4JEUB

Crystal structure of munc18a and syntaxin1 with native n-terminus complex
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
242
structure length
225
Chain Sequence
KDRTQELRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Syntaxin-binding protein 1
publication title Syntaxin1a variants lacking an N-peptide or bearing the LE mutation bind to Munc18a in a closed conformation.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis/exocytosis
total genus 90
structure length 225
sequence length 242
ec nomenclature
pdb deposition date 2013-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00804 Syntaxin Syntaxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4jeuB00
5M4YA 2XHEB 4JEHB 1EZ3A 1S94A 1FEWA 3LG7A 1G73A 4JEUB 5LG4A 2DNXA 1BR0A 1FIOA 3C98B 4TX5A 1HS7A
chains in the Genus database with same CATH superfamily
4P0BA 3LDQB 4B3RT 4AQFC 3FBLA 3SS1A 3ZYKA 4I43B 1ZHCA 4YXDA 2BS2A 4EB6E 4DV7T 3PE0A 4OK0A 4XAXB 3JAEA 3CX6B 2B76A 2NW7A 2Q9QB 2B1EA 3NRXA 3K3NA 2VWAA 2Y6XA 3FZKB 4EIWA 1YKEB 1J1JA 2UXBT 5AQNB 1HS7A 3CX7B 3PUQA 1MIVA 1G73A 3O9XA 4ILAA 5FL1A 2JIWA 3UULA 4UF0A 2VB6A 4QH4A 2PG8A 4C90A 4K0KT 4IREA 4H9PC 5AQRB 3B13A 1GQEA 4N78D 3L3PA 5JDFA 2BG9A 4QKNA 3T1YT 2XSBA 3AECA 2LSGA 3G06A 1XMOT 4PJLA 3GWHA 3ZN1B 5LB7B 5EK3A 3J7Yq 4TZ4C 4IDNA 1YQ4A 2FJAA 1X79A 1I6ZA 2BVLA 2JMHA 2A2FX 3GN5A 4O8SA 1H7CA 3QC9A 3JAFA 2DI4A 1SE7A 3F2EA 1YW0A 5FYMA 4UVAB 5FP3A 2XAJB 2VKOA 4AQGA 4IDPA 4P09A 5AQTB 3L09A 1VOMA 3U3IA 1IBLT 4A5XA 4ZS2A 4YLHA 1WCRA 4PFOA 2W2UA 4LF7T 5JR9C 2R6GF 3IHRA 2ZLYA 3GMIA 4HFCA 1FJGT 3BQLA 4QWNB 3SFDA 2WDRA 4GIWA 4MFRA 1HTJF 4ERRA 4EZHA 5JQGE 3P50A 4DR7T 4HWCA 2K3WA 2BBJA 3N9PA 2IW5B 3ZSTA 4LFCT 3AEBA 1WRDA 5AQKB 5FXVA 4CI2B 5HEHA 1BR0A 1MNEA 4DVDA 3BK9A 4AKHA 3AE9A 1D1BA 4PJNA 4HFIA 2UUBT 3ZMVB 4EEDA 4QXHB 3AAIA 2X9XA 1UX4A 4MLKA 4PFPA 3ZT5A 1V9DA 4JI5T 4ISSA 4AI6A 2XQ6A 3EAMA 1N32T 4K0UA 4UF0B 3UU5A 2N9DA 4ZZCA 4NPPA 1UUSA 4DBQA 1MMDA 3HKCE 2NOXA 2J4GA 5FKYA 2JQKA 5ABHA 4YSXA 2YDRA 1ZEEA 2BG9B 5HWXA 2MAWA 3LK2B 4GK0E 2FUPA 3HKEE 4TN7B 3KFWX 2CWYA 2CBIA 1VRBA 4KI0F 2LHRA 1XZYA 5LXTE 2PBIA 5HEUA 2J1DG 2XQAA 4PK5A 2E9XC 2A9UA 3RQWA 2E5VA 3KVBA 2ZM6T 2HH7A 2JQHA 2H7OA 2LSJA 3GN5B 3QK6A 2WCAA 4IT4A 3SRZA 3N2OA 2V5DA 3CPZA 2XZEA 3TLTA 2V7IA 1HR0T 2X9HA 2XM2A 4LF9T 3PUAA 2MYSA 1N33T 5C2TA 3HI2A 5A1LA 5LG3A 4I50E 2V7LA 1W9RA 2YKSA 3BQKA 4OYJA 1M7KA 2X68A 3I9YA 2KZ7B 2V5CA 4X62T 4BJMA 3WAJA 2I0MA 2YDSA 4UIGA 5ADXL 5HEJA 4MHCA 2E2AA 3ONXA 3ANWA 4H9RC 3AE3A 3H3AA 5LYJE 5HXHA 2WM9A 3PUVF 2KWIB 5IHYA 3NWIA 4X64T 4HKAA 3T8OA 3C4ZA 4ZEYA 3AA1B 3AVRA 2LKGA 2HN2A 4LF8T 3ZMZB 3O1IA 2BS4A 5L3CB 3LG7A 3MK7C 4EGWA 2DHRA 4EYUA 2D2SA 1LKXA 5EK4A 4QX8B 3UFEA 3LJCA 5KMGP 3AXJA 5FNVE 1KNZA 1D0XA 1HNZT 3ZC0A 3LBXA 3N9NA 1MMAA 4DV4T 1IBMT 1FMVA 3CKDA 3PUGA 3TKLB 3QB5A 4IHJE 2BS3A 2ZM0A 1FIOA 2IAKA 4PK4A 3C64A 4X1YE 2WU2A 4L0RA 4IIJE 3T1HT 1U5PA 4EV6A 4DV1T 5F3JA 5AQMB 3S4UA 2D9DA 2V26A 4KHPT 1BR1A 4DR3T 3AEAA 2DWGA 2NW9A 2YU1A 2V7MA 4JV5T 2EHOD 1Y64B 4HFEA 2QGSA 4DV0T 2BZBA 1KNRA 5FXXA 3FZMB 2EHOA 1ZP0A 1S35A 3RX6A 4DNDA 1QUUA 5ABFA 4JEHB 5LBMA 4A98A 1X9BA 1Z8UA 5AQFB 2CXLA 1B7TA 2Y8DA 3EVYA 4DUZT 1IAPA 5FXWA 4DR6T 3ZSSA 2UXCT 3OYXA 4O2BE 2KWHA 1W09A 3Q5WA 3ZYMA 4AXPA 4H9NC 3RPUA 3B57A 1T7SA 3HKBE 2ZM8A 4PAGA 3AA6B 2W66A 3V5SA 1J5ET 2LRKA 4KP3C 4ZI3C 3UTKA 2WAUA 3N9OA 2Y48B 3ANWB 4U31A 3CWZB 4JI4T 2XM1A 4XBFB 2X51A 3PJAJ 4WZXA 4O4IE 4H9OC 4B3ST 3EUHA 2LJLA 2BKOA 5J1GA 3IEEA 2LLYA 4DV6T 4JI7T 2KMFA 3ZJ1A 5LMUT 4ILUA 4IDZA 4DR4T 2D0TA 2CXFA 3CIRA 2M67A 4YT0A 4AKRB 4JI6T 2LKHA 4ISTA 5CA0E 2XTLA 3A5XA 3QOFA 2H89A 3UU4A 2WP9A 1MIYA 5LHGB 3AE4A 5CFBA 5F5WA 2CRBA 3PUXF 1D1CA 4JI8T 4DBRA 1S94A 3AXJB 1HG2A 4ZS3A 4JLEA 2QRXA 2WB5A 3LBXB 2VQET 3ETVA 3IA3A 3JADA 3IBPA 3UUBA 3CX8B 4CI3B 4DIDB 5LGTB 1XDOA 2XQ9A 4B3TT 2XQ7A 3AB3B 2KINB 2AE9A 4OX9T 1XWMA 4HEAA 4IE6A 2J62A 4P1NA 2N2NA 5JRCA 2WU5A 4U3CA 1KFYA 2XUEA 2C0SA 2XHEB 3EI0A 4AKLA 3FB2A 4HWIB 5M4YA 4QX7B 4CQIA 2VKDA 4HN9A 4U7IA 5CB4E 1LVFA 3FXDB 4U74A 3DJBA 3KV5A 3RGLA 2UU9T 4LMJA 2CCQA 5DQWA 2EHOB 4CXWA 3KV6A 1HX8A 3RF1A 5AQGB 2CBJA 3RH3A 5ABFB 4IL4A 5KDMC 2VURA 3SWHA 2VVSA 4HFVA 4H9QC 3P4RA 3ZCIA 3ZKRA 3KV9A 4FI5A 3FZLB 5FL0A 3O1JA 3JCFA 3Q5EA 1MMGA 3QUJA 2J47A 2M6IA 2UUCT 3EDUA 2V8SV 2X0HA 3PJAA 5HCMA 3VKHA 3CMLA 1NAFA 5ABEA 1MNDA 2BVMA 2JQ9A 4ILCA 5LA6E 3UUMA 5LJMA 2IDOB 2LM9A 3ZLIA 4YJ3E 1JNZA 3ZC1A 2DL1A 5FMNA 1BR4A 3ZT6A 2L9QA 4LFBT 2K5BB 4IE0A 3RC3A 2WWVA 3AEGA 5L2LA 2CHNA 2VASA 3ZJ2A 2CWOA 3CQXC 5JREA 2C5JA 3MACA 2K48A 4H63V 3VR9A 3OPCA 1M62A 5KX5E 3RYCE 2A3DA 4CN6A 3LSVA 5JTGA 3RQUA 1OEDC 1YXRA 3RKGA 2XQYA 3FHNA 3P7IA 1ZOYA 3E08A 4X65T 1YQ3A 4DUYT 2UXNB 3WI3A 5LGNB 4AIUA 3R6NA 2XJ7A 3EHZA 2LSKA 4LMLA 3H3MA 4UXNB 2WWUA 3P8CD 5L3EB 3UU3A 2BKNA 5L3FB 3AAAB 3I9WA 3HL6A 4I0UA 2H88A 5IYZE 4DR1T 1XDPA 2ACXA 1DU2A 5KXJA 1E1HB 2N1GA 4QH5A 1J5WA 2ZM2A 5JRCB 3B5MA 3RIUC 4ANJA 2XQ8A 2VQFT 4IE7A 3KBUA 4HGAA 2E9XD 1T8BA 3NZPA 4LMKA 1L0VA 4E7ZA 2WZIA 1CHUA 4GYRA 1UURA 3C51A 5LJNA 4OHFA 2RPAA 2E9XA 2NW8A 1XNRT 4UVBB 4PK6A 4CN4A 5H6RB 5JDLA 2WDVA 4QHOA 4EEBA 5JDHA 4YY3T 2DWKA 2HHHT 4NUVA 2JQQA 5AQIB 3K8PC 3OKQA 4MBQA 3PDYA 4HFDA 4PJJA 4NXMT 4EXTA 1XNQT 1SUMB 2KLQA 3NZQA 2LRLA 2MPKA 4G2AA 3KBTA 3EABA 3VRAA 4A56A 3AE1A 4LFAT 2I59A 3CQCB 5CA1E 4UR9A 3FZFB 2CLYC 5AQLB 4CXXA 3O1HA 2IUBA 2VL8A 4HWHA 2WZHA 4OFZA 3PV0F 5DJQC 2YINA 3NBXX 5DQVA 3C4XA 4M1PA 4YTMA 4PJMA 2X0LB 2X66A 1JNRA 4TWDA 4EAHA 1FMWA 1UX5A 3UU6A 3ABVA 3I0OA 3RYHE 1ZV4X 4TUYE 5FY7A 2CA5A 3IF8B 4F6RC 2CPTA 3N2KE 3K3OA 4JBWF 4U2YA 1I94T 4L5GA 4C91A 3DTOA 2ES0A 2X0YA 1NWMX 3CQGB 4P0AA 4BAYB 4AISA 3AA7B 5HXEA 2SPCA 2XPKA 1UK5A 4YTNA 4G63A 1W0BA 5FY1A 4HE8A 2NWBA 4HFBA 2Q9QC 4QH1A 3Q2MA 1AJ3A 4WNKA 3BQIA 2WQYA 5C3JA 2VL0A 2UXDT 3PUZF 2XAFB 1HNWT 1OEDE 2JMKA 2V1DB 5JDGA 5LNKA 5FY0A 5AQOB 1WR6A 2BBHA 4YJ2E 3MJXA 3ZYLA 5BMVE 2P9BA 2XY8B 2LT3A 5JDQA 5HXRA 3K3QC 2W4XA 4NIQA 5HEOA 2H3RA 2VKHA 2GK9A 3Q9DA 4UEMA 3F57A 3RYFE 5HWYA 1BR2A 4Q25A 3VHLA 3RYIE 1N36T 1LVKA 3E0ZA 2LOPA 5L47A 3HR0A 3UUNA 4ZI3D 4J2CA 3SOLA 4YFSA 5FXZA 1R8IA 4WYVA 2PTFA 4H63H 3N9MA 3CK6A 3P4WA 1N34T 3ETUA 2YN6A 4QXBB 5HEGA 4O2AE 2FJEA 2WMNA 2V6XA 2W67A 3UT5E 4TNVA 5E0OA 1KF6A 3AVSA 1WLXA 5HYAA 4U72A 4O4LE 2LE8A 4AQFA 4DMVA 4HTEA 4YHJA 3AE8A 2QA7A 1WYBA 2DNXA 4GOUA 5LCYA 1E2AA 3P4QA 5LG4A 3ESLA 1IJ6A 1VCTA 3KDSE 4IE5A 3PUSA 3FXEB 4KBMB 5ABGA 4TWHA 3JC6C 1OXZA 4COFA 3FZHB 4GKKT 4HWFA 5AQJB 4X66T 4UELA 2WS3A 3MKDA 2NTYA 4BA9A 2MBGA 3PUYF 1ZKEA 4UV8B 3RI5A 1Z0PA 3HA4A 5JVDE 1IJ5A 4TV8E 2PJQA 3L39A 2LM2A 4OYKA 3EDVA 3FBZA 1Y01A 3UU8A 4YSZA 4GYSA 4L9IA 5BR8T 5HXCA 3LK42 5AQSB 4DV5T 1HX1B 1LRZA 2C5KT 4U2ZA 4JUYA 3RIFA 4WW0A 1HF8A 4DV3T 4ILBA 5ETWA 3H37A 3UFGA 3F31A 3ZCJA 2UXXB 1WFDA 4TWFA 3GA8A 4ZZBA 1UCUA 3MXZA 3ZMUB 1NENA 1MIWA 2XSAA 2DLRA 2WMOA 2JRKA 2VKJA 4ZHQE 4ZI7E 5HAXA 2FJBA 2BG9C 3TLVA 3TLUA 3N2GE 3U78A 5DABA 4XZCA 3NVOA 3P4SA 5AQVB 4AQYT 1YKHB 3PUWF 3RC8A 1IZNB 4DO0A 2XAQB 2YK0A 4I55E 4KHZF 2IIUA 5AFUL 3PURA 5LGUB 2XQ3A 4YSYA 1CUNA 5JR9A 2UUAT 4JEUB 2XAHB 2ODUA 4Z91A 3LK3B 2WSSV 1HG5A 2NR4A 3RLFF 4IL9A 5LP6E 3J9X1 2AXDS 2HN1A 2OLTA 5IWAT 5LMNT 3HKDE 2I6HA 3P4PA 5LBQB 2E5LT 4X1IE 2IC6A 4PW8A 1FEWA 2NTXA 3MZKB 1KNPA 4X1KE 1OEDA 2OV9A 3E22E 3L8RA 4DV2T 5H6QB 1U4QA 2VVNA 4HFHA 2M6BA 2KNDA 3ONJA 3AEDA 5HCJA 4IDOA 4GKJT 2KSRA 3N9LA 3UUXB 4NXNT 1G8XA 3ZT7A 4UVCB 4PNIA 2L8KA 2L3LA 2G0UA 5LHHB 5J2UE 4QXCB 3A7MA 1MMNA 2LEHA 2RA1A 3AA0B 4AKIA 5L4HA 2H7VC 2PFVA 4UV9B 2KXPB 3OJAA 5L3GB 2OA5A 3I0QA 2CEAA 2IHR1 3RIUA 4CXYA 2HPLA 2V7JA 3QB5K 4CZZB 3PU8A 5EZYE 1VCSA 5FVLA 3Q5DA 4Z90A 2YU2A 2JJ9A 4DR5T 3ZEFB 1HFAA 1OWAA 4JI0T 3OTOT 1O3XA 4O4HE 4EYYR 4JI3T 3AE5A 5GONE 5AQQB 3NRYA 3KVAA 3OBVE 1YD8G 3W15B 2LHNA 4GK5E 2IMLA 5J0ZA 3N9QA 4DMWA 2D5UA 4EOZB 3PTRB 5JDMA 3AAEB 4IDQA 4TX5A 4ZOLE 3AEEA 3ZMSB 1IBKT 2X67A 2MOZA 1E7PA 1EZ3A 4HWDA 2K9AA 5CGMA 2A72A 2YEVC 5JR9B 4IE4A 3UQ7A 4ASKA 3D0TA 2KT9A 3X1DA 3TLSA 4LF4T 4A97A 2V6YA 3C98B 2W0GA 4JYAT 4YHHT 2CE7A 3KV4A 4U33A 2F4VT 1NEKA 5AQHB 5AQPB 3VKGA 2BG9E 4KUMB 2FJDA 3RRWA 2W61A 3MA9A 4I4TE 1D0YA 3WAKA 4LF5T 3C50A 3SFEA 5EK2A 3AEFA 5J2TE 2YDQA 3VU7H 2ODVA 5CJ5A 4H9SE 5AQUB 2V7KA 2FBWA 2W62A 3LFMA 1OEDB 5LOVE 1SA0E 3I1AA 3AE2A 5FVKA 2ACZA 2K24A 2LOSA 2ZMAA 4WBOA 3ONLC 3Q5XA 3VRBA 4BJNA 2CHOA 3A8YC 2XAGB 2Z6EA 2WY2A 2XQ4A 5L3BB 4MALA 1D0ZA 4YTPA 2RP4A 2Q9QD 3RKOA 4IGUA 4X20E 4B3MT 2QVAA 4KX6A 4ADZA 2VK9A 2Q9QA 3AE7A 2HPJA 3PU3A 5IUXA 4ZI2D 2JPFA 4E7SA 2CXDA 1WR0A 2LSIA 1T72A 2IC9A 4Z8XA 3O4XE 3N5LA 4F8HA 2X9YA 2E9XB 4ZI2C 1KEYA 5LHIB 4U7YA 3UQ4A 2YOEA 3RRCA 3ZN0B 4O4JE 3NKZA 4CI1B 3ZMTB 2WBLA 4TV9E 1T98A 3OYZA 3AE6A 2LSYA 4ZXLA 3RHWA 2BDEA 2C5IT 2MTQA 4KMCA 2QYWA 2DCFA 2E8IA 3VR8A 1SHZC 2D0UA 4JI1T 3M3ZB 4WBNE 3RIAA 2NP9A 1W0AA 2XASB 4JI2T 2EHOC 4AKGA 3R84B 2CLYB 1HCIA 4NUUA 4B6XA 2BKPA 4LF6T 2WDQA 3OVUA 3DP7A 2W00A 4FJOA 5JDNA 2V6YB 1US7B 3ZPOA 4V1Av 1QLBA 2CM0A 4TNWA 3TLWA 5L4EA 1XMQT 5F8PA 1D1AA 1KK7A 1HNXT 2W63A 4X5TA 2XQ5A 3M65A 3K1SA 5L3DB 1WYCA 3C4WA 3CVRA 1QSDA 3JC6D 2X9WA 5JH7E 5TAOA 3KINB 3V5UA 5C8YE 2CMRA 4EZ4A 4CN1A 3QNUA 4DR2T 1UGOA 5HXSA
chains in the Genus database with same CATH topology
1CUNA 4PK6A 5JR9A 3CKDA 4P0BA 5H6RB 5JDLA 4JEUB 3PUGA 4QHOA 3TKLB 5JDHA 2XAHB 2ODUA 4AQFC 2DWKA 4IHJE 3FBLA 3LK3B 2WSSV 1HG5A 2ZM0A 1FIOA 3SS1A 3ZYKA 5LP6E 4NUVA 2IAKA 4I43B 2JQQA 1ZHCA 3C64A 4PK4A 4X1YE 3K8PC 4EB6E 3OKQA 3J9X1 4MBQA 4L0RA 4IIJE 3PE0A 4OK0A 3PDYA 1U5PA 4XAXB 4PJJA 3HKDE 3CX6B 5F3JA 2NW7A 4EXTA 5LBQB 3S4UA 2Q9QB 2B1EA 2V26A 4X1IE 3NRXA 1BR1A 2IC6A 4PW8A 1FEWA 2KLQA 2NTXA 3MZKB 3NZQA 3K3NA 2VWAA 2Y6XA 4G2AA 4X1KE 2DWGA 3E22E 2NW9A 2YU1A 3KBTA 2V7MA 4EIWA 2EHOD 4A56A 1Y64B 1YKEB 1HS7A 3CX7B 3PUQA 2I59A 1MIVA 3CQCB 5H6QB 1U4QA 1G73A 2QGSA 3O9XA 5CA1E 2KNDA 2BZBA 2CLYC 5FXXA 3UULA 4CXXA 4UF0A 2EHOA 3N9LA 2VB6A 3UUXB 3O1HA 1G8XA 1S35A 3RX6A 4DNDA 2VL8A 1QUUA 2PG8A 4UVCB 4PNIA 4JEHB 4OFZA 4C90A 5DJQC 2L8KA 2YINA 3NBXX 2L3LA 4H9PC 5LBMA 5DQVA 2CXLA 1B7TA 3C4XA 3B13A 2G0UA 2Y8DA 4M1PA 3L3PA 4N78D 4QXCB 3EVYA 5J2UE 5LHHB 5JDFA 1MMNA 4PJMA 4QKNA 2LEHA 1IAPA 5FXWA 2RA1A 3AA0B 4AKIA 3OYXA 2X0LB 4O2BE 2H7VC 2KWHA 2X66A 2PFVA 4UV9B 3Q5WA 2KXPB 3OJAA 4EAHA 5L3GB 2OA5A 1FMWA 1UX5A 3I0QA 3ZYMA 4AXPA 4H9NC 2CEAA 3B57A 3RPUA 4CXYA 3HKBE 2LSGA 2HPLA 2ZM8A 3AA6B 3I0OA 4PAGA 2V7JA 3V5SA 4PJLA 3GWHA 3RYHE 4KP3C 1ZV4X 4TUYE 4CZZB 3PU8A 3ZN1B 5EZYE 4ZI3C 3UTKA 2WAUA 3N9OA 5FY7A 5EK3A 3J7Yq 2Y48B 2CA5A 4TZ4C 3ANWB 3CWZB 3IF8B 4F6RC 1X79A 3N2KE 3K3OA 2BVLA 2JMHA 4L5GA 4C91A 4XBFB 2A2FX 2X51A 2YU2A 2JJ9A 3DTOA 3GN5A 4O4IE 1HFAA 3ZEFB 4O8SA 1OWAA 2ES0A 1H7CA 3CQGB 1NWMX 4P0AA 1O3XA 3QC9A 4H9OC 3EUHA 4O4HE 4EYYR 4BAYB 2LJLA 2DI4A 3AA7B 5HXEA 2SPCA 3F2EA 5GONE 5J1GA 3IEEA 1YW0A 3NRYA 3KVAA 3OBVE 2KMFA 1YD8G 3ZJ1A 5FYMA 3W15B 4G63A 2LHNA 4GK5E 4ILUA 4IDZA 4UVAB 5FP3A 2XAJB 2VKOA 4AQGA 2D0TA 4HE8A 3L09A 2CXFA 3N9QA 2M67A 4P09A 5FY1A 4AKRB 4ISTA 2NWBA 5CA0E 1VOMA 3U3IA 2Q9QC 2XTLA 4DMWA 2D5UA 3Q2MA 3A5XA 4EOZB 3PTRB 4ZS2A 4YLHA 1AJ3A 4PFOA 4WNKA 5JDMA 3AAEB 3BQIA 1MIYA 5LHGB 4TX5A 5JR9C 1D1CA 2XAFB 4ZOLE 4DBRA 2JMKA 1S94A 2V1DB 3IHRA 2X67A 3ZMSB 2MOZA 2ZLYA 5JDGA 1HG2A 5LNKA 5FY0A 4ZS3A 4JLEA 1EZ3A 3GMIA 3BQLA 4QWNB 1WR6A 4YJ2E 2K9AA 4GIWA 4MFRA 3LBXB 3MJXA 3ETVA 3ZYLA 1HTJF 3IBPA 4ERRA 2A72A 5BMVE 4EZHA 2YEVC 5JQGE 5JR9B 4IE4A 3CX8B 2P9BA 4ASKA 4CI3B 2LT3A 5JDQA 5HXRA 3K3QC 3N9PA 3D0TA 2KT9A 2IW5B 5LGTB 1WRDA 5FXVA 2H3RA 4CI2B 3C98B 2W0GA 2VKHA 2GK9A 3AB3B 2CE7A 2KINB 3KV4A 3Q9DA 1BR0A 4HEAA 4UEMA 4IE6A 3F57A 3RYFE 3VKGA 4KUMB 3RRWA 2N2NA 1MNEA 5HWYA 1BR2A 5JRCA 4DVDA 2XUEA 2C0SA 3BK9A 3VHLA 4AKHA 3RYIE 2W61A 1D1BA 2XHEB 3MA9A 1LVKA 3E0ZA 4I4TE 4PJNA 4AKLA 2LOPA 3HR0A 3FB2A 1D0YA 3WAKA 5M4YA 3UUNA 4ZI3D 3C50A 5EK2A 4J2CA 3SOLA 5J2TE 3ZMVB 3VU7H 2ODVA 4QX7B 4YFSA 4H9SE 4QXHB 2V7KA 2W62A 3LFMA 4CQIA 5FXZA 3AAIA 4H63H 3N9MA 2VKDA 4HN9A 5LOVE 1SA0E 3I1AA 2X9XA 1UX4A 4MLKA 3ETUA 4PFPA 5CB4E 2K24A 1LVFA 2LOSA 1V9DA 3FXDB 4QXBB 4U74A 2ZMAA 4WBOA 4ISSA 3DJBA 4AI6A 3KV5A 4O2AE 2WMNA 2CCQA 5DQWA 3Q5XA 4K0UA 4UF0B 2EHOB 3UT5E 4BJNA 4CXWA 3KV6A 2N9DA 1HX8A 5E0OA 2XAGB 2Z6EA 4DBQA 1MMDA 3AVSA 3RH3A 4MALA 1D0ZA 1WLXA 5L3BB 3HKCE 5KDMC 2NOXA 3SWHA 2RP4A 2Q9QD 5HYAA 4U72A 4HFVA 4H9QC 4O4LE 2LE8A 3RKOA 3ZCIA 1ZEEA 4IGUA 4X20E 4AQFA 4DMVA 4HTEA 4YHJA 3KV9A 4ADZA 5HWXA 4FI5A 2VK9A 3LK2B 4GK0E 2QA7A 3O1JA 2Q9QA 1WYBA 1MMGA 3QUJA 3HKEE 3EDUA 4TN7B 3KFWX 2HPJA 2CWYA 2DNXA 4GOUA 5LCYA 3PU3A 3VKHA 1VRBA 5LG4A 2LHRA 5LXTE 3CMLA 3ESLA 1NAFA 1IJ6A 4ZI2D 2JPFA 1MNDA 2PBIA 3KDSE 4IE5A 4E7SA 2J1DG 2BVMA 4PK5A 5LA6E 3PUSA 2E9XC 2CXDA 3FXEB 3UUMA 4KBMB 5LJMA 2LM9A 2LSIA 3KVBA 3JC6C 3ZLIA 1OXZA 2HH7A 4YJ3E 3ZC1A 2H7OA 5FMNA 2LSJA 4UELA 3GN5B 3QK6A 1BR4A 3SRZA 2IC9A 4Z8XA 2L9QA 3MKDA 3N2OA 3CPZA 3O4XE 2K5BB 2NTYA 3N5LA 4BA9A 4IE0A 2MBGA 2X9YA 2E9XB 4ZI2C 3RC3A 1ZKEA 5LHIB 2V7IA 2X9HA 5L2LA 2VASA 4UV8B 3ZJ2A 2CWOA 3CQXC 5JREA 2C5JA 3PUAA 3RRCA 1Z0PA 3MACA 3HA4A 2MYSA 2K48A 3ZN0B 4O4JE 5JVDE 1IJ5A 4CI1B 3HI2A 4H63V 4TV8E 2PJQA 5A1LA 3ZMTB 2WBLA 4I50E 4TV9E 5KX5E 1T98A 2V7LA 3RYCE 2A3DA 3OYZA 4OYKA 2LSYA 3BQKA 4OYJA 2X68A 3EDVA 3FBZA 2BDEA 3I9YA 2KZ7B 4BJMA 4GYSA 2XQYA 3FHNA 4L9IA 3P7IA 2C5IT 3WAJA 2MTQA 3E08A 4KMCA 5HXCA 4UIGA 2DCFA 2E8IA 3LK42 5ADXL 1SHZC 2UXNB 3WI3A 4MHCA 3ONXA 1LRZA 2D0UA 5LGNB 3ANWA 2C5KT 3R6NA 4JUYA 4H9RC 4WW0A 1HF8A 3H3AA 5LYJE 4WBNE 5HXHA 2NP9A 2WM9A 5ETWA 2XASB 2KWIB 2EHOC 5IHYA 4AKGA 3H37A 2LSKA 3F31A 4HKAA 4UXNB 3ZCJA 3R84B 2UXXB 2WWUA 3P8CD 5L3EB 3GA8A 2CLYB 1HCIA 4NUUA 5L3FB 4B6XA 1UCUA 3MXZA 3AAAB 3ZMUB 3I9WA 3HL6A 3C4ZA 3T8OA 5IYZE 1MIWA 3DP7A 2W00A 2DLRA 3AA1B 2WMOA 3AVRA 2ACXA 4FJOA 5JDNA 2JRKA 2VKJA 4ZHQE 4ZI7E 1E1HB 1US7B 5HAXA 3ZMZB 3ZPOA 4V1Av 3O1IA 2CM0A 5L3CB 3LG7A 2N1GA 5F8PA 1D1AA 1KK7A 3MK7C 2DHRA 2ZM2A 4EYUA 5JRCB 3N2GE 3U78A 5DABA 4XZCA 2D2SA 4ANJA 1LKXA 4IE7A 2W63A 5EK4A 4QX8B 3M65A 3KBUA 5L3DB 1YKHB 3UFEA 1WYCA 3C4WA 4HGAA 2E9XD 3RC8A 1IZNB 3CVRA 3LJCA 1QSDA 5KMGP 5FNVE 3NZPA 1KNZA 4DO0A 2XAQB 3JC6D 2X9WA 4E7ZA 1D0XA 2YK0A 5JH7E 5TAOA 4I55E 4GYRA 3ZC0A 3KINB 3V5UA 3C51A 5AFUL 5LJNA 4OHFA 3PURA 5LGUB 3LBXA 3N9NA 1MMAA 2E9XA 2CMRA 4EZ4A 5C8YE 2NW8A 1FMVA 4UVBB 5HXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M4Y A;  2XHE B;  4JEH B;  1EZ3 A;  1S94 A;  1FEW A;  3LG7 A;  1G73 A;  4JEU B;  5LG4 A;  2DNX A;  1BR0 A;  1FIO A;  3C98 B;  4TX5 A;  1HS7 A; 
#chains in the Genus database with same CATH topology
 4P0B A;  3LDQ B;  4B3R T;  4AQF C;  3FBL A;  3SS1 A;  3ZYK A;  4I43 B;  1ZHC A;  4YXD A;  2BS2 A;  4EB6 E;  4DV7 T;  3PE0 A;  4OK0 A;  4XAX B;  3JAE A;  3CX6 B;  2B76 A;  2NW7 A;  2Q9Q B;  2B1E A;  3NRX A;  3K3N A;  2VWA A;  2Y6X A;  3FZK B;  4EIW A;  1YKE B;  1J1J A;  2UXB T;  5AQN B;  1HS7 A;  3CX7 B;  3PUQ A;  1MIV A;  1G73 A;  3O9X A;  4ILA A;  5FL1 A;  2JIW A;  3UUL A;  4UF0 A;  2VB6 A;  4QH4 A;  2PG8 A;  4C90 A;  4K0K T;  4IRE A;  4H9P C;  5AQR B;  3B13 A;  1GQE A;  4N78 D;  3L3P A;  5JDF A;  2BG9 A;  4QKN A;  3T1Y T;  2XSB A;  3AEC A;  2LSG A;  3G06 A;  1XMO T;  4PJL A;  3GWH A;  3ZN1 B;  5LB7 B;  5EK3 A;  3J7Y q;  4TZ4 C;  4IDN A;  1YQ4 A;  2FJA A;  1X79 A;  1I6Z A;  2BVL A;  2JMH A;  2A2F X;  3GN5 A;  4O8S A;  1H7C A;  3QC9 A;  3JAF A;  2DI4 A;  1SE7 A;  3F2E A;  1YW0 A;  5FYM A;  4UVA B;  5FP3 A;  2XAJ B;  2VKO A;  4AQG A;  4IDP A;  4P09 A;  5AQT B;  3L09 A;  1VOM A;  3U3I A;  1IBL T;  4A5X A;  4ZS2 A;  4YLH A;  1WCR A;  4PFO A;  2W2U A;  4LF7 T;  5JR9 C;  2R6G F;  3IHR A;  2ZLY A;  3GMI A;  4HFC A;  1FJG T;  3BQL A;  4QWN B;  3SFD A;  2WDR A;  4GIW A;  4MFR A;  1HTJ F;  4ERR A;  4EZH A;  5JQG E;  3P50 A;  4DR7 T;  4HWC A;  2K3W A;  2BBJ A;  3N9P A;  2IW5 B;  3ZST A;  4LFC T;  3AEB A;  1WRD A;  5AQK B;  5FXV A;  4CI2 B;  5HEH A;  1BR0 A;  1MNE A;  4DVD A;  3BK9 A;  4AKH A;  3AE9 A;  1D1B A;  4PJN A;  4HFI A;  2UUB T;  3ZMV B;  4EED A;  4QXH B;  3AAI A;  2X9X A;  1UX4 A;  4MLK A;  4PFP A;  3ZT5 A;  1V9D A;  4JI5 T;  4ISS A;  4AI6 A;  2XQ6 A;  3EAM A;  1N32 T;  4K0U A;  4UF0 B;  3UU5 A;  2N9D A;  4ZZC A;  4NPP A;  1UUS A;  4DBQ A;  1MMD A;  3HKC E;  2NOX A;  2J4G A;  5FKY A;  2JQK A;  5ABH A;  4YSX A;  2YDR A;  1ZEE A;  2BG9 B;  5HWX A;  2MAW A;  3LK2 B;  4GK0 E;  2FUP A;  3HKE E;  4TN7 B;  3KFW X;  2CWY A;  2CBI A;  1VRB A;  4KI0 F;  2LHR A;  1XZY A;  5LXT E;  2PBI A;  5HEU A;  2J1D G;  2XQA A;  4PK5 A;  2E9X C;  2A9U A;  3RQW A;  2E5V A;  3KVB A;  2ZM6 T;  2HH7 A;  2JQH A;  2H7O A;  2LSJ A;  3GN5 B;  3QK6 A;  2WCA A;  4IT4 A;  3SRZ A;  3N2O A;  2V5D A;  3CPZ A;  2XZE A;  3TLT A;  2V7I A;  1HR0 T;  2X9H A;  2XM2 A;  4LF9 T;  3PUA A;  2MYS A;  1N33 T;  5C2T A;  3HI2 A;  5A1L A;  5LG3 A;  4I50 E;  2V7L A;  1W9R A;  2YKS A;  3BQK A;  4OYJ A;  1M7K A;  2X68 A;  3I9Y A;  2KZ7 B;  2V5C A;  4X62 T;  4BJM A;  3WAJ A;  2I0M A;  2YDS A;  4UIG A;  5ADX L;  5HEJ A;  4MHC A;  2E2A A;  3ONX A;  3ANW A;  4H9R C;  3AE3 A;  3H3A A;  5LYJ E;  5HXH A;  2WM9 A;  3PUV F;  2KWI B;  5IHY A;  3NWI A;  4X64 T;  4HKA A;  3T8O A;  3C4Z A;  4ZEY A;  3AA1 B;  3AVR A;  2LKG A;  2HN2 A;  4LF8 T;  3ZMZ B;  3O1I A;  2BS4 A;  5L3C B;  3LG7 A;  3MK7 C;  4EGW A;  2DHR A;  4EYU A;  2D2S A;  1LKX A;  5EK4 A;  4QX8 B;  3UFE A;  3LJC A;  5KMG P;  3AXJ A;  5FNV E;  1KNZ A;  1D0X A;  1HNZ T;  3ZC0 A;  3LBX A;  3N9N A;  1MMA A;  4DV4 T;  1IBM T;  1FMV A;  3CKD A;  3PUG A;  3TKL B;  3QB5 A;  4IHJ E;  2BS3 A;  2ZM0 A;  1FIO A;  2IAK A;  4PK4 A;  3C64 A;  4X1Y E;  2WU2 A;  4L0R A;  4IIJ E;  3T1H T;  1U5P A;  4EV6 A;  4DV1 T;  5F3J A;  5AQM B;  3S4U A;  2D9D A;  2V26 A;  4KHP T;  1BR1 A;  4DR3 T;  3AEA A;  2DWG A;  2NW9 A;  2YU1 A;  2V7M A;  4JV5 T;  2EHO D;  1Y64 B;  4HFE A;  2QGS A;  4DV0 T;  2BZB A;  1KNR A;  5FXX A;  3FZM B;  2EHO A;  1ZP0 A;  1S35 A;  3RX6 A;  4DND A;  1QUU A;  5ABF A;  4JEH B;  5LBM A;  4A98 A;  1X9B A;  1Z8U A;  5AQF B;  2CXL A;  1B7T A;  2Y8D A;  3EVY A;  4DUZ T;  1IAP A;  5FXW A;  4DR6 T;  3ZSS A;  2UXC T;  3OYX A;  4O2B E;  2KWH A;  1W09 A;  3Q5W A;  3ZYM A;  4AXP A;  4H9N C;  3RPU A;  3B57 A;  1T7S A;  3HKB E;  2ZM8 A;  4PAG A;  3AA6 B;  2W66 A;  3V5S A;  1J5E T;  2LRK A;  4KP3 C;  4ZI3 C;  3UTK A;  2WAU A;  3N9O A;  2Y48 B;  3ANW B;  4U31 A;  3CWZ B;  4JI4 T;  2XM1 A;  4XBF B;  2X51 A;  3PJA J;  4WZX A;  4O4I E;  4H9O C;  4B3S T;  3EUH A;  2LJL A;  2BKO A;  5J1G A;  3IEE A;  2LLY A;  4DV6 T;  4JI7 T;  2KMF A;  3ZJ1 A;  5LMU T;  4ILU A;  4IDZ A;  4DR4 T;  2D0T A;  2CXF A;  3CIR A;  2M67 A;  4YT0 A;  4AKR B;  4JI6 T;  2LKH A;  4IST A;  5CA0 E;  2XTL A;  3A5X A;  3QOF A;  2H89 A;  3UU4 A;  2WP9 A;  1MIY A;  5LHG B;  3AE4 A;  5CFB A;  5F5W A;  2CRB A;  3PUX F;  1D1C A;  4JI8 T;  4DBR A;  1S94 A;  3AXJ B;  1HG2 A;  4ZS3 A;  4JLE A;  2QRX A;  2WB5 A;  3LBX B;  2VQE T;  3ETV A;  3IA3 A;  3JAD A;  3IBP A;  3UUB A;  3CX8 B;  4CI3 B;  4DID B;  5LGT B;  1XDO A;  2XQ9 A;  4B3T T;  2XQ7 A;  3AB3 B;  2KIN B;  2AE9 A;  4OX9 T;  1XWM A;  4HEA A;  4IE6 A;  2J62 A;  4P1N A;  2N2N A;  5JRC A;  2WU5 A;  4U3C A;  1KFY A;  2XUE A;  2C0S A;  2XHE B;  3EI0 A;  4AKL A;  3FB2 A;  4HWI B;  5M4Y A;  4QX7 B;  4CQI A;  2VKD A;  4HN9 A;  4U7I A;  5CB4 E;  1LVF A;  3FXD B;  4U74 A;  3DJB A;  3KV5 A;  3RGL A;  2UU9 T;  4LMJ A;  2CCQ A;  5DQW A;  2EHO B;  4CXW A;  3KV6 A;  1HX8 A;  3RF1 A;  5AQG B;  2CBJ A;  3RH3 A;  5ABF B;  4IL4 A;  5KDM C;  2VUR A;  3SWH A;  2VVS A;  4HFV A;  4H9Q C;  3P4R A;  3ZCI A;  3ZKR A;  3KV9 A;  4FI5 A;  3FZL B;  5FL0 A;  3O1J A;  3JCF A;  3Q5E A;  1MMG A;  3QUJ A;  2J47 A;  2M6I A;  2UUC T;  3EDU A;  2V8S V;  2X0H A;  3PJA A;  5HCM A;  3VKH A;  3CML A;  1NAF A;  5ABE A;  1MND A;  2BVM A;  2JQ9 A;  4ILC A;  5LA6 E;  3UUM A;  5LJM A;  2IDO B;  2LM9 A;  3ZLI A;  4YJ3 E;  1JNZ A;  3ZC1 A;  2DL1 A;  5FMN A;  1BR4 A;  3ZT6 A;  2L9Q A;  4LFB T;  2K5B B;  4IE0 A;  3RC3 A;  2WWV A;  3AEG A;  5L2L A;  2CHN A;  2VAS A;  3ZJ2 A;  2CWO A;  3CQX C;  5JRE A;  2C5J A;  3MAC A;  2K48 A;  4H63 V;  3VR9 A;  3OPC A;  1M62 A;  5KX5 E;  3RYC E;  2A3D A;  4CN6 A;  3LSV A;  5JTG A;  3RQU A;  1OED C;  1YXR A;  3RKG A;  2XQY A;  3FHN A;  3P7I A;  1ZOY A;  3E08 A;  4X65 T;  1YQ3 A;  4DUY T;  2UXN B;  3WI3 A;  5LGN B;  4AIU A;  3R6N A;  2XJ7 A;  3EHZ A;  2LSK A;  4LML A;  3H3M A;  4UXN B;  2WWU A;  3P8C D;  5L3E B;  3UU3 A;  2BKN A;  5L3F B;  3AAA B;  3I9W A;  3HL6 A;  4I0U A;  2H88 A;  5IYZ E;  4DR1 T;  1XDP A;  2ACX A;  1DU2 A;  5KXJ A;  1E1H B;  2N1G A;  4QH5 A;  1J5W A;  2ZM2 A;  5JRC B;  3B5M A;  3RIU C;  4ANJ A;  2XQ8 A;  2VQF T;  4IE7 A;  3KBU A;  4HGA A;  2E9X D;  1T8B A;  3NZP A;  4LMK A;  1L0V A;  4E7Z A;  2WZI A;  1CHU A;  4GYR A;  1UUR A;  3C51 A;  5LJN A;  4OHF A;  2RPA A;  2E9X A;  2NW8 A;  1XNR T;  4UVB B;  4PK6 A;  4CN4 A;  5H6R B;  5JDL A;  2WDV A;  4QHO A;  4EEB A;  5JDH A;  4YY3 T;  2DWK A;  2HHH T;  4NUV A;  2JQQ A;  5AQI B;  3K8P C;  3OKQ A;  4MBQ A;  3PDY A;  4HFD A;  4PJJ A;  4NXM T;  4EXT A;  1XNQ T;  1SUM B;  2KLQ A;  3NZQ A;  2LRL A;  2MPK A;  4G2A A;  3KBT A;  3EAB A;  3VRA A;  4A56 A;  3AE1 A;  4LFA T;  2I59 A;  3CQC B;  5CA1 E;  4UR9 A;  3FZF B;  2CLY C;  5AQL B;  4CXX A;  3O1H A;  2IUB A;  2VL8 A;  4HWH A;  2WZH A;  4OFZ A;  3PV0 F;  5DJQ C;  2YIN A;  3NBX X;  5DQV A;  3C4X A;  4M1P A;  4YTM A;  4PJM A;  2X0L B;  2X66 A;  1JNR A;  4TWD A;  4EAH A;  1FMW A;  1UX5 A;  3UU6 A;  3ABV A;  3I0O A;  3RYH E;  1ZV4 X;  4TUY E;  5FY7 A;  2CA5 A;  3IF8 B;  4F6R C;  2CPT A;  3N2K E;  3K3O A;  4JBW F;  4U2Y A;  1I94 T;  4L5G A;  4C91 A;  3DTO A;  2ES0 A;  2X0Y A;  1NWM X;  3CQG B;  4P0A A;  4BAY B;  4AIS A;  3AA7 B;  5HXE A;  2SPC A;  2XPK A;  1UK5 A;  4YTN A;  4G63 A;  1W0B A;  5FY1 A;  4HE8 A;  2NWB A;  4HFB A;  2Q9Q C;  4QH1 A;  3Q2M A;  1AJ3 A;  4WNK A;  3BQI A;  2WQY A;  5C3J A;  2VL0 A;  2UXD T;  3PUZ F;  2XAF B;  1HNW T;  1OED E;  2JMK A;  2V1D B;  5JDG A;  5LNK A;  5FY0 A;  5AQO B;  1WR6 A;  2BBH A;  4YJ2 E;  3MJX A;  3ZYL A;  5BMV E;  2P9B A;  2XY8 B;  2LT3 A;  5JDQ A;  5HXR A;  3K3Q C;  2W4X A;  4NIQ A;  5HEO A;  2H3R A;  2VKH A;  2GK9 A;  3Q9D A;  4UEM A;  3F57 A;  3RYF E;  5HWY A;  1BR2 A;  4Q25 A;  3VHL A;  3RYI E;  1N36 T;  1LVK A;  3E0Z A;  2LOP A;  5L47 A;  3HR0 A;  3UUN A;  4ZI3 D;  4J2C A;  3SOL A;  4YFS A;  5FXZ A;  1R8I A;  4WYV A;  2PTF A;  4H63 H;  3N9M A;  3CK6 A;  3P4W A;  1N34 T;  3ETU A;  2YN6 A;  4QXB B;  5HEG A;  4O2A E;  2FJE A;  2WMN A;  2V6X A;  2W67 A;  3UT5 E;  4TNV A;  5E0O A;  1KF6 A;  3AVS A;  1WLX A;  5HYA A;  4U72 A;  4O4L E;  2LE8 A;  4AQF A;  4DMV A;  4HTE A;  4YHJ A;  3AE8 A;  2QA7 A;  1WYB A;  2DNX A;  4GOU A;  5LCY A;  1E2A A;  3P4Q A;  5LG4 A;  3ESL A;  1IJ6 A;  1VCT A;  3KDS E;  4IE5 A;  3PUS A;  3FXE B;  4KBM B;  5ABG A;  4TWH A;  3JC6 C;  1OXZ A;  4COF A;  3FZH B;  4GKK T;  4HWF A;  5AQJ B;  4X66 T;  4UEL A;  2WS3 A;  3MKD A;  2NTY A;  4BA9 A;  2MBG A;  3PUY F;  1ZKE A;  4UV8 B;  3RI5 A;  1Z0P A;  3HA4 A;  5JVD E;  1IJ5 A;  4TV8 E;  2PJQ A;  3L39 A;  2LM2 A;  4OYK A;  3EDV A;  3FBZ A;  1Y01 A;  3UU8 A;  4YSZ A;  4GYS A;  4L9I A;  5BR8 T;  5HXC A;  3LK4 2;  5AQS B;  4DV5 T;  1HX1 B;  1LRZ A;  2C5K T;  4U2Z A;  4JUY A;  3RIF A;  4WW0 A;  1HF8 A;  4DV3 T;  4ILB A;  5ETW A;  3H37 A;  3UFG A;  3F31 A;  3ZCJ A;  2UXX B;  1WFD A;  4TWF A;  3GA8 A;  4ZZB A;  1UCU A;  3MXZ A;  3ZMU B;  1NEN A;  1MIW A;  2XSA A;  2DLR A;  2WMO A;  2JRK A;  2VKJ A;  4ZHQ E;  4ZI7 E;  5HAX A;  2FJB A;  2BG9 C;  3TLV A;  3TLU A;  3N2G E;  3U78 A;  5DAB A;  4XZC A;  3NVO A;  3P4S A;  5AQV B;  4AQY T;  1YKH B;  3PUW F;  3RC8 A;  1IZN B;  4DO0 A;  2XAQ B;  2YK0 A;  4I55 E;  4KHZ F;  2IIU A;  5AFU L;  3PUR A;  5LGU B;  2XQ3 A;  4YSY A;  1CUN A;  5JR9 A;  2UUA T;  4JEU B;  2XAH B;  2ODU A;  4Z91 A;  3LK3 B;  2WSS V;  1HG5 A;  2NR4 A;  3RLF F;  4IL9 A;  5LP6 E;  3J9X 1;  2AXD S;  2HN1 A;  2OLT A;  5IWA T;  5LMN T;  3HKD E;  2I6H A;  3P4P A;  5LBQ B;  2E5L T;  4X1I E;  2IC6 A;  4PW8 A;  1FEW A;  2NTX A;  3MZK B;  1KNP A;  4X1K E;  1OED A;  2OV9 A;  3E22 E;  3L8R A;  4DV2 T;  5H6Q B;  1U4Q A;  2VVN A;  4HFH A;  2M6B A;  2KND A;  3ONJ A;  3AED A;  5HCJ A;  4IDO A;  4GKJ T;  2KSR A;  3N9L A;  3UUX B;  4NXN T;  1G8X A;  3ZT7 A;  4UVC B;  4PNI A;  2L8K A;  2L3L A;  2G0U A;  5LHH B;  5J2U E;  4QXC B;  3A7M A;  1MMN A;  2LEH A;  2RA1 A;  3AA0 B;  4AKI A;  5L4H A;  2H7V C;  2PFV A;  4UV9 B;  2KXP B;  3OJA A;  5L3G B;  2OA5 A;  3I0Q A;  2CEA A;  2IHR 1;  3RIU A;  4CXY A;  2HPL A;  2V7J A;  3QB5 K;  4CZZ B;  3PU8 A;  5EZY E;  1VCS A;  5FVL A;  3Q5D A;  4Z90 A;  2YU2 A;  2JJ9 A;  4DR5 T;  3ZEF B;  1HFA A;  1OWA A;  4JI0 T;  3OTO T;  1O3X A;  4O4H E;  4EYY R;  4JI3 T;  3AE5 A;  5GON E;  5AQQ B;  3NRY A;  3KVA A;  3OBV E;  1YD8 G;  3W15 B;  2LHN A;  4GK5 E;  2IML A;  5J0Z A;  3N9Q A;  4DMW A;  2D5U A;  4EOZ B;  3PTR B;  5JDM A;  3AAE B;  4IDQ A;  4TX5 A;  4ZOL E;  3AEE A;  3ZMS B;  1IBK T;  2X67 A;  2MOZ A;  1E7P A;  1EZ3 A;  4HWD A;  2K9A A;  5CGM A;  2A72 A;  2YEV C;  5JR9 B;  4IE4 A;  3UQ7 A;  4ASK A;  3D0T A;  2KT9 A;  3X1D A;  3TLS A;  4LF4 T;  4A97 A;  2V6Y A;  3C98 B;  2W0G A;  4JYA T;  4YHH T;  2CE7 A;  3KV4 A;  4U33 A;  2F4V T;  1NEK A;  5AQH B;  5AQP B;  3VKG A;  2BG9 E;  4KUM B;  2FJD A;  3RRW A;  2W61 A;  3MA9 A;  4I4T E;  1D0Y A;  3WAK A;  4LF5 T;  3C50 A;  3SFE A;  5EK2 A;  3AEF A;  5J2T E;  2YDQ A;  3VU7 H;  2ODV A;  5CJ5 A;  4H9S E;  5AQU B;  2V7K A;  2FBW A;  2W62 A;  3LFM A;  1OED B;  5LOV E;  1SA0 E;  3I1A A;  3AE2 A;  5FVK A;  2ACZ A;  2K24 A;  2LOS A;  2ZMA A;  4WBO A;  3ONL C;  3Q5X A;  3VRB A;  4BJN A;  2CHO A;  3A8Y C;  2XAG B;  2Z6E A;  2WY2 A;  2XQ4 A;  5L3B B;  4MAL A;  1D0Z A;  4YTP A;  2RP4 A;  2Q9Q D;  3RKO A;  4IGU A;  4X20 E;  4B3M T;  2QVA A;  4KX6 A;  4ADZ A;  2VK9 A;  2Q9Q A;  3AE7 A;  2HPJ A;  3PU3 A;  5IUX A;  4ZI2 D;  2JPF A;  4E7S A;  2CXD A;  1WR0 A;  2LSI A;  1T72 A;  2IC9 A;  4Z8X A;  3O4X E;  3N5L A;  4F8H A;  2X9Y A;  2E9X B;  4ZI2 C;  1KEY A;  5LHI B;  4U7Y A;  3UQ4 A;  2YOE A;  3RRC A;  3ZN0 B;  4O4J E;  3NKZ A;  4CI1 B;  3ZMT B;  2WBL A;  4TV9 E;  1T98 A;  3OYZ A;  3AE6 A;  2LSY A;  4ZXL A;  3RHW A;  2BDE A;  2C5I T;  2MTQ A;  4KMC A;  2QYW A;  2DCF A;  2E8I A;  3VR8 A;  1SHZ C;  2D0U A;  4JI1 T;  3M3Z B;  4WBN E;  3RIA A;  2NP9 A;  1W0A A;  2XAS B;  4JI2 T;  2EHO C;  4AKG A;  3R84 B;  2CLY B;  1HCI A;  4NUU A;  4B6X A;  2BKP A;  4LF6 T;  2WDQ A;  3OVU A;  3DP7 A;  2W00 A;  4FJO A;  5JDN A;  2V6Y B;  1US7 B;  3ZPO A;  4V1A v;  1QLB A;  2CM0 A;  4TNW A;  3TLW A;  5L4E A;  1XMQ T;  5F8P A;  1D1A A;  1KK7 A;  1HNX T;  2W63 A;  4X5T A;  2XQ5 A;  3M65 A;  3K1S A;  5L3D B;  1WYC A;  3C4W A;  3CVR A;  1QSD A;  3JC6 D;  2X9W A;  5JH7 E;  5TAO A;  3KIN B;  3V5U A;  5C8Y E;  2CMR A;  4EZ4 A;  4CN1 A;  3QNU A;  4DR2 T;  1UGO A;  5HXS A; 
#chains in the Genus database with same CATH homology
 1CUN A;  4PK6 A;  5JR9 A;  3CKD A;  4P0B A;  5H6R B;  5JDL A;  4JEU B;  3PUG A;  4QHO A;  3TKL B;  5JDH A;  2XAH B;  2ODU A;  4AQF C;  2DWK A;  4IHJ E;  3FBL A;  3LK3 B;  2WSS V;  1HG5 A;  2ZM0 A;  1FIO A;  3SS1 A;  3ZYK A;  5LP6 E;  4NUV A;  2IAK A;  4I43 B;  2JQQ A;  1ZHC A;  3C64 A;  4PK4 A;  4X1Y E;  3K8P C;  4EB6 E;  3OKQ A;  3J9X 1;  4MBQ A;  4L0R A;  4IIJ E;  3PE0 A;  4OK0 A;  3PDY A;  1U5P A;  4XAX B;  4PJJ A;  3HKD E;  3CX6 B;  5F3J A;  2NW7 A;  4EXT A;  5LBQ B;  3S4U A;  2Q9Q B;  2B1E A;  2V26 A;  4X1I E;  3NRX A;  1BR1 A;  2IC6 A;  4PW8 A;  1FEW A;  2KLQ A;  2NTX A;  3MZK B;  3NZQ A;  3K3N A;  2VWA A;  2Y6X A;  4G2A A;  4X1K E;  2DWG A;  3E22 E;  2NW9 A;  2YU1 A;  3KBT A;  2V7M A;  4EIW A;  2EHO D;  4A56 A;  1Y64 B;  1YKE B;  1HS7 A;  3CX7 B;  3PUQ A;  2I59 A;  1MIV A;  3CQC B;  5H6Q B;  1U4Q A;  1G73 A;  2QGS A;  3O9X A;  5CA1 E;  2KND A;  2BZB A;  2CLY C;  5FXX A;  3UUL A;  4CXX A;  4UF0 A;  2EHO A;  3N9L A;  2VB6 A;  3UUX B;  3O1H A;  1G8X A;  1S35 A;  3RX6 A;  4DND A;  2VL8 A;  1QUU A;  2PG8 A;  4UVC B;  4PNI A;  4JEH B;  4OFZ A;  4C90 A;  5DJQ C;  2L8K A;  2YIN A;  3NBX X;  2L3L A;  4H9P C;  5LBM A;  5DQV A;  2CXL A;  1B7T A;  3C4X A;  3B13 A;  2G0U A;  2Y8D A;  4M1P A;  3L3P A;  4N78 D;  4QXC B;  3EVY A;  5J2U E;  5LHH B;  5JDF A;  1MMN A;  4PJM A;  4QKN A;  2LEH A;  1IAP A;  5FXW A;  2RA1 A;  3AA0 B;  4AKI A;  3OYX A;  2X0L B;  4O2B E;  2H7V C;  2KWH A;  2X66 A;  2PFV A;  4UV9 B;  3Q5W A;  2KXP B;  3OJA A;  4EAH A;  5L3G B;  2OA5 A;  1FMW A;  1UX5 A;  3I0Q A;  3ZYM A;  4AXP A;  4H9N C;  2CEA A;  3B57 A;  3RPU A;  4CXY A;  3HKB E;  2LSG A;  2HPL A;  2ZM8 A;  3AA6 B;  3I0O A;  4PAG A;  2V7J A;  3V5S A;  4PJL A;  3GWH A;  3RYH E;  4KP3 C;  1ZV4 X;  4TUY E;  4CZZ B;  3PU8 A;  3ZN1 B;  5EZY E;  4ZI3 C;  3UTK A;  2WAU A;  3N9O A;  5FY7 A;  5EK3 A;  3J7Y q;  2Y48 B;  2CA5 A;  4TZ4 C;  3ANW B;  3CWZ B;  3IF8 B;  4F6R C;  1X79 A;  3N2K E;  3K3O A;  2BVL A;  2JMH A;  4L5G A;  4C91 A;  4XBF B;  2A2F X;  2X51 A;  2YU2 A;  2JJ9 A;  3DTO A;  3GN5 A;  4O4I E;  1HFA A;  3ZEF B;  4O8S A;  1OWA A;  2ES0 A;  1H7C A;  3CQG B;  1NWM X;  4P0A A;  1O3X A;  3QC9 A;  4H9O C;  3EUH A;  4O4H E;  4EYY R;  4BAY B;  2LJL A;  2DI4 A;  3AA7 B;  5HXE A;  2SPC A;  3F2E A;  5GON E;  5J1G A;  3IEE A;  1YW0 A;  3NRY A;  3KVA A;  3OBV E;  2KMF A;  1YD8 G;  3ZJ1 A;  5FYM A;  3W15 B;  4G63 A;  2LHN A;  4GK5 E;  4ILU A;  4IDZ A;  4UVA B;  5FP3 A;  2XAJ B;  2VKO A;  4AQG A;  2D0T A;  4HE8 A;  3L09 A;  2CXF A;  3N9Q A;  2M67 A;  4P09 A;  5FY1 A;  4AKR B;  4IST A;  2NWB A;  5CA0 E;  1VOM A;  3U3I A;  2Q9Q C;  2XTL A;  4DMW A;  2D5U A;  3Q2M A;  3A5X A;  4EOZ B;  3PTR B;  4ZS2 A;  4YLH A;  1AJ3 A;  4PFO A;  4WNK A;  5JDM A;  3AAE B;  3BQI A;  1MIY A;  5LHG B;  4TX5 A;  5JR9 C;  1D1C A;  2XAF B;  4ZOL E;  4DBR A;  2JMK A;  1S94 A;  2V1D B;  3IHR A;  2X67 A;  3ZMS B;  2MOZ A;  2ZLY A;  5JDG A;  1HG2 A;  5LNK A;  5FY0 A;  4ZS3 A;  4JLE A;  1EZ3 A;  3GMI A;  3BQL A;  4QWN B;  1WR6 A;  4YJ2 E;  2K9A A;  4GIW A;  4MFR A;  3LBX B;  3MJX A;  3ETV A;  3ZYL A;  1HTJ F;  3IBP A;  4ERR A;  2A72 A;  5BMV E;  4EZH A;  2YEV C;  5JQG E;  5JR9 B;  4IE4 A;  3CX8 B;  2P9B A;  4ASK A;  4CI3 B;  2LT3 A;  5JDQ A;  5HXR A;  3K3Q C;  3N9P A;  3D0T A;  2KT9 A;  2IW5 B;  5LGT B;  1WRD A;  5FXV A;  2H3R A;  4CI2 B;  3C98 B;  2W0G A;  2VKH A;  2GK9 A;  3AB3 B;  2CE7 A;  2KIN B;  3KV4 A;  3Q9D A;  1BR0 A;  4HEA A;  4UEM A;  4IE6 A;  3F57 A;  3RYF E;  3VKG A;  4KUM B;  3RRW A;  2N2N A;  1MNE A;  5HWY A;  1BR2 A;  5JRC A;  4DVD A;  2XUE A;  2C0S A;  3BK9 A;  3VHL A;  4AKH A;  3RYI E;  2W61 A;  1D1B A;  2XHE B;  3MA9 A;  1LVK A;  3E0Z A;  4I4T E;  4PJN A;  4AKL A;  2LOP A;  3HR0 A;  3FB2 A;  1D0Y A;  3WAK A;  5M4Y A;  3UUN A;  4ZI3 D;  3C50 A;  5EK2 A;  4J2C A;  3SOL A;  5J2T E;  3ZMV B;  3VU7 H;  2ODV A;  4QX7 B;  4YFS A;  4H9S E;  4QXH B;  2V7K A;  2W62 A;  3LFM A;  4CQI A;  5FXZ A;  3AAI A;  4H63 H;  3N9M A;  2VKD A;  4HN9 A;  5LOV E;  1SA0 E;  3I1A A;  2X9X A;  1UX4 A;  4MLK A;  3ETU A;  4PFP A;  5CB4 E;  2K24 A;  1LVF A;  2LOS A;  1V9D A;  3FXD B;  4QXB B;  4U74 A;  2ZMA A;  4WBO A;  4ISS A;  3DJB A;  4AI6 A;  3KV5 A;  4O2A E;  2WMN A;  2CCQ A;  5DQW A;  3Q5X A;  4K0U A;  4UF0 B;  2EHO B;  3UT5 E;  4BJN A;  4CXW A;  3KV6 A;  2N9D A;  1HX8 A;  5E0O A;  2XAG B;  2Z6E A;  4DBQ A;  1MMD A;  3AVS A;  3RH3 A;  4MAL A;  1D0Z A;  1WLX A;  5L3B B;  3HKC E;  5KDM C;  2NOX A;  3SWH A;  2RP4 A;  2Q9Q D;  5HYA A;  4U72 A;  4HFV A;  4H9Q C;  4O4L E;  2LE8 A;  3RKO A;  3ZCI A;  1ZEE A;  4IGU A;  4X20 E;  4AQF A;  4DMV A;  4HTE A;  4YHJ A;  3KV9 A;  4ADZ A;  5HWX A;  4FI5 A;  2VK9 A;  3LK2 B;  4GK0 E;  2QA7 A;  3O1J A;  2Q9Q A;  1WYB A;  1MMG A;  3QUJ A;  3HKE E;  3EDU A;  4TN7 B;  3KFW X;  2HPJ A;  2CWY A;  2DNX A;  4GOU A;  5LCY A;  3PU3 A;  3VKH A;  1VRB A;  5LG4 A;  2LHR A;  5LXT E;  3CML A;  3ESL A;  1NAF A;  1IJ6 A;  4ZI2 D;  2JPF A;  1MND A;  2PBI A;  3KDS E;  4IE5 A;  4E7S A;  2J1D G;  2BVM A;  4PK5 A;  5LA6 E;  3PUS A;  2E9X C;  2CXD A;  3FXE B;  3UUM A;  4KBM B;  5LJM A;  2LM9 A;  2LSI A;  3KVB A;  3JC6 C;  3ZLI A;  1OXZ A;  2HH7 A;  4YJ3 E;  3ZC1 A;  2H7O A;  5FMN A;  2LSJ A;  4UEL A;  3GN5 B;  3QK6 A;  1BR4 A;  3SRZ A;  2IC9 A;  4Z8X A;  2L9Q A;  3MKD A;  3N2O A;  3CPZ A;  3O4X E;  2K5B B;  2NTY A;  3N5L A;  4BA9 A;  4IE0 A;  2MBG A;  2X9Y A;  2E9X B;  4ZI2 C;  3RC3 A;  1ZKE A;  5LHI B;  2V7I A;  2X9H A;  5L2L A;  2VAS A;  4UV8 B;  3ZJ2 A;  2CWO A;  3CQX C;  5JRE A;  2C5J A;  3PUA A;  3RRC A;  1Z0P A;  3MAC A;  3HA4 A;  2MYS A;  2K48 A;  3ZN0 B;  4O4J E;  5JVD E;  1IJ5 A;  4CI1 B;  3HI2 A;  4H63 V;  4TV8 E;  2PJQ A;  5A1L A;  3ZMT B;  2WBL A;  4I50 E;  4TV9 E;  5KX5 E;  1T98 A;  2V7L A;  3RYC E;  2A3D A;  3OYZ A;  4OYK A;  2LSY A;  3BQK A;  4OYJ A;  2X68 A;  3EDV A;  3FBZ A;  2BDE A;  3I9Y A;  2KZ7 B;  4BJM A;  4GYS A;  2XQY A;  3FHN A;  4L9I A;  3P7I A;  2C5I T;  3WAJ A;  2MTQ A;  3E08 A;  4KMC A;  5HXC A;  4UIG A;  2DCF A;  2E8I A;  3LK4 2;  5ADX L;  1SHZ C;  2UXN B;  3WI3 A;  4MHC A;  3ONX A;  1LRZ A;  2D0U A;  5LGN B;  3ANW A;  2C5K T;  3R6N A;  4JUY A;  4H9R C;  4WW0 A;  1HF8 A;  3H3A A;  5LYJ E;  4WBN E;  5HXH A;  2NP9 A;  2WM9 A;  5ETW A;  2XAS B;  2KWI B;  2EHO C;  5IHY A;  4AKG A;  3H37 A;  2LSK A;  3F31 A;  4HKA A;  4UXN B;  3ZCJ A;  3R84 B;  2UXX B;  2WWU A;  3P8C D;  5L3E B;  3GA8 A;  2CLY B;  1HCI A;  4NUU A;  5L3F B;  4B6X A;  1UCU A;  3MXZ A;  3AAA B;  3ZMU B;  3I9W A;  3HL6 A;  3C4Z A;  3T8O A;  5IYZ E;  1MIW A;  3DP7 A;  2W00 A;  2DLR A;  3AA1 B;  2WMO A;  3AVR A;  2ACX A;  4FJO A;  5JDN A;  2JRK A;  2VKJ A;  4ZHQ E;  4ZI7 E;  1E1H B;  1US7 B;  5HAX A;  3ZMZ B;  3ZPO A;  4V1A v;  3O1I A;  2CM0 A;  5L3C B;  3LG7 A;  2N1G A;  5F8P A;  1D1A A;  1KK7 A;  3MK7 C;  2DHR A;  2ZM2 A;  4EYU A;  5JRC B;  3N2G E;  3U78 A;  5DAB A;  4XZC A;  2D2S A;  4ANJ A;  1LKX A;  4IE7 A;  2W63 A;  5EK4 A;  4QX8 B;  3M65 A;  3KBU A;  5L3D B;  1YKH B;  3UFE A;  1WYC A;  3C4W A;  4HGA A;  2E9X D;  3RC8 A;  1IZN B;  3CVR A;  3LJC A;  1QSD A;  5KMG P;  5FNV E;  3NZP A;  1KNZ A;  4DO0 A;  2XAQ B;  3JC6 D;  2X9W A;  4E7Z A;  1D0X A;  2YK0 A;  5JH7 E;  5TAO A;  4I55 E;  4GYR A;  3ZC0 A;  3KIN B;  3V5U A;  3C51 A;  5AFU L;  5LJN A;  4OHF A;  3PUR A;  5LGU B;  3LBX A;  3N9N A;  1MMA A;  2E9X A;  2CMR A;  4EZ4 A;  5C8Y E;  2NW8 A;  1FMV A;  4UVB B;  5HXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...