4JEUB

Crystal structure of munc18a and syntaxin1 with native n-terminus complex
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
242
structure length
225
Chain Sequence
KDRTQELRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Syntaxin1a variants lacking an N-peptide or bearing the LE mutation bind to Munc18a in a closed conformation.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis/exocytosis
molecule keywords Syntaxin-binding protein 1
total genus 90
structure length 225
sequence length 242
ec nomenclature
pdb deposition date 2013-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00804 Syntaxin Syntaxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4jeuB00
5LG4A 1FEWA 5M4YA 1G73A 1HS7A 2DNXA 1FIOA 1S94A 4JEUB 4JEHB 3LG7A 2XHEB 1BR0A 3C98B 1EZ3A 4TX5A
chains in the Genus database with same CATH superfamily
5HCJA 3NRXA 5LGNB 5LMUT 4IDOA 2DCFA 1IZNB 2N1GA 2XAHB 3IA3A 3NWIA 3ZMTB 1ZHCA 3O1HA 4DV0T 4WZXA 3ZJ2A 3UQ7A 4EB6E 3VKHA 5JR9B 4IT4A 2L8KA 3Q5EA 4UELA 3K8PC 4B6XA 3K3QC 4DBRA 4MFRA 4ZI2C 3DJBA 2V26A 3FZMB 1KFYA 2Q9QC 3ZMZB 1YW0A 3QK6A 3S4UA 4YTNA 4DV3T 4ZXLA 1O3XA 3AE5A 4JI8T 1KNRA 3FXDB 1H7CA 4I0UA 4DV5T 4AISA 1YXRA 1S35A 2BKOA 3ZPOA 4UF0B 5AQQB 1UGOA 4LMKA 4CI3B 2VQET 5FNVE 4B3TT 4GK0E 1ZV4X 3ZT7A 3TKLB 3A7MA 3HKDE 2QGSA 1OEDE 1I6ZA 2K48A 2VB6A 2NOXA 2CA5A 2EHOA 2LM9A 2NW9A 1N36T 4HWHA 3RYHE 2YDSA 2KNDA 4IHJE 1WR6A 2YN6A 1OEDB 3C4XA 3K3NA 4IDNA 2MBGA 1IBLT 2CXLA 3ONJA 4HEAA 4EOZB 3WI3A 3FBLA 4ZI2D 5IWAT 2LHNA 3UQ4A 3O1JA 4V1Av 1NAFA 4JI0T 2V5DA 4HFDA 5FY0A 4P1NA 3UU4A 1N33T 3LBXA 4X1IE 2K5BB 3LK3B 5HAXA 4ZI3C 4MBQA 3ZT5A 4AKLA 1LKXA 5C2TA 2KXPB 2LHRA 3O1IA 3WAKA 1N32T 2WS3A 1XNQT 1T8BA 2HPJA 3C4ZA 4LFBT 3N9LA 5FYMA 2BG9B 2DWKA 2YINA 2CM0A 2UXNB 2P9BA 3L39A 4JBWF 3RKOA 1HNZT 4NXMT 3GWHA 4U74A 3SS1A 3ZKRA 4K0UA 5FY7A 1OEDA 4DMVA 2E5LT 3AA1B 3Q9DA 4O2AE 2MTQA 3R84B 1M62A 1MIVA 2EHOB 3LDQB 1QLBA 3ONXA 3PJAJ 5AQHB 3Q2MA 3RYFE 3ZSTA 2XQYA 5AQMB 3H37A 2JQHA 3N2OA 4HTEA 3F57A 5F5WA 1OXZA 3EABA 3AXJB 3P4SA 1J1JA 3AE6A 3C4WA 4QH4A 5FKYA 2WDQA 5H6RB 4WW0A 4EXTA 4B3MT 5AQRB 1HS7A 4JI7T 3OBVE 4ISSA 2BS2A 3MXZA 4ASKA 1D0YA 4X65T 3PE0A 4TWFA 4AQYT 1MMGA 2UUAT 4IDQA 2YOEA 3K3OA 4IE6A 4LF4T 2X68A 2NW8A 3M65A 3JC6D 5GONE 2LE8A 5JR9A 3AE7A 5AQVB 3T8OA 4HFHA 3Q5XA 5FXVA 4LFAT 2D0UA 5AQNB 5JVDE 3PU3A 5LXTE 4HFBA 3N9QA 4LF8T 2VQFT 2XQ3A 4YHHT 3CQXC 1WYCA 4ZS3A 3TLUA 2LRLA 2JQKA 1QSDA 4JEUB 2WDRA 5JDMA 3ZYLA 3VR9A 1EZ3A 2ZMAA 3N2GE 5ABHA 3PUQA 3RYIE 3ZMVB 2LOPA 1UX4A 4O4HE 2A3DA 3J9X1 3CIRA 3EVYA 3OTOT 3I9WA 4Z91A 4U31A 4H9SE 3KBUA 4IE7A 2WP9A 4UR9A 4EIWA 4H63H 2JJ9A 4KHZF 1D0XA 4EZHA 4UIGA 5AFUL 2LKGA 4NUUA 4UVAB 2FBWA 3ZN0B 4MLKA 5HXRA 2WAUA 2BG9E 5LGUB 1MNEA 5CA1E 4ISTA 2E5VA 2V1DB 1XMOT 4JV5T 3BQIA 3EAMA 2BDEA 4O8SA 4NUVA 5JH7E 3PUXF 1HFAA 2H88A 2WM9A 4HFCA 3QNUA 4DR1T 3ZC0A 2H7VC 3MK7C 4KBMB 3VRBA 3CX6B 3DTOA 1BR4A 3ZYMA 3EDUA 2IDOB 1G8XA 5LG4A 2JQ9A 1UUSA 4IE0A 2CBIA 1KF6A 3RIUC 5HEUA 4JI3T 3KDSE 4HFIA 5TAOA 2BKPA 4TWDA 2WSSV 4EEBA 2X0HA 2J1DG 1CUNA 3RIAA 1D1AA 1HCIA 2N9DA 4QH5A 5AQLB 2OA5A 4QX7B 4AQFC 3AE4A 3KVBA 5HXEA 3ZT6A 3AEDA 4PNIA 4CXXA 2VL0A 4E7ZA 2PTFA 1FJGT 2C5IT 3FZFB 4TN7B 3ZLIA 2Q9QB 2UU9T 2WU5A 4PJJA 5FMNA 3PUGA 4IDZA 3EHZA 4YTMA 2ES0A 2LOSA 1S94A 1VCTA 4O4IE 4X1YE 4DMWA 5L3BB 2WY2A 5J0ZA 4X62T 3VKGA 5LJMA 5L3EB 2Z6EA 4Z90A 4DNDA 4OYJA 3LFMA 3JCFA 3MACA 4ILAA 2CLYC 3OJAA 3P4WA 5DJQC 2NWBA 5L3FB 3O4XE 2VKOA 2XQ6A 3C98B 3CK6A 3FXEB 1US7B 5JDNA 2WMNA 4C90A 3H3MA 4X66T 3GA8A 1Y01A 3TLTA 4LF7T 3VR8A 4ERRA 2J62A 4GIWA 3FZHB 4HWIB 5HYAA 1DU2A 5HEGA 4I50E 4X1KE 2QRXA 2I59A 1JNRA 3F2EA 4MHCA 4HWFA 2YEVC 5CA0E 4U3CA 5HWYA 2DHRA 4B3ST 3RYCE 4WBOA 2BKNA 2B76A 3RLFF 4OHFA 4AKHA 4DR6T 4YFSA 4H9RC 4EYYR 5HXHA 1R8IA 1YKHB 2DWGA 2JQQA 2M6BA 3HL6A 3KFWX 5JDGA 2H89A 4H9NC 4H9PC 2XAGB 1XDPA 2V6XA 2CE7A 2XQAA 5HXSA 2CEAA 1MMNA 3HKCE 4UEMA 4U7YA 3GN5A 2EHOC 3KINB 4Q25A 5ETWA 5ABFA 5L47A 4DR5T 3AEBA 3NBXX 2V7MA 1SUMB 3CX7B 5ADXL 4OX9T 3AE2A 4HKAA 3I0QA 4AQGA 4OYKA 2WBLA 3AE1A 2ACZA 2X51A 4DIDB 5J2TE 4JI6T 2UUCT 1OWAA 2XPKA 2X9YA 3LBXB 2VK9A 3PUVF 5HEOA 3RKGA 4C91A 3CMLA 2D9DA 4ZHQE 2QYWA 4IE5A 5F8PA 3UU5A 4MALA 3JAFA 3NRYA 5AQGB 1W9RA 2XJ7A 2WU2A 3V5UA 4KHPT 1UX5A 3OYXA 1B7TA 2KT9A 3RF1A 1WRDA 2X67A 4QH1A 2CHNA 4KI0F 3CQCB 3FZLB 3RQWA 2JRKA 5EK4A 4QX8B 5C3JA 2V6YA 1XWMA 2ZM8A 3GN5B 4O4JE 2IC6A 4GYRA 2W63A 2V7KA 2W00A 3CKDA 2FJDA 1CHUA 2KSRA 3K1SA 2A2FX 2HH7A 2MAWA 5L3CB 4NXNT 3RIUA 2ZLYA 2VVSA 1Z0PA 4G2AA 5JREA 3ZSSA 1FMVA 2XASB 3PUSA 4JI1T 2E2AA 4GK5E 2ZM2A 3E08A 2W67A 3NZPA 4AKGA 4KX6A 3P8CD 1BR0A 4DV4T 4DV6T 4PAGA 3PU8A 2K24A 4JYAT 3AE3A 2N2NA 2X0YA 1IAPA 2VVNA 2IIUA 2LSIA 5LBQB 1XDOA 2FJEA 3OYZA 4EYUA 1ZKEA 3EDVA 2NTYA 2RA1A 3ETVA 4IE4A 4PK4A 4I4TE 4U2ZA 4U2YA 4I43B 3UFEA 3VRAA 4EEDA 5CGMA 2W61A 2CPTA 2DL1A 2LJLA 1M7KA 5DABA 5EZYE 5LCYA 1N34T 4AI6A 5BMVE 1MIYA 5KX5E 1KNZA 2BG9C 2IUBA 3F31A 1FMWA 2PJQA 3U3IA 4ILUA 3JC6C 5JQGE 3WAJA 2R6GF 4L5GA 5LOVE 4ZZBA 3ESLA 1LVKA 2W2UA 4CN1A 3IHRA 5JRCB 2CHOA 3FZKB 3UTKA 2FJBA 2YK0A 4IIJE 5LGTB 4ADZA 1MMAA 4FJOA 2XZEA 3AB3B 1J5ET 3AAEB 4GKKT 3FHNA 3OKQA 5AQPB 3RQUA 1MNDA 1W0AA 2WWUA 5F3JA 4UVBB 3UULA 3PDYA 3B57A 3P50A 1D1BA 2HHHT 4F6RC 1KNPA 1XZYA 2V5CA 3ZCJA 4YSZA 2UUBT 2LSGA 3RGLA 4K0KT 4WYVA 2X9WA 1HX8A 5L3GB 3CPZA 2UXDT 4I55E 2KWIB 4HFVA 4P0AA 4A5XA 3I1AA 4GKJT 1BR1A 2A72A 2XQ8A 1IBMT 4LF9T 3I9YA 2W4XA 2BVLA 4WNKA 3T1HT 4LFCT 4XBFB 2ODUA 3UU3A 4LF5T 1LRZA 4U7IA 1U4QA 2WCAA 3P4RA 1D0ZA 1U5PA 1J5WA 2XM1A 3BK9A 3IF8B 3SRZA 5CFBA 1IJ5A 2YKSA 2LM2A 3KV4A 5LHGB 4DR4T 4LMJA 1T72A 3N9NA 5JDFA 3LK42 4YY3T 2CWOA 2VWAA 4BJNA 2BG9A 5JDQA 2DI4A 4HFEA 1HTJF 4CXWA 2KZ7B 2VKDA 2E8IA 3RC3A 2I0MA 5HXCA 1T7SA 2M67A 1X79A 4J2CA 3JAEA 2KWHA 4ZOLE 3KV9A 2CWYA 3Q5DA 4Z8XA 2YU1A 4HE8A 2J47A 2E9XC 3AE8A 2V7LA 4AKRB 4UXNB 3RC8A 2OV9A 4YLHA 4PJNA 4YSXA 4DUZT 3RI5A 3N5LA 4ILBA 3J7Yq 2VKHA 2W66A 4IGUA 3AAAB 4N78D 5IYZE 3UT5E 5L4EA 4DR7T 3MKDA 5EK2A 1X9BA 2MOZA 4O2BE 4DO0A 2NP9A 3AE9A 4HGAA 5FVLA 1ZP0A 2C5JA 3NVOA 3HA4A 2DNXA 1UCUA 3D0TA 2DLRA 2HN1A 3QC9A 4U33A 2LSKA 3TLWA 5AQSB 5FY1A 2XAQB 2JMHA 2UXBT 2OLTA 2NR4A 5IHYA 1KEYA 3MZKB 2BVMA 1W09A 1UURA 3PUAA 4FI5A 1YQ3A 3RPUA 2JMKA 4PW8A 2FUPA 5L3DB 2B1EA 3ANWB 2RP4A 4UV8B 5KMGP 4DV1T 2A9UA 2MYSA 2QVAA 3ETUA 2EHOD 2ZM6T 1E2AA 2H7OA 2KMFA 3B13A 5FL0A 4X64T 3T1YT 4EGWA 2KINB 3AVRA 4M1PA 4L0RA 2IHR1 3ANWA 1W0BA 5E0OA 3ZEFB 1HG2A 3PV0F 2M6IA 2ODVA 4H9OC 5H6QB 1HR0T 3IEEA 4UV9B 4ZI3D 1V9DA 1HF8A 1UK5A 3OPCA 1HX1B 4ANJA 4PJMA 5A1LA 3UFGA 2LRKA 2CXFA 3ZC1A 4PK5A 1NWMX 1YKEB 3E0ZA 5LHHB 2E9XA 2UXXB 3PURA 5FXZA 4JI2T 5JDLA 4X5TA 2AXDS 2W0GA 2WZIA 5FVKA 3R6NA 3KBTA 5AQUB 4BJMA 2H3RA 2XQ5A 3AXJA 3QOFA 2NTXA 4TV9E 3X1DA 3Q5WA 4A56A 1QUUA 2VL8A 4TUYE 1E7PA 4DBQA 4F8HA 5ABEA 2XTLA 3IBPA 3AA7B 4UVCB 5M4YA 3C51A 2YU2A 3RH3A 2AE9A 4XZCA 5DQVA 1GQEA 2X9HA 4ZZCA 5JTGA 1MIWA 3FB2A 2V6YB 2V7IA 3HI2A 1SHZC 2RPAA 2VURA 4AQFA 4KP3C 3VHLA 2IMLA 4TZ4C 2QA7A 2JPFA 5EK3A 1KK7A 2IAKA 5FL1A 3P4PA 2LT3A 4DV2T 3H3AA 4IL9A 4GYSA 3CVRA 5FXWA 2J4GA 4YT0A 3SOLA 3UUXB 2PG8A 3LJCA 4ILCA 3ZMUB 5HWXA 1HNWT 5JR9C 1WR0A 5HCMA 2K9AA 5LHIB 3N9MA 2XUEA 4EZ4A 2Q9QD 5HEHA 3V5SA 4CN6A 3O9XA 1SA0E 4KMCA 3VU7H 4TWHA 5ABFB 2VASA 4NPPA 3RIFA 2CBJA 4HWDA 1VOMA 2XQ7A 3SFEA 1SE7A 2D2SA 2ZM0A 3CQGB 1I94T 5KDMC 5LYJE 4O4LE 1FIOA 3NKZA 4QXHB 3TLSA 3HKBE 3PJAA 4QHOA 2CXDA 2XSBA 3JADA 5DQWA 5FP3A 3NZQA 4CZZB 2XAFB 3UU6A 5AQTB 4ZI7E 5BR8T 2VKJA 4PFPA 3UUMA 1OEDC 2YDQA 3KV6A 1BR2A 1YD8G 2CRBA 4X20E 3UU8A 1WFDA 1JNZA 4AKIA 1ZOYA 1G73A 5ABGA 2LEHA 2WQYA 3SWHA 2XSAA 4TX5A 4JI5T 2W62A 2BZBA 5AQOB 1WCRA 3AEEA 2D0TA 4UF0A 1HNXT 2CLYB 1T98A 2HPLA 2BS4A 3AAIA 4L9IA 3AVSA 3C50A 2Y48B 3PTRB 5LMNT 2LSYA 3HR0A 3N9PA 1WLXA 3G06A 5HEJA 4ZS2A 2E9XB 5J2UE 5LBMA 3A8YC 3ZN1B 4YTPA 1LVFA 5JDHA 3EI0A 2HN2A 4PFOA 4IREA 4U72A 2PBIA 3ZCIA 2G0UA 5IUXA 4PJLA 4IL4A 4WBNE 5C8YE 4DUYT 3BQKA 2KLQA 2Y6XA 2GK9A 5LA6E 5KXJA 2L3LA 3L3PA 3FBZA 2X66A 1E1HB 2K3WA 3QUJA 4GOUA 4CXYA 3PUYF 2X9XA 3W15B 2SPCA 3LK2B 4HN9A 4DR3T 2V8SV 5AQFB 3A5XA 4LMLA 3UUBA 2V7JA 3CWZB 2WWVA 4BAYB 5FXXA 1ZEEA 2XM2A 1AJ3A 1XNRT 1L0VA 2CCQA 3B5MA 4QWNB 4IDPA 4DV7T 2XY8B 4ZEYA 4JUYA 5LNKA 2WB5A 4COFA 2PFVA 3QB5K 3ABVA 3LG7A 2Q9QA 3AEAA 3PUWF 2Y8DA 4JI4T 1NENA 4YJ2E 3BQLA 4PK6A 4B3RT 4CN4A 3DP7A 4OK0A 4G63A 4TNVA 4BA9A 5JRCA 5CB4E 4CI2B 2BBJA 3L8RA 4E7SA 2X0LB 3UUNA 2I6HA 3N2KE 2IW5B 4AIUA 1FEWA 2LLYA 3PUZF 4DR2T 3P7IA 3E22E 4H63V 4QKNA 4A97A 1VCSA 2LSJA 2E9XD 1D1CA 3U78A 2LKHA 4OFZA 3SFDA 5LJNA 3HKEE 4EV6A 4XAXB 1Y64B 2FJAA 2F4VT 2WDVA 5J1GA 2YDRA 1WYBA 1MMDA 3MA9A 5LB7B 4YJ3E 4A98A 4JLEA 3TLVA 4EAHA 5CJ5A 1IJ6A 2BBHA 2L9QA 3ONLC 4P0BA 3RRCA 2C0SA 3RRWA 4DVDA 4CI1B 2XQ9A 3C64A 3OVUA 3CX8B 3RHWA 1HG5A 3GMIA 4YSYA 1IBKT 1YQ4A 4KUMB 4NIQA 4P09A 3P4QA 5AQJB 1NEKA 5LP6E 4AXPA 3AEGA 4LF6T 4H9QC 3AA6B 2WMOA 3RX6A 5AQIB 3AEFA 3I0OA 2IC9A 2WZHA 4QXCB 4TNWA 1Z8UA 3L09A 2D5UA 2UXCT 3ZJ1A 2JIWA 3KVAA 1XMQT 3KV5A 4QXBB 4JEHB 3EUHA 4HWCA 5AQKB 3MJXA 2CMRA 4CQIA 2C5KT 3AA0B 2XQ4A 3QB5A 4TV8E 4YHJA 4YXDA 3LSVA 1VRBA 3ZYKA 5LG3A 2NW7A 2ACXA 2BS3A 5L4HA 2MPKA 2XAJB 3ZMSB 3AECA 2XHEB 3N9OA 5L2LA 3M3ZB
chains in the Genus database with same CATH topology
3NRXA 5LGNB 2DCFA 1IZNB 2N1GA 2XAHB 3ZMTB 1ZHCA 3O1HA 3VKHA 3ZJ2A 4EB6E 5JR9B 2L8KA 4UELA 4B6XA 3K8PC 4DBRA 3K3QC 4MFRA 4ZI2C 3DJBA 2V26A 3ZMZB 2Q9QC 1YW0A 3QK6A 3S4UA 1O3XA 3FXDB 1H7CA 4CI3B 1S35A 3ZPOA 4UF0B 5FNVE 4GK0E 1ZV4X 3TKLB 3HKDE 2QGSA 2K48A 2VB6A 2EHOA 2CA5A 2NOXA 2LM9A 2NW9A 3RYHE 2KNDA 4IHJE 1WR6A 3C4XA 2MBGA 3VKGA 3K3NA 2CXLA 4HEAA 4EOZB 3WI3A 3FBLA 4ZI2D 2LHNA 3O1JA 4V1Av 1NAFA 5FY0A 3LBXA 4X1IE 2K5BB 3LK3B 5HAXA 4ZI3C 4MBQA 4AKLA 1LKXA 2KXPB 2LHRA 3O1IA 3WAKA 2HPJA 3C4ZA 3N9LA 5FYMA 2DWKA 2YINA 2CM0A 2UXNB 2P9BA 3RKOA 3GWHA 4U74A 3SS1A 4K0UA 5FY7A 4DMVA 3AA1B 3Q9DA 4O2AE 2MTQA 3R84B 3ONXA 1MIVA 2EHOB 3RYFE 4ZI7E 3Q2MA 2XQYA 3H37A 3N2OA 4HTEA 3F57A 1OXZA 3C4WA 5H6RB 4EXTA 4WW0A 1HS7A 3OBVE 4ISSA 3MXZA 4ASKA 1D0YA 3PE0A 1MMGA 3K3OA 4IE6A 2X68A 2NW8A 3M65A 3JC6D 5GONE 2LE8A 5JR9A 3T8OA 3Q5XA 5FXVA 2D0UA 5JVDE 3PU3A 5LXTE 3N9QA 3CQXC 1WYCA 4ZS3A 1QSDA 4JEUB 5JDMA 3ZYLA 1EZ3A 2ZMAA 3N2GE 3PUQA 3RYIE 3ZMVB 2LOPA 1UX4A 4O4HE 2A3DA 3J9X1 3EVYA 3I9WA 4EIWA 4H9SE 3KBUA 4IE7A 4EZHA 5AFUL 4H63H 2JJ9A 1D0XA 4UIGA 4NUUA 4UVAB 3ZN0B 4MLKA 5HXRA 2WAUA 5LGUB 1MNEA 5CA1E 4ISTA 2V1DB 3BQIA 4O8SA 2BDEA 4NUVA 5JH7E 1HFAA 2WM9A 3ZC0A 2H7VC 3MK7C 4KBMB 3CX6B 3DTOA 1BR4A 3ZYMA 3EDUA 5LG4A 1G8XA 4IE0A 3KDSE 5TAOA 2WSSV 2J1DG 1CUNA 1D1AA 1HCIA 2N9DA 2OA5A 4QX7B 4AQFC 3KVBA 5HXEA 4PNIA 4CXXA 4E7ZA 2C5IT 4TN7B 3ZLIA 2Q9QB 4PJJA 5FMNA 3PUGA 4IDZA 2ES0A 2LOSA 1S94A 4X1YE 4O4IE 4DMWA 5L3BB 5LJMA 5L3EB 2Z6EA 4DNDA 4OYJA 3LFMA 3MACA 2CLYC 3OJAA 5DJQC 2NWBA 5L3FB 3O4XE 2VKOA 3C98B 3FXEB 5JDNA 1US7B 2WMNA 4C90A 3GA8A 4ERRA 4GIWA 5HYAA 4I50E 4X1KE 4MHCA 2I59A 3F2EA 2YEVC 5CA0E 5HWYA 2DHRA 3RYCE 4WBOA 4OHFA 4AKHA 4YFSA 4H9RC 4EYYR 5HXHA 1YKHB 2DWGA 2JQQA 3HL6A 3KFWX 5JDGA 4H9NC 4H9PC 2XAGB 2CE7A 5HXSA 2CEAA 1MMNA 3HKCE 4UEMA 3GN5A 2EHOC 3KINB 5ETWA 3NBXX 2V7MA 3CX7B 5ADXL 4AQGA 4HKAA 3I0QA 4OYKA 2WBLA 2X51A 5J2TE 1OWAA 2X9YA 3LBXB 2VK9A 4C91A 3CMLA 4ZHQE 4IE5A 5F8PA 4MALA 3NRYA 3V5UA 1UX5A 3OYXA 1B7TA 2KT9A 1WRDA 2X67A 3CQCB 2JRKA 5EK4A 4QX8B 2ZM8A 3GN5B 4O4JE 2IC6A 4GYRA 2W63A 2V7KA 2W00A 3CKDA 2A2FX 2HH7A 5L3CB 2ZLYA 4G2AA 1Z0PA 5JREA 1FMVA 2XASB 3PUSA 4GK5E 2ZM2A 3E08A 3NZPA 4AKGA 3P8CD 1BR0A 4PAGA 3PU8A 2K24A 2N2NA 4EYUA 1IAPA 5LBQB 2LSIA 3OYZA 1ZKEA 3EDVA 2NTYA 2RA1A 3ETVA 4IE4A 4PK4A 4I4TE 4I43B 3UFEA 2W61A 5EZYE 2LJLA 5DABA 5LCYA 4AI6A 5BMVE 1MIYA 5KX5E 1KNZA 3F31A 1FMWA 2PJQA 3U3IA 4ILUA 3JC6C 5JQGE 3WAJA 4L5GA 5LOVE 3ESLA 1LVKA 3IHRA 5JRCB 3UTKA 2YK0A 4IIJE 5LGTB 4ADZA 1MMAA 4FJOA 3AB3B 3AAEB 3FHNA 3OKQA 1MNDA 2WWUA 5F3JA 4UVBB 3UULA 3PDYA 3B57A 1D1BA 4F6RC 3ZCJA 2LSGA 2X9WA 1HX8A 5L3GB 3CPZA 4I55E 2KWIB 4HFVA 4P0AA 3I1AA 1BR1A 2A72A 3I9YA 4WNKA 2BVLA 4XBFB 2ODUA 1LRZA 1U4QA 1D0ZA 1U5PA 3BK9A 3SRZA 3IF8B 1IJ5A 3KV4A 5LHGB 3N9NA 5JDFA 3LK42 2CWOA 2VWAA 4BJNA 5JDQA 2DI4A 1HTJF 4CXWA 2KZ7B 2VKDA 2E8IA 3RC3A 5HXCA 2M67A 1X79A 4J2CA 4ZOLE 2KWHA 3KV9A 2CWYA 4Z8XA 2YU1A 4HE8A 2E9XC 2V7LA 4AKRB 4UXNB 3RC8A 4YLHA 4PJNA 3N5LA 3J7Yq 2VKHA 4IGUA 5IYZE 3AAAB 4N78D 3UT5E 3MKDA 5EK2A 2MOZA 4O2BE 4DO0A 2NP9A 4HGAA 2C5JA 3QC9A 3HA4A 2DNXA 1UCUA 3D0TA 2DLRA 2LSKA 5FY1A 2XAQB 2JMHA 5IHYA 4FI5A 3MZKB 2BVMA 3PUAA 3RPUA 5L3DB 2JMKA 4PW8A 2B1EA 3ANWB 2RP4A 4UV8B 5KMGP 2MYSA 3ETUA 2EHOD 2H7OA 2KMFA 3B13A 2KINB 3AVRA 4M1PA 4L0RA 3ANWA 5E0OA 3ZEFB 1HG2A 2ODVA 4H9OC 5H6QB 3IEEA 4UV9B 4ZI3D 1V9DA 1HF8A 4ANJA 5A1LA 4PJMA 2CXFA 3ZC1A 4PK5A 1NWMX 1YKEB 3E0ZA 5LHHB 2E9XA 2UXXB 3PURA 5FXZA 5JDLA 2W0GA 3R6NA 3KBTA 4BJMA 2H3RA 4TV9E 2NTXA 4A56A 3Q5WA 1QUUA 2VL8A 4DBQA 2XTLA 3IBPA 3AA7B 4UVCB 5M4YA 3C51A 2YU2A 3RH3A 4XZCA 5DQVA 2X9HA 1MIWA 3FB2A 2V7IA 3HI2A 1SHZC 4AQFA 4KP3C 3VHLA 4TZ4C 2QA7A 2JPFA 5EK3A 1KK7A 2IAKA 2LT3A 3H3AA 5FXWA 4GYSA 3CVRA 3SOLA 3UUXB 2PG8A 3LJCA 3ZMUB 5HWXA 5JR9C 5LHIB 2K9AA 3N9MA 2XUEA 4EZ4A 2Q9QD 3V5SA 3O9XA 1SA0E 4KMCA 3VU7H 2VASA 1VOMA 2D2SA 2ZM0A 3CQGB 5KDMC 5LYJE 4O4LE 1FIOA 4QXHB 3HKBE 4QHOA 2CXDA 5DQWA 5FP3A 3NZQA 4CZZB 2XAFB 2VKJA 4PFPA 3UUMA 3KV6A 1BR2A 1YD8G 4X20E 4AKIA 1G73A 2LEHA 3SWHA 4TX5A 2W62A 2BZBA 2D0TA 4UF0A 2CLYB 1T98A 2HPLA 3AAIA 4L9IA 3AVSA 3C50A 2Y48B 3PTRB 2LSYA 3HR0A 3N9PA 1WLXA 4ZS2A 2E9XB 5J2UE 5LBMA 3ZN1B 1LVFA 5JDHA 4PFOA 4U72A 2PBIA 3ZCIA 2G0UA 4PJLA 4WBNE 5C8YE 3BQKA 2KLQA 2Y6XA 2GK9A 5LA6E 2L3LA 3L3PA 3FBZA 2X66A 1E1HB 4GOUA 3QUJA 4CXYA 2X9XA 3W15B 2SPCA 3LK2B 4HN9A 3A5XA 2V7JA 3CWZB 4BAYB 5FXXA 1ZEEA 1AJ3A 2CCQA 4QWNB 5LNKA 4JUYA 2PFVA 3LG7A 2Q9QA 2Y8DA 4YJ2E 3BQLA 4PK6A 3DP7A 4OK0A 4G63A 4BA9A 5JRCA 5CB4E 4CI2B 4E7SA 2X0LB 3UUNA 3N2KE 2IW5B 1FEWA 3P7IA 3E22E 4H63V 4QKNA 2LSJA 2E9XD 1D1CA 3U78A 4OFZA 5LJNA 3HKEE 4XAXB 1Y64B 5J1GA 1WYBA 1MMDA 3MA9A 4YJ3E 4JLEA 4EAHA 1IJ6A 2L9QA 4DVDA 4P0BA 3RRCA 3RRWA 2C0SA 4CI1B 3C64A 3CX8B 1HG5A 3GMIA 4KUMB 4P09A 5LP6E 4AXPA 4H9QC 3AA6B 2WMOA 3RX6A 3I0OA 2IC9A 4QXCB 3L09A 2D5UA 3ZJ1A 3KVAA 3KV5A 4QXBB 4JEHB 3EUHA 3MJXA 2CMRA 4CQIA 2C5KT 3AA0B 4TV8E 4YHJA 1VRBA 3ZYKA 2NW7A 2ACXA 3ZMSB 2XAJB 4TUYE 2XHEB 3N9OA 5L2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LG4 A;  1FEW A;  5M4Y A;  1G73 A;  1HS7 A;  2DNX A;  1FIO A;  1S94 A;  4JEU B;  4JEH B;  3LG7 A;  2XHE B;  1BR0 A;  3C98 B;  1EZ3 A;  4TX5 A; 
#chains in the Genus database with same CATH topology
 5HCJ A;  3NRX A;  5LGN B;  5LMU T;  4IDO A;  2DCF A;  1IZN B;  2N1G A;  2XAH B;  3IA3 A;  3NWI A;  3ZMT B;  1ZHC A;  3O1H A;  4DV0 T;  4WZX A;  3ZJ2 A;  3UQ7 A;  4EB6 E;  3VKH A;  5JR9 B;  4IT4 A;  2L8K A;  3Q5E A;  4UEL A;  3K8P C;  4B6X A;  3K3Q C;  4DBR A;  4MFR A;  4ZI2 C;  3DJB A;  2V26 A;  3FZM B;  1KFY A;  2Q9Q C;  3ZMZ B;  1YW0 A;  3QK6 A;  3S4U A;  4YTN A;  4DV3 T;  4ZXL A;  1O3X A;  3AE5 A;  4JI8 T;  1KNR A;  3FXD B;  1H7C A;  4I0U A;  4DV5 T;  4AIS A;  1YXR A;  1S35 A;  2BKO A;  3ZPO A;  4UF0 B;  5AQQ B;  1UGO A;  4LMK A;  4CI3 B;  2VQE T;  5FNV E;  4B3T T;  4GK0 E;  1ZV4 X;  3ZT7 A;  3TKL B;  3A7M A;  3HKD E;  2QGS A;  1OED E;  1I6Z A;  2K48 A;  2VB6 A;  2NOX A;  2CA5 A;  2EHO A;  2LM9 A;  2NW9 A;  1N36 T;  4HWH A;  3RYH E;  2YDS A;  2KND A;  4IHJ E;  1WR6 A;  2YN6 A;  1OED B;  3C4X A;  3K3N A;  4IDN A;  2MBG A;  1IBL T;  2CXL A;  3ONJ A;  4HEA A;  4EOZ B;  3WI3 A;  3FBL A;  4ZI2 D;  5IWA T;  2LHN A;  3UQ4 A;  3O1J A;  4V1A v;  1NAF A;  4JI0 T;  2V5D A;  4HFD A;  5FY0 A;  4P1N A;  3UU4 A;  1N33 T;  3LBX A;  4X1I E;  2K5B B;  3LK3 B;  5HAX A;  4ZI3 C;  4MBQ A;  3ZT5 A;  4AKL A;  1LKX A;  5C2T A;  2KXP B;  2LHR A;  3O1I A;  3WAK A;  1N32 T;  2WS3 A;  1XNQ T;  1T8B A;  2HPJ A;  3C4Z A;  4LFB T;  3N9L A;  5FYM A;  2BG9 B;  2DWK A;  2YIN A;  2CM0 A;  2UXN B;  2P9B A;  3L39 A;  4JBW F;  3RKO A;  1HNZ T;  4NXM T;  3GWH A;  4U74 A;  3SS1 A;  3ZKR A;  4K0U A;  5FY7 A;  1OED A;  4DMV A;  2E5L T;  3AA1 B;  3Q9D A;  4O2A E;  2MTQ A;  3R84 B;  1M62 A;  1MIV A;  2EHO B;  3LDQ B;  1QLB A;  3ONX A;  3PJA J;  5AQH B;  3Q2M A;  3RYF E;  3ZST A;  2XQY A;  5AQM B;  3H37 A;  2JQH A;  3N2O A;  4HTE A;  3F57 A;  5F5W A;  1OXZ A;  3EAB A;  3AXJ B;  3P4S A;  1J1J A;  3AE6 A;  3C4W A;  4QH4 A;  5FKY A;  2WDQ A;  5H6R B;  4WW0 A;  4EXT A;  4B3M T;  5AQR B;  1HS7 A;  4JI7 T;  3OBV E;  4ISS A;  2BS2 A;  3MXZ A;  4ASK A;  1D0Y A;  4X65 T;  3PE0 A;  4TWF A;  4AQY T;  1MMG A;  2UUA T;  4IDQ A;  2YOE A;  3K3O A;  4IE6 A;  4LF4 T;  2X68 A;  2NW8 A;  3M65 A;  3JC6 D;  5GON E;  2LE8 A;  5JR9 A;  3AE7 A;  5AQV B;  3T8O A;  4HFH A;  3Q5X A;  5FXV A;  4LFA T;  2D0U A;  5AQN B;  5JVD E;  3PU3 A;  5LXT E;  4HFB A;  3N9Q A;  4LF8 T;  2VQF T;  2XQ3 A;  4YHH T;  3CQX C;  1WYC A;  4ZS3 A;  3TLU A;  2LRL A;  2JQK A;  1QSD A;  4JEU B;  2WDR A;  5JDM A;  3ZYL A;  3VR9 A;  1EZ3 A;  2ZMA A;  3N2G E;  5ABH A;  3PUQ A;  3RYI E;  3ZMV B;  2LOP A;  1UX4 A;  4O4H E;  2A3D A;  3J9X 1;  3CIR A;  3EVY A;  3OTO T;  3I9W A;  4Z91 A;  4U31 A;  4H9S E;  3KBU A;  4IE7 A;  2WP9 A;  4UR9 A;  4EIW A;  4H63 H;  2JJ9 A;  4KHZ F;  1D0X A;  4EZH A;  4UIG A;  5AFU L;  2LKG A;  4NUU A;  4UVA B;  2FBW A;  3ZN0 B;  4MLK A;  5HXR A;  2WAU A;  2BG9 E;  5LGU B;  1MNE A;  5CA1 E;  4IST A;  2E5V A;  2V1D B;  1XMO T;  4JV5 T;  3BQI A;  3EAM A;  2BDE A;  4O8S A;  4NUV A;  5JH7 E;  3PUX F;  1HFA A;  2H88 A;  2WM9 A;  4HFC A;  3QNU A;  4DR1 T;  3ZC0 A;  2H7V C;  3MK7 C;  4KBM B;  3VRB A;  3CX6 B;  3DTO A;  1BR4 A;  3ZYM A;  3EDU A;  2IDO B;  1G8X A;  5LG4 A;  2JQ9 A;  1UUS A;  4IE0 A;  2CBI A;  1KF6 A;  3RIU C;  5HEU A;  4JI3 T;  3KDS E;  4HFI A;  5TAO A;  2BKP A;  4TWD A;  2WSS V;  4EEB A;  2X0H A;  2J1D G;  1CUN A;  3RIA A;  1D1A A;  1HCI A;  2N9D A;  4QH5 A;  5AQL B;  2OA5 A;  4QX7 B;  4AQF C;  3AE4 A;  3KVB A;  5HXE A;  3ZT6 A;  3AED A;  4PNI A;  4CXX A;  2VL0 A;  4E7Z A;  2PTF A;  1FJG T;  2C5I T;  3FZF B;  4TN7 B;  3ZLI A;  2Q9Q B;  2UU9 T;  2WU5 A;  4PJJ A;  5FMN A;  3PUG A;  4IDZ A;  3EHZ A;  4YTM A;  2ES0 A;  2LOS A;  1S94 A;  1VCT A;  4O4I E;  4X1Y E;  4DMW A;  5L3B B;  2WY2 A;  5J0Z A;  4X62 T;  3VKG A;  5LJM A;  5L3E B;  2Z6E A;  4Z90 A;  4DND A;  4OYJ A;  3LFM A;  3JCF A;  3MAC A;  4ILA A;  2CLY C;  3OJA A;  3P4W A;  5DJQ C;  2NWB A;  5L3F B;  3O4X E;  2VKO A;  2XQ6 A;  3C98 B;  3CK6 A;  3FXE B;  1US7 B;  5JDN A;  2WMN A;  4C90 A;  3H3M A;  4X66 T;  3GA8 A;  1Y01 A;  3TLT A;  4LF7 T;  3VR8 A;  4ERR A;  2J62 A;  4GIW A;  3FZH B;  4HWI B;  5HYA A;  1DU2 A;  5HEG A;  4I50 E;  4X1K E;  2QRX A;  2I59 A;  1JNR A;  3F2E A;  4MHC A;  4HWF A;  2YEV C;  5CA0 E;  4U3C A;  5HWY A;  2DHR A;  4B3S T;  3RYC E;  4WBO A;  2BKN A;  2B76 A;  3RLF F;  4OHF A;  4AKH A;  4DR6 T;  4YFS A;  4H9R C;  4EYY R;  5HXH A;  1R8I A;  1YKH B;  2DWG A;  2JQQ A;  2M6B A;  3HL6 A;  3KFW X;  5JDG A;  2H89 A;  4H9N C;  4H9P C;  2XAG B;  1XDP A;  2V6X A;  2CE7 A;  2XQA A;  5HXS A;  2CEA A;  1MMN A;  3HKC E;  4UEM A;  4U7Y A;  3GN5 A;  2EHO C;  3KIN B;  4Q25 A;  5ETW A;  5ABF A;  5L47 A;  4DR5 T;  3AEB A;  3NBX X;  2V7M A;  1SUM B;  3CX7 B;  5ADX L;  4OX9 T;  3AE2 A;  4HKA A;  3I0Q A;  4AQG A;  4OYK A;  2WBL A;  3AE1 A;  2ACZ A;  2X51 A;  4DID B;  5J2T E;  4JI6 T;  2UUC T;  1OWA A;  2XPK A;  2X9Y A;  3LBX B;  2VK9 A;  3PUV F;  5HEO A;  3RKG A;  4C91 A;  3CML A;  2D9D A;  4ZHQ E;  2QYW A;  4IE5 A;  5F8P A;  3UU5 A;  4MAL A;  3JAF A;  3NRY A;  5AQG B;  1W9R A;  2XJ7 A;  2WU2 A;  3V5U A;  4KHP T;  1UX5 A;  3OYX A;  1B7T A;  2KT9 A;  3RF1 A;  1WRD A;  2X67 A;  4QH1 A;  2CHN A;  4KI0 F;  3CQC B;  3FZL B;  3RQW A;  2JRK A;  5EK4 A;  4QX8 B;  5C3J A;  2V6Y A;  1XWM A;  2ZM8 A;  3GN5 B;  4O4J E;  2IC6 A;  4GYR A;  2W63 A;  2V7K A;  2W00 A;  3CKD A;  2FJD A;  1CHU A;  2KSR A;  3K1S A;  2A2F X;  2HH7 A;  2MAW A;  5L3C B;  4NXN T;  3RIU A;  2ZLY A;  2VVS A;  1Z0P A;  4G2A A;  5JRE A;  3ZSS A;  1FMV A;  2XAS B;  3PUS A;  4JI1 T;  2E2A A;  4GK5 E;  2ZM2 A;  3E08 A;  2W67 A;  3NZP A;  4AKG A;  4KX6 A;  3P8C D;  1BR0 A;  4DV4 T;  4DV6 T;  4PAG A;  3PU8 A;  2K24 A;  4JYA T;  3AE3 A;  2N2N A;  2X0Y A;  1IAP A;  2VVN A;  2IIU A;  2LSI A;  5LBQ B;  1XDO A;  2FJE A;  3OYZ A;  4EYU A;  1ZKE A;  3EDV A;  2NTY A;  2RA1 A;  3ETV A;  4IE4 A;  4PK4 A;  4I4T E;  4U2Z A;  4U2Y A;  4I43 B;  3UFE A;  3VRA A;  4EED A;  5CGM A;  2W61 A;  2CPT A;  2DL1 A;  2LJL A;  1M7K A;  5DAB A;  5EZY E;  5LCY A;  1N34 T;  4AI6 A;  5BMV E;  1MIY A;  5KX5 E;  1KNZ A;  2BG9 C;  2IUB A;  3F31 A;  1FMW A;  2PJQ A;  3U3I A;  4ILU A;  3JC6 C;  5JQG E;  3WAJ A;  2R6G F;  4L5G A;  5LOV E;  4ZZB A;  3ESL A;  1LVK A;  2W2U A;  4CN1 A;  3IHR A;  5JRC B;  2CHO A;  3FZK B;  3UTK A;  2FJB A;  2YK0 A;  4IIJ E;  5LGT B;  4ADZ A;  1MMA A;  4FJO A;  2XZE A;  3AB3 B;  1J5E T;  3AAE B;  4GKK T;  3FHN A;  3OKQ A;  5AQP B;  3RQU A;  1MND A;  1W0A A;  2WWU A;  5F3J A;  4UVB B;  3UUL A;  3PDY A;  3B57 A;  3P50 A;  1D1B A;  2HHH T;  4F6R C;  1KNP A;  1XZY A;  2V5C A;  3ZCJ A;  4YSZ A;  2UUB T;  2LSG A;  3RGL A;  4K0K T;  4WYV A;  2X9W A;  1HX8 A;  5L3G B;  3CPZ A;  2UXD T;  4I55 E;  2KWI B;  4HFV A;  4P0A A;  4A5X A;  3I1A A;  4GKJ T;  1BR1 A;  2A72 A;  2XQ8 A;  1IBM T;  4LF9 T;  3I9Y A;  2W4X A;  2BVL A;  4WNK A;  3T1H T;  4LFC T;  4XBF B;  2ODU A;  3UU3 A;  4LF5 T;  1LRZ A;  4U7I A;  1U4Q A;  2WCA A;  3P4R A;  1D0Z A;  1U5P A;  1J5W A;  2XM1 A;  3BK9 A;  3IF8 B;  3SRZ A;  5CFB A;  1IJ5 A;  2YKS A;  2LM2 A;  3KV4 A;  5LHG B;  4DR4 T;  4LMJ A;  1T72 A;  3N9N A;  5JDF A;  3LK4 2;  4YY3 T;  2CWO A;  2VWA A;  4BJN A;  2BG9 A;  5JDQ A;  2DI4 A;  4HFE A;  1HTJ F;  4CXW A;  2KZ7 B;  2VKD A;  2E8I A;  3RC3 A;  2I0M A;  5HXC A;  1T7S A;  2M67 A;  1X79 A;  4J2C A;  3JAE A;  2KWH A;  4ZOL E;  3KV9 A;  2CWY A;  3Q5D A;  4Z8X A;  2YU1 A;  4HE8 A;  2J47 A;  2E9X C;  3AE8 A;  2V7L A;  4AKR B;  4UXN B;  3RC8 A;  2OV9 A;  4YLH A;  4PJN A;  4YSX A;  4DUZ T;  3RI5 A;  3N5L A;  4ILB A;  3J7Y q;  2VKH A;  2W66 A;  4IGU A;  3AAA B;  4N78 D;  5IYZ E;  3UT5 E;  5L4E A;  4DR7 T;  3MKD A;  5EK2 A;  1X9B A;  2MOZ A;  4O2B E;  4DO0 A;  2NP9 A;  3AE9 A;  4HGA A;  5FVL A;  1ZP0 A;  2C5J A;  3NVO A;  3HA4 A;  2DNX A;  1UCU A;  3D0T A;  2DLR A;  2HN1 A;  3QC9 A;  4U33 A;  2LSK A;  3TLW A;  5AQS B;  5FY1 A;  2XAQ B;  2JMH A;  2UXB T;  2OLT A;  2NR4 A;  5IHY A;  1KEY A;  3MZK B;  2BVM A;  1W09 A;  1UUR A;  3PUA A;  4FI5 A;  1YQ3 A;  3RPU A;  2JMK A;  4PW8 A;  2FUP A;  5L3D B;  2B1E A;  3ANW B;  2RP4 A;  4UV8 B;  5KMG P;  4DV1 T;  2A9U A;  2MYS A;  2QVA A;  3ETU A;  2EHO D;  2ZM6 T;  1E2A A;  2H7O A;  2KMF A;  3B13 A;  5FL0 A;  4X64 T;  3T1Y T;  4EGW A;  2KIN B;  3AVR A;  4M1P A;  4L0R A;  2IHR 1;  3ANW A;  1W0B A;  5E0O A;  3ZEF B;  1HG2 A;  3PV0 F;  2M6I A;  2ODV A;  4H9O C;  5H6Q B;  1HR0 T;  3IEE A;  4UV9 B;  4ZI3 D;  1V9D A;  1HF8 A;  1UK5 A;  3OPC A;  1HX1 B;  4ANJ A;  4PJM A;  5A1L A;  3UFG A;  2LRK A;  2CXF A;  3ZC1 A;  4PK5 A;  1NWM X;  1YKE B;  3E0Z A;  5LHH B;  2E9X A;  2UXX B;  3PUR A;  5FXZ A;  4JI2 T;  5JDL A;  4X5T A;  2AXD S;  2W0G A;  2WZI A;  5FVK A;  3R6N A;  3KBT A;  5AQU B;  4BJM A;  2H3R A;  2XQ5 A;  3AXJ A;  3QOF A;  2NTX A;  4TV9 E;  3X1D A;  3Q5W A;  4A56 A;  1QUU A;  2VL8 A;  4TUY E;  1E7P A;  4DBQ A;  4F8H A;  5ABE A;  2XTL A;  3IBP A;  3AA7 B;  4UVC B;  5M4Y A;  3C51 A;  2YU2 A;  3RH3 A;  2AE9 A;  4XZC A;  5DQV A;  1GQE A;  2X9H A;  4ZZC A;  5JTG A;  1MIW A;  3FB2 A;  2V6Y B;  2V7I A;  3HI2 A;  1SHZ C;  2RPA A;  2VUR A;  4AQF A;  4KP3 C;  3VHL A;  2IML A;  4TZ4 C;  2QA7 A;  2JPF A;  5EK3 A;  1KK7 A;  2IAK A;  5FL1 A;  3P4P A;  2LT3 A;  4DV2 T;  3H3A A;  4IL9 A;  4GYS A;  3CVR A;  5FXW A;  2J4G A;  4YT0 A;  3SOL A;  3UUX B;  2PG8 A;  3LJC A;  4ILC A;  3ZMU B;  5HWX A;  1HNW T;  5JR9 C;  1WR0 A;  5HCM A;  2K9A A;  5LHI B;  3N9M A;  2XUE A;  4EZ4 A;  2Q9Q D;  5HEH A;  3V5S A;  4CN6 A;  3O9X A;  1SA0 E;  4KMC A;  3VU7 H;  4TWH A;  5ABF B;  2VAS A;  4NPP A;  3RIF A;  2CBJ A;  4HWD A;  1VOM A;  2XQ7 A;  3SFE A;  1SE7 A;  2D2S A;  2ZM0 A;  3CQG B;  1I94 T;  5KDM C;  5LYJ E;  4O4L E;  1FIO A;  3NKZ A;  4QXH B;  3TLS A;  3HKB E;  3PJA A;  4QHO A;  2CXD A;  2XSB A;  3JAD A;  5DQW A;  5FP3 A;  3NZQ A;  4CZZ B;  2XAF B;  3UU6 A;  5AQT B;  4ZI7 E;  5BR8 T;  2VKJ A;  4PFP A;  3UUM A;  1OED C;  2YDQ A;  3KV6 A;  1BR2 A;  1YD8 G;  2CRB A;  4X20 E;  3UU8 A;  1WFD A;  1JNZ A;  4AKI A;  1ZOY A;  1G73 A;  5ABG A;  2LEH A;  2WQY A;  3SWH A;  2XSA A;  4TX5 A;  4JI5 T;  2W62 A;  2BZB A;  5AQO B;  1WCR A;  3AEE A;  2D0T A;  4UF0 A;  1HNX T;  2CLY B;  1T98 A;  2HPL A;  2BS4 A;  3AAI A;  4L9I A;  3AVS A;  3C50 A;  2Y48 B;  3PTR B;  5LMN T;  2LSY A;  3HR0 A;  3N9P A;  1WLX A;  3G06 A;  5HEJ A;  4ZS2 A;  2E9X B;  5J2U E;  5LBM A;  3A8Y C;  3ZN1 B;  4YTP A;  1LVF A;  5JDH A;  3EI0 A;  2HN2 A;  4PFO A;  4IRE A;  4U72 A;  2PBI A;  3ZCI A;  2G0U A;  5IUX A;  4PJL A;  4IL4 A;  4WBN E;  5C8Y E;  4DUY T;  3BQK A;  2KLQ A;  2Y6X A;  2GK9 A;  5LA6 E;  5KXJ A;  2L3L A;  3L3P A;  3FBZ A;  2X66 A;  1E1H B;  2K3W A;  3QUJ A;  4GOU A;  4CXY A;  3PUY F;  2X9X A;  3W15 B;  2SPC A;  3LK2 B;  4HN9 A;  4DR3 T;  2V8S V;  5AQF B;  3A5X A;  4LML A;  3UUB A;  2V7J A;  3CWZ B;  2WWV A;  4BAY B;  5FXX A;  1ZEE A;  2XM2 A;  1AJ3 A;  1XNR T;  1L0V A;  2CCQ A;  3B5M A;  4QWN B;  4IDP A;  4DV7 T;  2XY8 B;  4ZEY A;  4JUY A;  5LNK A;  2WB5 A;  4COF A;  2PFV A;  3QB5 K;  3ABV A;  3LG7 A;  2Q9Q A;  3AEA A;  3PUW F;  2Y8D A;  4JI4 T;  1NEN A;  4YJ2 E;  3BQL A;  4PK6 A;  4B3R T;  4CN4 A;  3DP7 A;  4OK0 A;  4G63 A;  4TNV A;  4BA9 A;  5JRC A;  5CB4 E;  4CI2 B;  2BBJ A;  3L8R A;  4E7S A;  2X0L B;  3UUN A;  2I6H A;  3N2K E;  2IW5 B;  4AIU A;  1FEW A;  2LLY A;  3PUZ F;  4DR2 T;  3P7I A;  3E22 E;  4H63 V;  4QKN A;  4A97 A;  1VCS A;  2LSJ A;  2E9X D;  1D1C A;  3U78 A;  2LKH A;  4OFZ A;  3SFD A;  5LJN A;  3HKE E;  4EV6 A;  4XAX B;  1Y64 B;  2FJA A;  2F4V T;  2WDV A;  5J1G A;  2YDR A;  1WYB A;  1MMD A;  3MA9 A;  5LB7 B;  4YJ3 E;  4A98 A;  4JLE A;  3TLV A;  4EAH A;  5CJ5 A;  1IJ6 A;  2BBH A;  2L9Q A;  3ONL C;  4P0B A;  3RRC A;  2C0S A;  3RRW A;  4DVD A;  4CI1 B;  2XQ9 A;  3C64 A;  3OVU A;  3CX8 B;  3RHW A;  1HG5 A;  3GMI A;  4YSY A;  1IBK T;  1YQ4 A;  4KUM B;  4NIQ A;  4P09 A;  3P4Q A;  5AQJ B;  1NEK A;  5LP6 E;  4AXP A;  3AEG A;  4LF6 T;  4H9Q C;  3AA6 B;  2WMO A;  3RX6 A;  5AQI B;  3AEF A;  3I0O A;  2IC9 A;  2WZH A;  4QXC B;  4TNW A;  1Z8U A;  3L09 A;  2D5U A;  2UXC T;  3ZJ1 A;  2JIW A;  3KVA A;  1XMQ T;  3KV5 A;  4QXB B;  4JEH B;  3EUH A;  4HWC A;  5AQK B;  3MJX A;  2CMR A;  4CQI A;  2C5K T;  3AA0 B;  2XQ4 A;  3QB5 A;  4TV8 E;  4YHJ A;  4YXD A;  3LSV A;  1VRB A;  3ZYK A;  5LG3 A;  2NW7 A;  2ACX A;  2BS3 A;  5L4H A;  2MPK A;  2XAJ B;  3ZMS B;  3AEC A;  2XHE B;  3N9O A;  5L2L A;  3M3Z B; 
#chains in the Genus database with same CATH homology
 3NRX A;  5LGN B;  2DCF A;  1IZN B;  2N1G A;  2XAH B;  3ZMT B;  1ZHC A;  3O1H A;  3VKH A;  3ZJ2 A;  4EB6 E;  5JR9 B;  2L8K A;  4UEL A;  4B6X A;  3K8P C;  4DBR A;  3K3Q C;  4MFR A;  4ZI2 C;  3DJB A;  2V26 A;  3ZMZ B;  2Q9Q C;  1YW0 A;  3QK6 A;  3S4U A;  1O3X A;  3FXD B;  1H7C A;  4CI3 B;  1S35 A;  3ZPO A;  4UF0 B;  5FNV E;  4GK0 E;  1ZV4 X;  3TKL B;  3HKD E;  2QGS A;  2K48 A;  2VB6 A;  2EHO A;  2CA5 A;  2NOX A;  2LM9 A;  2NW9 A;  3RYH E;  2KND A;  4IHJ E;  1WR6 A;  3C4X A;  2MBG A;  3VKG A;  3K3N A;  2CXL A;  4HEA A;  4EOZ B;  3WI3 A;  3FBL A;  4ZI2 D;  2LHN A;  3O1J A;  4V1A v;  1NAF A;  5FY0 A;  3LBX A;  4X1I E;  2K5B B;  3LK3 B;  5HAX A;  4ZI3 C;  4MBQ A;  4AKL A;  1LKX A;  2KXP B;  2LHR A;  3O1I A;  3WAK A;  2HPJ A;  3C4Z A;  3N9L A;  5FYM A;  2DWK A;  2YIN A;  2CM0 A;  2UXN B;  2P9B A;  3RKO A;  3GWH A;  4U74 A;  3SS1 A;  4K0U A;  5FY7 A;  4DMV A;  3AA1 B;  3Q9D A;  4O2A E;  2MTQ A;  3R84 B;  3ONX A;  1MIV A;  2EHO B;  3RYF E;  4ZI7 E;  3Q2M A;  2XQY A;  3H37 A;  3N2O A;  4HTE A;  3F57 A;  1OXZ A;  3C4W A;  5H6R B;  4EXT A;  4WW0 A;  1HS7 A;  3OBV E;  4ISS A;  3MXZ A;  4ASK A;  1D0Y A;  3PE0 A;  1MMG A;  3K3O A;  4IE6 A;  2X68 A;  2NW8 A;  3M65 A;  3JC6 D;  5GON E;  2LE8 A;  5JR9 A;  3T8O A;  3Q5X A;  5FXV A;  2D0U A;  5JVD E;  3PU3 A;  5LXT E;  3N9Q A;  3CQX C;  1WYC A;  4ZS3 A;  1QSD A;  4JEU B;  5JDM A;  3ZYL A;  1EZ3 A;  2ZMA A;  3N2G E;  3PUQ A;  3RYI E;  3ZMV B;  2LOP A;  1UX4 A;  4O4H E;  2A3D A;  3J9X 1;  3EVY A;  3I9W A;  4EIW A;  4H9S E;  3KBU A;  4IE7 A;  4EZH A;  5AFU L;  4H63 H;  2JJ9 A;  1D0X A;  4UIG A;  4NUU A;  4UVA B;  3ZN0 B;  4MLK A;  5HXR A;  2WAU A;  5LGU B;  1MNE A;  5CA1 E;  4IST A;  2V1D B;  3BQI A;  4O8S A;  2BDE A;  4NUV A;  5JH7 E;  1HFA A;  2WM9 A;  3ZC0 A;  2H7V C;  3MK7 C;  4KBM B;  3CX6 B;  3DTO A;  1BR4 A;  3ZYM A;  3EDU A;  5LG4 A;  1G8X A;  4IE0 A;  3KDS E;  5TAO A;  2WSS V;  2J1D G;  1CUN A;  1D1A A;  1HCI A;  2N9D A;  2OA5 A;  4QX7 B;  4AQF C;  3KVB A;  5HXE A;  4PNI A;  4CXX A;  4E7Z A;  2C5I T;  4TN7 B;  3ZLI A;  2Q9Q B;  4PJJ A;  5FMN A;  3PUG A;  4IDZ A;  2ES0 A;  2LOS A;  1S94 A;  4X1Y E;  4O4I E;  4DMW A;  5L3B B;  5LJM A;  5L3E B;  2Z6E A;  4DND A;  4OYJ A;  3LFM A;  3MAC A;  2CLY C;  3OJA A;  5DJQ C;  2NWB A;  5L3F B;  3O4X E;  2VKO A;  3C98 B;  3FXE B;  5JDN A;  1US7 B;  2WMN A;  4C90 A;  3GA8 A;  4ERR A;  4GIW A;  5HYA A;  4I50 E;  4X1K E;  4MHC A;  2I59 A;  3F2E A;  2YEV C;  5CA0 E;  5HWY A;  2DHR A;  3RYC E;  4WBO A;  4OHF A;  4AKH A;  4YFS A;  4H9R C;  4EYY R;  5HXH A;  1YKH B;  2DWG A;  2JQQ A;  3HL6 A;  3KFW X;  5JDG A;  4H9N C;  4H9P C;  2XAG B;  2CE7 A;  5HXS A;  2CEA A;  1MMN A;  3HKC E;  4UEM A;  3GN5 A;  2EHO C;  3KIN B;  5ETW A;  3NBX X;  2V7M A;  3CX7 B;  5ADX L;  4AQG A;  4HKA A;  3I0Q A;  4OYK A;  2WBL A;  2X51 A;  5J2T E;  1OWA A;  2X9Y A;  3LBX B;  2VK9 A;  4C91 A;  3CML A;  4ZHQ E;  4IE5 A;  5F8P A;  4MAL A;  3NRY A;  3V5U A;  1UX5 A;  3OYX A;  1B7T A;  2KT9 A;  1WRD A;  2X67 A;  3CQC B;  2JRK A;  5EK4 A;  4QX8 B;  2ZM8 A;  3GN5 B;  4O4J E;  2IC6 A;  4GYR A;  2W63 A;  2V7K A;  2W00 A;  3CKD A;  2A2F X;  2HH7 A;  5L3C B;  2ZLY A;  4G2A A;  1Z0P A;  5JRE A;  1FMV A;  2XAS B;  3PUS A;  4GK5 E;  2ZM2 A;  3E08 A;  3NZP A;  4AKG A;  3P8C D;  1BR0 A;  4PAG A;  3PU8 A;  2K24 A;  2N2N A;  4EYU A;  1IAP A;  5LBQ B;  2LSI A;  3OYZ A;  1ZKE A;  3EDV A;  2NTY A;  2RA1 A;  3ETV A;  4IE4 A;  4PK4 A;  4I4T E;  4I43 B;  3UFE A;  2W61 A;  5EZY E;  2LJL A;  5DAB A;  5LCY A;  4AI6 A;  5BMV E;  1MIY A;  5KX5 E;  1KNZ A;  3F31 A;  1FMW A;  2PJQ A;  3U3I A;  4ILU A;  3JC6 C;  5JQG E;  3WAJ A;  4L5G A;  5LOV E;  3ESL A;  1LVK A;  3IHR A;  5JRC B;  3UTK A;  2YK0 A;  4IIJ E;  5LGT B;  4ADZ A;  1MMA A;  4FJO A;  3AB3 B;  3AAE B;  3FHN A;  3OKQ A;  1MND A;  2WWU A;  5F3J A;  4UVB B;  3UUL A;  3PDY A;  3B57 A;  1D1B A;  4F6R C;  3ZCJ A;  2LSG A;  2X9W A;  1HX8 A;  5L3G B;  3CPZ A;  4I55 E;  2KWI B;  4HFV A;  4P0A A;  3I1A A;  1BR1 A;  2A72 A;  3I9Y A;  4WNK A;  2BVL A;  4XBF B;  2ODU A;  1LRZ A;  1U4Q A;  1D0Z A;  1U5P A;  3BK9 A;  3SRZ A;  3IF8 B;  1IJ5 A;  3KV4 A;  5LHG B;  3N9N A;  5JDF A;  3LK4 2;  2CWO A;  2VWA A;  4BJN A;  5JDQ A;  2DI4 A;  1HTJ F;  4CXW A;  2KZ7 B;  2VKD A;  2E8I A;  3RC3 A;  5HXC A;  2M67 A;  1X79 A;  4J2C A;  4ZOL E;  2KWH A;  3KV9 A;  2CWY A;  4Z8X A;  2YU1 A;  4HE8 A;  2E9X C;  2V7L A;  4AKR B;  4UXN B;  3RC8 A;  4YLH A;  4PJN A;  3N5L A;  3J7Y q;  2VKH A;  4IGU A;  5IYZ E;  3AAA B;  4N78 D;  3UT5 E;  3MKD A;  5EK2 A;  2MOZ A;  4O2B E;  4DO0 A;  2NP9 A;  4HGA A;  2C5J A;  3QC9 A;  3HA4 A;  2DNX A;  1UCU A;  3D0T A;  2DLR A;  2LSK A;  5FY1 A;  2XAQ B;  2JMH A;  5IHY A;  4FI5 A;  3MZK B;  2BVM A;  3PUA A;  3RPU A;  5L3D B;  2JMK A;  4PW8 A;  2B1E A;  3ANW B;  2RP4 A;  4UV8 B;  5KMG P;  2MYS A;  3ETU A;  2EHO D;  2H7O A;  2KMF A;  3B13 A;  2KIN B;  3AVR A;  4M1P A;  4L0R A;  3ANW A;  5E0O A;  3ZEF B;  1HG2 A;  2ODV A;  4H9O C;  5H6Q B;  3IEE A;  4UV9 B;  4ZI3 D;  1V9D A;  1HF8 A;  4ANJ A;  5A1L A;  4PJM A;  2CXF A;  3ZC1 A;  4PK5 A;  1NWM X;  1YKE B;  3E0Z A;  5LHH B;  2E9X A;  2UXX B;  3PUR A;  5FXZ A;  5JDL A;  2W0G A;  3R6N A;  3KBT A;  4BJM A;  2H3R A;  4TV9 E;  2NTX A;  4A56 A;  3Q5W A;  1QUU A;  2VL8 A;  4DBQ A;  2XTL A;  3IBP A;  3AA7 B;  4UVC B;  5M4Y A;  3C51 A;  2YU2 A;  3RH3 A;  4XZC A;  5DQV A;  2X9H A;  1MIW A;  3FB2 A;  2V7I A;  3HI2 A;  1SHZ C;  4AQF A;  4KP3 C;  3VHL A;  4TZ4 C;  2QA7 A;  2JPF A;  5EK3 A;  1KK7 A;  2IAK A;  2LT3 A;  3H3A A;  5FXW A;  4GYS A;  3CVR A;  3SOL A;  3UUX B;  2PG8 A;  3LJC A;  3ZMU B;  5HWX A;  5JR9 C;  5LHI B;  2K9A A;  3N9M A;  2XUE A;  4EZ4 A;  2Q9Q D;  3V5S A;  3O9X A;  1SA0 E;  4KMC A;  3VU7 H;  2VAS A;  1VOM A;  2D2S A;  2ZM0 A;  3CQG B;  5KDM C;  5LYJ E;  4O4L E;  1FIO A;  4QXH B;  3HKB E;  4QHO A;  2CXD A;  5DQW A;  5FP3 A;  3NZQ A;  4CZZ B;  2XAF B;  2VKJ A;  4PFP A;  3UUM A;  3KV6 A;  1BR2 A;  1YD8 G;  4X20 E;  4AKI A;  1G73 A;  2LEH A;  3SWH A;  4TX5 A;  2W62 A;  2BZB A;  2D0T A;  4UF0 A;  2CLY B;  1T98 A;  2HPL A;  3AAI A;  4L9I A;  3AVS A;  3C50 A;  2Y48 B;  3PTR B;  2LSY A;  3HR0 A;  3N9P A;  1WLX A;  4ZS2 A;  2E9X B;  5J2U E;  5LBM A;  3ZN1 B;  1LVF A;  5JDH A;  4PFO A;  4U72 A;  2PBI A;  3ZCI A;  2G0U A;  4PJL A;  4WBN E;  5C8Y E;  3BQK A;  2KLQ A;  2Y6X A;  2GK9 A;  5LA6 E;  2L3L A;  3L3P A;  3FBZ A;  2X66 A;  1E1H B;  4GOU A;  3QUJ A;  4CXY A;  2X9X A;  3W15 B;  2SPC A;  3LK2 B;  4HN9 A;  3A5X A;  2V7J A;  3CWZ B;  4BAY B;  5FXX A;  1ZEE A;  1AJ3 A;  2CCQ A;  4QWN B;  5LNK A;  4JUY A;  2PFV A;  3LG7 A;  2Q9Q A;  2Y8D A;  4YJ2 E;  3BQL A;  4PK6 A;  3DP7 A;  4OK0 A;  4G63 A;  4BA9 A;  5JRC A;  5CB4 E;  4CI2 B;  4E7S A;  2X0L B;  3UUN A;  3N2K E;  2IW5 B;  1FEW A;  3P7I A;  3E22 E;  4H63 V;  4QKN A;  2LSJ A;  2E9X D;  1D1C A;  3U78 A;  4OFZ A;  5LJN A;  3HKE E;  4XAX B;  1Y64 B;  5J1G A;  1WYB A;  1MMD A;  3MA9 A;  4YJ3 E;  4JLE A;  4EAH A;  1IJ6 A;  2L9Q A;  4DVD A;  4P0B A;  3RRC A;  3RRW A;  2C0S A;  4CI1 B;  3C64 A;  3CX8 B;  1HG5 A;  3GMI A;  4KUM B;  4P09 A;  5LP6 E;  4AXP A;  4H9Q C;  3AA6 B;  2WMO A;  3RX6 A;  3I0O A;  2IC9 A;  4QXC B;  3L09 A;  2D5U A;  3ZJ1 A;  3KVA A;  3KV5 A;  4QXB B;  4JEH B;  3EUH A;  3MJX A;  2CMR A;  4CQI A;  2C5K T;  3AA0 B;  4TV8 E;  4YHJ A;  1VRB A;  3ZYK A;  2NW7 A;  2ACX A;  3ZMS B;  2XAJ B;  4TUY E;  2XHE B;  3N9O A;  5L2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...