4JEUB

Crystal structure of munc18a and syntaxin1 with native n-terminus complex
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
242
structure length
225
Chain Sequence
KDRTQELRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Syntaxin-binding protein 1
publication title Syntaxin1a variants lacking an N-peptide or bearing the LE mutation bind to Munc18a in a closed conformation.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis/exocytosis
total genus 90
structure length 225
sequence length 242
ec nomenclature
pdb deposition date 2013-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00804 Syntaxin Syntaxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4jeuB00
5LG4A 1HS7A 4TX5A 3LG7A 1G73A 1FEWA 1EZ3A 3C98B 1BR0A 4JEUB 5M4YA 1S94A 2DNXA 1FIOA 2XHEB 4JEHB
chains in the Genus database with same CATH superfamily
3ZKRA 1N36T 1KNRA 3PE0A 2KWIB 1HFAA 4HWHA 4H9SE 3EHZA 4IGUA 3MA9A 4QKNA 2HPJA 4B6XA 2F4VT 2E5LT 3Q5EA 1FIOA 4HFCA 1U4QA 1SE7A 3KV6A 2QGSA 2VQFT 3O9XA 4PFOA 4E7SA 3ZC0A 3AA7B 5LOVE 2CXLA 2XQ6A 5LJNA 3QC9A 2IC6A 2MTQA 5AQVB 1UK5A 2X67A 5CB4E 3TLUA 3H3AA 2X9WA 2FUPA 4AKIA 5HAXA 5C8YE 2M6IA 2WB5A 3OPCA 2CPTA 3R84B 1WR0A 2UXNB 2BG9A 4B3RT 3OVUA 2X0YA 3I9YA 3Q5WA 1B7TA 3QUJA 3CQXC 2X51A 2W61A 3UFGA 4A97A 2UU9T 4HGAA 4YFSA 2ZMAA 5JDQA 2PBIA 4DR2T 3HKDE 2MPKA 1KFYA 3KV4A 1WR6A 2FBWA 5HXRA 3ABVA 4X20E 3PUZF 5IYZE 4LFBT 4QH1A 5H6RB 5LHHB 4AI6A 4Q25A 3FZHB 1R8IA 1U5PA 3H3MA 3AVSA 1FEWA 2Y6XA 2CBIA 4MHCA 5JDNA 5E0OA 5HCMA 4JI2T 5BMVE 2V7KA 5HWYA 1KEYA 1NEKA 2LKGA 3ZYMA 4PK6A 3E22E 5LG3A 2LT3A 1W0BA 3AE7A 3ONJA 1WYCA 3L8RA 1YW0A 4EYYR 3ONXA 4IE7A 3PV0F 3AEEA 4JEHB 3CIRA 4X1KE 4IDQA 4HWDA 5AQIB 3M65A 3FZKB 2Q9QC 1NAFA 5KMGP 4IL9A 2E2AA 3LK2B 1V9DA 4IDPA 4U33A 5HXSA 4TNVA 1KK7A 2OLTA 3ZCJA 4JI6T 2H3RA 4DV3T 3E0ZA 5EK2A 3AE4A 5JH7E 4Z91A 3VKHA 3NRYA 4EIWA 2WCAA 4G2AA 3RKGA 1JNZA 3I0OA 3UTKA 5L47A 1QLBA 4OK0A 2XAGB 4UV9B 2WZHA 1XNRT 3PJAA 1BR0A 4LF9T 4EEBA 4QHOA 2LLYA 3UQ4A 3A5XA 3AA0B 2XQYA 1UUSA 1ZKEA 4U7YA 5L4HA 1SA0E 2XZEA 4QH4A 3BQIA 4TWDA 3LBXB 5L3DB 2LSKA 3HL6A 4AQFA 5DABA 5ABGA 4ZI2D 2BG9B 5ADXL 3WI3A 5AQGB 5ABHA 2WP9A 3ZYLA 5H6QB 2M67A 2JQ9A 3LFMA 4FJOA 4HE8A 4OYJA 2Y8DA 4A56A 4P0AA 1YKEB 3MJXA 3O4XE 4N78D 3RQUA 1LKXA 3JAFA 4AIUA 3AB3B 3UFEA 2DCFA 1HX1B 1IBKT 5CFBA 3D0TA 2X9HA 2YDSA 4K0KT 4PJLA 2WQYA 4DUZT 3L09A 3AE3A 3ZEFB 2UXBT 3VHLA 5JVDE 2UXXB 4I0UA 4U2YA 2WS3A 2KZ7B 4TNWA 3M3ZB 4UR9A 3N9PA 2UXDT 3HA4A 3P4QA 4XBFB 3B57A 1T98A 2XM2A 3HI2A 1UURA 3SFEA 3OBVE 2BS4A 2YDRA 5J2TE 2OA5A 4ZI3D 3FZLB 4KHPT 3HR0A 5LJMA 4ZZCA 4DVDA 1CUNA 3AA6B 4TZ4C 2IC9A 4GK0E 5FY1A 5DQVA 4YTPA 3KV5A 1QSDA 1OEDE 3NZQA 4IHJE 3NZPA 3JADA 5TAOA 3ONLC 2KMFA 3AE6A 2A3DA 5AQHB 5AQRB 1HNZT 4KMCA 3PUWF 4H63H 3KVAA 2M6BA 5KDMC 1FJGT 2VASA 2VWAA 3KBTA 2VKDA 2CA5A 3QB5A 2W67A 4G63A 4ZOLE 3GA8A 2K3WA 2CWOA 4TX5A 3RPUA 3UU4A 4IDNA 1BR4A 2JPFA 3KBUA 1J1JA 4JYAT 5AQFB 1HS7A 2ES0A 3UUXB 2XJ7A 1IBLT 3AA1B 2W00A 3I0QA 4NUUA 4JI1T 2PJQA 1QUUA 4O4LE 3ZMSB 2CM0A 2XQ9A 2ODVA 3RC3A 3ZSTA 1IJ6A 1G73A 5AQQB 5FXWA 2BBHA 2NW9A 2J4GA 3JCFA 2WWUA 3PTRB 2WY2A 3QNUA 5JRCB 5ETWA 3NBXX 3S4UA 4GKJT 3N9NA 3N9OA 4LF4T 3P8CD 2MOZA 3B13A 3N9QA 2LJLA 5DQWA 3RKOA 4JI5T 5JDGA 3OTOT 4PAGA 4DV6T 2E9XA 2NOXA 3SWHA 4DNDA 3TLWA 2XAHB 3PU8A 2EHOA 3ESLA 2L8KA 4DV1T 5AQUB 3T8OA 2DNXA 5C2TA 3PURA 2I6HA 2V7IA 1YXRA 3P50A 3KV9A 5ABFA 1LVFA 3UULA 4IDOA 5LA6E 4ZI7E 2ZM6T 4COFA 1VOMA 4GYSA 2KT9A 1YQ3A 2BS3A 5HWXA 5DJQC 2VURA 3Q9DA 4X5TA 2WSSV 5LBQB 3ZMUB 5FVLA 2KSRA 3F2EA 1M7KA 2KINB 4DMVA 2V8SV 1HNWT 5LMUT 3Q2MA 1E2AA 1KNZA 3RIUA 3ANWB 1D0YA 1X79A 4X66T 4AKLA 2ZM8A 2JJ9A 3NVOA 4CI1B 3CX8B 2ZM2A 2X0LB 1UX5A 3DTOA 2CBJA 2E9XD 5LYJE 3RLFF 2NW8A 1IAPA 2W2UA 1YKHB 2BKNA 2EHOD 3C51A 1O3XA 1XDOA 4I50E 4MBQA 1EZ3A 2XAQB 3PUSA 2LHNA 3PUYF 2N1GA 4DV2T 2PG8A 3C64A 2PFVA 5LNKA 1HNXT 4YHJA 2DI4A 4LMLA 1XNQT 4OYKA 2VQET 3LK3B 4H9PC 2LOSA 3DJBA 5LGNB 3UU8A 2DL1A 3CQGB 2JQKA 2YK0A 4YTMA 2WU5A 4JBWF 3W15B 2WAUA 3FZFB 1LRZA 2DHRA 2YOEA 3ZT5A 4GOUA 2LEHA 4DR6T 5A1LA 4L9IA 4QH5A 1BR1A 2NTYA 3P4SA 1VRBA 4EOZB 5FYMA 2LRLA 4GK5E 4QWNB 4LF8T 2E9XB 1XMQT 2XHEB 2QRXA 3CK6A 1CHUA 4V1Av 5FL0A 1ZOYA 4F8HA 4O4IE 2K5BB 2BBJA 3RRWA 3PU3A 4X1YE 5FY0A 3UUMA 2HN2A 2W66A 2FJEA 3Q5XA 3CPZA 4EEDA 2V7MA 1E7PA 3J9X1 2IW5B 4UF0A 4MLKA 4A98A 2BKOA 5AQKB 2XASB 3P4WA 5FNVE 3OJAA 4TN7B 3UQ7A 1AJ3A 4AXPA 3SOLA 4XZCA 1GQEA 4ASKA 3TLTA 1I6ZA 3ZN1B 2CXDA 3AAEB 4UVBB 4H9OC 5FXZA 3RF1A 5HEOA 3AVRA 1Y64B 5L2LA 2UUCT 2XSAA 2LM2A 4HFDA 4NIQA 3EI0A 4LFAT 2BG9C 5HEGA 5HEHA 5AQLB 2BVMA 4HWIB 2FJDA 1Z8UA 1N32T 1ZV4X 2XSBA 3DP7A 1OEDA 4TWFA 4PNIA 3NRXA 5LHGB 5AFUL 2CCQA 1L0VA 4ANJA 2FJBA 2YKSA 2VL8A 4DBRA 4C90A 2R6GF 2W62A 1MIVA 2CLYC 4B3ST 2MBGA 1MMDA 3P4PA 1X9BA 3FBLA 4I43B 2X9XA 4DR5T 3NKZA 4H9NC 4UXNB 4WBOA 4TV9E 3K8PC 5F5WA 2IIUA 2VB6A 2W0GA 3VKGA 1KF6A 3CWZB 4IIJE 1UGOA 5J2UE 2WDRA 4NXMT 1XWMA 3X1DA 4M1PA 4L5GA 4BA9A 4IREA 1MNEA 4ZI2C 2CLYB 3PUVF 3MZKB 2RP4A 2YEVC 3AE8A 4ZHQE 4YJ3E 4DV7T 4DUYT 4K0UA 4KUMB 3UT5E 4OX9T 2JQQA 3PJAJ 2UUAT 3MACA 2KXPB 3TKLB 4X62T 4DR7T 4E7ZA 2CE7A 3GWHA 1NENA 2CMRA 3LSVA 4DIDB 2RPAA 4LF6T 4LMKA 5HXCA 3AE1A 2IMLA 1XZYA 4UF0B 2MYSA 4PK4A 3CX7B 4U7IA 4O4JE 3RI5A 3O1IA 3PUAA 4ZS2A 1FMVA 3ZYKA 4JI8T 1W09A 4ZI3C 2J47A 1MMNA 3AAAB 4ZS3A 4ILCA 5FP3A 3RRCA 3T1HT 1D1CA 2XAFB 4NXNT 2V7JA 3ETUA 3JAEA 3U78A 3O1HA 5LP6E 3A8YC 5CJ5A 2XQ4A 3CX6B 2H7OA 4ISTA 4AQFC 5ABEA 5L3GB 5AQJB 5L3BB 4U72A 4BAYB 3EVYA 3PUQA 2LSGA 4GKKT 4TUYE 2ZLYA 5J0ZA 4WW0A 3OYXA 1OEDB 4JI3T 2Y48B 4DO0A 3RC8A 2WDQA 1D1AA 5FKYA 5KX5E 4UIGA 3EUHA 4CN6A 1Y01A 2J62A 1MIWA 2C5IT 4HFHA 1OXZA 4EXTA 2A2FX 4Z90A 2JIWA 2H89A 4EZ4A 2L9QA 3UU3A 3G06A 2XAJB 2BDEA 1KNPA 2UUBT 2X66A 2KNDA 2YN6A 5JREA 4LFCT 3UU6A 1D1BA 1S94A 2QYWA 3QK6A 3VRAA 3WAKA 2H7VC 2XTLA 4I4TE 4CXXA 4DV0T 1IJ5A 4YT0A 4Z8XA 1IBMT 3FB2A 2VKOA 4PJMA 2WBLA 2V5DA 2Z6EA 5EZYE 1S35A 1D0ZA 3CVRA 4UV8B 1I94T 4J2CA 3C4WA 4UVCB 1XDPA 2BZBA 4JI4T 3T1YT 1J5ET 4X64T 2FJAA 4P0BA 1J5WA 5L4EA 3N9LA 1MMGA 1WFDA 2C5JA 4PK5A 1WRDA 4U31A 2DWKA 3ZJ2A 5AQNB 4UELA 5CGMA 5M4YA 4O2AE 3RYFE 1M62A 2C0SA 3LK42 3HKEE 3RYHE 3F31A 4CZZB 4QXHB 3C98B 3ZMZB 4HEAA 5FVKA 4ILAA 4CI3B 3FXEB 4CXWA 2D9DA 4ILUA 4EZHA 2LE8A 4YXDA 4JLEA 3RYCE 1G8XA 2YU2A 4IE5A 2K48A 4LF7T 1LVKA 4UVAB 4LMJA 2VVNA 4ZEYA 1SHZC 3UU5A 3RIAA 2NTXA 4AKGA 3ZCIA 3RGLA 4PW8A 4WYVA 5HXEA 4YSYA 4CI2B 2A9UA 2XUEA 2LSYA 4BJNA 4HFEA 1HG5A 3PDYA 2V1DB 2JQHA 2XM1A 4ERRA 2V6XA 2JRKA 3C4ZA 2HH7A 2E9XC 5FXXA 5FXVA 3QOFA 2L3LA 4BJMA 2E8IA 2Q9QA 3K3QC 1WLXA 4HN9A 3AXJA 2XQ5A 1T7SA 2EHOC 5FL1A 1D0XA 3LBXA 3KINB 2K24A 4YLHA 4X65T 4P09A 4EAHA 1E1HB 3V5SA 4ADZA 3UUBA 2K9AA 2BVLA 4DV5T 3CQCB 1DU2A 2XQ3A 5L3FB 4B3TT 5JDFA 5IWAT 1XMOT 3PUXF 2VKJA 1HCIA 3KFWX 3MXZA 3IEEA 4QX7B 4O2BE 4WBNE 2CEAA 1N34T 5HCJA 2YINA 2G0UA 4O8SA 5HXHA 3RHWA 4OFZA 5JDMA 2XQ8A 3RX6A 1W0AA 2EHOB 3AE9A 4CQIA 1W9RA 4LF5T 2J1DG 2ODUA 3RIUC 3B5MA 5GONE 3N2GE 4IE6A 4JEUB 5AQTB 3C50A 3BQKA 2W4XA 4OHFA 2H88A 4U2ZA 2CHOA 3LDQB 4DR4T 3AEGA 3OYZA 4CN4A 4PFPA 3F57A 5ABFB 3ZN0B 1WCRA 2VK9A 5J1GA 1T8BA 2E5VA 2Q9QD 3AAIA 4I55E 2WWVA 2RA1A 1HR0T 4GIWA 1HTJF 2VL0A 4EYUA 2N9DA 3LG7A 3C4XA 1JNRA 2ACXA 4KI0F 5JDLA 2HPLA 2D2SA 2I0MA 4H63V 4QX8B 2ZM0A 1UCUA 5JR9A 3CMLA 2CWYA 3TLSA 3JC6D 2BG9E 5CA1E 2NW7A 1Z0PA 1ZP0A 3HKCE 5LMNT 3I9WA 4PJNA 3OKQA 3ZJ1A 4HWCA 5LGUB 2I59A 3K3NA 2IUBA 3WAJA 3ZPOA 5KXJA 2KWHA 2DWGA 3I1AA 4TWHA 2HHHT 2A72A 2LM9A 4IT4A 3RIFA 2BKPA 4PJJA 2AXDS 1MIYA 4DR3T 3ZSSA 4EGWA 2V7LA 4JI7T 4KX6A 4JI0T 4L0RA 5AQSB 4HFIA 3JC6C 2WDVA 2NR4A 4CN1A 4P1NA 1HX8A 4YHHT 2Q9QB 2W63A 4AISA 3AXJB 1YD8G 3AEAA 5L3EB 1HG2A 4NPPA 3K3OA 4QXBB 2XY8B 4EV6A 3VR9A 4KBMB 4ILBA 5AQOB 4H9RC 3BQLA 4MALA 2D0TA 3BK9A 5JRCA 1H7CA 3GMIA 4QXCB 3NWIA 3U3IA 4A5XA 3V5UA 3EABA 4AQYT 5C3JA 3QB5K 3AE2A 3N9MA 3MKDA 4H9QC 2LHRA 4ZZBA 3CKDA 4JV5T 1US7B 3L3PA 3LJCA 4U3CA 5LG4A 2V6YA 3AECA 1UX4A 4HTEA 2IAKA 2P9BA 3AE5A 4U74A 4C91A 4F6RC 4YJ2E 2MAWA 2SPCA 5LB7B 3SRZA 3ZC1A 2YDQA 2IHR1 5JR9C 4WZXA 4X1IE 3N5LA 2N2NA 2X68A 4DMWA 3RH3A 4JUYA 1OEDC 2IDOB 4AKHA 1OWAA 5F3JA 3L39A 4FI5A 2AE9A 3GN5A 3P4RA 3ZLIA 4IDZA 3UUNA 1ZHCA 2X9YA 4YSXA 4DBQA 4DR1T 4XAXB 4ZXLA 1SUMB 3SS1A 3ANWA 2XQAA 4YTNA 4MFRA 2WU2A 3N2OA 5LCYA 2PTFA 2LOPA 3AEBA 3IBPA 4CXYA 3ZT6A 2KLQA 3HKBE 4DV4T 5JR9B 2XPKA 2UXCT 3IF8B 1MNDA 2OV9A 4EB6E 5L3CB 2B76A 1T72A 2QVAA 3IA3A 4YSZA 4YY3T 3H37A 3P7IA 2V5CA 1NWMX 5FMNA 2D5UA 4IL4A 4O4HE 3RYIE 2D0UA 1MMAA 5IHYA 2YU1A 2WZIA 2VVSA 3EDUA 3FHNA 4KP3C 3Q5DA 2CXFA 2WMOA 3AEDA 3ETVA 1N33T 4WNKA 5LGTB 5LHIB 3ZMVB 1VCSA 2X0HA 3FZMB 2C5KT 3N2KE 2HN1A 2LRKA 5BR8T 2ACZA 3IHRA 3KDSE 4GYRA 2LSJA 5LXTE 4KHZF 2JMHA 3FXDB 4HKAA 5LBMA 2WM9A 3K1SA 5IUXA 2JMKA 5F8PA 2BS2A 2CRBA 3R6NA 5JQGE 3VU7H 5HEUA 3EAMA 4IE4A 2LKHA 2CHNA 1FMWA 5EK4A 4IE0A 2DLRA 2V6YB 2XQ7A 1IZNB 2NWBA 5JTGA 4AKRB 3E08A 3J7Yq 5HYAA 3PUGA 2QA7A 2WMNA 3MK7C 1ZEEA 5FY7A 4ISSA 4B3MT 4HFBA 4HFVA 3O1JA 5HEJA 2LSIA 4NUVA 5EK3A 2NP9A 5JDHA 5CA0E 3ZT7A 4UEMA 2B1EA 1BR2A 3ZMTB 3VRBA 3TLVA 5AQPB 3EDVA 3A7MA 3AEFA 4AQGA 2VKHA 3GN5B 1YQ4A 3FBZA 1HF8A 4TV8E 2GK9A 4HWFA 1WYBA 1VCTA 3SFDA 3RQWA 3VR8A 5AQMB 3KVBA 2V26A
chains in the Genus database with same CATH topology
2PJQA 1QUUA 5J1GA 4O4LE 3PE0A 2KWIB 4ZI2C 2Q9QD 3AAIA 4I55E 1HFAA 2CLYB 4H9SE 3ZMSB 2CM0A 4IGUA 2ODVA 3MZKB 3RC3A 2RA1A 3MA9A 4QKNA 1IJ6A 4GIWA 1HTJF 2HPJA 2RP4A 4B6XA 2YEVC 4EYUA 4ZHQE 2N9DA 3LG7A 1G73A 4YJ3E 5FXWA 1FIOA 3C4XA 1U4QA 2NW9A 3KV6A 2QGSA 2ACXA 4K0UA 5JDLA 4KUMB 2HPLA 3UT5E 3O9XA 4PFOA 4E7SA 2WWUA 2JQQA 3PTRB 3ZC0A 2D2SA 3AA7B 5ETWA 3NBXX 5LOVE 2CXLA 3MACA 5JRCB 2KXPB 3S4UA 5LJNA 3N9NA 3TKLB 3QC9A 2IC6A 4E7ZA 3N9OA 2CE7A 3GWHA 3P8CD 2CMRA 2MTQA 2MOZA 4H63V 4QX8B 2X67A 5CB4E 2ZM0A 5HXCA 3B13A 3H3AA 3N9QA 2LJLA 2X9WA 4UF0B 1UCUA 2MYSA 5DQWA 3RKOA 5JR9A 3CMLA 4PK4A 3CX7B 4AKIA 2CWYA 5JDGA 3JC6D 4O4JE 5HAXA 5C8YE 4PAGA 5CA1E 2NW7A 1Z0PA 2E9XA 2NOXA 3HKCE 3I9WA 3R84B 4PJNA 3SWHA 3OKQA 3ZJ1A 4DNDA 2UXNB 3O1IA 3PUAA 5LGUB 2I59A 3K3NA 2XAHB 3PU8A 2EHOA 3WAJA 3ZPOA 2KWHA 3I9YA 3Q5WA 1FMVA 3ESLA 4ZS2A 3ZYKA 2DWGA 3I1AA 2L8KA 1B7TA 2A72A 2LM9A 3QUJA 4ZI3C 3T8OA 3CQXC 4PJJA 2DNXA 2X51A 1MMNA 3PURA 2W61A 1MIYA 3AAAB 2V7IA 4ZS3A 2V7LA 4HGAA 5FP3A 3RRCA 1D1CA 2XAFB 4L0RA 4YFSA 2V7JA 3KV9A 3JC6C 2ZMAA 3ETUA 3U78A 3O1HA 5JDQA 2PBIA 5LP6E 1LVFA 3UULA 3CX6B 3HKDE 5LA6E 4ZI7E 2H7OA 3KV4A 4ISTA 1WR6A 1HX8A 2Q9QB 5HXRA 4AQFC 1VOMA 2W63A 4GYSA 5L3GB 2KT9A 4X20E 5L3BB 4U72A 5IYZE 1YD8G 5HWXA 5DJQC 5H6RB 5L3EB 5LHHB 1HG2A 3Q9DA 4BAYB 3EVYA 3PUQA 3K3OA 2WSSV 2LSGA 4QXBB 5LBQB 3ZMUB 4AI6A 3F2EA 1U5PA 2KINB 4KBMB 4TUYE 4DMVA 2ZLYA 3AVSA 4H9RC 3BQLA 4WW0A 1FEWA 4MALA 2Y6XA 3OYXA 2D0TA 3BK9A 4MHCA 2Y48B 5JRCA 3Q2MA 4DO0A 3RC8A 1H7CA 3GMIA 1D1AA 5JDNA 4QXCB 5E0OA 1KNZA 5KX5E 4UIGA 5BMVE 3EUHA 3U3IA 2V7KA 1D0YA 3ANWB 3V5UA 5HWYA 1X79A 1MIWA 3N9MA 3MKDA 3ZYMA 4H9QC 2C5IT 1OXZA 2LHRA 4EXTA 4AKLA 4PK6A 3E22E 2LT3A 3CKDA 2ZM8A 2JJ9A 4CI1B 2A2FX 3CX8B 1US7B 2ZM2A 2X0LB 3L3PA 2L9QA 3LJCA 4EZ4A 1WYCA 1UX5A 1YW0A 3DTOA 5LG4A 4EYYR 2E9XD 5LYJE 3ONXA 4IE7A 2NW8A 1UX4A 4HTEA 2XAJB 1IAPA 2BDEA 2IAKA 2P9BA 4U74A 4JEHB 4C91A 4F6RC 1YKHB 2EHOD 2X66A 3C51A 4X1KE 1O3XA 2KNDA 4YJ2E 5JREA 4I50E 4MBQA 3M65A 1EZ3A 2Q9QC 1D1BA 1S94A 2XAQB 3PUSA 1NAFA 5KMGP 3QK6A 2SPCA 2LHNA 3SRZA 3WAKA 2H7VC 3ZC1A 2N1GA 2XTLA 3LK2B 4I4TE 1V9DA 4CXXA 5JR9C 4X1IE 2PG8A 3N5LA 3C64A 2PFVA 1IJ5A 2N2NA 2X68A 4DMWA 5HXSA 5LNKA 4Z8XA 1KK7A 3ZCJA 3FB2A 2VKOA 2H3RA 3RH3A 4PJMA 4JUYA 2WBLA 2Z6EA 5EZYE 1S35A 4YHJA 1D0ZA 3E0ZA 2DI4A 5EK2A 5JH7E 3CVRA 4UV8B 3VKHA 3NRYA 4AKHA 1OWAA 5F3JA 4EIWA 4FI5A 4J2CA 3C4WA 4UVCB 3GN5A 3ZLIA 4IDZA 2BZBA 4G2AA 4OYKA 3LK3B 3UUNA 4H9PC 1ZHCA 2X9YA 2LOSA 3DJBA 4P0BA 3I0OA 5LGNB 3CQGB 3UTKA 2YK0A 4OK0A 4XAXB 2XAGB 3N9LA 4DBQA 1MMGA 4UV9B 2C5JA 2WAUA 3W15B 1LRZA 4PK5A 3SS1A 1WRDA 2DHRA 2DWKA 3ZJ2A 1BR0A 3ANWA 4GOUA 4MFRA 4UELA 5M4YA 4QHOA 2LEHA 3N2OA 5LCYA 3A5XA 5A1LA 2LOPA 3AA0B 4L9IA 4O2AE 3IBPA 3RYFE 4CXYA 2XQYA 1BR1A 2NTYA 2KLQA 1ZKEA 3HKBE 5JR9B 1SA0E 3BQIA 1VRBA 4EOZB 2C0SA 5FYMA 3IF8B 3LBXB 4GK5E 5L3DB 4QWNB 2LSKA 1MNDA 3LK42 3HKEE 2E9XB 3RYHE 4EB6E 2XHEB 3F31A 4CZZB 5L3CB 3HL6A 4AQFA 4QXHB 3C98B 5DABA 3ZMZB 4HEAA 4ZI2D 4V1Av 3H37A 4O4IE 3FXEB 4CI3B 4CXWA 5ADXL 2K5BB 3WI3A 3RRWA 3PU3A 3P7IA 4X1YE 4ILUA 4EZHA 5FY0A 3UUMA 2LE8A 3ZYLA 5H6QB 2M67A 4JLEA 1NWMX 3LFMA 4FJOA 4HE8A 4OYJA 5FMNA 3RYCE 2Y8DA 1G8XA 2YU2A 4A56A 4P0AA 2D5UA 1YKEB 3MJXA 3Q5XA 3CPZA 2V7MA 3O4XE 4IE5A 4O4HE 3RYIE 2K48A 1LVKA 2D0UA 4N78D 1MMAA 4UVAB 4UF0A 2IW5B 3J9X1 5IHYA 2YU1A 4MLKA 1SHZC 3EDUA 3FHNA 4KP3C 2NTXA 1LKXA 4AKGA 2CXFA 2XASB 3ZCIA 5FNVE 3AB3B 3OJAA 4TN7B 2WMOA 1AJ3A 3UFEA 2DCFA 3ETVA 4PW8A 4AXPA 3D0TA 2X9HA 4WNKA 3SOLA 4PJLA 5HXEA 4XZCA 3L09A 4ASKA 4CI2B 3ZEFB 2XUEA 2LSYA 5LGTB 4BJNA 3ZN1B 5LHIB 2CXDA 3VHLA 3AAEB 1HG5A 3PDYA 3ZMVB 5JVDE 2V1DB 2UXXB 4UVBB 2C5KT 3N2KE 4H9OC 5FXZA 4ERRA 2KZ7B 3N9PA 3HA4A 4XBFB 3B57A 3AVRA 1T98A 2JRKA 3C4ZA 1Y64B 3HI2A 5L2LA 3IHRA 3OBVE 2HH7A 3KDSE 2LSJA 4GYRA 2E9XC 5FXXA 5LXTE 5J2TE 5FXVA 2OA5A 2L3LA 4ZI3D 2JMHA 3FXDB 2E8IA 2Q9QA 4HKAA 5LBMA 2WM9A 3K3QC 4BJMA 3HR0A 1WLXA 5LJMA 4HN9A 4DVDA 1CUNA 3AA6B 2JMKA 5F8PA 3R6NA 4TZ4C 2IC9A 4GK0E 5JQGE 2EHOC 5FY1A 2BVMA 5DQVA 3VU7H 4IE4A 3KV5A 1QSDA 1D0XA 3LBXA 3KINB 3NZQA 4IHJE 3NZPA 5TAOA 2K24A 1FMWA 4YLHA 2KMFA 5EK4A 4IE0A 4P09A 2DLRA 1ZV4X 4EAHA 1E1HB 3DP7A 2A3DA 3V5SA 4ADZA 2K9AA 2BVLA 3CQCB 4KMCA 1IZNB 4PNIA 4H63H 3NRXA 2NWBA 5LHGB 5AFUL 2CCQA 4AKRB 3E08A 5L3FB 3J7Yq 5HYAA 3PUGA 5JDFA 4ANJA 2QA7A 2VL8A 4DBRA 3KVAA 2WMNA 3MK7C 4C90A 2VKJA 1HCIA 5KDMC 3KFWX 3MXZA 1ZEEA 2W62A 3IEEA 4QX7B 5FY7A 4ISSA 1MIVA 4HFVA 4O2BE 2CLYC 3O1JA 2LSIA 4NUVA 2VASA 5EK3A 2MBGA 2VWAA 1MMDA 3KBTA 2VKDA 2NP9A 2CA5A 4WBNE 5JDHA 2CEAA 5CA0E 4UEMA 2B1EA 1BR2A 2YINA 3ZMTB 4G63A 3FBLA 2G0UA 3EDVA 4ZOLE 4I43B 2X9XA 4O8SA 5HXHA 4OFZA 5JDMA 3GA8A 3RX6A 4H9NC 4UXNB 2CWOA 4TX5A 4WBOA 3RPUA 4TV9E 3K8PC 2EHOB 4CQIA 1BR4A 4AQGA 2J1DG 2ODUA 2VB6A 2JPFA 2W0GA 2VKHA 3KBUA 3N2GE 4IE6A 5GONE 4JEUB 3VKGA 3C50A 3CWZB 3BQKA 1HS7A 2ES0A 3UUXB 3GN5B 4IIJE 3AA1B 3FBZA 1HF8A 4TV8E 5J2UE 2GK9A 1WYBA 4OHFA 2W00A 3I0QA 4NUUA 4M1PA 4L5GA 3OYZA 4PFPA 3F57A 3KVBA 4BA9A 3ZN0B 1MNEA 2V26A 2VK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LG4 A;  1HS7 A;  4TX5 A;  3LG7 A;  1G73 A;  1FEW A;  1EZ3 A;  3C98 B;  1BR0 A;  4JEU B;  5M4Y A;  1S94 A;  2DNX A;  1FIO A;  2XHE B;  4JEH B; 
#chains in the Genus database with same CATH topology
 3ZKR A;  1N36 T;  1KNR A;  3PE0 A;  2KWI B;  1HFA A;  4HWH A;  4H9S E;  3EHZ A;  4IGU A;  3MA9 A;  4QKN A;  2HPJ A;  4B6X A;  2F4V T;  2E5L T;  3Q5E A;  1FIO A;  4HFC A;  1U4Q A;  1SE7 A;  3KV6 A;  2QGS A;  2VQF T;  3O9X A;  4PFO A;  4E7S A;  3ZC0 A;  3AA7 B;  5LOV E;  2CXL A;  2XQ6 A;  5LJN A;  3QC9 A;  2IC6 A;  2MTQ A;  5AQV B;  1UK5 A;  2X67 A;  5CB4 E;  3TLU A;  3H3A A;  2X9W A;  2FUP A;  4AKI A;  5HAX A;  5C8Y E;  2M6I A;  2WB5 A;  3OPC A;  2CPT A;  3R84 B;  1WR0 A;  2UXN B;  2BG9 A;  4B3R T;  3OVU A;  2X0Y A;  3I9Y A;  3Q5W A;  1B7T A;  3QUJ A;  3CQX C;  2X51 A;  2W61 A;  3UFG A;  4A97 A;  2UU9 T;  4HGA A;  4YFS A;  2ZMA A;  5JDQ A;  2PBI A;  4DR2 T;  3HKD E;  2MPK A;  1KFY A;  3KV4 A;  1WR6 A;  2FBW A;  5HXR A;  3ABV A;  4X20 E;  3PUZ F;  5IYZ E;  4LFB T;  4QH1 A;  5H6R B;  5LHH B;  4AI6 A;  4Q25 A;  3FZH B;  1R8I A;  1U5P A;  3H3M A;  3AVS A;  1FEW A;  2Y6X A;  2CBI A;  4MHC A;  5JDN A;  5E0O A;  5HCM A;  4JI2 T;  5BMV E;  2V7K A;  5HWY A;  1KEY A;  1NEK A;  2LKG A;  3ZYM A;  4PK6 A;  3E22 E;  5LG3 A;  2LT3 A;  1W0B A;  3AE7 A;  3ONJ A;  1WYC A;  3L8R A;  1YW0 A;  4EYY R;  3ONX A;  4IE7 A;  3PV0 F;  3AEE A;  4JEH B;  3CIR A;  4X1K E;  4IDQ A;  4HWD A;  5AQI B;  3M65 A;  3FZK B;  2Q9Q C;  1NAF A;  5KMG P;  4IL9 A;  2E2A A;  3LK2 B;  1V9D A;  4IDP A;  4U33 A;  5HXS A;  4TNV A;  1KK7 A;  2OLT A;  3ZCJ A;  4JI6 T;  2H3R A;  4DV3 T;  3E0Z A;  5EK2 A;  3AE4 A;  5JH7 E;  4Z91 A;  3VKH A;  3NRY A;  4EIW A;  2WCA A;  4G2A A;  3RKG A;  1JNZ A;  3I0O A;  3UTK A;  5L47 A;  1QLB A;  4OK0 A;  2XAG B;  4UV9 B;  2WZH A;  1XNR T;  3PJA A;  1BR0 A;  4LF9 T;  4EEB A;  4QHO A;  2LLY A;  3UQ4 A;  3A5X A;  3AA0 B;  2XQY A;  1UUS A;  1ZKE A;  4U7Y A;  5L4H A;  1SA0 E;  2XZE A;  4QH4 A;  3BQI A;  4TWD A;  3LBX B;  5L3D B;  2LSK A;  3HL6 A;  4AQF A;  5DAB A;  5ABG A;  4ZI2 D;  2BG9 B;  5ADX L;  3WI3 A;  5AQG B;  5ABH A;  2WP9 A;  3ZYL A;  5H6Q B;  2M67 A;  2JQ9 A;  3LFM A;  4FJO A;  4HE8 A;  4OYJ A;  2Y8D A;  4A56 A;  4P0A A;  1YKE B;  3MJX A;  3O4X E;  4N78 D;  3RQU A;  1LKX A;  3JAF A;  4AIU A;  3AB3 B;  3UFE A;  2DCF A;  1HX1 B;  1IBK T;  5CFB A;  3D0T A;  2X9H A;  2YDS A;  4K0K T;  4PJL A;  2WQY A;  4DUZ T;  3L09 A;  3AE3 A;  3ZEF B;  2UXB T;  3VHL A;  5JVD E;  2UXX B;  4I0U A;  4U2Y A;  2WS3 A;  2KZ7 B;  4TNW A;  3M3Z B;  4UR9 A;  3N9P A;  2UXD T;  3HA4 A;  3P4Q A;  4XBF B;  3B57 A;  1T98 A;  2XM2 A;  3HI2 A;  1UUR A;  3SFE A;  3OBV E;  2BS4 A;  2YDR A;  5J2T E;  2OA5 A;  4ZI3 D;  3FZL B;  4KHP T;  3HR0 A;  5LJM A;  4ZZC A;  4DVD A;  1CUN A;  3AA6 B;  4TZ4 C;  2IC9 A;  4GK0 E;  5FY1 A;  5DQV A;  4YTP A;  3KV5 A;  1QSD A;  1OED E;  3NZQ A;  4IHJ E;  3NZP A;  3JAD A;  5TAO A;  3ONL C;  2KMF A;  3AE6 A;  2A3D A;  5AQH B;  5AQR B;  1HNZ T;  4KMC A;  3PUW F;  4H63 H;  3KVA A;  2M6B A;  5KDM C;  1FJG T;  2VAS A;  2VWA A;  3KBT A;  2VKD A;  2CA5 A;  3QB5 A;  2W67 A;  4G63 A;  4ZOL E;  3GA8 A;  2K3W A;  2CWO A;  4TX5 A;  3RPU A;  3UU4 A;  4IDN A;  1BR4 A;  2JPF A;  3KBU A;  1J1J A;  4JYA T;  5AQF B;  1HS7 A;  2ES0 A;  3UUX B;  2XJ7 A;  1IBL T;  3AA1 B;  2W00 A;  3I0Q A;  4NUU A;  4JI1 T;  2PJQ A;  1QUU A;  4O4L E;  3ZMS B;  2CM0 A;  2XQ9 A;  2ODV A;  3RC3 A;  3ZST A;  1IJ6 A;  1G73 A;  5AQQ B;  5FXW A;  2BBH A;  2NW9 A;  2J4G A;  3JCF A;  2WWU A;  3PTR B;  2WY2 A;  3QNU A;  5JRC B;  5ETW A;  3NBX X;  3S4U A;  4GKJ T;  3N9N A;  3N9O A;  4LF4 T;  3P8C D;  2MOZ A;  3B13 A;  3N9Q A;  2LJL A;  5DQW A;  3RKO A;  4JI5 T;  5JDG A;  3OTO T;  4PAG A;  4DV6 T;  2E9X A;  2NOX A;  3SWH A;  4DND A;  3TLW A;  2XAH B;  3PU8 A;  2EHO A;  3ESL A;  2L8K A;  4DV1 T;  5AQU B;  3T8O A;  2DNX A;  5C2T A;  3PUR A;  2I6H A;  2V7I A;  1YXR A;  3P50 A;  3KV9 A;  5ABF A;  1LVF A;  3UUL A;  4IDO A;  5LA6 E;  4ZI7 E;  2ZM6 T;  4COF A;  1VOM A;  4GYS A;  2KT9 A;  1YQ3 A;  2BS3 A;  5HWX A;  5DJQ C;  2VUR A;  3Q9D A;  4X5T A;  2WSS V;  5LBQ B;  3ZMU B;  5FVL A;  2KSR A;  3F2E A;  1M7K A;  2KIN B;  4DMV A;  2V8S V;  1HNW T;  5LMU T;  3Q2M A;  1E2A A;  1KNZ A;  3RIU A;  3ANW B;  1D0Y A;  1X79 A;  4X66 T;  4AKL A;  2ZM8 A;  2JJ9 A;  3NVO A;  4CI1 B;  3CX8 B;  2ZM2 A;  2X0L B;  1UX5 A;  3DTO A;  2CBJ A;  2E9X D;  5LYJ E;  3RLF F;  2NW8 A;  1IAP A;  2W2U A;  1YKH B;  2BKN A;  2EHO D;  3C51 A;  1O3X A;  1XDO A;  4I50 E;  4MBQ A;  1EZ3 A;  2XAQ B;  3PUS A;  2LHN A;  3PUY F;  2N1G A;  4DV2 T;  2PG8 A;  3C64 A;  2PFV A;  5LNK A;  1HNX T;  4YHJ A;  2DI4 A;  4LML A;  1XNQ T;  4OYK A;  2VQE T;  3LK3 B;  4H9P C;  2LOS A;  3DJB A;  5LGN B;  3UU8 A;  2DL1 A;  3CQG B;  2JQK A;  2YK0 A;  4YTM A;  2WU5 A;  4JBW F;  3W15 B;  2WAU A;  3FZF B;  1LRZ A;  2DHR A;  2YOE A;  3ZT5 A;  4GOU A;  2LEH A;  4DR6 T;  5A1L A;  4L9I A;  4QH5 A;  1BR1 A;  2NTY A;  3P4S A;  1VRB A;  4EOZ B;  5FYM A;  2LRL A;  4GK5 E;  4QWN B;  4LF8 T;  2E9X B;  1XMQ T;  2XHE B;  2QRX A;  3CK6 A;  1CHU A;  4V1A v;  5FL0 A;  1ZOY A;  4F8H A;  4O4I E;  2K5B B;  2BBJ A;  3RRW A;  3PU3 A;  4X1Y E;  5FY0 A;  3UUM A;  2HN2 A;  2W66 A;  2FJE A;  3Q5X A;  3CPZ A;  4EED A;  2V7M A;  1E7P A;  3J9X 1;  2IW5 B;  4UF0 A;  4MLK A;  4A98 A;  2BKO A;  5AQK B;  2XAS B;  3P4W A;  5FNV E;  3OJA A;  4TN7 B;  3UQ7 A;  1AJ3 A;  4AXP A;  3SOL A;  4XZC A;  1GQE A;  4ASK A;  3TLT A;  1I6Z A;  3ZN1 B;  2CXD A;  3AAE B;  4UVB B;  4H9O C;  5FXZ A;  3RF1 A;  5HEO A;  3AVR A;  1Y64 B;  5L2L A;  2UUC T;  2XSA A;  2LM2 A;  4HFD A;  4NIQ A;  3EI0 A;  4LFA T;  2BG9 C;  5HEG A;  5HEH A;  5AQL B;  2BVM A;  4HWI B;  2FJD A;  1Z8U A;  1N32 T;  1ZV4 X;  2XSB A;  3DP7 A;  1OED A;  4TWF A;  4PNI A;  3NRX A;  5LHG B;  5AFU L;  2CCQ A;  1L0V A;  4ANJ A;  2FJB A;  2YKS A;  2VL8 A;  4DBR A;  4C90 A;  2R6G F;  2W62 A;  1MIV A;  2CLY C;  4B3S T;  2MBG A;  1MMD A;  3P4P A;  1X9B A;  3FBL A;  4I43 B;  2X9X A;  4DR5 T;  3NKZ A;  4H9N C;  4UXN B;  4WBO A;  4TV9 E;  3K8P C;  5F5W A;  2IIU A;  2VB6 A;  2W0G A;  3VKG A;  1KF6 A;  3CWZ B;  4IIJ E;  1UGO A;  5J2U E;  2WDR A;  4NXM T;  1XWM A;  3X1D A;  4M1P A;  4L5G A;  4BA9 A;  4IRE A;  1MNE A;  4ZI2 C;  2CLY B;  3PUV F;  3MZK B;  2RP4 A;  2YEV C;  3AE8 A;  4ZHQ E;  4YJ3 E;  4DV7 T;  4DUY T;  4K0U A;  4KUM B;  3UT5 E;  4OX9 T;  2JQQ A;  3PJA J;  2UUA T;  3MAC A;  2KXP B;  3TKL B;  4X62 T;  4DR7 T;  4E7Z A;  2CE7 A;  3GWH A;  1NEN A;  2CMR A;  3LSV A;  4DID B;  2RPA A;  4LF6 T;  4LMK A;  5HXC A;  3AE1 A;  2IML A;  1XZY A;  4UF0 B;  2MYS A;  4PK4 A;  3CX7 B;  4U7I A;  4O4J E;  3RI5 A;  3O1I A;  3PUA A;  4ZS2 A;  1FMV A;  3ZYK A;  4JI8 T;  1W09 A;  4ZI3 C;  2J47 A;  1MMN A;  3AAA B;  4ZS3 A;  4ILC A;  5FP3 A;  3RRC A;  3T1H T;  1D1C A;  2XAF B;  4NXN T;  2V7J A;  3ETU A;  3JAE A;  3U78 A;  3O1H A;  5LP6 E;  3A8Y C;  5CJ5 A;  2XQ4 A;  3CX6 B;  2H7O A;  4IST A;  4AQF C;  5ABE A;  5L3G B;  5AQJ B;  5L3B B;  4U72 A;  4BAY B;  3EVY A;  3PUQ A;  2LSG A;  4GKK T;  4TUY E;  2ZLY A;  5J0Z A;  4WW0 A;  3OYX A;  1OED B;  4JI3 T;  2Y48 B;  4DO0 A;  3RC8 A;  2WDQ A;  1D1A A;  5FKY A;  5KX5 E;  4UIG A;  3EUH A;  4CN6 A;  1Y01 A;  2J62 A;  1MIW A;  2C5I T;  4HFH A;  1OXZ A;  4EXT A;  2A2F X;  4Z90 A;  2JIW A;  2H89 A;  4EZ4 A;  2L9Q A;  3UU3 A;  3G06 A;  2XAJ B;  2BDE A;  1KNP A;  2UUB T;  2X66 A;  2KND A;  2YN6 A;  5JRE A;  4LFC T;  3UU6 A;  1D1B A;  1S94 A;  2QYW A;  3QK6 A;  3VRA A;  3WAK A;  2H7V C;  2XTL A;  4I4T E;  4CXX A;  4DV0 T;  1IJ5 A;  4YT0 A;  4Z8X A;  1IBM T;  3FB2 A;  2VKO A;  4PJM A;  2WBL A;  2V5D A;  2Z6E A;  5EZY E;  1S35 A;  1D0Z A;  3CVR A;  4UV8 B;  1I94 T;  4J2C A;  3C4W A;  4UVC B;  1XDP A;  2BZB A;  4JI4 T;  3T1Y T;  1J5E T;  4X64 T;  2FJA A;  4P0B A;  1J5W A;  5L4E A;  3N9L A;  1MMG A;  1WFD A;  2C5J A;  4PK5 A;  1WRD A;  4U31 A;  2DWK A;  3ZJ2 A;  5AQN B;  4UEL A;  5CGM A;  5M4Y A;  4O2A E;  3RYF E;  1M62 A;  2C0S A;  3LK4 2;  3HKE E;  3RYH E;  3F31 A;  4CZZ B;  4QXH B;  3C98 B;  3ZMZ B;  4HEA A;  5FVK A;  4ILA A;  4CI3 B;  3FXE B;  4CXW A;  2D9D A;  4ILU A;  4EZH A;  2LE8 A;  4YXD A;  4JLE A;  3RYC E;  1G8X A;  2YU2 A;  4IE5 A;  2K48 A;  4LF7 T;  1LVK A;  4UVA B;  4LMJ A;  2VVN A;  4ZEY A;  1SHZ C;  3UU5 A;  3RIA A;  2NTX A;  4AKG A;  3ZCI A;  3RGL A;  4PW8 A;  4WYV A;  5HXE A;  4YSY A;  4CI2 B;  2A9U A;  2XUE A;  2LSY A;  4BJN A;  4HFE A;  1HG5 A;  3PDY A;  2V1D B;  2JQH A;  2XM1 A;  4ERR A;  2V6X A;  2JRK A;  3C4Z A;  2HH7 A;  2E9X C;  5FXX A;  5FXV A;  3QOF A;  2L3L A;  4BJM A;  2E8I A;  2Q9Q A;  3K3Q C;  1WLX A;  4HN9 A;  3AXJ A;  2XQ5 A;  1T7S A;  2EHO C;  5FL1 A;  1D0X A;  3LBX A;  3KIN B;  2K24 A;  4YLH A;  4X65 T;  4P09 A;  4EAH A;  1E1H B;  3V5S A;  4ADZ A;  3UUB A;  2K9A A;  2BVL A;  4DV5 T;  3CQC B;  1DU2 A;  2XQ3 A;  5L3F B;  4B3T T;  5JDF A;  5IWA T;  1XMO T;  3PUX F;  2VKJ A;  1HCI A;  3KFW X;  3MXZ A;  3IEE A;  4QX7 B;  4O2B E;  4WBN E;  2CEA A;  1N34 T;  5HCJ A;  2YIN A;  2G0U A;  4O8S A;  5HXH A;  3RHW A;  4OFZ A;  5JDM A;  2XQ8 A;  3RX6 A;  1W0A A;  2EHO B;  3AE9 A;  4CQI A;  1W9R A;  4LF5 T;  2J1D G;  2ODU A;  3RIU C;  3B5M A;  5GON E;  3N2G E;  4IE6 A;  4JEU B;  5AQT B;  3C50 A;  3BQK A;  2W4X A;  4OHF A;  2H88 A;  4U2Z A;  2CHO A;  3LDQ B;  4DR4 T;  3AEG A;  3OYZ A;  4CN4 A;  4PFP A;  3F57 A;  5ABF B;  3ZN0 B;  1WCR A;  2VK9 A;  5J1G A;  1T8B A;  2E5V A;  2Q9Q D;  3AAI A;  4I55 E;  2WWV A;  2RA1 A;  1HR0 T;  4GIW A;  1HTJ F;  2VL0 A;  4EYU A;  2N9D A;  3LG7 A;  3C4X A;  1JNR A;  2ACX A;  4KI0 F;  5JDL A;  2HPL A;  2D2S A;  2I0M A;  4H63 V;  4QX8 B;  2ZM0 A;  1UCU A;  5JR9 A;  3CML A;  2CWY A;  3TLS A;  3JC6 D;  2BG9 E;  5CA1 E;  2NW7 A;  1Z0P A;  1ZP0 A;  3HKC E;  5LMN T;  3I9W A;  4PJN A;  3OKQ A;  3ZJ1 A;  4HWC A;  5LGU B;  2I59 A;  3K3N A;  2IUB A;  3WAJ A;  3ZPO A;  5KXJ A;  2KWH A;  2DWG A;  3I1A A;  4TWH A;  2HHH T;  2A72 A;  2LM9 A;  4IT4 A;  3RIF A;  2BKP A;  4PJJ A;  2AXD S;  1MIY A;  4DR3 T;  3ZSS A;  4EGW A;  2V7L A;  4JI7 T;  4KX6 A;  4JI0 T;  4L0R A;  5AQS B;  4HFI A;  3JC6 C;  2WDV A;  2NR4 A;  4CN1 A;  4P1N A;  1HX8 A;  4YHH T;  2Q9Q B;  2W63 A;  4AIS A;  3AXJ B;  1YD8 G;  3AEA A;  5L3E B;  1HG2 A;  4NPP A;  3K3O A;  4QXB B;  2XY8 B;  4EV6 A;  3VR9 A;  4KBM B;  4ILB A;  5AQO B;  4H9R C;  3BQL A;  4MAL A;  2D0T A;  3BK9 A;  5JRC A;  1H7C A;  3GMI A;  4QXC B;  3NWI A;  3U3I A;  4A5X A;  3V5U A;  3EAB A;  4AQY T;  5C3J A;  3QB5 K;  3AE2 A;  3N9M A;  3MKD A;  4H9Q C;  2LHR A;  4ZZB A;  3CKD A;  4JV5 T;  1US7 B;  3L3P A;  3LJC A;  4U3C A;  5LG4 A;  2V6Y A;  3AEC A;  1UX4 A;  4HTE A;  2IAK A;  2P9B A;  3AE5 A;  4U74 A;  4C91 A;  4F6R C;  4YJ2 E;  2MAW A;  2SPC A;  5LB7 B;  3SRZ A;  3ZC1 A;  2YDQ A;  2IHR 1;  5JR9 C;  4WZX A;  4X1I E;  3N5L A;  2N2N A;  2X68 A;  4DMW A;  3RH3 A;  4JUY A;  1OED C;  2IDO B;  4AKH A;  1OWA A;  5F3J A;  3L39 A;  4FI5 A;  2AE9 A;  3GN5 A;  3P4R A;  3ZLI A;  4IDZ A;  3UUN A;  1ZHC A;  2X9Y A;  4YSX A;  4DBQ A;  4DR1 T;  4XAX B;  4ZXL A;  1SUM B;  3SS1 A;  3ANW A;  2XQA A;  4YTN A;  4MFR A;  2WU2 A;  3N2O A;  5LCY A;  2PTF A;  2LOP A;  3AEB A;  3IBP A;  4CXY A;  3ZT6 A;  2KLQ A;  3HKB E;  4DV4 T;  5JR9 B;  2XPK A;  2UXC T;  3IF8 B;  1MND A;  2OV9 A;  4EB6 E;  5L3C B;  2B76 A;  1T72 A;  2QVA A;  3IA3 A;  4YSZ A;  4YY3 T;  3H37 A;  3P7I A;  2V5C A;  1NWM X;  5FMN A;  2D5U A;  4IL4 A;  4O4H E;  3RYI E;  2D0U A;  1MMA A;  5IHY A;  2YU1 A;  2WZI A;  2VVS A;  3EDU A;  3FHN A;  4KP3 C;  3Q5D A;  2CXF A;  2WMO A;  3AED A;  3ETV A;  1N33 T;  4WNK A;  5LGT B;  5LHI B;  3ZMV B;  1VCS A;  2X0H A;  3FZM B;  2C5K T;  3N2K E;  2HN1 A;  2LRK A;  5BR8 T;  2ACZ A;  3IHR A;  3KDS E;  4GYR A;  2LSJ A;  5LXT E;  4KHZ F;  2JMH A;  3FXD B;  4HKA A;  5LBM A;  2WM9 A;  3K1S A;  5IUX A;  2JMK A;  5F8P A;  2BS2 A;  2CRB A;  3R6N A;  5JQG E;  3VU7 H;  5HEU A;  3EAM A;  4IE4 A;  2LKH A;  2CHN A;  1FMW A;  5EK4 A;  4IE0 A;  2DLR A;  2V6Y B;  2XQ7 A;  1IZN B;  2NWB A;  5JTG A;  4AKR B;  3E08 A;  3J7Y q;  5HYA A;  3PUG A;  2QA7 A;  2WMN A;  3MK7 C;  1ZEE A;  5FY7 A;  4ISS A;  4B3M T;  4HFB A;  4HFV A;  3O1J A;  5HEJ A;  2LSI A;  4NUV A;  5EK3 A;  2NP9 A;  5JDH A;  5CA0 E;  3ZT7 A;  4UEM A;  2B1E A;  1BR2 A;  3ZMT B;  3VRB A;  3TLV A;  5AQP B;  3EDV A;  3A7M A;  3AEF A;  4AQG A;  2VKH A;  3GN5 B;  1YQ4 A;  3FBZ A;  1HF8 A;  4TV8 E;  2GK9 A;  4HWF A;  1WYB A;  1VCT A;  3SFD A;  3RQW A;  3VR8 A;  5AQM B;  3KVB A;  2V26 A; 
#chains in the Genus database with same CATH homology
 2PJQ A;  1QUU A;  5J1G A;  4O4L E;  3PE0 A;  2KWI B;  4ZI2 C;  2Q9Q D;  3AAI A;  4I55 E;  1HFA A;  2CLY B;  4H9S E;  3ZMS B;  2CM0 A;  4IGU A;  2ODV A;  3MZK B;  3RC3 A;  2RA1 A;  3MA9 A;  4QKN A;  1IJ6 A;  4GIW A;  1HTJ F;  2HPJ A;  2RP4 A;  4B6X A;  2YEV C;  4EYU A;  4ZHQ E;  2N9D A;  3LG7 A;  1G73 A;  4YJ3 E;  5FXW A;  1FIO A;  3C4X A;  1U4Q A;  2NW9 A;  3KV6 A;  2QGS A;  2ACX A;  4K0U A;  5JDL A;  4KUM B;  2HPL A;  3UT5 E;  3O9X A;  4PFO A;  4E7S A;  2WWU A;  2JQQ A;  3PTR B;  3ZC0 A;  2D2S A;  3AA7 B;  5ETW A;  3NBX X;  5LOV E;  2CXL A;  3MAC A;  5JRC B;  2KXP B;  3S4U A;  5LJN A;  3N9N A;  3TKL B;  3QC9 A;  2IC6 A;  4E7Z A;  3N9O A;  2CE7 A;  3GWH A;  3P8C D;  2CMR A;  2MTQ A;  2MOZ A;  4H63 V;  4QX8 B;  2X67 A;  5CB4 E;  2ZM0 A;  5HXC A;  3B13 A;  3H3A A;  3N9Q A;  2LJL A;  2X9W A;  4UF0 B;  1UCU A;  2MYS A;  5DQW A;  3RKO A;  5JR9 A;  3CML A;  4PK4 A;  3CX7 B;  4AKI A;  2CWY A;  5JDG A;  3JC6 D;  4O4J E;  5HAX A;  5C8Y E;  4PAG A;  5CA1 E;  2NW7 A;  1Z0P A;  2E9X A;  2NOX A;  3HKC E;  3I9W A;  3R84 B;  4PJN A;  3SWH A;  3OKQ A;  3ZJ1 A;  4DND A;  2UXN B;  3O1I A;  3PUA A;  5LGU B;  2I59 A;  3K3N A;  2XAH B;  3PU8 A;  2EHO A;  3WAJ A;  3ZPO A;  2KWH A;  3I9Y A;  3Q5W A;  1FMV A;  3ESL A;  4ZS2 A;  3ZYK A;  2DWG A;  3I1A A;  2L8K A;  1B7T A;  2A72 A;  2LM9 A;  3QUJ A;  4ZI3 C;  3T8O A;  3CQX C;  4PJJ A;  2DNX A;  2X51 A;  1MMN A;  3PUR A;  2W61 A;  1MIY A;  3AAA B;  2V7I A;  4ZS3 A;  2V7L A;  4HGA A;  5FP3 A;  3RRC A;  1D1C A;  2XAF B;  4L0R A;  4YFS A;  2V7J A;  3KV9 A;  3JC6 C;  2ZMA A;  3ETU A;  3U78 A;  3O1H A;  5JDQ A;  2PBI A;  5LP6 E;  1LVF A;  3UUL A;  3CX6 B;  3HKD E;  5LA6 E;  4ZI7 E;  2H7O A;  3KV4 A;  4IST A;  1WR6 A;  1HX8 A;  2Q9Q B;  5HXR A;  4AQF C;  1VOM A;  2W63 A;  4GYS A;  5L3G B;  2KT9 A;  4X20 E;  5L3B B;  4U72 A;  5IYZ E;  1YD8 G;  5HWX A;  5DJQ C;  5H6R B;  5L3E B;  5LHH B;  1HG2 A;  3Q9D A;  4BAY B;  3EVY A;  3PUQ A;  3K3O A;  2WSS V;  2LSG A;  4QXB B;  5LBQ B;  3ZMU B;  4AI6 A;  3F2E A;  1U5P A;  2KIN B;  4KBM B;  4TUY E;  4DMV A;  2ZLY A;  3AVS A;  4H9R C;  3BQL A;  4WW0 A;  1FEW A;  4MAL A;  2Y6X A;  3OYX A;  2D0T A;  3BK9 A;  4MHC A;  2Y48 B;  5JRC A;  3Q2M A;  4DO0 A;  3RC8 A;  1H7C A;  3GMI A;  1D1A A;  5JDN A;  4QXC B;  5E0O A;  1KNZ A;  5KX5 E;  4UIG A;  5BMV E;  3EUH A;  3U3I A;  2V7K A;  1D0Y A;  3ANW B;  3V5U A;  5HWY A;  1X79 A;  1MIW A;  3N9M A;  3MKD A;  3ZYM A;  4H9Q C;  2C5I T;  1OXZ A;  2LHR A;  4EXT A;  4AKL A;  4PK6 A;  3E22 E;  2LT3 A;  3CKD A;  2ZM8 A;  2JJ9 A;  4CI1 B;  2A2F X;  3CX8 B;  1US7 B;  2ZM2 A;  2X0L B;  3L3P A;  2L9Q A;  3LJC A;  4EZ4 A;  1WYC A;  1UX5 A;  1YW0 A;  3DTO A;  5LG4 A;  4EYY R;  2E9X D;  5LYJ E;  3ONX A;  4IE7 A;  2NW8 A;  1UX4 A;  4HTE A;  2XAJ B;  1IAP A;  2BDE A;  2IAK A;  2P9B A;  4U74 A;  4JEH B;  4C91 A;  4F6R C;  1YKH B;  2EHO D;  2X66 A;  3C51 A;  4X1K E;  1O3X A;  2KND A;  4YJ2 E;  5JRE A;  4I50 E;  4MBQ A;  3M65 A;  1EZ3 A;  2Q9Q C;  1D1B A;  1S94 A;  2XAQ B;  3PUS A;  1NAF A;  5KMG P;  3QK6 A;  2SPC A;  2LHN A;  3SRZ A;  3WAK A;  2H7V C;  3ZC1 A;  2N1G A;  2XTL A;  3LK2 B;  4I4T E;  1V9D A;  4CXX A;  5JR9 C;  4X1I E;  2PG8 A;  3N5L A;  3C64 A;  2PFV A;  1IJ5 A;  2N2N A;  2X68 A;  4DMW A;  5HXS A;  5LNK A;  4Z8X A;  1KK7 A;  3ZCJ A;  3FB2 A;  2VKO A;  2H3R A;  3RH3 A;  4PJM A;  4JUY A;  2WBL A;  2Z6E A;  5EZY E;  1S35 A;  4YHJ A;  1D0Z A;  3E0Z A;  2DI4 A;  5EK2 A;  5JH7 E;  3CVR A;  4UV8 B;  3VKH A;  3NRY A;  4AKH A;  1OWA A;  5F3J A;  4EIW A;  4FI5 A;  4J2C A;  3C4W A;  4UVC B;  3GN5 A;  3ZLI A;  4IDZ A;  2BZB A;  4G2A A;  4OYK A;  3LK3 B;  3UUN A;  4H9P C;  1ZHC A;  2X9Y A;  2LOS A;  3DJB A;  4P0B A;  3I0O A;  5LGN B;  3CQG B;  3UTK A;  2YK0 A;  4OK0 A;  4XAX B;  2XAG B;  3N9L A;  4DBQ A;  1MMG A;  4UV9 B;  2C5J A;  2WAU A;  3W15 B;  1LRZ A;  4PK5 A;  3SS1 A;  1WRD A;  2DHR A;  2DWK A;  3ZJ2 A;  1BR0 A;  3ANW A;  4GOU A;  4MFR A;  4UEL A;  5M4Y A;  4QHO A;  2LEH A;  3N2O A;  5LCY A;  3A5X A;  5A1L A;  2LOP A;  3AA0 B;  4L9I A;  4O2A E;  3IBP A;  3RYF E;  4CXY A;  2XQY A;  1BR1 A;  2NTY A;  2KLQ A;  1ZKE A;  3HKB E;  5JR9 B;  1SA0 E;  3BQI A;  1VRB A;  4EOZ B;  2C0S A;  5FYM A;  3IF8 B;  3LBX B;  4GK5 E;  5L3D B;  4QWN B;  2LSK A;  1MND A;  3LK4 2;  3HKE E;  2E9X B;  3RYH E;  4EB6 E;  2XHE B;  3F31 A;  4CZZ B;  5L3C B;  3HL6 A;  4AQF A;  4QXH B;  3C98 B;  5DAB A;  3ZMZ B;  4HEA A;  4ZI2 D;  4V1A v;  3H37 A;  4O4I E;  3FXE B;  4CI3 B;  4CXW A;  5ADX L;  2K5B B;  3WI3 A;  3RRW A;  3PU3 A;  3P7I A;  4X1Y E;  4ILU A;  4EZH A;  5FY0 A;  3UUM A;  2LE8 A;  3ZYL A;  5H6Q B;  2M67 A;  4JLE A;  1NWM X;  3LFM A;  4FJO A;  4HE8 A;  4OYJ A;  5FMN A;  3RYC E;  2Y8D A;  1G8X A;  2YU2 A;  4A56 A;  4P0A A;  2D5U A;  1YKE B;  3MJX A;  3Q5X A;  3CPZ A;  2V7M A;  3O4X E;  4IE5 A;  4O4H E;  3RYI E;  2K48 A;  1LVK A;  2D0U A;  4N78 D;  1MMA A;  4UVA B;  4UF0 A;  2IW5 B;  3J9X 1;  5IHY A;  2YU1 A;  4MLK A;  1SHZ C;  3EDU A;  3FHN A;  4KP3 C;  2NTX A;  1LKX A;  4AKG A;  2CXF A;  2XAS B;  3ZCI A;  5FNV E;  3AB3 B;  3OJA A;  4TN7 B;  2WMO A;  1AJ3 A;  3UFE A;  2DCF A;  3ETV A;  4PW8 A;  4AXP A;  3D0T A;  2X9H A;  4WNK A;  3SOL A;  4PJL A;  5HXE A;  4XZC A;  3L09 A;  4ASK A;  4CI2 B;  3ZEF B;  2XUE A;  2LSY A;  5LGT B;  4BJN A;  3ZN1 B;  5LHI B;  2CXD A;  3VHL A;  3AAE B;  1HG5 A;  3PDY A;  3ZMV B;  5JVD E;  2V1D B;  2UXX B;  4UVB B;  2C5K T;  3N2K E;  4H9O C;  5FXZ A;  4ERR A;  2KZ7 B;  3N9P A;  3HA4 A;  4XBF B;  3B57 A;  3AVR A;  1T98 A;  2JRK A;  3C4Z A;  1Y64 B;  3HI2 A;  5L2L A;  3IHR A;  3OBV E;  2HH7 A;  3KDS E;  2LSJ A;  4GYR A;  2E9X C;  5FXX A;  5LXT E;  5J2T E;  5FXV A;  2OA5 A;  2L3L A;  4ZI3 D;  2JMH A;  3FXD B;  2E8I A;  2Q9Q A;  4HKA A;  5LBM A;  2WM9 A;  3K3Q C;  4BJM A;  3HR0 A;  1WLX A;  5LJM A;  4HN9 A;  4DVD A;  1CUN A;  3AA6 B;  2JMK A;  5F8P A;  3R6N A;  4TZ4 C;  2IC9 A;  4GK0 E;  5JQG E;  2EHO C;  5FY1 A;  2BVM A;  5DQV A;  3VU7 H;  4IE4 A;  3KV5 A;  1QSD A;  1D0X A;  3LBX A;  3KIN B;  3NZQ A;  4IHJ E;  3NZP A;  5TAO A;  2K24 A;  1FMW A;  4YLH A;  2KMF A;  5EK4 A;  4IE0 A;  4P09 A;  2DLR A;  1ZV4 X;  4EAH A;  1E1H B;  3DP7 A;  2A3D A;  3V5S A;  4ADZ A;  2K9A A;  2BVL A;  3CQC B;  4KMC A;  1IZN B;  4PNI A;  4H63 H;  3NRX A;  2NWB A;  5LHG B;  5AFU L;  2CCQ A;  4AKR B;  3E08 A;  5L3F B;  3J7Y q;  5HYA A;  3PUG A;  5JDF A;  4ANJ A;  2QA7 A;  2VL8 A;  4DBR A;  3KVA A;  2WMN A;  3MK7 C;  4C90 A;  2VKJ A;  1HCI A;  5KDM C;  3KFW X;  3MXZ A;  1ZEE A;  2W62 A;  3IEE A;  4QX7 B;  5FY7 A;  4ISS A;  1MIV A;  4HFV A;  4O2B E;  2CLY C;  3O1J A;  2LSI A;  4NUV A;  2VAS A;  5EK3 A;  2MBG A;  2VWA A;  1MMD A;  3KBT A;  2VKD A;  2NP9 A;  2CA5 A;  4WBN E;  5JDH A;  2CEA A;  5CA0 E;  4UEM A;  2B1E A;  1BR2 A;  2YIN A;  3ZMT B;  4G63 A;  3FBL A;  2G0U A;  3EDV A;  4ZOL E;  4I43 B;  2X9X A;  4O8S A;  5HXH A;  4OFZ A;  5JDM A;  3GA8 A;  3RX6 A;  4H9N C;  4UXN B;  2CWO A;  4TX5 A;  4WBO A;  3RPU A;  4TV9 E;  3K8P C;  2EHO B;  4CQI A;  1BR4 A;  4AQG A;  2J1D G;  2ODU A;  2VB6 A;  2JPF A;  2W0G A;  2VKH A;  3KBU A;  3N2G E;  4IE6 A;  5GON E;  4JEU B;  3VKG A;  3C50 A;  3CWZ B;  3BQK A;  1HS7 A;  2ES0 A;  3UUX B;  3GN5 B;  4IIJ E;  3AA1 B;  3FBZ A;  1HF8 A;  4TV8 E;  5J2U E;  2GK9 A;  1WYB A;  4OHF A;  2W00 A;  3I0Q A;  4NUU A;  4M1P A;  4L5G A;  3OYZ A;  4PFP A;  3F57 A;  3KVB A;  4BA9 A;  3ZN0 B;  1MNE A;  2V26 A;  2VK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...