 5EK4A 2XASB 1MNEA 4H9RC 4B6XA 2XAFB 3E22E 3OYZA 4PNIA 2MOZA 3UUMA 3P7IA 1T98A 2K24A 4AXPA 4H9SE 3HKDE 4DO0A 4CXWA 4OYJA 4J2CA 3V5UA 2VKJA 5FY7A 1BR4A 2OA5A 3ZN0B 2CMRA 2WMOA 4L9IA 2N1GA 5HXRA 1ZHCA 3N9LA 2ODVA 4UF0A 1BR1A 1D1CA 3L09A 3HI2A 3GN5A 5FXXA 5FMNA 1S35A 4PAGA 2CLYC 3PU8A 4ZI7E 3H3AA 3KVBA 4YFSA 4U72A 3K3OA 3KBTA 2Y8DA 5EZYE 2VKDA 2LJLA 5JDGA 4O2AE 4OHFA 3ZYMA 3A5XA 3LK3B 4ADZA 4QX7B 4F6RC 2LSGA 2XQYA 3P8CD 1HF8A 1ZV4X 1MMDA 5LGNB 4IHJE 2NOXA 3R6NA 4L0RA 4CI2B 1X79A 1LKXA 4YJ3E 4WBNE 3FB2A 2ZM0A 4BJMA 2E9XD 4AKRB 2ZMAA 4ZS3A 4OFZA 4EYUA 4PJNA 5ETWA 5C8YE 1MNDA 5BMVE 2W00A 3I9YA 3VKHA 1WR6A 3NZPA 4H63V 3KINB 3JC6C 4UVCB 1D0XA 2IW5B 3SS1A 4TZ4C 4G2AA 4HN9A 3LK2B 2HPJA 1MIWA 4CQIA 1YKHB 4PK5A 2E8IA 1LVFA 3FBLA 4QXHB 3RPUA 3ZLIA 5H6QB 2XAQB 5JDMA 3NRXA 2VKOA 3SWHA 3WI3A 3ZC1A 4CXYA 3I9WA 2DI4A 3ZMZB 2YU1A 1B7TA 5HXSA 3UUNA 2D2SA 3RH3A 2V7LA 4GYSA 2LOPA 2XAGB 3IEEA 4AKLA 2WBLA 3N2OA 2LSJA 1KNZA 5ADXL 1FMWA 1MMGA 1WRDA 3DJBA 2WM9A 4MFRA 5L3BB 5LXTE 3L3PA 2A2FX 1UX4A 3CPZA 3M65A 3AA0B 3UTKA 4PFOA 4IE6A 4L5GA 5LBMA 3BQIA 2H7OA 1OXZA 4XAXB 3GN5B 3ZYLA 1IAPA 2IAKA 3KV9A 4UF0B 3WAKA 4C90A 1ZEEA 1OWAA 4DBRA 2JMHA 4CI1B 3CX8B 5FNVE 5HWYA 5KMGP 2LHNA 3RRWA 2JMKA 3MACA 1QSDA 2QA7A 3UUXB 4ERRA 2NW7A 1MMAA 4X1KE 5JVDE 2XHEB 1IJ5A 4HTEA 4PJMA 3NBXX 3ZPOA 4O4JE 1Z0PA 3O1HA 2LM9A 4ZI3C 3LBXA 5JR9C 3K3NA 2H3RA 3N5LA 3UULA 3I0OA 3VHLA 3NZQA 3PUSA 3QC9A 5HYAA 2VL8A 3H37A 2C0SA 1S94A 2EHOC 4DBQA 1LRZA 1ZKEA 3HL6A 2UXNB 4HE8A 3N9OA 4P09A 4BJNA 2DNXA 3OYXA 2Q9QD 3WAJA 4ASKA 1BR2A 1HS7A 5FXWA 4AQFC 4PJLA 1VOMA 2IC6A 1WLXA 5M4YA 1U4QA 4XBFB 2CM0A 2Y6XA 4QXBB 2C5IT 4MLKA 2X67A 4OYKA 4IGUA 2CCQA 4NUVA 2KINB 4M1PA 2DWKA 5CA0E 4BAYB 4ZI2C 5LHHB 3BK9A 3RYCE 3I1AA 3PUGA 5J1GA 1IZNB 1WYCA 2VKHA 4QX8B 5HWXA 5LOVE 1HTJF 2V7IA 1UCUA 2LSIA 3ANWA 3FXDB 2W63A 4YJ2E 4MBQA 2NW8A 2H7VC 3F57A 3IF8B 2PFVA 3OKQA 3N9PA 4FJOA 3BQLA 3ETVA 3U3IA 4HFVA 3GMIA 5DQWA 4E7SA 2DWGA 5H6RB 1D1BA 5IHYA 4GIWA 2KXPB 2EHOB 1MIYA 2KWHA 2UXXB 4IIJE 3T8OA 2X9WA 5L3FB 5LYJE 5LG4A 3PURA 2G0UA 1D0ZA 3C98B 2MTQA 2YU2A 3PUQA 1UX5A 2L8KA 3EVYA 3ZMVB 4CI3B 2X68A 5J2UE 2CWYA 1YD8G 4PK4A 2CA5A 3RKOA 5GONE 2JJ9A 3C4ZA 2NTYA 3ZJ1A 4E7ZA 4KBMB 3F2EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XHE B;  2DNX A;  4JEH B;  5LG4 A;  4TX5 A;  4JEU B;  5M4Y A;  3C98 B;  1BR0 A;  1FIO A;  1S94 A;  1FEW A;  1HS7 A;  1G73 A;  1EZ3 A;  3LG7 A; 
#chains in the Genus database with same CATH topology
 2BS3 A;  5AQG B;  3OVU A;  3ANW B;  3EAM A;  2CE7 A;  2LM2 A;  5AQT B;  3TLV A;  2WAU A;  3Q5X A;  4UVA B;  5HCJ A;  3HA4 A;  2ZM8 A;  3HR0 A;  4GOU A;  3C64 A;  4QH1 A;  2CLY B;  4U3C A;  3AE1 A;  1VRB A;  2BVL A;  4HWH A;  4QWN B;  3ZMS B;  4JI2 T;  2CWO A;  4H9N C;  1J5W A;  3AAI A;  3ONX A;  2K3W A;  3Q5E A;  1ZOY A;  4ILC A;  4TN7 B;  4WNK A;  4I0U A;  5DJQ C;  2DCF A;  4Z91 A;  2BZB A;  5IYZ E;  4EOZ B;  3KV4 A;  4EZH A;  4AKH A;  2Q9Q A;  2Y48 B;  2NW9 A;  1N33 T;  1Y64 B;  3D0T A;  2L9Q A;  4KUM B;  1E1H B;  3OJA A;  4I50 E;  2W4X A;  1IBM T;  4LF6 T;  2A72 A;  1DU2 A;  1UGO A;  4EIW A;  5HXE A;  2MBG A;  3SOL A;  1OED B;  2V7K A;  3AAA B;  5AQO B;  3MK7 C;  4H63 H;  5DAB A;  4K0K T;  3MKD A;  5BR8 T;  3CKD A;  1FIO A;  4KP3 C;  2ODU A;  3PDY A;  4HGA A;  2YEV C;  3ZT7 A;  5JRE A;  2BKO A;  3LG7 A;  4AI6 A;  5ABF B;  2UXB T;  2OV9 A;  3U78 A;  3AE8 A;  3PV0 F;  1I94 T;  5LGU B;  1J5E T;  4V1A v;  5E0O A;  3B57 A;  3HKB E;  4UXN B;  3K1S A;  4KHP T;  2XTL A;  3FXE B;  4P0B A;  5HEO A;  2IML A;  2FJA A;  2YKS A;  4QXC B;  3E0Z A;  4WBO A;  5LJM A;  3LBX B;  2LE8 A;  3QB5 K;  5LJN A;  4H9O C;  1WYB A;  2IIU A;  5AQF B;  3EDU A;  4O4H E;  4TWD A;  4AQG A;  4A56 A;  1XWM A;  3K3Q C;  4JLE A;  3RIU A;  5LA6 E;  3J7Y q;  3BQK A;  3QOF A;  3K8P C;  4PJJ A;  5CJ5 A;  4YTN A;  4C91 A;  3CQC B;  2K9A A;  2V26 A;  3KBU A;  4MAL A;  3SFE A;  5DQV A;  3PJA A;  3T1Y T;  4B3T T;  5FXV A;  2J4G A;  1HR0 T;  1NWM X;  3AEE A;  2CPT A;  3CX6 B;  2LSY A;  4FI5 A;  3IBP A;  2CXD A;  2M67 A;  4NUU A;  4X1Y E;  3O9X A;  3HKE E;  4DMV A;  2UUA T;  4GK0 E;  5F8P A;  3AXJ B;  3KDS E;  2NR4 A;  4TWH A;  4NIQ A;  3AA1 B;  1HNW T;  2W61 A;  1G8X A;  1HG5 A;  2LSK A;  5JH7 E;  3RIA A;  5TAO A;  3KV5 A;  2JQQ A;  3AE5 A;  3DP7 A;  3P50 A;  4ISS A;  2W62 A;  3Q2M A;  4IE7 A;  3LFM A;  3ONL C;  4JI8 T;  2N2N A;  4DVD A;  1YKE B;  4TX5 A;  2CEA A;  2W66 A;  4DV2 T;  1ZP0 A;  2M6B A;  4NXM T;  1G73 A;  4U33 A;  3ZCJ A;  2HPL A;  3GWH A;  3RHW A;  2GK9 A;  2J62 A;  4IST A;  4UVB B;  3CVR A;  5JTG A;  4DV7 T;  2IUB A;  1CUN A;  2D0T A;  4TV9 E;  2BKP A;  1OED E;  4H9Q C;  5AQU B;  3ZYK A;  2ZM2 A;  3CML A;  5F3J A;  2KWI B;  1CHU A;  3O1I A;  2VWA A;  4KHZ F;  4DV4 T;  3AVR A;  2E9X B;  3AE7 A;  4TV8 E;  5HCM A;  3RYH E;  2Z6E A;  4BA9 A;  5JDN A;  5CA1 E;  5IWA T;  2BDE A;  2PBI A;  2CXF A;  2BG9 E;  3RIU C;  4IDZ A;  4TWF A;  2E9X A;  2CHO A;  3MJX A;  4DMW A;  4IDO A;  4MHC A;  4EB6 E;  2RA1 A;  3PE0 A;  5L3D B;  1T7S A;  2LT3 A;  2XUE A;  1KEY A;  2YK0 A;  2I6H A;  4UR9 A;  2XQ9 A;  4K0U A;  5FVK A;  1GQE A;  3CIR A;  2W0G A;  1SUM B;  3N9M A;  4IL9 A;  4YHJ A;  4GYR A;  2UXD T;  4P0A A;  2VQF T;  2XM1 A;  4HFH A;  3AA7 B;  3Q5W A;  2V7M A;  1IJ6 A;  1WFD A;  4PFP A;  3UT5 E;  4JI7 T;  3JAE A;  2X0Y A;  3UFG A;  3VRB A;  2BS4 A;  3RF1 A;  2BKN A;  4KX6 A;  1KF6 A;  1W0A A;  3AB3 B;  4AKI A;  1HX8 A;  3M3Z B;  4ZI3 D;  3MA9 A;  4PW8 A;  5HEJ A;  1FMV A;  4UEM A;  3UFE A;  3EI0 A;  4KMC A;  4QHO A;  5AQK B;  3R84 B;  3RYF E;  5LGT B;  4LF9 T;  3SRZ A;  3B5M A;  1JNZ A;  3AXJ A;  2IHR 1;  4IE5 A;  3E08 A;  4U2Z A;  5AQQ B;  2PG8 A;  3S4U A;  5LHG B;  2D0U A;  3F31 A;  3V5S A;  5JDF A;  3ZEF B;  2B1E A;  2VAS A;  3KVA A;  4IE4 A;  4ZOL E;  3UUB A;  2Q9Q C;  5KX5 E;  5L3C B;  4DV1 T;  3UQ4 A;  4IDP A;  3C50 A;  4ZEY A;  2CBI A;  1T72 A;  5FYM A;  2KMF A;  3O4X E;  2KT9 A;  4CZZ B;  3RC3 A;  4HFI A;  2RP4 A;  3ZST A;  5KDM C;  3AVS A;  3VKG A;  4JEU B;  3O1J A;  3LJC A;  2E9X C;  3PUA A;  3PUZ F;  4HEA A;  4DV0 T;  2VK9 A;  2W2U A;  4GKK T;  4EED A;  2QGS A;  1VCT A;  1H7C A;  1SA0 E;  3FBZ A;  3AA6 B;  4UV9 B;  4Z8X A;  1XMQ T;  2XQ7 A;  1SE7 A;  1KNR A;  1SHZ C;  1YQ3 A;  4G63 A;  5CGM A;  2X0L B;  3ZMT B;  3ZSS A;  3FZK B;  4I55 E;  3QNU A;  3KFW X;  4TUY E;  2JPF A;  3CQX C;  3JC6 D;  2FBW A;  4O4L E;  4O2B E;  4ANJ A;  2X9Y A;  4QH5 A;  2AXD S;  2FJB A;  2K48 A;  3MZK B;  4ILU A;  4OX9 T;  1D1A A;  1M62 A;  4EV6 A;  4ZHQ E;  2XJ7 A;  2BBH A;  1KNP A;  2WSS V;  3PUX F;  2PTF A;  2N9D A;  2HN1 A;  4H9P C;  5FY1 A;  3TLW A;  4EYY R;  5ABF A;  3AEG A;  5CB4 E;  3TLS A;  4TNW A;  2WMN A;  4O8S A;  3ZN1 B;  5LP6 E;  1V9D A;  2XAH B;  5LB7 B;  5A1L A;  4ILA A;  4JI1 T;  1MMN A;  3UU5 A;  1OED A;  4IE0 A;  1NEK A;  2NWB A;  2NP9 A;  2SPC A;  4LML A;  3RX6 A;  4CXX A;  4DV5 T;  3AAE B;  3CQG B;  5EK3 A;  5ABH A;  2KZ7 B;  3ZMU B;  3ZC0 A;  3ZT6 A;  3ZJ2 A;  5LCY A;  4GKJ T;  2JQK A;  1U5P A;  4AKG A;  2Q9Q B;  4UIG A;  5L4H A;  1WR0 A;  2ACX A;  3TLT A;  5AQN B;  5EK2 A;  4ZS2 A;  5JDQ A;  4DR3 T;  4UV8 B;  1EZ3 A;  4AIU A;  2LKH A;  3EDV A;  4DUY T;  3B13 A;  3N2K E;  2KLQ A;  2WWU A;  5LBQ B;  4UEL A;  4DV6 T;  5LNK A;  3FZL B;  4HWF A;  3OPC A;  2WDQ A;  3N9Q A;  4YLH A;  5HXC A;  3MXZ A;  3P4P A;  3A8Y C;  5JDH A;  1NAF A;  3RC8 A;  3FHN A;  2LEH A;  1QUU A;  3CWZ B;  4IT4 A;  2LHR A;  3RGL A;  5L4E A;  2JRK A;  4JI0 T;  3C4W A;  3PU3 A;  2J1D G;  3C51 A;  3ESL A;  3ETU A;  4EAH A;  5J2T E;  2KSR A;  2UU9 T;  2H88 A;  2I59 A;  2X66 A;  2X51 A;  3C4X A;  3UU4 A;  1MIV A;  5AFU L;  3IHR A;  2NTX A;  2V7J A;  2BG9 B;  4AQF A;  4EZ4 A;  2DHR A;  2WS3 A;  2XQ4 A;  2X9X A;  1X9B A;  3ZKR A;  2CRB A;  2K5B B;  4IDQ A;  4JEH B;  3N2G E;  2PJQ A;  2C5K T;  2EHO A;  4WYV A;  5AQM B;  2XAJ B;  4YHH T;  1FEW A;  3N9N A;  2V6Y B;  2P9B A;  3NRY A;  2RPA A;  3TKL B;  2UUB T;  4B3R T;  2YDR A;  3DTO A;  4JUY A;  3KV6 A;  2A3D A;  2X9H A;  3ZT5 A;  2DL1 A;  4X66 T;  1R8I A;  1E2A A;  4DR1 T;  5JR9 B;  5JRC A;  3RRC A;  2L3L A;  3Q9D A;  5JQG E;  2AE9 A;  4HFD A;  4EGW A;  5HXH A;  1IBL T;  2XQ5 A;  2BVM A;  4IRE A;  3QB5 A;  4WZX A;  2VB6 A;  3RI5 A;  2JQH A;  3W15 B;  2LOS A;  1HFA A;  1LVK A;  2KND A;  2LKG A;  4LMK A;  5FL0 A;  1YW0 A;  4ZXL A;  4YXD A;  5JDL A;  3QK6 A;  1HCI A;  1US7 B;  2ZLY A;  2DLR A;  3P4W A;  4HKA A;  4EXT A;  2C5J A;  2XY8 B;  2J47 A;  5L3E B;  5LHI B;  4LF4 T;  2EHO D;  2ES0 A;  4AQY T;  3GA8 A;  2IC9 A;  2YIN A;  4I43 B;  5FP3 A;  3PTR B;  3FZF B;  5AQL B;  5JR9 A;  5JRC B;  4U74 A;  2JQ9 A;  4I4T E;  4X1I E;  2FJD A;  3FZH B;  3CX7 B;  3G06 A;  4O4I E;  4DND A;  5L3G B;  4JV5 T;  5CFB A;  2YN6 A;  5HAX A;  3EUH A;  2BG9 C;  3LK4 2;  1BR0 A;  4A97 A;  4A5X A;  4YSX A;  2HH7 A;  4HFE A;  5L2L A;  3ZCI A;  5FY0 A;  4NPP A;  1KK7 A;  1W0B A;  3QUJ A;  3X1D A;  4JI6 T;  1O3X A;  4P1N A;  1NEN A;  4GK5 E;  4HFC A;  2D5U A;  2WU2 A;  4N78 D;  1UUS A;  3VU7 H;  1D0Y A;  2FUP A;  2V1D B;  2CXL A;  3J9X 1;  2E5L T;  4ZI2 D;  2XM2 A;  3OBV E;  4YY3 T;  4WW0 A;  3RYI E;  4F8H A;  4X20 E;  4XZC A;  3RQW A;  4PK6 A;  3NVO A;  3I0Q A;  5FXZ A;  1HG2 A;  4OK0 A;  2XQ3 A;  4QKN A;  2LRK A;  2MYS A;  2CHN A;  3HKC E;  5EK4 A;  2XAS B;  1MNE A;  3L8R A;  4H9R C;  2XAF B;  4B6X A;  3E22 E;  5HYA A;  3VR9 A;  3OYZ A;  4PNI A;  2MOZ A;  3UUM A;  2E5V A;  3P7I A;  1T98 A;  1L0V A;  1YQ4 A;  2K24 A;  4AXP A;  5AQV B;  4H9S E;  3HKD E;  4DO0 A;  2OLT A;  4OYJ A;  4CXW A;  4J2C A;  3V5U A;  4DR5 T;  1I6Z A;  2VKJ A;  5FY7 A;  3LSV A;  1BR4 A;  1XDP A;  2H89 A;  2OA5 A;  3ZN0 B;  2CMR A;  2WMO A;  2IDO B;  4L9I A;  2N1G A;  4DV3 T;  5HXR A;  1ZHC A;  3N9L A;  2ODV A;  3P4Q A;  4UF0 A;  1BR1 A;  1D1C A;  2XSB A;  4HWD A;  3L09 A;  3HI2 A;  3GN5 A;  2UUC T;  5FXX A;  4B3M T;  5FMN A;  1S35 A;  4PAG A;  2CLY C;  3AEF A;  4ZZC A;  4JYA T;  3PU8 A;  2V5C A;  4ZI7 E;  3H3A A;  3KVB A;  4YFS A;  4U72 A;  3K3O A;  3KBT A;  5ABG A;  3RQU A;  4DUZ T;  5AQJ B;  2Y8D A;  4HFB A;  5EZY E;  2VKD A;  2LJL A;  5JDG A;  4O2A E;  4OHF A;  4Z90 A;  3ZYM A;  3A5X A;  3AEA A;  3LK3 B;  2XSA A;  5C3J A;  3AE3 A;  4ILB A;  4ADZ A;  5LMN T;  1XNQ T;  2YDS A;  4QX7 B;  1OED C;  4F6R C;  1IBK T;  2LSG A;  3UU3 A;  1WCR A;  1Z8U A;  4YSZ A;  2XQY A;  3P8C D;  1HF8 A;  1E7P A;  1ZV4 X;  1N32 T;  1MMD A;  2CBJ A;  5LGN B;  4IHJ E;  2NOX A;  3R6N A;  4L0R A;  3LDQ B;  4CI2 B;  1X79 A;  4JI4 T;  1LKX A;  2VQE T;  4YJ3 E;  5AQS B;  1N36 T;  4WBN E;  3FB2 A;  2ZM0 A;  3AE4 A;  4BJM A;  3EHZ A;  3PJA J;  5L47 A;  4X64 T;  2E9X D;  4YSY A;  3AED A;  3PUV F;  2ZMA A;  4ZS3 A;  4LF8 T;  4AKR B;  4OFZ A;  4IDN A;  4EYU A;  4U7Y A;  2UXC T;  4PJN A;  5ETW A;  5C8Y E;  1MND A;  5BMV E;  2A9U A;  2W00 A;  2WP9 A;  3I9Y A;  3NKZ A;  3VKH A;  1J1J A;  5AQH B;  1WR6 A;  3NZP A;  4H63 V;  3VR8 A;  2MPK A;  3JC6 C;  3KIN B;  1D0X A;  4UVC B;  2VUR A;  2IW5 B;  3SS1 A;  3NWI A;  4TZ4 C;  4G2A A;  2QYW A;  4HN9 A;  4U7I A;  3LK2 B;  2HPJ A;  4ZZB A;  3TLU A;  3CK6 A;  5HEH A;  2X0H A;  2FJE A;  1MIW A;  2XQA A;  2BS2 A;  4CQI A;  1XZY A;  3AE6 A;  1YKH B;  4PK5 A;  5IUX A;  4YTP A;  2E8I A;  1LVF A;  2WDR A;  3FBL A;  4QXH B;  2B76 A;  2XPK A;  5AQI B;  4Q25 A;  3RPU A;  4X62 T;  3ZLI A;  1KFY A;  5H6Q B;  2XAQ B;  1XNR T;  5JDM A;  4YT0 A;  3NRX A;  3RLF F;  2JIW A;  2VKO A;  3SWH A;  4CN4 A;  3WI3 A;  4LF7 T;  3ZC1 A;  4CN6 A;  4DID B;  4CXY A;  2R6G F;  3I9W A;  2DI4 A;  4U2Y A;  1T8B A;  3ZMZ B;  2YU1 A;  3H3M A;  1B7T A;  5HXS A;  3UUN A;  1M7K A;  2D2S A;  3RH3 A;  2YOE A;  4LFC T;  2V7L A;  4GYS A;  2LOP A;  2XAG B;  3IEE A;  4AKL A;  1N34 T;  2WBL A;  3N2O A;  2LSJ A;  1KNZ A;  2LRL A;  2XQ8 A;  5ADX L;  1FMW A;  1MMG A;  1WRD A;  3PUY F;  2E2A A;  3SFD A;  3VRA A;  3DJB A;  2WM9 A;  5KXJ A;  4MFR A;  5L3B B;  1FJG T;  5LG3 A;  3AE2 A;  2LLY A;  5LXT E;  3L3P A;  2A2F X;  3ABV A;  1UX4 A;  3CPZ A;  3M65 A;  3AA0 B;  3UTK A;  1XDO A;  4IE6 A;  4L5G A;  4PFO A;  2WB5 A;  3BQI A;  2H7O A;  1OXZ A;  4XAX B;  3GN5 B;  5AQP B;  5LBM A;  4QH4 A;  3ZYL A;  1IAP A;  2IAK A;  2V6X A;  3KV9 A;  1HNX T;  2ZM6 T;  4UF0 B;  1HNZ T;  4LMJ A;  2XQ6 A;  3WAK A;  1ZEE A;  4C90 A;  4DR4 T;  1OWA A;  4DBR A;  2JMH A;  3UU8 A;  3OTO T;  4CI1 B;  3CX8 B;  5FNV E;  5HWY A;  5KMG P;  4JI3 T;  2LHN A;  4LFA T;  3RRW A;  5HEG A;  2QVA A;  2JMK A;  2HHH T;  2F4V T;  3MAC A;  2V8S V;  1YXR A;  2WZH A;  1QSD A;  5J0Z A;  2QA7 A;  3UUX B;  4ERR A;  2NW7 A;  1MMA A;  4HWI B;  4X1K E;  4COF A;  5JVD E;  2XHE B;  4B3S T;  2WY2 A;  4NXN T;  1IJ5 A;  4HTE A;  4PJM A;  3NBX X;  3ZPO A;  3P4R A;  4O4J E;  1Z0P A;  5F5W A;  3RKG A;  3O1H A;  4AIS A;  2LM9 A;  4ZI3 C;  3LBX A;  1Y01 A;  3K3N A;  5JR9 C;  2H3R A;  4LF5 T;  2VVS A;  3N5L A;  2M6I A;  3UUL A;  1HX1 B;  2ACZ A;  3I0O A;  3VHL A;  3NZQ A;  3PUS A;  2VVN A;  3QC9 A;  2VL8 A;  3H37 A;  4KI0 F;  2MAW A;  2C0S A;  4EEB A;  1W09 A;  1S94 A;  3JAF A;  3P4S A;  3PUW F;  2EHO C;  4HWC A;  2WZI A;  4DBQ A;  1LRZ A;  2D9D A;  1ZKE A;  3HL6 A;  4A98 A;  2UXN B;  4IL4 A;  4DR6 T;  4HE8 A;  3N9O A;  4P09 A;  4BJN A;  2DNX A;  3OYX A;  1UK5 A;  2Q9Q D;  3WAJ A;  3A7M A;  4LFB T;  1VCS A;  3FZM B;  3IA3 A;  4ASK A;  1BR2 A;  1HS7 A;  5FXW A;  4AQF C;  4PJL A;  1VOM A;  2BBJ A;  3JAD A;  3UQ7 A;  2IC6 A;  3AE9 A;  3RIF A;  1WLX A;  1QLB A;  1U4Q A;  5M4Y A;  4XBF B;  2CM0 A;  2WQY A;  4JBW F;  2Y6X A;  4QXB B;  4X5T A;  2C5I T;  5FVL A;  4MLK A;  2X67 A;  4OYK A;  4IGU A;  2CCQ A;  4TNV A;  1UUR A;  4NUV A;  2KIN B;  4M1P A;  4CN1 A;  2DWK A;  5CA0 E;  2YDQ A;  3AEB A;  1XMO T;  4BAY B;  5FKY A;  4ZI2 C;  5LHH B;  4X65 T;  2WWV A;  3BK9 A;  5C2T A;  3RYC E;  5FL1 A;  4KBM B;  2WCA A;  3I1A A;  5AQR B;  3PUG A;  5J1G A;  1IZN B;  1WYC A;  2I0M A;  2VKH A;  4QX8 B;  5HWX A;  1W9R A;  3EAB A;  1HTJ F;  2V7I A;  3Q5D A;  5LOV E;  2W67 A;  1UCU A;  2LSI A;  3ANW A;  5HEU A;  3FXD B;  2W63 A;  4YJ2 E;  4MBQ A;  2NW8 A;  2H7V C;  3F57 A;  3IF8 B;  2PFV A;  3OKQ A;  4YTM A;  3N9P A;  4FJO A;  3BQL A;  3ETV A;  3U3I A;  4HFV A;  3GMI A;  5DQW A;  2XZE A;  4U31 A;  5LMU T;  3JCF A;  4E7S A;  2DWG A;  5H6R B;  1D1B A;  5IHY A;  2QRX A;  2V6Y A;  1AJ3 A;  4GIW A;  2KXP B;  3T1H T;  2EHO B;  1MIY A;  2KWH A;  2UXX B;  3L39 A;  2WU5 A;  4IIJ E;  2X9W A;  3T8O A;  2V5D A;  3UU6 A;  5L3F B;  3PUR A;  5LG4 A;  5LYJ E;  4DR7 T;  2G0U A;  1D0Z A;  3AEC A;  2MTQ A;  2YU2 A;  3C98 B;  3PUQ A;  4JI5 T;  5ABE A;  1UX5 A;  2L8K A;  2VL0 A;  3EVY A;  3ZMV B;  3ONJ A;  4DR2 T;  2BG9 A;  4CI3 B;  2X68 A;  5J2U E;  2HN2 A;  2CWY A;  1YD8 G;  4PK4 A;  2CA5 A;  3RKO A;  5GON E;  2JJ9 A;  3C4Z A;  2NTY A;  3ZJ1 A;  4E7Z A;  1JNR A;  3F2E A;  2WDV A; 
#chains in the Genus database with same CATH homology
 3ANW B;  2CE7 A;  2WAU A;  3Q5X A;  4UVA B;  3HA4 A;  2ZM8 A;  3HR0 A;  4GOU A;  3C64 A;  2CLY B;  1VRB A;  2BVL A;  4QWN B;  3ZMS B;  2CWO A;  4H9N C;  3AAI A;  4TN7 B;  3ONX A;  4WNK A;  5DJQ C;  5IYZ E;  4EOZ B;  2DCF A;  4EZH A;  2BZB A;  3KV4 A;  4AKH A;  2Q9Q A;  2Y48 B;  2NW9 A;  1Y64 B;  3D0T A;  2L9Q A;  4KUM B;  1E1H B;  3OJA A;  4I50 E;  2A72 A;  4EIW A;  5HXE A;  2MBG A;  3SOL A;  2V7K A;  3AAA B;  3MK7 C;  4H63 H;  5DAB A;  3MKD A;  3CKD A;  1FIO A;  4KP3 C;  2ODU A;  3PDY A;  4HGA A;  2YEV C;  5JRE A;  4AI6 A;  3LG7 A;  3U78 A;  5LGU B;  4V1A v;  5E0O A;  3B57 A;  3HKB E;  4UXN B;  2XTL A;  3FXE B;  4P0B A;  4QXC B;  3E0Z A;  4WBO A;  5LJM A;  3LBX B;  2LE8 A;  5LJN A;  4H9O C;  1WYB A;  3EDU A;  4O4H E;  4AQG A;  3J7Y q;  4A56 A;  4JLE A;  3K3Q C;  5LA6 E;  3BQK A;  3K8P C;  4PJJ A;  4C91 A;  3CQC B;  2K9A A;  2V26 A;  3KBU A;  4MAL A;  5DQV A;  5FXV A;  1NWM X;  3CX6 B;  4NUU A;  2LSY A;  4FI5 A;  3IBP A;  2CXD A;  2M67 A;  4X1Y E;  3O9X A;  3HKE E;  4DMV A;  4GK0 E;  5F8P A;  3KDS E;  3AA1 B;  2W61 A;  1G8X A;  1HG5 A;  2LSK A;  5JH7 E;  5TAO A;  3KV5 A;  2JQQ A;  4ISS A;  3DP7 A;  2W62 A;  3Q2M A;  4IE7 A;  3LFM A;  2N2N A;  4DVD A;  1YKE B;  4TX5 A;  2CEA A;  1G73 A;  3ZCJ A;  2HPL A;  3GWH A;  2GK9 A;  4IST A;  4UVB B;  3CVR A;  1CUN A;  2D0T A;  4TV9 E;  3ZYK A;  4H9Q C;  2ZM2 A;  3CML A;  5F3J A;  2KWI B;  3O1I A;  2VWA A;  3AVR A;  2E9X B;  5JDN A;  4TV8 E;  3RYH E;  2Z6E A;  4BA9 A;  5CA1 E;  2BDE A;  2PBI A;  2CXF A;  4IDZ A;  2E9X A;  4EB6 E;  3MJX A;  4DMW A;  4MHC A;  5L3D B;  1AJ3 A;  2RA1 A;  3PE0 A;  2YK0 A;  2LT3 A;  2XUE A;  4K0U A;  3N9M A;  2W0G A;  4YHJ A;  4GYR A;  4P0A A;  3AA7 B;  3Q5W A;  2V7M A;  1IJ6 A;  4PFP A;  3UT5 E;  3AB3 B;  4AKI A;  1HX8 A;  4ZI3 D;  3MA9 A;  4PW8 A;  1FMV A;  4UEM A;  3UFE A;  3R84 B;  4KMC A;  4QHO A;  5LGT B;  3RYF E;  3SRZ A;  4IE5 A;  3S4U A;  3E08 A;  2PG8 A;  5LHG B;  2D0U A;  3F31 A;  3V5S A;  5JDF A;  3ZEF B;  2B1E A;  2VAS A;  3KVA A;  4IE4 A;  4ZOL E;  5KX5 E;  2Q9Q C;  5L3C B;  3C50 A;  5FYM A;  2KMF A;  3O4X E;  2KT9 A;  4CZZ B;  3RC3 A;  2RP4 A;  5KDM C;  3AVS A;  3VKG A;  4JEU B;  3O1J A;  3LJC A;  2E9X C;  3PUA A;  4HEA A;  2VK9 A;  2QGS A;  1H7C A;  1SA0 E;  3FBZ A;  3AA6 B;  4UV9 B;  4Z8X A;  1SHZ C;  4G63 A;  2X0L B;  3ZMT B;  4I55 E;  3KFW X;  4TUY E;  2JPF A;  3CQX C;  3JC6 D;  4O4L E;  4O2B E;  4ANJ A;  2X9Y A;  2K48 A;  3MZK B;  4ILU A;  1D1A A;  4ZHQ E;  4H9P C;  4EYY R;  2WSS V;  5FY1 A;  2N9D A;  5CB4 E;  2WMN A;  4O8S A;  3ZN1 B;  5LP6 E;  1V9D A;  2XAH B;  5A1L A;  1MMN A;  4IE0 A;  2NWB A;  2NP9 A;  2SPC A;  3RX6 A;  4CXX A;  3AAE B;  3CQG B;  5EK3 A;  3ZC0 A;  2KZ7 B;  3ZMU B;  3ZJ2 A;  5LCY A;  1U5P A;  4AKG A;  2Q9Q B;  4UIG A;  2ACX A;  5EK2 A;  5JDQ A;  4ZS2 A;  4UV8 B;  1EZ3 A;  3EDV A;  3B13 A;  3N2K E;  2KLQ A;  2WWU A;  5LBQ B;  4UEL A;  5LNK A;  4YLH A;  3N9Q A;  5HXC A;  3MXZ A;  5JDH A;  1NAF A;  3RC8 A;  3FHN A;  2LEH A;  1QUU A;  3CWZ B;  2LHR A;  2JRK A;  3C4W A;  3PU3 A;  2J1D G;  3C51 A;  3ESL A;  3ETU A;  4EAH A;  5J2T E;  3C4X A;  2I59 A;  2X66 A;  2X51 A;  1MIV A;  5AFU L;  3IHR A;  2NTX A;  2V7J A;  4AQF A;  4EZ4 A;  2DHR A;  2X9X A;  2K5B B;  4JEH B;  3N2G E;  2PJQ A;  2C5K T;  2EHO A;  2XAJ B;  1FEW A;  3N9N A;  3NRY A;  2P9B A;  3TKL B;  3DTO A;  4JUY A;  3KV6 A;  2A3D A;  2X9H A;  5JRC A;  5JR9 B;  3RRC A;  2L3L A;  3Q9D A;  5JQG E;  5HXH A;  2BVM A;  2VB6 A;  3W15 B;  2LOS A;  2KND A;  1HFA A;  1LVK A;  1YW0 A;  5JDL A;  3QK6 A;  1HCI A;  1US7 B;  2ZLY A;  2DLR A;  4EXT A;  4HKA A;  5L3E B;  2C5J A;  5LHI B;  2EHO D;  2ES0 A;  3GA8 A;  2IC9 A;  2YIN A;  4I43 B;  5FP3 A;  3PTR B;  5JR9 A;  5JRC B;  4U74 A;  4I4T E;  4X1I E;  3CX7 B;  4O4I E;  4DND A;  5L3G B;  5HAX A;  3EUH A;  3LK4 2;  1BR0 A;  2HH7 A;  5L2L A;  3ZCI A;  5FY0 A;  1KK7 A;  3QUJ A;  1O3X A;  4GK5 E;  2D5U A;  4N78 D;  3VU7 H;  1D0Y A;  2V1D B;  2CXL A;  3J9X 1;  4ZI2 D;  3OBV E;  4WW0 A;  3RYI E;  4X20 E;  4XZC A;  4PK6 A;  3I0Q A;  5FXZ A;  1HG2 A;  4OK0 A;  4QKN A;  3HKC E;  2MYS A;  5EK4 A;  2XAS B;  1MNE A;  4H9R C;  4B6X A;  2XAF B;  3E22 E;  3OYZ A;  4PNI A;  2MOZ A;  3UUM A;  3P7I A;  1T98 A;  2K24 A;  4AXP A;  4H9S E;  3HKD E;  4DO0 A;  4CXW A;  4OYJ A;  4J2C A;  3V5U A;  2VKJ A;  5FY7 A;  1BR4 A;  2OA5 A;  3ZN0 B;  2CMR A;  2WMO A;  4L9I A;  2N1G A;  5HXR A;  1ZHC A;  3N9L A;  2ODV A;  4UF0 A;  1BR1 A;  1D1C A;  3L09 A;  3HI2 A;  3GN5 A;  5FXX A;  5FMN A;  1S35 A;  4PAG A;  2CLY C;  3PU8 A;  4ZI7 E;  3H3A A;  3KVB A;  4YFS A;  4U72 A;  3K3O A;  3KBT A;  2Y8D A;  5EZY E;  2VKD A;  2LJL A;  5JDG A;  4O2A E;  4OHF A;  3ZYM A;  3A5X A;  3LK3 B;  4ADZ A;  4QX7 B;  4F6R C;  2LSG A;  2XQY A;  3P8C D;  1HF8 A;  1ZV4 X;  1MMD A;  5LGN B;  4IHJ E;  2NOX A;  3R6N A;  4L0R A;  4CI2 B;  1X79 A;  1LKX A;  4YJ3 E;  4WBN E;  3FB2 A;  2ZM0 A;  4BJM A;  2E9X D;  4AKR B;  2ZMA A;  4ZS3 A;  4OFZ A;  4EYU A;  4PJN A;  5ETW A;  5C8Y E;  1MND A;  5BMV E;  2W00 A;  3I9Y A;  3VKH A;  1WR6 A;  3NZP A;  4H63 V;  3KIN B;  3JC6 C;  4UVC B;  1D0X A;  2IW5 B;  3SS1 A;  4TZ4 C;  4G2A A;  4HN9 A;  3LK2 B;  2HPJ A;  1MIW A;  4CQI A;  1YKH B;  4PK5 A;  2E8I A;  1LVF A;  3FBL A;  4QXH B;  3RPU A;  3ZLI A;  5H6Q B;  2XAQ B;  5JDM A;  3NRX A;  2VKO A;  3SWH A;  3WI3 A;  3ZC1 A;  4CXY A;  3I9W A;  2DI4 A;  3ZMZ B;  2YU1 A;  1B7T A;  5HXS A;  3UUN A;  2D2S A;  3RH3 A;  2V7L A;  4GYS A;  2LOP A;  2XAG B;  3IEE A;  4AKL A;  2WBL A;  3N2O A;  2LSJ A;  1KNZ A;  5ADX L;  1FMW A;  1MMG A;  1WRD A;  3DJB A;  2WM9 A;  4MFR A;  5L3B B;  5LXT E;  3L3P A;  2A2F X;  1UX4 A;  3CPZ A;  3M65 A;  3AA0 B;  3UTK A;  4PFO A;  4IE6 A;  4L5G A;  5LBM A;  3BQI A;  2H7O A;  1OXZ A;  4XAX B;  3GN5 B;  3ZYL A;  1IAP A;  2IAK A;  3KV9 A;  4UF0 B;  3WAK A;  4C90 A;  1ZEE A;  1OWA A;  4DBR A;  2JMH A;  4CI1 B;  3CX8 B;  5FNV E;  5HWY A;  5KMG P;  2LHN A;  3RRW A;  2JMK A;  3MAC A;  1QSD A;  2QA7 A;  3UUX B;  4ERR A;  2NW7 A;  1MMA A;  4X1K E;  5JVD E;  2XHE B;  1IJ5 A;  4HTE A;  4PJM A;  3NBX X;  3ZPO A;  4O4J E;  1Z0P A;  3O1H A;  2LM9 A;  4ZI3 C;  3LBX A;  5JR9 C;  3K3N A;  2H3R A;  3N5L A;  3UUL A;  3I0O A;  3VHL A;  3NZQ A;  3PUS A;  3QC9 A;  5HYA A;  2VL8 A;  3H37 A;  2C0S A;  1S94 A;  2EHO C;  4DBQ A;  1LRZ A;  1ZKE A;  3HL6 A;  2UXN B;  4HE8 A;  3N9O A;  4P09 A;  4BJN A;  2DNX A;  3OYX A;  2Q9Q D;  3WAJ A;  4ASK A;  1BR2 A;  1HS7 A;  5FXW A;  4AQF C;  4PJL A;  1VOM A;  2IC6 A;  1WLX A;  5M4Y A;  1U4Q A;  4XBF B;  2CM0 A;  2Y6X A;  4QXB B;  2C5I T;  4MLK A;  2X67 A;  4OYK A;  4IGU A;  2CCQ A;  4NUV A;  2KIN B;  4M1P A;  2DWK A;  5CA0 E;  4BAY B;  4ZI2 C;  5LHH B;  3BK9 A;  3RYC E;  3I1A A;  3PUG A;  5J1G A;  1IZN B;  1WYC A;  2VKH A;  4QX8 B;  5HWX A;  5LOV E;  1HTJ F;  2V7I A;  1UCU A;  2LSI A;  3ANW A;  3FXD B;  2W63 A;  4YJ2 E;  4MBQ A;  2NW8 A;  2H7V C;  3F57 A;  3IF8 B;  2PFV A;  3OKQ A;  3N9P A;  4FJO A;  3BQL A;  3ETV A;  3U3I A;  4HFV A;  3GMI A;  5DQW A;  4E7S A;  2DWG A;  5H6R B;  1D1B A;  5IHY A;  4GIW A;  2KXP B;  2EHO B;  1MIY A;  2KWH A;  2UXX B;  4IIJ E;  3T8O A;  2X9W A;  5L3F B;  5LYJ E;  5LG4 A;  3PUR A;  2G0U A;  1D0Z A;  3C98 B;  2MTQ A;  2YU2 A;  3PUQ A;  1UX5 A;  2L8K A;  3EVY A;  3ZMV B;  4CI3 B;  2X68 A;  5J2U E;  2CWY A;  1YD8 G;  4PK4 A;  2CA5 A;  3RKO A;  5GON E;  2JJ9 A;  3C4Z A;  2NTY A;  3ZJ1 A;  4E7Z A;  4KBM B;  3F2E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...