4JEUB

Crystal structure of munc18a and syntaxin1 with native n-terminus complex
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
242
structure length
225
Chain Sequence
b'KDRTQELRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Syntaxin-binding protein 1
publication title Syntaxin1a variants lacking an N-peptide or bearing the LE mutation bind to Munc18a in a closed conformation.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis/exocytosis
total genus 90
structure length 225
sequence length 242
ec nomenclature
pdb deposition date 2013-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00804 Syntaxin Syntaxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4jeuB00
1FIOA 1HS7A 2DNXA 4TX5A 4JEHB 5LG4A 1BR0A 1S94A 1EZ3A 5M4YA 2XHEB 1G73A 1FEWA 4JEUB 3C98B 3LG7A
chains in the Genus database with same CATH superfamily
5FXXA 4QHOA 5FYMA 5ABEA 2XAJB 3RF1A 3RYIE 2Q9QA 2CHNA 2XSAA 4ZS3A 2V7KA 4UR9A 4AKRB 2MOZA 2XUEA 5LNKA 5JREA 2E9XC 4YHJA 3AAAB 3ZMVB 4WZXA 5HEGA 4UXNB 1D0ZA 1QSDA 3SRZA 3JCFA 3KDSE 4JI6T 3RHWA 4HN9A 4ANJA 2QA7A 3CQCB 5JDFA 3NVOA 5JTGA 2NP9A 5JVDE 3MJXA 3ZYKA 3GMIA 4CQIA 3ZJ1A 2X9XA 5LCYA 4U74A 3KV4A 3PTRB 4KBMB 2Q9QC 4PAGA 4K0UA 5L3EB 3EDUA 2MBGA 2ACXA 4ZZBA 2UXNB 4PJLA 4GK5E 2HHHT 5KMGP 1E7PA 2WSSV 4CI1B 3FB2A 5AQMB 2KWIB 2AXDS 5FXVA 4HFHA 3VU7H 3CKDA 3T1HT 2MAWA 3RYFE 4MLKA 2BS4A 2V6YB 3ZC0A 3PUXF 5FY0A 2WU5A 5AQRB 1J5ET 1WR6A 2XAGB 2P9BA 3ONJA 5LXTE 5LHHB 2LM2A 3CX7B 3LFMA 4IHJE 2XQ8A 1IJ6A 1U4QA 2F4VT 1MMNA 2PFVA 4GKKT 3ZC1A 2V8SV 4TN7B 1HCIA 1X9BA 2L3LA 3DP7A 4O4IE 5FKYA 2ODVA 2A3DA 2N1GA 4AKGA 2I59A 1XDPA 4XZCA 4OYJA 3M3ZB 3MXZA 5LG4A 2CM0A 3N9NA 4BA9A 4HKAA 4UELA 4E7SA 5AQPB 4ASKA 3CQXC 2VK9A 2LSKA 1D1BA 2X51A 2YU1A 4TWFA 4HWFA 3H3MA 3KBTA 1IBKT 3UULA 1HR0T 2CBJA 2LHRA 4DUZT 2H89A 4ZZCA 3FBZA 3K1SA 4ZI2D 5JR9B 2W61A 2WBLA 4ILBA 2WZHA 5AQFB 4V1Av 4UIGA 1YQ4A 2UXBT 1XMQT 2VURA 3CQGB 3P4PA 5CGMA 3F57A 4EZ4A 4TV9E 2BKOA 4WNKA 4ZI7E 2FJDA 5IWAT 4YLHA 3QNUA 1ZV4X 2CWYA 1X79A 5TAOA 5J2TE 3LBXB 5LHGB 1Y01A 2V6XA 4IDNA 2YDQA 5LOVE 3RIFA 2VVSA 3NRYA 2BBHA 4TZ4C 1OWAA 3LK2B 4CXXA 2W66A 4DR3T 2CCQA 3F2EA 2KLQA 2NWBA 2UUAT 1YKEB 1OEDE 2X68A 4UV9B 4WYVA 2UXXB 3ZT7A 2V6YA 3MK7C 2XZEA 4I55E 3RYHE 3K3OA 4PNIA 3D0TA 2X9HA 1HS7A 2XTLA 3N2KE 4YSXA 2XASB 2D0UA 3K8PC 4HTEA 3RC8A 5DQWA 1N33T 4P09A 3R84B 4P1NA 1NENA 4H9OC 5JDMA 1S35A 2YOEA 1MMGA 1N34T 4QKNA 4AQGA 4CI2B 2OV9A 4ZS2A 2XQ3A 1G8XA 3PUAA 4HEAA 5ABHA 2E5LT 4DMWA 2CMRA 2VL8A 3EI0A 3N9MA 2NTYA 3P4WA 2H7OA 4CI3B 4EYUA 4DR6T 4PW8A 4ADZA 2YEVC 2ZM8A 3W15B 3QB5K 5JR9A 5HXEA 3IF8B 5LB7B 4EIWA 4DV7T 3VKHA 4U7IA 4HWIB 2BKPA 1UGOA 4KHPT 2BG9E 3CWZB 1MNDA 3TLSA 3ONXA 4JI5T 2BVMA 4NUVA 2NR4A 4ZEYA 4G63A 2DLRA 3LBXA 2WDQA 3RRWA 2LRKA 3ZKRA 2LT3A 3TLUA 5E0OA 4DR1T 4DBQA 2X9WA 4WW0A 4H9RC 3Q5WA 2CHOA 4EB6E 2LLYA 5JH7E 4O4HE 5AQSB 3R6NA 3ZN0B 1HFAA 4JV5T 4O2AE 3Q5DA 5AFUL 4ZOLE 2VQET 2J47A 4DUYT 3ZYLA 3KINB 5H6QB 3B5MA 3P4RA 3RC3A 4GK0E 1I94T 5LP6E 1D1CA 2VKHA 1LKXA 2HN1A 4UV8B 2BG9B 3C64A 4I4TE 5LYJE 3QUJA 2VWAA 1YW0A 1N36T 3P4QA 2YDSA 3TLTA 2M6IA 3AA7B 2X9YA 5FVLA 4PK5A 2GK9A 2AE9A 3KV5A 3C4WA 5LJMA 2XM1A 4JEHB 2XJ7A 3UU3A 3AEFA 4QXHB 4PFPA 4B3MT 4U3CA 2KSRA 4YTNA 4IE4A 3AXJB 1KNZA 3O9XA 2UXCT 2VQFT 4OHFA 3AEGA 1FEWA 1UUSA 4ZHQE 4LMLA 2B1EA 3PUWF 4C91A 4DR2T 3AE6A 5HXCA 2XPKA 5KDMC 4EGWA 1SA0E 5FL1A 3NZPA 4CXYA 3WI3A 5JDGA 1VOMA 2K24A 2A9UA 3LG7A 2WMNA 1M7KA 2QGSA 5CA0E 5LG3A 2JQHA 1H7CA 3AEEA 1BR2A 4QX8B 2IIUA 2FBWA 5LBMA 4TV8E 3LK42 2PTFA 1HF8A 1OEDC 1IBLT 3U78A 3PUVF 4KMCA 4XBFB 3H3AA 2WWUA 4XAXB 4DIDB 2H88A 4IDZA 2XQAA 2VL0A 2ZM6T 5FXWA 3T8OA 4DV3T 4LFCT 2JMHA 3FZLB 3VKGA 4JI1T 2OA5A 2BG9A 5LBQB 3PUYF 1UK5A 3RI5A 3KFWX 2NW7A 2UUBT 1S94A 5HEJA 1IBMT 4AKHA 1T7SA 3AE8A 4TUYE 1FIOA 5AQGB 3LJCA 3SOLA 4IE0A 3K3QC 5HXRA 4DMVA 3FZKB 4X62T 3CIRA 2DI4A 1KF6A 2CXLA 4AIUA 3PU3A 2YN6A 5EK3A 3UQ7A 3AXJA 4B3TT 3OBVE 2CXFA 2CLYB 3OTOT 4BJMA 2IC9A 5A1LA 1NEKA 1W09A 2UU9T 2D9DA 3N9LA 4MFRA 3JC6C 4L9IA 2IMLA 4J2CA 4F6RC 3AE7A 4CZZB 3UU8A 3ZYMA 2K3WA 3I1AA 5AQVB 3UFEA 5L3FB 4DR7T 2XM2A 3I0OA 5AQTB 3CPZA 2VKDA 1VCTA 1SUMB 4HGAA 2DL1A 1IZNB 1ZKEA 4O4LE 2YDRA 4X66T 3PV0F 2YU2A 1UURA 1IJ5A 1YQ3A 5FL0A 3P4SA 2PBIA 4JI7T 5EK2A 2LHNA 1J5WA 4X64T 2IW5B 3EDVA 3UT5E 4JI8T 2BS2A 3NKZA 4YY3T 3C98B 3TLVA 2X0HA 1KFYA 1MIWA 3WAKA 3Q5XA 5ABFB 4A97A 4MBQA 2BVLA 3EHZA 4CN4A 5J0ZA 1NWMX 4HFCA 2KZ7B 3QOFA 4LF4T 2V1DB 5HAXA 2XHEB 4WBNE 2H7VC 2XQYA 3P7IA 3ZSTA 4A56A 1LRZA 1CUNA 1E2AA 2RPAA 1HNWT 3CK6A 3ZCJA 2XAHB 3L8RA 2V5DA 3P50A 1O3XA 4YXDA 1L0VA 2IUBA 4U72A 2WB5A 4AKIA 3VR9A 1W0BA 3BQIA 4X1IE 4PJMA 4U2ZA 3GN5B 4DNDA 3DTOA 3AA1B 1MMDA 3MZKB 2SPCA 3PUSA 3HKCE 2KWHA 1CHUA 2X67A 5AQQB 4H9QC 4QXBB 4CN6A 2JQKA 4PJJA 4EOZB 1UX5A 3LDQB 3AAEB 1KEYA 4NXNT 2MTQA 3PUGA 3K3NA 2JQ9A 4EXTA 1XZYA 2IC6A 1BR0A 5FXZA 3I0QA 3AEBA 4COFA 2NOXA 4Z90A 2ZM2A 1QLBA 2CXDA 4UVCB 1E1HB 2IHR1 2G0UA 1HTJF 4F8HA 4PK6A 4JI3T 3JAFA 4KX6A 2X66A 3E22E 2LOPA 2I0MA 3BQLA 3QC9A 2Y48B 1BR1A 5F5WA 3ZEFB 4I0UA 3LSVA 3ZSSA 1W9RA 3UU4A 4KP3C 3V5SA 4C90A 2WP9A 1YD8G 3EAMA 3Q9DA 5ABFA 3ZN1B 4IIJE 5AQKB 2V5CA 2FJEA 2JJ9A 4X20E 3H37A 2H3RA 4BAYB 1T72A 2BKNA 5FY1A 2XQ7A 3VRBA 1ZP0A 5C2TA 1OXZA 3FZFB 2N9DA 1XNRT 1R8IA 4YSYA 4HFIA 5KXJA 2EHOB 4IGUA 4GOUA 5FMNA 2E5VA 3AE1A 3GN5A 2EHOD 2QYWA 3NRXA 2C5KT 5AQUB 2QVAA 2ZM0A 4AXPA 3ANWB 3UU6A 4U2YA 3ABVA 5FVKA 3AVSA 1DU2A 4OFZA 4LF7T 4B3ST 1Z8UA 3ZJ2A 3PJAJ 1MNEA 4ZI2C 4PFOA 3B57A 4HFBA 4LF5T 1HG5A 1SE7A 4E7ZA 2J1DG 3M65A 3JADA 1JNZA 5JR9C 2HH7A 2L9QA 4UF0B 3A5XA 4EZHA 3RKOA 2LOSA 2KNDA 2XAFB 2X0YA 3HKDE 4JYAT 3J7Yq 3OVUA 2RA1A 4IE6A 3HKBE 2LM9A 3SWHA 5L3GB 2E9XB 3AB3B 2LKHA 3AE9A 2JQQA 3UU5A 4B3RT 4O4JE 3OYZA 2LSIA 2E9XD 5HYAA 3AEAA 2MYSA 2W2UA 4YJ3E 2W00A 5BR8T 5AQJB 3N9QA 5L3BB 2X0LB 5FNVE 1IAPA 4GYSA 1YKHB 5HXHA 3UQ4A 4DV4T 3GWHA 5EZYE 1WYBA 3HKEE 3RRCA 2NTXA 4HFDA 2YINA 4OK0A 3LK3B 2LSGA 4NPPA 4DV1T 2D2SA 2KT9A 3RIUA 3ZT5A 3L3PA 1ZEEA 2WS3A 3O1JA 1UCUA 1QUUA 5CB4E 4TNWA 4X65T 1Y64B 2EHOA 3ZMTB 4AI6A 5IUXA 4G2AA 5C3JA 4DR4T 3T1YT 5F8PA 3ETUA 4PJNA 3ANWA 3RPUA 1D0YA 5CA1E 5JDQA 4HWDA 3IEEA 3OKQA 3IA3A 5CJ5A 4Z8XA 4IDPA 4U31A 4PK4A 4HWCA 5AQHB 2W63A 2DNXA 4GKJT 2BDEA 2XSBA 3TLWA 5LMNT 2KXPB 2LSYA 2M6BA 2ES0A 3NWIA 4LFBT 2M67A 3FXDB 4UF0A 4QX7B 2EHOC 3VHLA 1T98A 4ILAA 3J9X1 4IDOA 3FZMB 2E9XA 2BBJA 2Z6EA 5HEOA 3RKGA 2RP4A 5AQIB 2W4XA 3ETVA 3N2GE 4AKLA 3RX6A 4YSZA 2IAKA 3ZCIA 2CEAA 5AQNB 4YT0A 4UVBB 3ZMZB 2N2NA 1LVFA 4O2BE 3RYCE 3PUQA 2JMKA 3UUNA 5CFBA 3AE4A 5HCMA 4ZXLA 4NUUA 3RLFF 3MA9A 3EVYA 4YTMA 4ZI3D 2VKOA 5JRCB 4UVAB 1WRDA 4AISA 2C5IT 3O1HA 2WCAA 4MHCA 4IL9A 5HEUA 5DQVA 2J4GA 5HCJA 3CX8B 4CXWA 2UXDT 4LMJA 2PG8A 1D0XA 4A98A 3O1IA 3NBXX 3AECA 2J62A 4X1KE 5HEHA 4I43B 4H63H 5AQOB 2BG9C 5L47A 3DJBA 3IHRA 4ILUA 2CPTA 4L5GA 3AAIA 3RGLA 4KUMB 1NAFA 2XQ5A 3EABA 2K9AA 2WZIA 3A7MA 1XWMA 4GIWA 5JDLA 4LF9T 1I6ZA 1VRBA 5ETWA 4CN1A 2Y6XA 4MALA 2VVNA 5IYZE 4KHZF 3PDYA 3VRAA 5JDHA 4QWNB 1WYCA 4ISTA 3Q2MA 3SFEA 1J1JA 3RQWA 3BQKA 1MIVA 5HXSA 4DV2T 2UUCT 4IREA 4DV0T 3KV6A 2KMFA 1AJ3A 2DHRA 4IT4A 3G06A 3UUXB 4U33A 1KK7A 2WY2A 2K5BB 4A5XA 3OPCA 4X1YE 2ZMAA 1KNPA 2BS3A 2CRBA 3PJAA 2E8IA 5LGTB 4X5TA 2JRKA 2LEHA 4P0AA 3N5LA 4EAHA 4QXCB 2VB6A 2W62A 1V9DA 5JRCA 4TX5A 5ADXL 4OYKA 3Q5EA 4M1PA 4ILCA 3V5UA 3RIAA 5KX5E 2V7LA 4TWDA 1GQEA 3ZLIA 4NIQA 2CE7A 3EUHA 4KI0F 1FMVA 2HPJA 4JBWF 2WQYA 5F3JA 4HE8A 2E2AA 3JAEA 1G73A 3UTKA 4L0RA 4JI4T 2YKSA 4ZI3C 2WM9A 5L3DB 2OLTA 1T8BA 2FJBA 1FMWA 3AVRA 1FJGT 1Z0PA 4DV6T 4B6XA 5IHYA 4IE7A 1XNQT 3KBUA 4H63V 1JNRA 2V7JA 4JI2T 1YXRA 5LGNB 3HI2A 4OX9T 1XMOT 2XQ6A 1W0AA 3OYXA 2CLYC 4LF6T 2FJAA 3FHNA 2I6HA 3QB5A 4LF8T 3HR0A 2K48A 2MPKA 3MKDA 3CVRA 1ZHCA 1B7TA 3C4XA 5FY7A 1MMAA 3KVBA 5EK4A 4JUYA 3AA0B 3FBLA 3UFGA 2LE8A 1XDOA 3KVAA 2B76A 1WR0A 2ACZA 3HA4A 4AQYT 2WAUA 2D0TA 2LRLA 1LVKA 5FP3A 2NW8A 4TNVA 3C51A 1EZ3A 3U3IA 2R6GF 3ONLC 2NW9A 2XY8B 1UX4A 1HNZT 5JQGE 3ZMSB 3HL6A 1HX8A 4O8SA 2C0SA 5L4EA 4NXMT 3PURA 3NZQA 2DCFA 4QH5A 4I50E 4WBOA 3RH3A 2JPFA 5M4YA 3B13A 4EEBA 3N2OA 4AQFA 4YHHT 1WFDA 5LGUB 2CBIA 4YFSA 2WDRA 3RQUA 3AA6B 3GA8A 2QRXA 4K0KT 2WU2A 2CA5A 2XAQB 3N9PA 2WDVA 4DR5T 5HWXA 1OEDB 1SHZC 5GONE 5HWYA 2W0GA 4DVDA 4Z91A 5L3CB 1WLXA 4JI0T 3ZMUB 2IDOB 2Y8DA 4YJ2E 1MIYA 3QK6A 4IL4A 2XQ9A 1VCSA 2FUPA 4N78D 5LHIB 4AQFC 5AQLB 4UEMA 5LJNA 3SFDA 3AE3A 4JEUB 2LJLA 4Q25A 3C4ZA 4QH4A 2BZBA 1WCRA 4DO0A 4FJOA 3A8YC 4DBRA 1M62A 3UUBA 5LMUT 3L09A 5DABA 4EYYR 2C5JA 2A2FX 5H6RB 3SS1A 4LMKA 1US7B 5J1GA 2VKJA 3CX6B 2D5UA 1KNRA 2L8KA 3P8CD 4TWHA 2V7IA 2WMOA 2LKGA 3AEDA 4ISSA 3C50A 3MACA 3UUMA 2Q9QB 1D1AA 1ZOYA 2PJQA 4BJNA 3E0ZA 4YTPA 3E08A 5L2LA 2HN2A 3I9WA 4IDQA 2LSJA 2Q9QD 4HFVA 3FZHB 4QH1A 4IE5A 3JC6D 2KINB 3AE2A 2DWGA 3ZPOA 4HWHA 3PU8A 3AE5A 4HFEA 4U7YA 3FXEB 2HPLA 4H9SE 3O4XE 2ODUA 3PE0A 3ZT6A 4FI5A 5LA6E 4EEDA 1OEDA 4LFAT 3I9YA 3WAJA 3BK9A 3F31A 1HG2A 3S4UA 1HX1B 3KV9A 2WWVA 2V7MA 3RIUC 5J2UE 3N9OA 3ESLA 4H9NC 3IBPA 5JDNA 5L4HA 5C8YE 1BR4A 4GYRA 3VR8A 3CMLA 2VASA 3L39A 2XQ4A 1N32T 2YK0A 4JLEA 2V26A 5ABGA 4DV5T 4P0BA 4ERRA 2CWOA 2A72A 5BMVE 2ZLYA 5DJQC 2DWKA 2JIWA 4H9PC 3TKLB 2W67A 1U5PA 1HNXT 3X1DA 3PUZF 4EV6A 3OJAA
chains in the Genus database with same CATH topology
4X1YE 4C90A 5FXXA 1YD8G 2ZMAA 3Q9DA 4QHOA 5FYMA 5LP6E 3ZN1B 2E8IA 4IIJE 2XAJB 5LGTB 2JJ9A 1D1CA 2JRKA 2VKHA 2LEHA 4X20E 3RYIE 4P0AA 3H37A 3N5LA 1LKXA 4EAHA 2H3RA 4UV8B 3C64A 4I4TE 2Q9QA 4QXCB 5LYJE 3QUJA 2VWAA 4BAYB 4ZS3A 1YW0A 2V7KA 2VB6A 2W62A 5FY1A 4AKRB 1V9DA 2MOZA 2XUEA 5LNKA 5JRCA 5JREA 2E9XC 4YHJA 3AAAB 4TX5A 5ADXL 1OXZA 3ZMVB 4OYKA 3AA7B 4UXNB 4M1PA 2N9DA 1D0ZA 1QSDA 3SRZA 2X9YA 4PK5A 3V5UA 2GK9A 5KX5E 3KV5A 3KDSE 2V7LA 3C4WA 5LJMA 4JEHB 4QXHB 4PFPA 3ZLIA 4HN9A 2EHOB 4IGUA 2QA7A 4ANJA 3CQCB 2CE7A 3EUHA 5JDFA 4GOUA 1FMVA 2NP9A 2HPJA 5FMNA 4IE4A 5F3JA 3GN5A 3MJXA 5JVDE 3ZYKA 1KNZA 2EHOD 3O9XA 4HE8A 3GMIA 3NRXA 4CQIA 2C5KT 3ZJ1A 1G73A 4OHFA 1FEWA 2ZM0A 4L0RA 3UTKA 4ZHQE 4AXPA 4ZI3C 2X9XA 5LCYA 3ANWB 2WM9A 5L3DB 2B1EA 4C91A 4U74A 1FMWA 3AVRA 3KV4A 3PTRB 4KBMB 2Q9QC 5HXCA 3AVSA 4PAGA 4OFZA 1Z0PA 3ZJ2A 5KDMC 1SA0E 4K0UA 5L3EB 3NZPA 3EDUA 2MBGA 4CXYA 3WI3A 4B6XA 2ACXA 5IHYA 2UXNB 4PJLA 5JDGA 1VOMA 4GK5E 4IE7A 1MNEA 4ZI2C 2K24A 4PFOA 3B57A 3LG7A 5KMGP 1HG5A 3KBUA 2WMNA 4H63V 2WSSV 2QGSA 2V7JA 4CI1B 5CA0E 4E7ZA 5LGNB 2J1DG 3FB2A 3HI2A 3M65A 1H7CA 5JR9C 1BR2A 2KWIB 4QX8B 2HH7A 5FXVA 2L9QA 4UF0B 3A5XA 3VU7H 4EZHA 3RKOA 3OYXA 2CLYC 3CKDA 5LBMA 2LOSA 2KNDA 2XAFB 3FHNA 4TV8E 3RYFE 4MLKA 3HR0A 3ZC0A 3HKDE 5FY0A 3LK42 1HF8A 3J7Yq 2RA1A 1WR6A 2XAGB 4IE6A 2K48A 3MKDA 2P9BA 3HKBE 3U78A 2LM9A 3SWHA 5L3GB 5LHHB 5LXTE 2E9XB 3CVRA 4KMCA 3CX7B 3LFMA 4XBFB 3AB3B 3H3AA 1ZHCA 2JQQA 1IJ6A 4IHJE 1U4QA 1B7TA 1MMNA 2PFVA 3C4XA 2WWUA 4XAXB 4O4JE 3ZC1A 3OYZA 5FY7A 1MMAA 4IDZA 2LSIA 2E9XD 5HYAA 3KVBA 4TN7B 1HCIA 5EK4A 2L3LA 2MYSA 3DP7A 4O4IE 4JUYA 4YJ3E 2W00A 2ODVA 2A3DA 2N1GA 3AA0B 5FXWA 3T8OA 3FBLA 4AKGA 2I59A 2LE8A 4XZCA 3N9QA 3KVAA 4OYJA 5L3BB 2X0LB 3HA4A 2JMHA 5FNVE 2WAUA 2D0TA 1IAPA 4GYSA 3VKGA 1LVKA 3MXZA 1YKHB 2NW8A 2OA5A 3C51A 5FP3A 1EZ3A 5LG4A 3U3IA 5LBQB 2CM0A 5HXHA 3GWHA 3N9NA 4BA9A 3KFWX 4HKAA 5EZYE 2NW7A 2NW9A 1S94A 1WYBA 3HKEE 4UELA 3RRCA 4E7SA 1UX4A 4ASKA 2NTXA 3CQXC 2VK9A 5JQGE 2LSKA 2YINA 3ZMSB 4AKHA 1D1BA 3HL6A 1HX8A 2X51A 2C0SA 2YU1A 3LK3B 4O8SA 4OK0A 2LSGA 4TUYE 1FIOA 3SOLA 2D2SA 3LJCA 3NZQA 3PURA 4IE0A 2DCFA 2KT9A 3K3QC 5HXRA 3L3PA 1ZEEA 4I50E 4WBOA 3RH3A 4DMVA 3KBTA 3O1JA 2JPFA 1UCUA 5M4YA 3UULA 1QUUA 3B13A 5CB4E 3N2OA 4AQFA 2DI4A 2LHRA 1Y64B 2EHOA 3ZMTB 4AI6A 5LGUB 2CXLA 3PU3A 4YFSA 3FBZA 5EK3A 4ZI2D 3AA6B 5JR9B 3GA8A 2W61A 2WBLA 4G2AA 3OBVE 2CXFA 4V1Av 2CA5A 2CLYB 2XAQB 4UIGA 3ETUA 5F8PA 3N9PA 5HWXA 4BJMA 2IC9A 3CQGB 5A1LA 3F57A 4EZ4A 4PJNA 3ANWA 4TV9E 3RPUA 4WNKA 1SHZC 5GONE 4ZI7E 5HWYA 4YLHA 1D0YA 2W0GA 3N9LA 4DVDA 4MFRA 5CA1E 3JC6C 1ZV4X 1WLXA 3IEEA 4L9IA 5JDQA 3OKQA 4J2CA 3ZMUB 5L3CB 4F6RC 2CWYA 4CZZB 1X79A 3ZYMA 5TAOA 4Z8XA 5J2TE 2Y8DA 3I1AA 3LBXB 5LHGB 4PK4A 4YJ2E 1MIYA 3QK6A 3UFEA 5LOVE 5L3FB 3NRYA 3I0OA 4TZ4C 1OWAA 2W63A 2DNXA 3LK2B 2BDEA 2VKDA 3CPZA 4CXXA 4HGAA 2CCQA 2KXPB 3F2EA 2LSYA 2KLQA 1IZNB 2ES0A 2NWBA 1ZKEA 4N78D 5LHIB 2M67A 3FXDB 4AQFC 1YKEB 4QX7B 4UEMA 2EHOC 4UF0A 3VHLA 5LJNA 1T98A 4O4LE 2X68A 4UV9B 2UXXB 2YU2A 3J9X1 3MK7C 4JEUB 2LJLA 3C4ZA 4I55E 3RYHE 1IJ5A 2BZBA 4DO0A 3K3OA 4FJOA 2E9XA 4DBRA 2PBIA 4PNIA 3D0TA 2X9HA 2Z6EA 5EK2A 1HS7A 2RP4A 2LHNA 3ETVA 3L09A 2XTLA 3N2GE 3N2KE 2IW5B 3EDVA 4AKLA 5DABA 3RX6A 2XASB 2D0UA 3UT5E 4EYYR 3K8PC 4HTEA 2C5JA 2A2FX 5H6RB 3RC8A 2IAKA 3SS1A 3ZCIA 1US7B 2CEAA 5DQWA 5J1GA 3C98B 2VKJA 3CX6B 4UVBB 1MIWA 2D5UA 2N2NA 1LVFA 4P09A 3ZMZB 3R84B 3WAKA 4O2BE 2L8KA 3RYCE 3P8CD 3PUQA 2JMKA 2V7IA 3Q5XA 3UUNA 2WMOA 4H9OC 4NUUA 5JDMA 1S35A 4MBQA 1MMGA 4ISSA 2BVLA 3C50A 3MA9A 4QKNA 1NWMX 4AQGA 3EVYA 4CI2B 3MACA 4ZS2A 2KZ7B 3UUMA 2Q9QB 1D1AA 1G8XA 3PUAA 4HEAA 2PJQA 4BJNA 3E0ZA 2V1DB 4ZI3D 5HAXA 4DMWA 2VKOA 3E08A 5L2LA 2XHEB 3I9WA 4WBNE 5JRCB 2H7VC 2XQYA 3P7IA 1WRDA 4UVAB 4A56A 1LRZA 2CMRA 2LSJA 1CUNA 2Q9QD 2VL8A 2C5IT 3O1HA 4HFVA 2XAHB 3ZCJA 4MHCA 3N9MA 4IE5A 2NTYA 3JC6D 2KINB 2H7OA 5DQVA 4CI3B 3CX8B 1O3XA 4EYUA 4CXWA 2DWGA 3ZPOA 2PG8A 3PU8A 4PW8A 4ADZA 1D0XA 2YEVC 2ZM8A 3O1IA 3W15B 3NBXX 3FXEB 5JR9A 5HXEA 3IF8B 2HPLA 4U72A 4X1KE 4EIWA 4H9SE 3O4XE 4AKIA 3VKHA 2ODUA 3PE0A 4FI5A 3BQIA 4X1IE 4PJMA 5LA6E 3GN5B 4I43B 4DNDA 3DTOA 4H63H 3AA1B 1MMDA 3MZKB 2SPCA 3PUSA 3CWZB 3HKCE 2KWHA 3DJBA 2X67A 3I9YA 3IHRA 1MNDA 3WAJA 3BK9A 3ONXA 4ILUA 4H9QC 3F31A 1HG2A 2BVMA 4QXBB 3S4UA 4NUVA 3KV9A 4G63A 2V7MA 4PJJA 2DLRA 4EOZB 3LBXA 1UX5A 3AAEB 4L5GA 3AAIA 3RRWA 5J2UE 3N9OA 4KUMB 2MTQA 3PUGA 1NAFA 3K3NA 3ESLA 4EXTA 4H9NC 2IC6A 2K9AA 1BR0A 3IBPA 5FXZA 4GIWA 5JDLA 5JDNA 2LT3A 3I0QA 5E0OA 5C8YE 1BR4A 1VRBA 4GYRA 5ETWA 4DBQA 2X9WA 4WW0A 2NOXA 2Y6XA 4H9RC 4MALA 5IYZE 3CMLA 3Q5WA 2VASA 3PDYA 2ZM2A 5JDHA 4EB6E 4QWNB 2CXDA 4UVCB 1E1HB 2G0UA 2YK0A 5JH7E 1HTJF 4O4HE 1WYCA 4ISTA 3Q2MA 4PK6A 3R6NA 3ZN0B 3BQKA 4JLEA 1MIVA 1HFAA 2V26A 4P0BA 4ERRA 2CWOA 2A72A 2X66A 4O2AE 3E22E 4ZOLE 5AFUL 5BMVE 2ZLYA 5HXSA 2LOPA 3BQLA 3QC9A 5DJQC 2DWKA 2Y48B 1BR1A 3ZEFB 4H9PC 3TKLB 3ZYLA 3KINB 3KV6A 5H6QB 2KMFA 1AJ3A 1U5PA 2DHRA 3UUXB 4KP3C 3RC3A 1KK7A 3V5SA 2K5BB 4GK0E 3OJAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FIO A;  1HS7 A;  2DNX A;  4TX5 A;  4JEH B;  5LG4 A;  1BR0 A;  1S94 A;  1EZ3 A;  5M4Y A;  2XHE B;  1G73 A;  1FEW A;  4JEU B;  3C98 B;  3LG7 A; 
#chains in the Genus database with same CATH topology
 5FXX A;  4QHO A;  5FYM A;  5ABE A;  2XAJ B;  3RF1 A;  3RYI E;  2Q9Q A;  2CHN A;  2XSA A;  4ZS3 A;  2V7K A;  4UR9 A;  4AKR B;  2MOZ A;  2XUE A;  5LNK A;  5JRE A;  2E9X C;  4YHJ A;  3AAA B;  3ZMV B;  4WZX A;  5HEG A;  4UXN B;  1D0Z A;  1QSD A;  3SRZ A;  3JCF A;  3KDS E;  4JI6 T;  3RHW A;  4HN9 A;  4ANJ A;  2QA7 A;  3CQC B;  5JDF A;  3NVO A;  5JTG A;  2NP9 A;  5JVD E;  3MJX A;  3ZYK A;  3GMI A;  4CQI A;  3ZJ1 A;  2X9X A;  5LCY A;  4U74 A;  3KV4 A;  3PTR B;  4KBM B;  2Q9Q C;  4PAG A;  4K0U A;  5L3E B;  3EDU A;  2MBG A;  2ACX A;  4ZZB A;  2UXN B;  4PJL A;  4GK5 E;  2HHH T;  5KMG P;  1E7P A;  2WSS V;  4CI1 B;  3FB2 A;  5AQM B;  2KWI B;  2AXD S;  5FXV A;  4HFH A;  3VU7 H;  3CKD A;  3T1H T;  2MAW A;  3RYF E;  4MLK A;  2BS4 A;  2V6Y B;  3ZC0 A;  3PUX F;  5FY0 A;  2WU5 A;  5AQR B;  1J5E T;  1WR6 A;  2XAG B;  2P9B A;  3ONJ A;  5LXT E;  5LHH B;  2LM2 A;  3CX7 B;  3LFM A;  4IHJ E;  2XQ8 A;  1IJ6 A;  1U4Q A;  2F4V T;  1MMN A;  2PFV A;  4GKK T;  3ZC1 A;  2V8S V;  4TN7 B;  1HCI A;  1X9B A;  2L3L A;  3DP7 A;  4O4I E;  5FKY A;  2ODV A;  2A3D A;  2N1G A;  4AKG A;  2I59 A;  1XDP A;  4XZC A;  4OYJ A;  3M3Z B;  3MXZ A;  5LG4 A;  2CM0 A;  3N9N A;  4BA9 A;  4HKA A;  4UEL A;  4E7S A;  5AQP B;  4ASK A;  3CQX C;  2VK9 A;  2LSK A;  1D1B A;  2X51 A;  2YU1 A;  4TWF A;  4HWF A;  3H3M A;  3KBT A;  1IBK T;  3UUL A;  1HR0 T;  2CBJ A;  2LHR A;  4DUZ T;  2H89 A;  4ZZC A;  3FBZ A;  3K1S A;  4ZI2 D;  5JR9 B;  2W61 A;  2WBL A;  4ILB A;  2WZH A;  5AQF B;  4V1A v;  4UIG A;  1YQ4 A;  2UXB T;  1XMQ T;  2VUR A;  3CQG B;  3P4P A;  5CGM A;  3F57 A;  4EZ4 A;  4TV9 E;  2BKO A;  4WNK A;  4ZI7 E;  2FJD A;  5IWA T;  4YLH A;  3QNU A;  1ZV4 X;  2CWY A;  1X79 A;  5TAO A;  5J2T E;  3LBX B;  5LHG B;  1Y01 A;  2V6X A;  4IDN A;  2YDQ A;  5LOV E;  3RIF A;  2VVS A;  3NRY A;  2BBH A;  4TZ4 C;  1OWA A;  3LK2 B;  4CXX A;  2W66 A;  4DR3 T;  2CCQ A;  3F2E A;  2KLQ A;  2NWB A;  2UUA T;  1YKE B;  1OED E;  2X68 A;  4UV9 B;  4WYV A;  2UXX B;  3ZT7 A;  2V6Y A;  3MK7 C;  2XZE A;  4I55 E;  3RYH E;  3K3O A;  4PNI A;  3D0T A;  2X9H A;  1HS7 A;  2XTL A;  3N2K E;  4YSX A;  2XAS B;  2D0U A;  3K8P C;  4HTE A;  3RC8 A;  5DQW A;  1N33 T;  4P09 A;  3R84 B;  4P1N A;  1NEN A;  4H9O C;  5JDM A;  1S35 A;  2YOE A;  1MMG A;  1N34 T;  4QKN A;  4AQG A;  4CI2 B;  2OV9 A;  4ZS2 A;  2XQ3 A;  1G8X A;  3PUA A;  4HEA A;  5ABH A;  2E5L T;  4DMW A;  2CMR A;  2VL8 A;  3EI0 A;  3N9M A;  2NTY A;  3P4W A;  2H7O A;  4CI3 B;  4EYU A;  4DR6 T;  4PW8 A;  4ADZ A;  2YEV C;  2ZM8 A;  3W15 B;  3QB5 K;  5JR9 A;  5HXE A;  3IF8 B;  5LB7 B;  4EIW A;  4DV7 T;  3VKH A;  4U7I A;  4HWI B;  2BKP A;  1UGO A;  4KHP T;  2BG9 E;  3CWZ B;  1MND A;  3TLS A;  3ONX A;  4JI5 T;  2BVM A;  4NUV A;  2NR4 A;  4ZEY A;  4G63 A;  2DLR A;  3LBX A;  2WDQ A;  3RRW A;  2LRK A;  3ZKR A;  2LT3 A;  3TLU A;  5E0O A;  4DR1 T;  4DBQ A;  2X9W A;  4WW0 A;  4H9R C;  3Q5W A;  2CHO A;  4EB6 E;  2LLY A;  5JH7 E;  4O4H E;  5AQS B;  3R6N A;  3ZN0 B;  1HFA A;  4JV5 T;  4O2A E;  3Q5D A;  5AFU L;  4ZOL E;  2VQE T;  2J47 A;  4DUY T;  3ZYL A;  3KIN B;  5H6Q B;  3B5M A;  3P4R A;  3RC3 A;  4GK0 E;  1I94 T;  5LP6 E;  1D1C A;  2VKH A;  1LKX A;  2HN1 A;  4UV8 B;  2BG9 B;  3C64 A;  4I4T E;  5LYJ E;  3QUJ A;  2VWA A;  1YW0 A;  1N36 T;  3P4Q A;  2YDS A;  3TLT A;  2M6I A;  3AA7 B;  2X9Y A;  5FVL A;  4PK5 A;  2GK9 A;  2AE9 A;  3KV5 A;  3C4W A;  5LJM A;  2XM1 A;  4JEH B;  2XJ7 A;  3UU3 A;  3AEF A;  4QXH B;  4PFP A;  4B3M T;  4U3C A;  2KSR A;  4YTN A;  4IE4 A;  3AXJ B;  1KNZ A;  3O9X A;  2UXC T;  2VQF T;  4OHF A;  3AEG A;  1FEW A;  1UUS A;  4ZHQ E;  4LML A;  2B1E A;  3PUW F;  4C91 A;  4DR2 T;  3AE6 A;  5HXC A;  2XPK A;  5KDM C;  4EGW A;  1SA0 E;  5FL1 A;  3NZP A;  4CXY A;  3WI3 A;  5JDG A;  1VOM A;  2K24 A;  2A9U A;  3LG7 A;  2WMN A;  1M7K A;  2QGS A;  5CA0 E;  5LG3 A;  2JQH A;  1H7C A;  3AEE A;  1BR2 A;  4QX8 B;  2IIU A;  2FBW A;  5LBM A;  4TV8 E;  3LK4 2;  2PTF A;  1HF8 A;  1OED C;  1IBL T;  3U78 A;  3PUV F;  4KMC A;  4XBF B;  3H3A A;  2WWU A;  4XAX B;  4DID B;  2H88 A;  4IDZ A;  2XQA A;  2VL0 A;  2ZM6 T;  5FXW A;  3T8O A;  4DV3 T;  4LFC T;  2JMH A;  3FZL B;  3VKG A;  4JI1 T;  2OA5 A;  2BG9 A;  5LBQ B;  3PUY F;  1UK5 A;  3RI5 A;  3KFW X;  2NW7 A;  2UUB T;  1S94 A;  5HEJ A;  1IBM T;  4AKH A;  1T7S A;  3AE8 A;  4TUY E;  1FIO A;  5AQG B;  3LJC A;  3SOL A;  4IE0 A;  3K3Q C;  5HXR A;  4DMV A;  3FZK B;  4X62 T;  3CIR A;  2DI4 A;  1KF6 A;  2CXL A;  4AIU A;  3PU3 A;  2YN6 A;  5EK3 A;  3UQ7 A;  3AXJ A;  4B3T T;  3OBV E;  2CXF A;  2CLY B;  3OTO T;  4BJM A;  2IC9 A;  5A1L A;  1NEK A;  1W09 A;  2UU9 T;  2D9D A;  3N9L A;  4MFR A;  3JC6 C;  4L9I A;  2IML A;  4J2C A;  4F6R C;  3AE7 A;  4CZZ B;  3UU8 A;  3ZYM A;  2K3W A;  3I1A A;  5AQV B;  3UFE A;  5L3F B;  4DR7 T;  2XM2 A;  3I0O A;  5AQT B;  3CPZ A;  2VKD A;  1VCT A;  1SUM B;  4HGA A;  2DL1 A;  1IZN B;  1ZKE A;  4O4L E;  2YDR A;  4X66 T;  3PV0 F;  2YU2 A;  1UUR A;  1IJ5 A;  1YQ3 A;  5FL0 A;  3P4S A;  2PBI A;  4JI7 T;  5EK2 A;  2LHN A;  1J5W A;  4X64 T;  2IW5 B;  3EDV A;  3UT5 E;  4JI8 T;  2BS2 A;  3NKZ A;  4YY3 T;  3C98 B;  3TLV A;  2X0H A;  1KFY A;  1MIW A;  3WAK A;  3Q5X A;  5ABF B;  4A97 A;  4MBQ A;  2BVL A;  3EHZ A;  4CN4 A;  5J0Z A;  1NWM X;  4HFC A;  2KZ7 B;  3QOF A;  4LF4 T;  2V1D B;  5HAX A;  2XHE B;  4WBN E;  2H7V C;  2XQY A;  3P7I A;  3ZST A;  4A56 A;  1LRZ A;  1CUN A;  1E2A A;  2RPA A;  1HNW T;  3CK6 A;  3ZCJ A;  2XAH B;  3L8R A;  2V5D A;  3P50 A;  1O3X A;  4YXD A;  1L0V A;  2IUB A;  4U72 A;  2WB5 A;  4AKI A;  3VR9 A;  1W0B A;  3BQI A;  4X1I E;  4PJM A;  4U2Z A;  3GN5 B;  4DND A;  3DTO A;  3AA1 B;  1MMD A;  3MZK B;  2SPC A;  3PUS A;  3HKC E;  2KWH A;  1CHU A;  2X67 A;  5AQQ B;  4H9Q C;  4QXB B;  4CN6 A;  2JQK A;  4PJJ A;  4EOZ B;  1UX5 A;  3LDQ B;  3AAE B;  1KEY A;  4NXN T;  2MTQ A;  3PUG A;  3K3N A;  2JQ9 A;  4EXT A;  1XZY A;  2IC6 A;  1BR0 A;  5FXZ A;  3I0Q A;  3AEB A;  4COF A;  2NOX A;  4Z90 A;  2ZM2 A;  1QLB A;  2CXD A;  4UVC B;  1E1H B;  2IHR 1;  2G0U A;  1HTJ F;  4F8H A;  4PK6 A;  4JI3 T;  3JAF A;  4KX6 A;  2X66 A;  3E22 E;  2LOP A;  2I0M A;  3BQL A;  3QC9 A;  2Y48 B;  1BR1 A;  5F5W A;  3ZEF B;  4I0U A;  3LSV A;  3ZSS A;  1W9R A;  3UU4 A;  4KP3 C;  3V5S A;  4C90 A;  2WP9 A;  1YD8 G;  3EAM A;  3Q9D A;  5ABF A;  3ZN1 B;  4IIJ E;  5AQK B;  2V5C A;  2FJE A;  2JJ9 A;  4X20 E;  3H37 A;  2H3R A;  4BAY B;  1T72 A;  2BKN A;  5FY1 A;  2XQ7 A;  3VRB A;  1ZP0 A;  5C2T A;  1OXZ A;  3FZF B;  2N9D A;  1XNR T;  1R8I A;  4YSY A;  4HFI A;  5KXJ A;  2EHO B;  4IGU A;  4GOU A;  5FMN A;  2E5V A;  3AE1 A;  3GN5 A;  2EHO D;  2QYW A;  3NRX A;  2C5K T;  5AQU B;  2QVA A;  2ZM0 A;  4AXP A;  3ANW B;  3UU6 A;  4U2Y A;  3ABV A;  5FVK A;  3AVS A;  1DU2 A;  4OFZ A;  4LF7 T;  4B3S T;  1Z8U A;  3ZJ2 A;  3PJA J;  1MNE A;  4ZI2 C;  4PFO A;  3B57 A;  4HFB A;  4LF5 T;  1HG5 A;  1SE7 A;  4E7Z A;  2J1D G;  3M65 A;  3JAD A;  1JNZ A;  5JR9 C;  2HH7 A;  2L9Q A;  4UF0 B;  3A5X A;  4EZH A;  3RKO A;  2LOS A;  2KND A;  2XAF B;  2X0Y A;  3HKD E;  4JYA T;  3J7Y q;  3OVU A;  2RA1 A;  4IE6 A;  3HKB E;  2LM9 A;  3SWH A;  5L3G B;  2E9X B;  3AB3 B;  2LKH A;  3AE9 A;  2JQQ A;  3UU5 A;  4B3R T;  4O4J E;  3OYZ A;  2LSI A;  2E9X D;  5HYA A;  3AEA A;  2MYS A;  2W2U A;  4YJ3 E;  2W00 A;  5BR8 T;  5AQJ B;  3N9Q A;  5L3B B;  2X0L B;  5FNV E;  1IAP A;  4GYS A;  1YKH B;  5HXH A;  3UQ4 A;  4DV4 T;  3GWH A;  5EZY E;  1WYB A;  3HKE E;  3RRC A;  2NTX A;  4HFD A;  2YIN A;  4OK0 A;  3LK3 B;  2LSG A;  4NPP A;  4DV1 T;  2D2S A;  2KT9 A;  3RIU A;  3ZT5 A;  3L3P A;  1ZEE A;  2WS3 A;  3O1J A;  1UCU A;  1QUU A;  5CB4 E;  4TNW A;  4X65 T;  1Y64 B;  2EHO A;  3ZMT B;  4AI6 A;  5IUX A;  4G2A A;  5C3J A;  4DR4 T;  3T1Y T;  5F8P A;  3ETU A;  4PJN A;  3ANW A;  3RPU A;  1D0Y A;  5CA1 E;  5JDQ A;  4HWD A;  3IEE A;  3OKQ A;  3IA3 A;  5CJ5 A;  4Z8X A;  4IDP A;  4U31 A;  4PK4 A;  4HWC A;  5AQH B;  2W63 A;  2DNX A;  4GKJ T;  2BDE A;  2XSB A;  3TLW A;  5LMN T;  2KXP B;  2LSY A;  2M6B A;  2ES0 A;  3NWI A;  4LFB T;  2M67 A;  3FXD B;  4UF0 A;  4QX7 B;  2EHO C;  3VHL A;  1T98 A;  4ILA A;  3J9X 1;  4IDO A;  3FZM B;  2E9X A;  2BBJ A;  2Z6E A;  5HEO A;  3RKG A;  2RP4 A;  5AQI B;  2W4X A;  3ETV A;  3N2G E;  4AKL A;  3RX6 A;  4YSZ A;  2IAK A;  3ZCI A;  2CEA A;  5AQN B;  4YT0 A;  4UVB B;  3ZMZ B;  2N2N A;  1LVF A;  4O2B E;  3RYC E;  3PUQ A;  2JMK A;  3UUN A;  5CFB A;  3AE4 A;  5HCM A;  4ZXL A;  4NUU A;  3RLF F;  3MA9 A;  3EVY A;  4YTM A;  4ZI3 D;  2VKO A;  5JRC B;  4UVA B;  1WRD A;  4AIS A;  2C5I T;  3O1H A;  2WCA A;  4MHC A;  4IL9 A;  5HEU A;  5DQV A;  2J4G A;  5HCJ A;  3CX8 B;  4CXW A;  2UXD T;  4LMJ A;  2PG8 A;  1D0X A;  4A98 A;  3O1I A;  3NBX X;  3AEC A;  2J62 A;  4X1K E;  5HEH A;  4I43 B;  4H63 H;  5AQO B;  2BG9 C;  5L47 A;  3DJB A;  3IHR A;  4ILU A;  2CPT A;  4L5G A;  3AAI A;  3RGL A;  4KUM B;  1NAF A;  2XQ5 A;  3EAB A;  2K9A A;  2WZI A;  3A7M A;  1XWM A;  4GIW A;  5JDL A;  4LF9 T;  1I6Z A;  1VRB A;  5ETW A;  4CN1 A;  2Y6X A;  4MAL A;  2VVN A;  5IYZ E;  4KHZ F;  3PDY A;  3VRA A;  5JDH A;  4QWN B;  1WYC A;  4IST A;  3Q2M A;  3SFE A;  1J1J A;  3RQW A;  3BQK A;  1MIV A;  5HXS A;  4DV2 T;  2UUC T;  4IRE A;  4DV0 T;  3KV6 A;  2KMF A;  1AJ3 A;  2DHR A;  4IT4 A;  3G06 A;  3UUX B;  4U33 A;  1KK7 A;  2WY2 A;  2K5B B;  4A5X A;  3OPC A;  4X1Y E;  2ZMA A;  1KNP A;  2BS3 A;  2CRB A;  3PJA A;  2E8I A;  5LGT B;  4X5T A;  2JRK A;  2LEH A;  4P0A A;  3N5L A;  4EAH A;  4QXC B;  2VB6 A;  2W62 A;  1V9D A;  5JRC A;  4TX5 A;  5ADX L;  4OYK A;  3Q5E A;  4M1P A;  4ILC A;  3V5U A;  3RIA A;  5KX5 E;  2V7L A;  4TWD A;  1GQE A;  3ZLI A;  4NIQ A;  2CE7 A;  3EUH A;  4KI0 F;  1FMV A;  2HPJ A;  4JBW F;  2WQY A;  5F3J A;  4HE8 A;  2E2A A;  3JAE A;  1G73 A;  3UTK A;  4L0R A;  4JI4 T;  2YKS A;  4ZI3 C;  2WM9 A;  5L3D B;  2OLT A;  1T8B A;  2FJB A;  1FMW A;  3AVR A;  1FJG T;  1Z0P A;  4DV6 T;  4B6X A;  5IHY A;  4IE7 A;  1XNQ T;  3KBU A;  4H63 V;  1JNR A;  2V7J A;  4JI2 T;  1YXR A;  5LGN B;  3HI2 A;  4OX9 T;  1XMO T;  2XQ6 A;  1W0A A;  3OYX A;  2CLY C;  4LF6 T;  2FJA A;  3FHN A;  2I6H A;  3QB5 A;  4LF8 T;  3HR0 A;  2K48 A;  2MPK A;  3MKD A;  3CVR A;  1ZHC A;  1B7T A;  3C4X A;  5FY7 A;  1MMA A;  3KVB A;  5EK4 A;  4JUY A;  3AA0 B;  3FBL A;  3UFG A;  2LE8 A;  1XDO A;  3KVA A;  2B76 A;  1WR0 A;  2ACZ A;  3HA4 A;  4AQY T;  2WAU A;  2D0T A;  2LRL A;  1LVK A;  5FP3 A;  2NW8 A;  4TNV A;  3C51 A;  1EZ3 A;  3U3I A;  2R6G F;  3ONL C;  2NW9 A;  2XY8 B;  1UX4 A;  1HNZ T;  5JQG E;  3ZMS B;  3HL6 A;  1HX8 A;  4O8S A;  2C0S A;  5L4E A;  4NXM T;  3PUR A;  3NZQ A;  2DCF A;  4QH5 A;  4I50 E;  4WBO A;  3RH3 A;  2JPF A;  5M4Y A;  3B13 A;  4EEB A;  3N2O A;  4AQF A;  4YHH T;  1WFD A;  5LGU B;  2CBI A;  4YFS A;  2WDR A;  3RQU A;  3AA6 B;  3GA8 A;  2QRX A;  4K0K T;  2WU2 A;  2CA5 A;  2XAQ B;  3N9P A;  2WDV A;  4DR5 T;  5HWX A;  1OED B;  1SHZ C;  5GON E;  5HWY A;  2W0G A;  4DVD A;  4Z91 A;  5L3C B;  1WLX A;  4JI0 T;  3ZMU B;  2IDO B;  2Y8D A;  4YJ2 E;  1MIY A;  3QK6 A;  4IL4 A;  2XQ9 A;  1VCS A;  2FUP A;  4N78 D;  5LHI B;  4AQF C;  5AQL B;  4UEM A;  5LJN A;  3SFD A;  3AE3 A;  4JEU B;  2LJL A;  4Q25 A;  3C4Z A;  4QH4 A;  2BZB A;  1WCR A;  4DO0 A;  4FJO A;  3A8Y C;  4DBR A;  1M62 A;  3UUB A;  5LMU T;  3L09 A;  5DAB A;  4EYY R;  2C5J A;  2A2F X;  5H6R B;  3SS1 A;  4LMK A;  1US7 B;  5J1G A;  2VKJ A;  3CX6 B;  2D5U A;  1KNR A;  2L8K A;  3P8C D;  4TWH A;  2V7I A;  2WMO A;  2LKG A;  3AED A;  4ISS A;  3C50 A;  3MAC A;  3UUM A;  2Q9Q B;  1D1A A;  1ZOY A;  2PJQ A;  4BJN A;  3E0Z A;  4YTP A;  3E08 A;  5L2L A;  2HN2 A;  3I9W A;  4IDQ A;  2LSJ A;  2Q9Q D;  4HFV A;  3FZH B;  4QH1 A;  4IE5 A;  3JC6 D;  2KIN B;  3AE2 A;  2DWG A;  3ZPO A;  4HWH A;  3PU8 A;  3AE5 A;  4HFE A;  4U7Y A;  3FXE B;  2HPL A;  4H9S E;  3O4X E;  2ODU A;  3PE0 A;  3ZT6 A;  4FI5 A;  5LA6 E;  4EED A;  1OED A;  4LFA T;  3I9Y A;  3WAJ A;  3BK9 A;  3F31 A;  1HG2 A;  3S4U A;  1HX1 B;  3KV9 A;  2WWV A;  2V7M A;  3RIU C;  5J2U E;  3N9O A;  3ESL A;  4H9N C;  3IBP A;  5JDN A;  5L4H A;  5C8Y E;  1BR4 A;  4GYR A;  3VR8 A;  3CML A;  2VAS A;  3L39 A;  2XQ4 A;  1N32 T;  2YK0 A;  4JLE A;  2V26 A;  5ABG A;  4DV5 T;  4P0B A;  4ERR A;  2CWO A;  2A72 A;  5BMV E;  2ZLY A;  5DJQ C;  2DWK A;  2JIW A;  4H9P C;  3TKL B;  2W67 A;  1U5P A;  1HNX T;  3X1D A;  3PUZ F;  4EV6 A;  3OJA A; 
#chains in the Genus database with same CATH homology
 4X1Y E;  4C90 A;  5FXX A;  1YD8 G;  2ZMA A;  3Q9D A;  4QHO A;  5FYM A;  5LP6 E;  3ZN1 B;  2E8I A;  4IIJ E;  2XAJ B;  5LGT B;  2JJ9 A;  1D1C A;  2JRK A;  2VKH A;  2LEH A;  4X20 E;  3RYI E;  4P0A A;  3H37 A;  3N5L A;  1LKX A;  4EAH A;  2H3R A;  4UV8 B;  3C64 A;  4I4T E;  2Q9Q A;  4QXC B;  5LYJ E;  3QUJ A;  2VWA A;  4BAY B;  4ZS3 A;  1YW0 A;  2V7K A;  2VB6 A;  2W62 A;  5FY1 A;  4AKR B;  1V9D A;  2MOZ A;  2XUE A;  5LNK A;  5JRC A;  5JRE A;  2E9X C;  4YHJ A;  3AAA B;  4TX5 A;  5ADX L;  1OXZ A;  3ZMV B;  4OYK A;  3AA7 B;  4UXN B;  4M1P A;  2N9D A;  1D0Z A;  1QSD A;  3SRZ A;  2X9Y A;  4PK5 A;  3V5U A;  2GK9 A;  5KX5 E;  3KV5 A;  3KDS E;  2V7L A;  3C4W A;  5LJM A;  4JEH B;  4QXH B;  4PFP A;  3ZLI A;  4HN9 A;  2EHO B;  4IGU A;  2QA7 A;  4ANJ A;  3CQC B;  2CE7 A;  3EUH A;  5JDF A;  4GOU A;  1FMV A;  2NP9 A;  2HPJ A;  5FMN A;  4IE4 A;  5F3J A;  3GN5 A;  3MJX A;  5JVD E;  3ZYK A;  1KNZ A;  2EHO D;  3O9X A;  4HE8 A;  3GMI A;  3NRX A;  4CQI A;  2C5K T;  3ZJ1 A;  1G73 A;  4OHF A;  1FEW A;  2ZM0 A;  4L0R A;  3UTK A;  4ZHQ E;  4AXP A;  4ZI3 C;  2X9X A;  5LCY A;  3ANW B;  2WM9 A;  5L3D B;  2B1E A;  4C91 A;  4U74 A;  1FMW A;  3AVR A;  3KV4 A;  3PTR B;  4KBM B;  2Q9Q C;  5HXC A;  3AVS A;  4PAG A;  4OFZ A;  1Z0P A;  3ZJ2 A;  5KDM C;  1SA0 E;  4K0U A;  5L3E B;  3NZP A;  3EDU A;  2MBG A;  4CXY A;  3WI3 A;  4B6X A;  2ACX A;  5IHY A;  2UXN B;  4PJL A;  5JDG A;  1VOM A;  4GK5 E;  4IE7 A;  1MNE A;  4ZI2 C;  2K24 A;  4PFO A;  3B57 A;  3LG7 A;  5KMG P;  1HG5 A;  3KBU A;  2WMN A;  4H63 V;  2WSS V;  2QGS A;  2V7J A;  4CI1 B;  5CA0 E;  4E7Z A;  5LGN B;  2J1D G;  3FB2 A;  3HI2 A;  3M65 A;  1H7C A;  5JR9 C;  1BR2 A;  2KWI B;  4QX8 B;  2HH7 A;  5FXV A;  2L9Q A;  4UF0 B;  3A5X A;  3VU7 H;  4EZH A;  3RKO A;  3OYX A;  2CLY C;  3CKD A;  5LBM A;  2LOS A;  2KND A;  2XAF B;  3FHN A;  4TV8 E;  3RYF E;  4MLK A;  3HR0 A;  3ZC0 A;  3HKD E;  5FY0 A;  3LK4 2;  1HF8 A;  3J7Y q;  2RA1 A;  1WR6 A;  2XAG B;  4IE6 A;  2K48 A;  3MKD A;  2P9B A;  3HKB E;  3U78 A;  2LM9 A;  3SWH A;  5L3G B;  5LHH B;  5LXT E;  2E9X B;  3CVR A;  4KMC A;  3CX7 B;  3LFM A;  4XBF B;  3AB3 B;  3H3A A;  1ZHC A;  2JQQ A;  1IJ6 A;  4IHJ E;  1U4Q A;  1B7T A;  1MMN A;  2PFV A;  3C4X A;  2WWU A;  4XAX B;  4O4J E;  3ZC1 A;  3OYZ A;  5FY7 A;  1MMA A;  4IDZ A;  2LSI A;  2E9X D;  5HYA A;  3KVB A;  4TN7 B;  1HCI A;  5EK4 A;  2L3L A;  2MYS A;  3DP7 A;  4O4I E;  4JUY A;  4YJ3 E;  2W00 A;  2ODV A;  2A3D A;  2N1G A;  3AA0 B;  5FXW A;  3T8O A;  3FBL A;  4AKG A;  2I59 A;  2LE8 A;  4XZC A;  3N9Q A;  3KVA A;  4OYJ A;  5L3B B;  2X0L B;  3HA4 A;  2JMH A;  5FNV E;  2WAU A;  2D0T A;  1IAP A;  4GYS A;  3VKG A;  1LVK A;  3MXZ A;  1YKH B;  2NW8 A;  2OA5 A;  3C51 A;  5FP3 A;  1EZ3 A;  5LG4 A;  3U3I A;  5LBQ B;  2CM0 A;  5HXH A;  3GWH A;  3N9N A;  4BA9 A;  3KFW X;  4HKA A;  5EZY E;  2NW7 A;  2NW9 A;  1S94 A;  1WYB A;  3HKE E;  4UEL A;  3RRC A;  4E7S A;  1UX4 A;  4ASK A;  2NTX A;  3CQX C;  2VK9 A;  5JQG E;  2LSK A;  2YIN A;  3ZMS B;  4AKH A;  1D1B A;  3HL6 A;  1HX8 A;  2X51 A;  2C0S A;  2YU1 A;  3LK3 B;  4O8S A;  4OK0 A;  2LSG A;  4TUY E;  1FIO A;  3SOL A;  2D2S A;  3LJC A;  3NZQ A;  3PUR A;  4IE0 A;  2DCF A;  2KT9 A;  3K3Q C;  5HXR A;  3L3P A;  1ZEE A;  4I50 E;  4WBO A;  3RH3 A;  4DMV A;  3KBT A;  3O1J A;  2JPF A;  1UCU A;  5M4Y A;  3UUL A;  1QUU A;  3B13 A;  5CB4 E;  3N2O A;  4AQF A;  2DI4 A;  2LHR A;  1Y64 B;  2EHO A;  3ZMT B;  4AI6 A;  5LGU B;  2CXL A;  3PU3 A;  4YFS A;  3FBZ A;  5EK3 A;  4ZI2 D;  3AA6 B;  5JR9 B;  3GA8 A;  2W61 A;  2WBL A;  4G2A A;  3OBV E;  2CXF A;  4V1A v;  2CA5 A;  2CLY B;  2XAQ B;  4UIG A;  3ETU A;  5F8P A;  3N9P A;  5HWX A;  4BJM A;  2IC9 A;  3CQG B;  5A1L A;  3F57 A;  4EZ4 A;  4PJN A;  3ANW A;  4TV9 E;  3RPU A;  4WNK A;  1SHZ C;  5GON E;  4ZI7 E;  5HWY A;  4YLH A;  1D0Y A;  2W0G A;  3N9L A;  4DVD A;  4MFR A;  5CA1 E;  3JC6 C;  1ZV4 X;  1WLX A;  3IEE A;  4L9I A;  5JDQ A;  3OKQ A;  4J2C A;  3ZMU B;  5L3C B;  4F6R C;  2CWY A;  4CZZ B;  1X79 A;  3ZYM A;  5TAO A;  4Z8X A;  5J2T E;  2Y8D A;  3I1A A;  3LBX B;  5LHG B;  4PK4 A;  4YJ2 E;  1MIY A;  3QK6 A;  3UFE A;  5LOV E;  5L3F B;  3NRY A;  3I0O A;  4TZ4 C;  1OWA A;  2W63 A;  2DNX A;  3LK2 B;  2BDE A;  2VKD A;  3CPZ A;  4CXX A;  4HGA A;  2CCQ A;  2KXP B;  3F2E A;  2LSY A;  2KLQ A;  1IZN B;  2ES0 A;  2NWB A;  1ZKE A;  4N78 D;  5LHI B;  2M67 A;  3FXD B;  4AQF C;  1YKE B;  4QX7 B;  4UEM A;  2EHO C;  4UF0 A;  3VHL A;  5LJN A;  1T98 A;  4O4L E;  2X68 A;  4UV9 B;  2UXX B;  2YU2 A;  3J9X 1;  3MK7 C;  4JEU B;  2LJL A;  3C4Z A;  4I55 E;  3RYH E;  1IJ5 A;  2BZB A;  4DO0 A;  3K3O A;  4FJO A;  2E9X A;  4DBR A;  2PBI A;  4PNI A;  3D0T A;  2X9H A;  2Z6E A;  5EK2 A;  1HS7 A;  2RP4 A;  2LHN A;  3ETV A;  3L09 A;  2XTL A;  3N2G E;  3N2K E;  2IW5 B;  3EDV A;  4AKL A;  5DAB A;  3RX6 A;  2XAS B;  2D0U A;  3UT5 E;  4EYY R;  3K8P C;  4HTE A;  2C5J A;  2A2F X;  5H6R B;  3RC8 A;  2IAK A;  3SS1 A;  3ZCI A;  1US7 B;  2CEA A;  5DQW A;  5J1G A;  3C98 B;  2VKJ A;  3CX6 B;  4UVB B;  1MIW A;  2D5U A;  2N2N A;  1LVF A;  4P09 A;  3ZMZ B;  3R84 B;  3WAK A;  4O2B E;  2L8K A;  3RYC E;  3P8C D;  3PUQ A;  2JMK A;  2V7I A;  3Q5X A;  3UUN A;  2WMO A;  4H9O C;  4NUU A;  5JDM A;  1S35 A;  4MBQ A;  1MMG A;  4ISS A;  2BVL A;  3C50 A;  3MA9 A;  4QKN A;  1NWM X;  4AQG A;  3EVY A;  4CI2 B;  3MAC A;  4ZS2 A;  2KZ7 B;  3UUM A;  2Q9Q B;  1D1A A;  1G8X A;  3PUA A;  4HEA A;  2PJQ A;  4BJN A;  3E0Z A;  2V1D B;  4ZI3 D;  5HAX A;  4DMW A;  2VKO A;  3E08 A;  5L2L A;  2XHE B;  3I9W A;  4WBN E;  5JRC B;  2H7V C;  2XQY A;  3P7I A;  1WRD A;  4UVA B;  4A56 A;  1LRZ A;  2CMR A;  2LSJ A;  1CUN A;  2Q9Q D;  2VL8 A;  2C5I T;  3O1H A;  4HFV A;  2XAH B;  3ZCJ A;  4MHC A;  3N9M A;  4IE5 A;  2NTY A;  3JC6 D;  2KIN B;  2H7O A;  5DQV A;  4CI3 B;  3CX8 B;  1O3X A;  4EYU A;  4CXW A;  2DWG A;  3ZPO A;  2PG8 A;  3PU8 A;  4PW8 A;  4ADZ A;  1D0X A;  2YEV C;  2ZM8 A;  3O1I A;  3W15 B;  3NBX X;  3FXE B;  5JR9 A;  5HXE A;  3IF8 B;  2HPL A;  4U72 A;  4X1K E;  4EIW A;  4H9S E;  3O4X E;  4AKI A;  3VKH A;  2ODU A;  3PE0 A;  4FI5 A;  3BQI A;  4X1I E;  4PJM A;  5LA6 E;  3GN5 B;  4I43 B;  4DND A;  3DTO A;  4H63 H;  3AA1 B;  1MMD A;  3MZK B;  2SPC A;  3PUS A;  3CWZ B;  3HKC E;  2KWH A;  3DJB A;  2X67 A;  3I9Y A;  3IHR A;  1MND A;  3WAJ A;  3BK9 A;  3ONX A;  4ILU A;  4H9Q C;  3F31 A;  1HG2 A;  2BVM A;  4QXB B;  3S4U A;  4NUV A;  3KV9 A;  4G63 A;  2V7M A;  4PJJ A;  2DLR A;  4EOZ B;  3LBX A;  1UX5 A;  3AAE B;  4L5G A;  3AAI A;  3RRW A;  5J2U E;  3N9O A;  4KUM B;  2MTQ A;  3PUG A;  1NAF A;  3K3N A;  3ESL A;  4EXT A;  4H9N C;  2IC6 A;  2K9A A;  1BR0 A;  3IBP A;  5FXZ A;  4GIW A;  5JDL A;  5JDN A;  2LT3 A;  3I0Q A;  5E0O A;  5C8Y E;  1BR4 A;  1VRB A;  4GYR A;  5ETW A;  4DBQ A;  2X9W A;  4WW0 A;  2NOX A;  2Y6X A;  4H9R C;  4MAL A;  5IYZ E;  3CML A;  3Q5W A;  2VAS A;  3PDY A;  2ZM2 A;  5JDH A;  4EB6 E;  4QWN B;  2CXD A;  4UVC B;  1E1H B;  2G0U A;  2YK0 A;  5JH7 E;  1HTJ F;  4O4H E;  1WYC A;  4IST A;  3Q2M A;  4PK6 A;  3R6N A;  3ZN0 B;  3BQK A;  4JLE A;  1MIV A;  1HFA A;  2V26 A;  4P0B A;  4ERR A;  2CWO A;  2A72 A;  2X66 A;  4O2A E;  3E22 E;  4ZOL E;  5AFU L;  5BMV E;  2ZLY A;  5HXS A;  2LOP A;  3BQL A;  3QC9 A;  5DJQ C;  2DWK A;  2Y48 B;  1BR1 A;  3ZEF B;  4H9P C;  3TKL B;  3ZYL A;  3KIN B;  3KV6 A;  5H6Q B;  2KMF A;  1AJ3 A;  1U5P A;  2DHR A;  3UUX B;  4KP3 C;  3RC3 A;  1KK7 A;  3V5S A;  2K5B B;  4GK0 E;  3OJA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...