4JF1A

R144q mutant of n-acetylornithine aminotransferase
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
396
structure length
390
Chain Sequence
TFDEVILPVYAPADFIPVKGKGSRVWDQQGKEYIDFAGGIAVTALGHCHPALVEALKSQGETLWHTSNVFTNEPALRLGRKLIDATFAERVLFMNSGTEANETAFKLARHYACVRHSPFKTKIIAFHNAFHGQSLFTVSVGGQPKYSDGFGPKPADIIHVPFNDLHAVKAVMDDHTCAVVVEPIQGEGGVQAATPEFLKGLRDLCDEHQALLVFDEVQCGMGRTGDLFAYMHYGVTPDILTSAKALGGGFPVSAMLTTQEIASAFSTYGGNPLACAVAGATFDIINTPEVLQGIHTKRQQFVQHLQAIDEQFDIFSDIRGMGLLIGAELKPKYKGRARDFLYAGAEAGVMVLNAGADVMRFAPSLVVEEADIHEGMQRFAQAVGKVVALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylornithine/succinyldiaminopimelate aminotransferase
publication title Conformational transitions, ligand specificity and catalysis in N-acetylornithine aminotransferase: Implications on drug designing and rational enzyme engineering in omega aminotransferases
rcsb
source organism Salmonella typhimurium
molecule tags Transferase
total genus 144
structure length 390
sequence length 396
chains with identical sequence B
ec nomenclature ec 2.6.1.11: Acetylornithine transaminase.
pdb deposition date 2013-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00202 Aminotran_3 Aminotransferase class-III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4jf1A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4jf1A01
2ZC0A 1DGDA 2BI3A 3B1DA 3BC8A 4ZDOA 1YIZA 2AY9A 2JG2A 3QBOA 4WYDA 3UE8A 5M4DA 3EUCA 1BQAA 2E7IA 1TOKA 2JJEA 1GD9A 2AY2A 2W8JA 4N0WA 4XQ2A 4E3QA 3AEPA 3MADA 1ZODA 4K2MA 3QGUA 1JS3A 5TF5A 3B1CA 4RLGA 3WY7A 4P7YA 1SFFA 1LC8A 1RV3A 2EGYA 3A8UX 3E6GA 1B5PA 2R5CA 4RKDA 4U1TA 5EUEA 1GBNA 2VGWA 3HVYA 2W8TA 4ITGA 4TV7A 4ZAHA 1V2FA 1LW5A 5G09A 1G4VA 4RITA 4RM1A 1C9CA 3H7FA 3NU8A 4BA4A 1ASMA 4GDYA 4W91A 3FVSA 4JEZA 2AEVA 2BHXA 1ZOBA 3P6KA 3GZDC 1T3IA 4F5FA 7AATA 1M4NA 3PDBB 2HP2A 3L8AA 1WKGA 2Z1YA 3JTXA 4F5KA 2GQNA 1H0CA 3FRKA 1BW0A 4CXRA 1BS0A 4P3MA 2WK7A 3VK3A 3FQAA 1S07A 1KL2A 2VIBA 4LNMA 2NMPA 3A9XA 4F5IA 2OATA 5EAAA 3AEOA 4WLHA 5M46A 1AKCA 1C7OA 1G7WA 2AY7A 2HUUA 3KE3A 4GE4A 2YKXA 1QGNA 4WYGA 5DX5A 2W7IA 3LV2A 1ARSA 2VYCA 2R2NA 2Z9XA 4OMAA 4R5FA 1SF2A 2CH1A 4OC9A 1YAAA 3IHJA 3ASAA 2OQXA 1SVVA 4JF0A 4RKCA 1ARTA 3ZRQA 1VEFA 4RJ0A 3VOMA 3GZDA 4XJMA 3JZLA 4KYOA 1ZC9A 4B9BA 2XBNA 3I4JA 1WKHA 1AHEA 2AY5A 2CJDA 3ZZKA 4AO4A 4CVQA 2D7ZA 2JGTA 1J04A 3LVJA 1AAMA 2VGVA 1E5EA 3WX9A 4WXGA 1AJRA 2EZ2A 4Q75A 4WLJA 2D7YA 1ASEA 5EFSA 4MQPA 3WZFA 5BJ4A 3PGYA 2ZUKA 1W3UA 4RAEA 2FM1A 1MDOA 2VLHA 1PMOA 5JAYA 4OYTA 2JISA 2BIAA 1QJ5A 4ZSYA 5M4BA 1ASLA 4Y0HA 3RBLA 3F6TA 3HQTA 5I92A 3G7QA 1D7VA 3I5TA 2R5CB 2CB1A 1KKJA 2Z20A 2ZY2A 4DQ6A 3AOVA 3ATHA 2EZ1A 2FQ6A 4K2IA 3ELEA 2ZYJA 4IYOA 4UHMA 3JWBA 1UU0A 5EUDA 1OXPA 1O4SA 1I43A 2DGLA 1BQDA 1QISA 2Q7WA 2YKUA 4KXKA 4DGTA 1ARGA 1ASAA 2VMUA 2HUFA 1B5OA 1AY4A 2BKWA 4LNJA 3AELA 1U08A 1M0OA 3USFA 1AJSA 4F5MA 2EPJA 3PPLA 2OKKA 1I29A 1YIYA 5HHYA 4ZDPA 1WYVA 4ADEA 3FKDA 2D66A 3EZ1A 1YNUA 4DBCA 3GR9A 2VMOA 3MEBA 1UKJA 3PDXA 2OKJA 3E2YA 5F8VA 4ATPA 2BWNA 4IXZA 1M32A 2QMAA 4ADDA 3FZ7A 1BJNA 1OATA 2D65A 4AH3A 3TCMA 3CAIA 1GC0A 5G4JA 4JE5D 3HDOA 4XJLA 2CSTA 1DJUA 4MY5A 4OBVA 1AAWA 3FQ8A 4HVKA 2HZPA 4ZSWA 1N8PA 2X3LA 1TARA 2E54A 2D63A 3E2ZB 1P3WA 1MGVA 4ZWVA 4IXOA 4A0RA 4KAMA 3UAKA 3FZ8A 4E77A 1KL1A 1AMQA 2EH6A 3LY1A 2HOYA 4F4EA 3N5MA 1AHFA 1J32A 1ELUA 1LKCA 1W7NA 4W5KA 3FVXA 3PJ0A 1OHYA 3JU7A 3RI6A 4R5ZA 4GE7A 4ADCA 4EMYA 2Z67A 3E9KA 5E5IA 3AEJC 1C7GA 1PG8A 2GMUA 4IXSA 3Q8NA 4JEWA 2VMZA 4MQRA 4BMKA 5J8QA 3HL2A 1KMJA 4XEWA 4TN4A 4WB0A 1VP4A 1C7NA 1B4XA 2V1PA 5D95A 3WGCA 4UQVA 2TPLA 4PIWA 2CY8A 3TQXA 4A72A 4EU1A 3BCBA 2E7UA 2D61A 1LW4A 2JJGA 2RFVA 1WYUA 2FN6A 4Q6RA 3VK2A 3DR4A 3LVLB 3DR7A 2QBTA 2DOUA 3PA9A 3WGBA 3QPGA 1KKPA 4A6UA 2E7JA 1M0QA 1LC7A 1X28A 1AJSB 4W1VA 3W1HA 2YOBA 1CJ0A 3AEJA 3RCHA 1UU2A 1ARIA 2ZP7A 3EIAA 3PAAA 2DR1A 4F5JA 4WYAA 3ECDA 4K2BA 3MC6C 4ZWMA 1TOEA 1EG5A 1SZKA 2W8VA 4ISYA 4JE5A 1QJ3A 1CZCA 1JF9A 2WK8A 3R4TA 3EIBA 1M0NA 4MKKA 4RJYA 4GEBA 4TMRA 3GSBA 4WD2A 4XJPA 2W7FA 2VMXA 1GDEA 3WKSA 2W7LA 3QI6A 5DB5A 4OCAA 5HXXA 1GEWA 4Y0DA 3AENA 3NRAA 3OKSA 1MLYA 4MSOA 2QB2A 3L44A 1QIRA 1DJEA 2ZJGA 3EI6A 4J5UA 2HOXA 1O62A 3FVUA 3P1TA 2CANA 3W1JA 3DYDA 1OXOA 2EO5A 3R9AA 4WYEA 1WSTA 2R5EA 5LH9A 4F5LA 3QM2A 2ZY3A 2C7TA 1BJOA 2VMQA 3MBBA 3NUBA 5DJ9A 2V0YA 4HF8A 3MC6A 1WYTA 1IAYA 1SZSA 1TASA 2HUIA 3ZRPA 1AMAA 1M0PA 4FL0A 3BN1A 1Y4IA 2AY1A 2AEUA 2XH1A 3NDNA 5G2PA 5M49A 3II0A 4JEXA 4JEYA 2VMWA 4GE9A 1AY8A 4PFFA 4XK1A 1AICA 2WK9A 2W7EA 2Z61A 3A9ZA 3LWSA 3K40A 1G4XA 4BQ0A 3QN6A 4JF1A 1QITA 2BI1A 4A0GA 3ASBA 3K28A 4L0OA 3QHXA 2VGZA 2VMTA 2QLRA 2YCNA 1GEXA 3N0LA 4A00A 3B46A 5F9SA 1YJSA 3FDDA 3JWAA 1CZEA 1WYUB 2Z1ZA 5C6UA 2YCTA 2W8WA 3BCXA 1RV4A 1MDXA 4J8LA 1IX8A 3FD0A 1TPLA 1X2AA 3WCOA 2VMNA 3DU4A 4MGRA 2C0RA 4LW4A 3JW9A 3RCHB 4ADBA 1CL2A 3VP6A 4UHNA 3HT4A 4W8IA 2HOZA 3NU7A 2W7KA 4W1WA 2G6WA 4M2MA 4CBSA 2CJGA 3PD6A 5FT5A 3CQ4A 3DC1A 3ISLA 4I8AA 1S08A 3GZCA 4AZKA 3MKJA 4IX8A 2BI9A 4EFFA 1ELQA 1MAQA 2W7DA 3KKIA 4NOGA 3AENB 2W7GA 3FSLA 1QZ9A 4WYFA 4W1XA 3ZZJA 4R8DA 2O7CA 4WXFA 4OTLA 2VIAA 3A9YA 5LHAA 1IAXA 1N2TA 1EJIA 1CL1A 3FDBA 5EQCA 3COGA 4AOAA 1PFFA 4ZM4A 1TOIA 3DZZA 5FT4A 1AHGA 1I41A 3G8MA 3PDBA 1SZUA 4AO9A 4WP0A 2YKYA 1DJ9A 1X29A 1AKAA 2CJHA 1M6SA 2BYJA 3FZ6A 4ATQA 2HP1A 3TFUA 1AKBA 1BJOB 1UU1A 4M2JA 3GBXA 2QA3A 3FQ7A 2WKAA 1WYTB 2D64A 1O61A 1KMKA 2VMVA 1W7MA 5E4ZA 4XAUA 1E5FA 2VGSA 3TFTA 1RVUA 3RBFA 3AV7A 4IY7A 1AHYA 3UWCA 3M5UA 1IUGA 1JS6A 4E1OA 4ITXA 1Z7DA 3KGWA 3N75A 3WCNA 1YJZA 1SPAA 5EUNA 2X5FA 2CFBA 5E3KA 3KGXA 2VGTA 4ZM3A 1AHXA 3NYSA 5G2QA 2VGUA 4LW2A 2DKJA 4EB5A 1I48A 1JG8A 4IYOB 5AX8A 2GSAA 1YOOA 4ZDLA 1H1CA 1FC4A 1MDZA 3T32A 3F0HA 2YRIA 3CQ5A 4JEVA 2OGEA 1DKAA 1GCKA 1W7LA 5IWQA 4XJOA 1Z3ZA 3E77A 4WBTA 4ZASA 2CINA 2AATA 3HBXA 4FFCA 1W23A 2VI8A 4U2HA 3H14A 3MAUA 3VAXA 3K7YA 1MAPA 1OHWA 1ORDA 1TATA 1D7UA 2VMYA 2YKVA 1WYVB 3DODA 3BS8A 3GETA 1DTYA 1PMMA 2C81A 2YCPA 3DXVA 4R2NA 3PD6B 4ZLVA 3PIUA 1TOJA 1ASGA 3ELPA 3I16A 2BIGA 1AIBA 2VMPA 2YRRA 3AEMC 3EZSA 2OGAA 3FFRA 4Y0IA 1M7YA 8AATA 2BWPA 1D7RA 4A0HA 2CTZA 3FTBA 4PFNA 5EAVA 3RQ1A 4A0FA 4LNLA 1RVYA 4MQQA 1BKGA 1YJYA 2BIEA 1XI9A 3E2FA 5G4IA 1LC5A 1B8GA 1X0MA 2AY4A 2Z9WA 3RUYA 3EI7A 1LK9A 3HLMA 2GMSA 4CBRA 2ZY5A 1N31A 3NYUA 2YHKA 4GSAA 4QGRA 4OBUA 4M2KA 1GEYA 1B9HA 3FCRA 3BV0A 4A6TA 1G7XA 1S09A 1MLZA 2VMRA 3LG0A 3LVMA 4Q31A 2O1BA 5BJ3A 2CH2A 3AEMA 1AIAA 4CXQA 1ASFA 3D6KA 5FT8A 1DGEA 3NYTA 1FG3A 1D2FA 1V2EA 2DKBA 2ZSMA 3BWNC 1AMRA 2FNIA 4N0BA 1C4KA 3CQ6A 4F5HA 2ZY4A 4IW7A 1GC4A 3DRDA 4RIZA 5HDMA 3OP7A 4BHDA 2VI9A 4B98A 4WB0B 1BJ4A 3DXWA 3E2ZA 1EQBA 2JJHA 3ACZA 1B9IA 3B1EA 1IJIA 3ZRRA 1VJOA 3MAFA 3VK4A 2AY3A 4MKJA 5EIGA 3EI5A 3WKRA 3GJUA 4A6RA 2D5YA 4BA5A 5D5SA 1IBJA 2DGKA 4OT8A 2F8JA 1LS3A 3W1IA 4H51A 1FG7A 4E3RA 1CQ6A 1GC2A 1IX7A 1ASCA 1GC3A 2O0RA 2W7HA 3F9TA 2JJFA 3A2BA 1S06A 3BWNA 3GWPA 1AX4A 1V2DA 2BYLA 3AATA 2PO3A 3NTJA 4WXBA 1ASBA 1V72A 2DGMA 4PVFA 2X8UA 2FYFA 2Z9UA 1CS1A 3HMUA 2X5DA 1IX6A 1CQ7A 2W8UA 4LC3A 1TOGA 2BI5A 3NNKA 2R0TA 4O6ZA 1S0AA 1C0NA 3FFHA 3LVKA 3BWOA 3BCAA 1ASDA 9AATA 1IVRA 2AY6A 1AMSA 5FT6A 1ASNA 2AY8A 5K8BA 3B8XA 2W7MA 3TATA 1ARHA 2BI2A 4UOYA 4UHOA 2W7JA 4GRXA 2ORDA 2VMSA 3EI9A 4F5GA 1DFOA 2HORA 3IF2A 1ECXA 3AOWA 4Q76A 3CBFA 4EB7A 1BJWA 4WYCA 3G0TA 2GB3A 2QB3A 1O69A 1XEYA 2PB2A 2C44A 3NUIA 2Z9VA 1BT4A 2ZSLA 1AY5A 3EI8A 4AZJA 5G0AA 1D7SA 1OHVA 2VLFA 2BWOA 3NX3A 5DJ1A 3WLXA 2FNUA 3BB8A 3MAFB 5EIGB 1CQ8A 2PB0A
chains in the Genus database with same CATH superfamily
2ZC0A 1DGDA 2BI3A 3B1DA 3BC8A 4ZDOA 1YIZA 2AY9A 2JG2A 3QBOA 4WYDA 3UE8A 5M4DA 3EUCA 1BQAA 2E7IA 1TOKA 2JJEA 1GD9A 2AY2A 2W8JA 4N0WA 4XQ2A 4E3QA 3AEPA 3MADA 1ZODA 4K2MA 3QGUA 1JS3A 5TF5A 3B1CA 4RLGA 3WY7A 4P7YA 1SFFA 1LC8A 1RV3A 2EGYA 3A8UX 3E6GA 1B5PA 2R5CA 4RKDA 4U1TA 5EUEA 1GBNA 2VGWA 3HVYA 2W8TA 4ITGA 4TV7A 4ZAHA 1V2FA 1LW5A 5G09A 1G4VA 4RITA 4RM1A 1C9CA 3H7FA 3NU8A 4BA4A 1ASMA 4GDYA 4W91A 3FVSA 4JEZA 2AEVA 2BHXA 1ZOBA 3P6KA 3GZDC 1T3IA 4F5FA 7AATA 1M4NA 3PDBB 2HP2A 3L8AA 1WKGA 2Z1YA 3JTXA 4F5KA 2GQNA 1H0CA 3FRKA 1BW0A 4CXRA 1BS0A 4P3MA 2WK7A 3VK3A 3FQAA 1S07A 1KL2A 2VIBA 4LNMA 2NMPA 3A9XA 4F5IA 2OATA 5EAAA 3AEOA 4WLHA 5M46A 1AKCA 1C7OA 1G7WA 2AY7A 2HUUA 3KE3A 4GE4A 2YKXA 1QGNA 4WYGA 5DX5A 2W7IA 3LV2A 1ARSA 2VYCA 2R2NA 2Z9XA 4OMAA 4R5FA 1SF2A 2CH1A 4OC9A 1YAAA 3IHJA 3ASAA 2OQXA 1SVVA 4JF0A 4RKCA 1ARTA 3ZRQA 1VEFA 4RJ0A 3VOMA 3GZDA 4XJMA 2QSRA 3JZLA 4KYOA 1ZC9A 4B9BA 3H9XA 2XBNA 3I4JA 1WKHA 1AHEA 2AY5A 2CJDA 3ZZKA 4AO4A 4CVQA 2D7ZA 2JGTA 1J04A 3LVJA 1AAMA 2VGVA 1E5EA 3WX9A 4WXGA 1AJRA 2EZ2A 4Q75A 4WLJA 2D7YA 1ASEA 5EFSA 4MQPA 3WZFA 5BJ4A 3PGYA 2ZUKA 1W3UA 4RAEA 2FM1A 1MDOA 2VLHA 1PMOA 5JAYA 4OYTA 2JISA 2BIAA 1QJ5A 4ZSYA 5M4BA 1ASLA 4Y0HA 3RBLA 3F6TA 3HQTA 5I92A 3G7QA 1D7VA 3I5TA 2EYQA 2R5CB 2CB1A 1KKJA 2Z20A 2ZY2A 4DQ6A 3AOVA 3ATHA 2EZ1A 2FQ6A 4K2IA 3ELEA 2ZYJA 4IYOA 4UHMA 3JWBA 1UU0A 5EUDA 1OXPA 1O4SA 1I43A 2DGLA 1BQDA 1QISA 2Q7WA 2YKUA 4KXKA 4DGTA 1ARGA 1ASAA 2VMUA 2HUFA 1B5OA 1AY4A 2BKWA 4LNJA 3AELA 1U08A 1M0OA 3USFA 1AJSA 4F5MA 2EPJA 3PPLA 2OKKA 1I29A 1YIYA 5HHYA 4ZDPA 1WYVA 4ADEA 3FKDA 2D66A 3EZ1A 1YNUA 4DBCA 3GR9A 2VMOA 3MEBA 1UKJA 3PDXA 2OKJA 3E2YA 5F8VA 4ATPA 2BWNA 4IXZA 1M32A 2QMAA 4ADDA 3FZ7A 1BJNA 1OATA 2D65A 4AH3A 3TCMA 3CAIA 1GC0A 5G4JA 4JE5D 3HDOA 4XJLA 2CSTA 1DJUA 4MY5A 4OBVA 1AAWA 3FQ8A 4HVKA 2HZPA 4ZSWA 1N8PA 2X3LA 1TARA 2E54A 2D63A 3E2ZB 1P3WA 1MGVA 4ZWVA 4IXOA 4A0RA 4KAMA 3UAKA 3FZ8A 4E77A 1KL1A 1AMQA 2EH6A 3LY1A 2HOYA 4F4EA 3N5MA 1AHFA 1J32A 1ELUA 1LKCA 1W7NA 4W5KA 3FVXA 3PJ0A 1OHYA 3JU7A 3RI6A 4R5ZA 4GE7A 4ADCA 4EMYA 2Z67A 3E9KA 5E5IA 3AEJC 1C7GA 1PG8A 2GMUA 4IXSA 3Q8NA 4JEWA 2WB6A 2VMZA 4MQRA 4BMKA 5J8QA 3HL2A 1KMJA 4XEWA 4TN4A 4WB0A 1VP4A 1C7NA 1B4XA 2V1PA 5D95A 3WGCA 4UQVA 2TPLA 4PIWA 2CY8A 3TQXA 4A72A 4EU1A 3BCBA 2E7UA 2D61A 2A1VA 1LW4A 2JJGA 2RFVA 1WYUA 2FN6A 4Q6RA 3VK2A 3DR4A 3LVLB 3DR7A 2QBTA 2DOUA 3PA9A 3WGBA 3N4RA 3QPGA 1KKPA 4A6UA 2E7JA 1M0QA 1LC7A 1X28A 1AJSB 4W1VA 3W1HA 2YOBA 1CJ0A 3AEJA 3RCHA 1UU2A 1ARIA 2ZP7A 2FKIA 3EIAA 3PAAA 2DR1A 4F5JA 4WYAA 3ECDA 4K2BA 3MC6C 4ZWMA 1TOEA 1EG5A 1SZKA 2W8VA 4ISYA 4JE5A 1QJ3A 1CZCA 1JF9A 2WK8A 3R4TA 3EIBA 1M0NA 4MKKA 4RJYA 4GEBA 4TMRA 3GSBA 4WD2A 4XJPA 2W7FA 2VMXA 1GDEA 3WKSA 2W7LA 3QI6A 5DB5A 4OCAA 5HXXA 1GEWA 4Y0DA 3AENA 3NRAA 3OKSA 1MLYA 4MSOA 2QB2A 3L44A 1QIRA 1DJEA 2ZJGA 3EI6A 4J5UA 2HOXA 1O62A 3FVUA 3P1TA 2CANA 3W1JA 3DYDA 1OXOA 2EO5A 3R9AA 4WYEA 1WSTA 2R5EA 5LH9A 4F5LA 3QM2A 3N7NA 2ZY3A 2C7TA 1BJOA 2VMQA 3MBBA 3NUBA 5DJ9A 2V0YA 4HF8A 3MC6A 1WYTA 1IAYA 1SZSA 1TASA 2HUIA 3ZRPA 1AMAA 1M0PA 4FL0A 3BN1A 1Y4IA 2AY1A 2AEUA 2XH1A 3NDNA 5G2PA 5M49A 3II0A 4JEXA 4JEYA 2VMWA 4GE9A 1AY8A 4PFFA 4XK1A 1AICA 2WK9A 2W7EA 2Z61A 3A9ZA 3LWSA 3K40A 1G4XA 4BQ0A 3QN6A 4JF1A 1QITA 2BI1A 4A0GA 3ASBA 3K28A 4L0OA 3QHXA 2VGZA 2VMTA 2QLRA 2YCNA 1GEXA 3N0LA 4A00A 3B46A 5F9SA 1YJSA 3FDDA 3JWAA 1CZEA 1WYUB 2Z1ZA 5C6UA 3N4XA 2YCTA 2W8WA 3BCXA 1RV4A 1MDXA 4J8LA 3N4SA 1IX8A 3FD0A 1TPLA 1X2AA 3WCOA 2VMNA 3DU4A 4MGRA 2C0RA 4LW4A 3JW9A 3RCHB 4ADBA 5KTBA 1CL2A 3VP6A 4UHNA 3HT4A 4W8IA 2HOZA 3NU7A 2W7KA 4W1WA 2G6WA 4M2MA 4CBSA 2CJGA 3PD6A 5FT5A 3CQ4A 3DC1A 3ISLA 4I8AA 1S08A 3GZCA 4AZKA 3MKJA 4IX8A 2BI9A 4EFFA 1ELQA 1MAQA 2W7DA 3KKIA 4NOGA 3AENB 2W7GA 3FSLA 1QZ9A 4WYFA 4W1XA 3ZZJA 4R8DA 2O7CA 4WXFA 4OTLA 2VIAA 3A9YA 5LHAA 1IAXA 1N2TA 1EJIA 1CL1A 3FDBA 5EQCA 3COGA 4AOAA 1PFFA 4ZM4A 1TOIA 3DZZA 5FT4A 1AHGA 1I41A 3G8MA 3PDBA 1SZUA 4AO9A 4WP0A 2YKYA 1DJ9A 1X29A 1AKAA 2CJHA 1M6SA 2BYJA 3FZ6A 4ATQA 2HP1A 3TFUA 1AKBA 1BJOB 1UU1A 4M2JA 3GBXA 2QA3A 3FQ7A 2WKAA 1WYTB 2D64A 1O61A 1KMKA 2VMVA 1W7MA 5E4ZA 4XAUA 1E5FA 2VGSA 3TFTA 1RVUA 3RBFA 3AV7A 4IY7A 1AHYA 3UWCA 3M5UA 1IUGA 1JS6A 4E1OA 4ITXA 1Z7DA 3KGWA 3N75A 3WCNA 2G7JA 1YJZA 1SPAA 5EUNA 2X5FA 2CFBA 5E3KA 3KGXA 2VGTA 4ZM3A 1AHXA 3NYSA 5G2QA 2VGUA 4LW2A 2DKJA 4EB5A 1I48A 1JG8A 4IYOB 5AX8A 2GSAA 1YOOA 4ZDLA 1H1CA 1FC4A 1MDZA 3T32A 3F0HA 2YRIA 3CQ5A 4JEVA 2OGEA 1DKAA 1GCKA 1W7LA 5IWQA 4XJOA 1Z3ZA 3E77A 4WBTA 4ZASA 2CINA 2AATA 3HBXA 4FFCA 1W23A 2VI8A 4U2HA 3H14A 3MAUA 3VAXA 3K7YA 1MAPA 1OHWA 1ORDA 1TATA 1D7UA 2VMYA 2YKVA 1WYVB 3DODA 3BS8A 3GETA 1DTYA 1PMMA 2C81A 2YCPA 3DXVA 4R2NA 3PD6B 4ZLVA 3PIUA 1TOJA 1ASGA 3ELPA 3I16A 2BIGA 1AIBA 2VMPA 2YRRA 3AEMC 3EZSA 2OGAA 3FFRA 4Y0IA 1M7YA 8AATA 2BWPA 1D7RA 4A0HA 2CTZA 3FTBA 4PFNA 5EAVA 3RQ1A 4A0FA 4LNLA 1RVYA 4MQQA 1BKGA 1YJYA 2BIEA 1XI9A 3E2FA 5G4IA 1LC5A 1B8GA 1X0MA 2AY4A 2Z9WA 3RUYA 3EI7A 1LK9A 4H63Q 3HLMA 2GMSA 4CBRA 2ZY5A 1N31A 3NYUA 2YHKA 4GSAA 4QGRA 4OBUA 4M2KA 1GEYA 1B9HA 3FCRA 3BV0A 4A6TA 1G7XA 1S09A 1MLZA 2VMRA 3LG0A 3LVMA 4Q31A 2O1BA 5BJ3A 2CH2A 3AEMA 1AIAA 4CXQA 1ASFA 3D6KA 5FT8A 1DGEA 3NYTA 1FG3A 1D2FA 1V2EA 2DKBA 2ZSMA 3BWNC 1AMRA 2FNIA 4N0BA 1C4KA 3CQ6A 4F5HA 2ZY4A 4IW7A 1GC4A 3DRDA 4RIZA 5HDMA 3OP7A 4BHDA 2VI9A 4B98A 4WB0B 1BJ4A 3DXWA 3E2ZA 1EQBA 2JJHA 3ACZA 1B9IA 3B1EA 1IJIA 3ZRRA 1VJOA 3MAFA 3VK4A 2AY3A 4MKJA 5EIGA 3EI5A 3WKRA 3GJUA 4A6RA 2D5YA 4BA5A 5D5SA 1IBJA 2DGKA 4OT8A 2F8JA 1LS3A 3W1IA 4H51A 1FG7A 4E3RA 1CQ6A 1GC2A 1IX7A 1ASCA 2KFPA 1GC3A 2O0RA 2W7HA 3F9TA 2JJFA 3A2BA 1S06A 3BWNA 3GWPA 1AX4A 1V2DA 2BYLA 3AATA 2PO3A 3NTJA 4WXBA 1ASBA 1V72A 2DGMA 4PVFA 2X8UA 2FYFA 2Z9UA 1CS1A 3HMUA 2X5DA 1IX6A 1CQ7A 2W8UA 4LC3A 1TOGA 2BI5A 3NNKA 2R0TA 4O6ZA 1S0AA 1C0NA 3FFHA 3LVKA 3BWOA 3BCAA 1ASDA 9AATA 1IVRA 1KAFA 2AY6A 1AMSA 5FT6A 1ASNA 2AY8A 5K8BA 3B8XA 2W7MA 3TATA 1ARHA 2BI2A 4UOYA 4UHOA 2W7JA 4GRXA 2ORDA 2VMSA 3EI9A 4F5GA 1DFOA 2HORA 3IF2A 1ECXA 3AOWA 4Q76A 3CBFA 4EB7A 1BJWA 4WYCA 3G0TA 2GB3A 2QB3A 1O69A 1XEYA 2PB2A 2C44A 3NUIA 2Z9VA 1BT4A 2ZSLA 1AY5A 3EI8A 4AZJA 5G0AA 1D7SA 4K05A 1OHVA 2VLFA 2BWOA 3NX3A 5DJ1A 3WLXA 2FNUA 3BB8A 3MAFB 5EIGB 1CQ8A 2PB0A
chains in the Genus database with same CATH topology
2ZC0A 1DGDA 2BI3A 3B1DA 3BC8A 4ZDOA 1YIZA 2AY9A 2JG2A 3QBOA 4WYDA 3UE8A 5M4DA 3EUCA 1BQAA 2E7IA 1TOKA 2JJEA 1GD9A 2AY2A 2W8JA 4N0WA 4XQ2A 4E3QA 3AEPA 3MADA 1ZODA 4K2MA 3QGUA 1JS3A 5TF5A 3B1CA 4RLGA 3WY7A 4P7YA 1SFFA 1LC8A 1RV3A 2EGYA 3A8UX 3E6GA 1B5PA 2R5CA 4RKDA 4U1TA 5EUEA 1GBNA 2VGWA 3HVYA 2W8TA 4ITGA 4TV7A 4ZAHA 1V2FA 1LW5A 5G09A 1G4VA 4RITA 4RM1A 1C9CA 3H7FA 3NU8A 4BA4A 1ASMA 4GDYA 4W91A 3FVSA 4JEZA 2AEVA 2BHXA 1ZOBA 3P6KA 3GZDC 1T3IA 4F5FA 7AATA 1M4NA 3PDBB 2HP2A 3L8AA 1WKGA 2Z1YA 3JTXA 4F5KA 2GQNA 1H0CA 3FRKA 1BW0A 4CXRA 1BS0A 4P3MA 2WK7A 3VK3A 3FQAA 1S07A 1KL2A 2VIBA 4LNMA 2NMPA 3A9XA 4F5IA 2OATA 5EAAA 3AEOA 4WLHA 5M46A 1AKCA 1C7OA 1G7WA 2AY7A 2HUUA 3KE3A 4GE4A 2YKXA 1QGNA 4WYGA 5DX5A 2W7IA 3LV2A 1ARSA 2VYCA 2R2NA 2Z9XA 4OMAA 4R5FA 1SF2A 2CH1A 4OC9A 1YAAA 3IHJA 3ASAA 2OQXA 1SVVA 4JF0A 4RKCA 1ARTA 3ZRQA 1VEFA 4RJ0A 3VOMA 3GZDA 4XJMA 2QSRA 3JZLA 4KYOA 1ZC9A 4B9BA 3H9XA 2XBNA 3I4JA 1WKHA 1AHEA 2AY5A 2CJDA 3ZZKA 4AO4A 4CVQA 2D7ZA 2JGTA 1J04A 3LVJA 1AAMA 2VGVA 1E5EA 3WX9A 4WXGA 1AJRA 2EZ2A 4Q75A 4WLJA 2D7YA 1ASEA 5EFSA 4MQPA 3WZFA 5BJ4A 3PGYA 2ZUKA 1W3UA 4RAEA 2FM1A 1MDOA 2VLHA 1PMOA 5JAYA 4OYTA 2JISA 2BIAA 1QJ5A 4ZSYA 5M4BA 1ASLA 4Y0HA 3RBLA 3F6TA 3HQTA 5I92A 3G7QA 1D7VA 3I5TA 2EYQA 2R5CB 2CB1A 1KKJA 2Z20A 2ZY2A 4DQ6A 3AOVA 3ATHA 2EZ1A 2FQ6A 4K2IA 3ELEA 2ZYJA 4IYOA 4UHMA 3JWBA 1UU0A 5EUDA 1OXPA 1O4SA 1I43A 2DGLA 1BQDA 1QISA 2Q7WA 2YKUA 4KXKA 4DGTA 1ARGA 1ASAA 2VMUA 2HUFA 1B5OA 1AY4A 2BKWA 4LNJA 3AELA 1U08A 1M0OA 3USFA 1AJSA 4F5MA 2EPJA 3PPLA 2OKKA 1I29A 1YIYA 5HHYA 4ZDPA 1WYVA 4ADEA 3FKDA 2D66A 3EZ1A 1YNUA 4DBCA 3GR9A 2VMOA 3MEBA 1UKJA 3PDXA 2OKJA 3E2YA 5F8VA 4ATPA 2BWNA 4IXZA 1M32A 2QMAA 4ADDA 3FZ7A 1BJNA 1OATA 2D65A 4AH3A 3TCMA 3CAIA 1GC0A 5G4JA 4JE5D 3HDOA 4XJLA 2CSTA 1DJUA 4MY5A 4OBVA 1AAWA 3FQ8A 4HVKA 2HZPA 4ZSWA 1N8PA 2X3LA 1TARA 2E54A 2D63A 3E2ZB 1P3WA 1MGVA 4ZWVA 4IXOA 4A0RA 4KAMA 3UAKA 3FZ8A 4E77A 1KL1A 1AMQA 2EH6A 3LY1A 2HOYA 4F4EA 3N5MA 1AHFA 1J32A 1ELUA 1LKCA 1W7NA 4W5KA 3FVXA 3PJ0A 1OHYA 3JU7A 3RI6A 4R5ZA 4GE7A 4ADCA 4EMYA 2Z67A 3E9KA 5E5IA 3AEJC 1C7GA 1PG8A 2GMUA 4IXSA 3Q8NA 4JEWA 2WB6A 2VMZA 4MQRA 4BMKA 5J8QA 3HL2A 1KMJA 4XEWA 4TN4A 4WB0A 1VP4A 1C7NA 1B4XA 2V1PA 5D95A 3WGCA 4UQVA 2TPLA 4PIWA 2CY8A 3TQXA 4A72A 4EU1A 3BCBA 2E7UA 2D61A 2A1VA 1LW4A 2JJGA 2RFVA 1WYUA 2FN6A 4Q6RA 3VK2A 3DR4A 3LVLB 3DR7A 2QBTA 2DOUA 3PA9A 3WGBA 3N4RA 3QPGA 1KKPA 4A6UA 2E7JA 1M0QA 1LC7A 1X28A 1AJSB 4W1VA 3W1HA 2YOBA 1CJ0A 3AEJA 3RCHA 1UU2A 1ARIA 2ZP7A 2FKIA 3EIAA 3PAAA 2DR1A 4F5JA 4WYAA 3ECDA 4K2BA 3MC6C 4ZWMA 1TOEA 1EG5A 1SZKA 2W8VA 4ISYA 4JE5A 1QJ3A 1CZCA 1JF9A 2WK8A 3R4TA 3EIBA 1M0NA 4MKKA 4RJYA 4GEBA 4TMRA 3GSBA 4WD2A 4XJPA 2W7FA 2VMXA 1GDEA 3WKSA 2W7LA 3QI6A 5DB5A 4OCAA 5HXXA 1GEWA 4Y0DA 3AENA 3NRAA 3OKSA 1MLYA 4MSOA 2QB2A 3L44A 1QIRA 1DJEA 2ZJGA 3EI6A 4J5UA 2HOXA 1O62A 3FVUA 3P1TA 2CANA 3W1JA 3DYDA 1OXOA 2EO5A 3R9AA 4WYEA 1WSTA 2R5EA 5LH9A 4F5LA 3QM2A 3N7NA 2ZY3A 2C7TA 1BJOA 2VMQA 3MBBA 3NUBA 5DJ9A 2V0YA 4HF8A 3MC6A 1WYTA 1IAYA 1SZSA 1TASA 2HUIA 3ZRPA 1AMAA 1M0PA 4FL0A 3BN1A 1Y4IA 2AY1A 2AEUA 2XH1A 3NDNA 5G2PA 5M49A 3II0A 4JEXA 4JEYA 2VMWA 4GE9A 1AY8A 4PFFA 4XK1A 1AICA 2WK9A 2W7EA 2Z61A 3A9ZA 3LWSA 3K40A 1G4XA 4BQ0A 3QN6A 4JF1A 1QITA 2BI1A 4A0GA 3ASBA 3K28A 4L0OA 3QHXA 2VGZA 2VMTA 2QLRA 2YCNA 1GEXA 3N0LA 4A00A 3B46A 5F9SA 1YJSA 3FDDA 3JWAA 1CZEA 1WYUB 2Z1ZA 5C6UA 3N4XA 2YCTA 2W8WA 3BCXA 1RV4A 1MDXA 4J8LA 3N4SA 1IX8A 3FD0A 1TPLA 1X2AA 3WCOA 2VMNA 3DU4A 4MGRA 2C0RA 4LW4A 3JW9A 3RCHB 4ADBA 5KTBA 1CL2A 3VP6A 4UHNA 3HT4A 4W8IA 2HOZA 3NU7A 2W7KA 4W1WA 2G6WA 4M2MA 4CBSA 2CJGA 3PD6A 5FT5A 3CQ4A 3DC1A 3ISLA 4I8AA 1S08A 3GZCA 4AZKA 3MKJA 4IX8A 2BI9A 4EFFA 1ELQA 1MAQA 2W7DA 3KKIA 4NOGA 3AENB 2W7GA 3FSLA 1QZ9A 4WYFA 4W1XA 3ZZJA 4R8DA 2O7CA 4WXFA 4OTLA 2VIAA 3A9YA 5LHAA 1IAXA 1N2TA 1EJIA 1CL1A 3FDBA 5EQCA 3COGA 4AOAA 1PFFA 4ZM4A 1TOIA 3DZZA 5FT4A 1AHGA 1I41A 3G8MA 3PDBA 1SZUA 4AO9A 4WP0A 2YKYA 1DJ9A 1X29A 1AKAA 2CJHA 1M6SA 2BYJA 3FZ6A 4ATQA 2HP1A 3TFUA 1AKBA 1BJOB 1UU1A 4M2JA 3GBXA 2QA3A 3FQ7A 2WKAA 1WYTB 2D64A 1O61A 1KMKA 2VMVA 1W7MA 5E4ZA 4XAUA 1E5FA 2VGSA 3TFTA 1RVUA 3RBFA 3AV7A 4IY7A 1AHYA 3UWCA 3M5UA 1IUGA 1JS6A 4E1OA 4ITXA 1Z7DA 3KGWA 3N75A 3WCNA 2G7JA 1YJZA 1SPAA 5EUNA 2X5FA 2CFBA 5E3KA 3KGXA 2VGTA 4ZM3A 1AHXA 3NYSA 5G2QA 2VGUA 4LW2A 2DKJA 4EB5A 1I48A 1JG8A 4IYOB 5AX8A 2GSAA 1YOOA 4ZDLA 1H1CA 1FC4A 1MDZA 3T32A 3F0HA 2YRIA 3CQ5A 4JEVA 2OGEA 1DKAA 1GCKA 1W7LA 5IWQA 4XJOA 1Z3ZA 3E77A 4WBTA 4ZASA 2CINA 2AATA 3HBXA 4FFCA 1W23A 2VI8A 4U2HA 3H14A 3MAUA 3VAXA 3K7YA 1MAPA 1OHWA 1ORDA 1TATA 1D7UA 2VMYA 2YKVA 1WYVB 3DODA 3BS8A 3GETA 1DTYA 1PMMA 2C81A 2YCPA 3DXVA 4R2NA 3PD6B 4ZLVA 3PIUA 1TOJA 1ASGA 3ELPA 3I16A 2BIGA 1AIBA 2VMPA 2YRRA 3AEMC 3EZSA 2OGAA 3FFRA 4Y0IA 1M7YA 8AATA 2BWPA 1D7RA 4A0HA 2CTZA 3FTBA 4PFNA 5EAVA 3RQ1A 4A0FA 4LNLA 1RVYA 4MQQA 1BKGA 1YJYA 2BIEA 1XI9A 3E2FA 5G4IA 1LC5A 1B8GA 1X0MA 2AY4A 2Z9WA 3RUYA 3EI7A 1LK9A 4H63Q 3HLMA 2GMSA 4CBRA 2ZY5A 1N31A 3NYUA 2YHKA 4GSAA 4QGRA 4OBUA 4M2KA 1GEYA 1B9HA 3FCRA 3BV0A 4A6TA 1G7XA 1S09A 1MLZA 2VMRA 3LG0A 3LVMA 4Q31A 2O1BA 5BJ3A 2CH2A 3AEMA 1AIAA 4CXQA 1ASFA 3D6KA 5FT8A 1DGEA 3NYTA 1FG3A 1D2FA 1V2EA 2DKBA 2ZSMA 3BWNC 1AMRA 2FNIA 4N0BA 1C4KA 3CQ6A 4F5HA 2ZY4A 4IW7A 1GC4A 3DRDA 4RIZA 5HDMA 3OP7A 4BHDA 2VI9A 4B98A 4WB0B 1BJ4A 3DXWA 3E2ZA 1EQBA 2JJHA 3ACZA 1B9IA 3B1EA 1IJIA 3ZRRA 1VJOA 3MAFA 3VK4A 2AY3A 4MKJA 5EIGA 3EI5A 3WKRA 3GJUA 4A6RA 2D5YA 4BA5A 5D5SA 1IBJA 2DGKA 4OT8A 2F8JA 1LS3A 3W1IA 4H51A 1FG7A 4E3RA 1CQ6A 1GC2A 1IX7A 1ASCA 2KFPA 1GC3A 2O0RA 2W7HA 3F9TA 2JJFA 3A2BA 1S06A 3BWNA 3GWPA 1AX4A 1V2DA 2BYLA 3AATA 2PO3A 3NTJA 4WXBA 1ASBA 1V72A 2DGMA 4PVFA 2X8UA 2FYFA 2Z9UA 1CS1A 3HMUA 2X5DA 1IX6A 1CQ7A 2W8UA 4LC3A 1TOGA 2BI5A 3NNKA 2R0TA 4O6ZA 1S0AA 1C0NA 3FFHA 3LVKA 3BWOA 3BCAA 1ASDA 9AATA 1IVRA 2AY6A 1AMSA 5FT6A 1ASNA 2AY8A 5K8BA 3B8XA 2W7MA 3TATA 1ARHA 2BI2A 4UOYA 4UHOA 2W7JA 4GRXA 2ORDA 2VMSA 3EI9A 4F5GA 1DFOA 2HORA 3IF2A 1ECXA 3AOWA 4Q76A 3CBFA 4EB7A 1BJWA 4WYCA 3G0TA 2GB3A 2QB3A 1O69A 1XEYA 2PB2A 2C44A 3NUIA 2Z9VA 1BT4A 2ZSLA 1AY5A 3EI8A 4AZJA 5G0AA 1D7SA 4K05A 1OHVA 2VLFA 2BWOA 3NX3A 5DJ1A 3WLXA 2FNUA 3BB8A 3MAFB 5EIGB 1CQ8A 2PB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZC0 A;  1DGD A;  2BI3 A;  3B1D A;  3BC8 A;  4ZDO A;  1YIZ A;  2AY9 A;  2JG2 A;  3QBO A;  4WYD A;  3UE8 A;  5M4D A;  3EUC A;  1BQA A;  2E7I A;  1TOK A;  2JJE A;  1GD9 A;  2AY2 A;  2W8J A;  4N0W A;  4XQ2 A;  4E3Q A;  3AEP A;  3MAD A;  1ZOD A;  4K2M A;  3QGU A;  1JS3 A;  5TF5 A;  3B1C A;  4RLG A;  3WY7 A;  4P7Y A;  1SFF A;  1LC8 A;  1RV3 A;  2EGY A;  3A8U X;  3E6G A;  1B5P A;  2R5C A;  4RKD A;  4U1T A;  5EUE A;  1GBN A;  2VGW A;  3HVY A;  2W8T A;  4ITG A;  4TV7 A;  4ZAH A;  1V2F A;  1LW5 A;  5G09 A;  1G4V A;  4RIT A;  4RM1 A;  1C9C A;  3H7F A;  3NU8 A;  4BA4 A;  1ASM A;  4GDY A;  4W91 A;  3FVS A;  4JEZ A;  2AEV A;  2BHX A;  1ZOB A;  3P6K A;  3GZD C;  1T3I A;  4F5F A;  7AAT A;  1M4N A;  3PDB B;  2HP2 A;  3L8A A;  1WKG A;  2Z1Y A;  3JTX A;  4F5K A;  2GQN A;  1H0C A;  3FRK A;  1BW0 A;  4CXR A;  1BS0 A;  4P3M A;  2WK7 A;  3VK3 A;  3FQA A;  1S07 A;  1KL2 A;  2VIB A;  4LNM A;  2NMP A;  3A9X A;  4F5I A;  2OAT A;  5EAA A;  3AEO A;  4WLH A;  5M46 A;  1AKC A;  1C7O A;  1G7W A;  2AY7 A;  2HUU A;  3KE3 A;  4GE4 A;  2YKX A;  1QGN A;  4WYG A;  5DX5 A;  2W7I A;  3LV2 A;  1ARS A;  2VYC A;  2R2N A;  2Z9X A;  4OMA A;  4R5F A;  1SF2 A;  2CH1 A;  4OC9 A;  1YAA A;  3IHJ A;  3ASA A;  2OQX A;  1SVV A;  4JF0 A;  4RKC A;  1ART A;  3ZRQ A;  1VEF A;  4RJ0 A;  3VOM A;  3GZD A;  4XJM A;  3JZL A;  4KYO A;  1ZC9 A;  4B9B A;  2XBN A;  3I4J A;  1WKH A;  1AHE A;  2AY5 A;  2CJD A;  3ZZK A;  4AO4 A;  4CVQ A;  2D7Z A;  2JGT A;  1J04 A;  3LVJ A;  1AAM A;  2VGV A;  1E5E A;  3WX9 A;  4WXG A;  1AJR A;  2EZ2 A;  4Q75 A;  4WLJ A;  2D7Y A;  1ASE A;  5EFS A;  4MQP A;  3WZF A;  5BJ4 A;  3PGY A;  2ZUK A;  1W3U A;  4RAE A;  2FM1 A;  1MDO A;  2VLH A;  1PMO A;  5JAY A;  4OYT A;  2JIS A;  2BIA A;  1QJ5 A;  4ZSY A;  5M4B A;  1ASL A;  4Y0H A;  3RBL A;  3F6T A;  3HQT A;  5I92 A;  3G7Q A;  1D7V A;  3I5T A;  2R5C B;  2CB1 A;  1KKJ A;  2Z20 A;  2ZY2 A;  4DQ6 A;  3AOV A;  3ATH A;  2EZ1 A;  2FQ6 A;  4K2I A;  3ELE A;  2ZYJ A;  4IYO A;  4UHM A;  3JWB A;  1UU0 A;  5EUD A;  1OXP A;  1O4S A;  1I43 A;  2DGL A;  1BQD A;  1QIS A;  2Q7W A;  2YKU A;  4KXK A;  4DGT A;  1ARG A;  1ASA A;  2VMU A;  2HUF A;  1B5O A;  1AY4 A;  2BKW A;  4LNJ A;  3AEL A;  1U08 A;  1M0O A;  3USF A;  1AJS A;  4F5M A;  2EPJ A;  3PPL A;  2OKK A;  1I29 A;  1YIY A;  5HHY A;  4ZDP A;  1WYV A;  4ADE A;  3FKD A;  2D66 A;  3EZ1 A;  1YNU A;  4DBC A;  3GR9 A;  2VMO A;  3MEB A;  1UKJ A;  3PDX A;  2OKJ A;  3E2Y A;  5F8V A;  4ATP A;  2BWN A;  4IXZ A;  1M32 A;  2QMA A;  4ADD A;  3FZ7 A;  1BJN A;  1OAT A;  2D65 A;  4AH3 A;  3TCM A;  3CAI A;  1GC0 A;  5G4J A;  4JE5 D;  3HDO A;  4XJL A;  2CST A;  1DJU A;  4MY5 A;  4OBV A;  1AAW A;  3FQ8 A;  4HVK A;  2HZP A;  4ZSW A;  1N8P A;  2X3L A;  1TAR A;  2E54 A;  2D63 A;  3E2Z B;  1P3W A;  1MGV A;  4ZWV A;  4IXO A;  4A0R A;  4KAM A;  3UAK A;  3FZ8 A;  4E77 A;  1KL1 A;  1AMQ A;  2EH6 A;  3LY1 A;  2HOY A;  4F4E A;  3N5M A;  1AHF A;  1J32 A;  1ELU A;  1LKC A;  1W7N A;  4W5K A;  3FVX A;  3PJ0 A;  1OHY A;  3JU7 A;  3RI6 A;  4R5Z A;  4GE7 A;  4ADC A;  4EMY A;  2Z67 A;  3E9K A;  5E5I A;  3AEJ C;  1C7G A;  1PG8 A;  2GMU A;  4IXS A;  3Q8N A;  4JEW A;  2VMZ A;  4MQR A;  4BMK A;  5J8Q A;  3HL2 A;  1KMJ A;  4XEW A;  4TN4 A;  4WB0 A;  1VP4 A;  1C7N A;  1B4X A;  2V1P A;  5D95 A;  3WGC A;  4UQV A;  2TPL A;  4PIW A;  2CY8 A;  3TQX A;  4A72 A;  4EU1 A;  3BCB A;  2E7U A;  2D61 A;  1LW4 A;  2JJG A;  2RFV A;  1WYU A;  2FN6 A;  4Q6R A;  3VK2 A;  3DR4 A;  3LVL B;  3DR7 A;  2QBT A;  2DOU A;  3PA9 A;  3WGB A;  3QPG A;  1KKP A;  4A6U A;  2E7J A;  1M0Q A;  1LC7 A;  1X28 A;  1AJS B;  4W1V A;  3W1H A;  2YOB A;  1CJ0 A;  3AEJ A;  3RCH A;  1UU2 A;  1ARI A;  2ZP7 A;  3EIA A;  3PAA A;  2DR1 A;  4F5J A;  4WYA A;  3ECD A;  4K2B A;  3MC6 C;  4ZWM A;  1TOE A;  1EG5 A;  1SZK A;  2W8V A;  4ISY A;  4JE5 A;  1QJ3 A;  1CZC A;  1JF9 A;  2WK8 A;  3R4T A;  3EIB A;  1M0N A;  4MKK A;  4RJY A;  4GEB A;  4TMR A;  3GSB A;  4WD2 A;  4XJP A;  2W7F A;  2VMX A;  1GDE A;  3WKS A;  2W7L A;  3QI6 A;  5DB5 A;  4OCA A;  5HXX A;  1GEW A;  4Y0D A;  3AEN A;  3NRA A;  3OKS A;  1MLY A;  4MSO A;  2QB2 A;  3L44 A;  1QIR A;  1DJE A;  2ZJG A;  3EI6 A;  4J5U A;  2HOX A;  1O62 A;  3FVU A;  3P1T A;  2CAN A;  3W1J A;  3DYD A;  1OXO A;  2EO5 A;  3R9A A;  4WYE A;  1WST A;  2R5E A;  5LH9 A;  4F5L A;  3QM2 A;  2ZY3 A;  2C7T A;  1BJO A;  2VMQ A;  3MBB A;  3NUB A;  5DJ9 A;  2V0Y A;  4HF8 A;  3MC6 A;  1WYT A;  1IAY A;  1SZS A;  1TAS A;  2HUI A;  3ZRP A;  1AMA A;  1M0P A;  4FL0 A;  3BN1 A;  1Y4I A;  2AY1 A;  2AEU A;  2XH1 A;  3NDN A;  5G2P A;  5M49 A;  3II0 A;  4JEX A;  4JEY A;  2VMW A;  4GE9 A;  1AY8 A;  4PFF A;  4XK1 A;  1AIC A;  2WK9 A;  2W7E A;  2Z61 A;  3A9Z A;  3LWS A;  3K40 A;  1G4X A;  4BQ0 A;  3QN6 A;  4JF1 A;  1QIT A;  2BI1 A;  4A0G A;  3ASB A;  3K28 A;  4L0O A;  3QHX A;  2VGZ A;  2VMT A;  2QLR A;  2YCN A;  1GEX A;  3N0L A;  4A00 A;  3B46 A;  5F9S A;  1YJS A;  3FDD A;  3JWA A;  1CZE A;  1WYU B;  2Z1Z A;  5C6U A;  2YCT A;  2W8W A;  3BCX A;  1RV4 A;  1MDX A;  4J8L A;  1IX8 A;  3FD0 A;  1TPL A;  1X2A A;  3WCO A;  2VMN A;  3DU4 A;  4MGR A;  2C0R A;  4LW4 A;  3JW9 A;  3RCH B;  4ADB A;  1CL2 A;  3VP6 A;  4UHN A;  3HT4 A;  4W8I A;  2HOZ A;  3NU7 A;  2W7K A;  4W1W A;  2G6W A;  4M2M A;  4CBS A;  2CJG A;  3PD6 A;  5FT5 A;  3CQ4 A;  3DC1 A;  3ISL A;  4I8A A;  1S08 A;  3GZC A;  4AZK A;  3MKJ A;  4IX8 A;  2BI9 A;  4EFF A;  1ELQ A;  1MAQ A;  2W7D A;  3KKI A;  4NOG A;  3AEN B;  2W7G A;  3FSL A;  1QZ9 A;  4WYF A;  4W1X A;  3ZZJ A;  4R8D A;  2O7C A;  4WXF A;  4OTL A;  2VIA A;  3A9Y A;  5LHA A;  1IAX A;  1N2T A;  1EJI A;  1CL1 A;  3FDB A;  5EQC A;  3COG A;  4AOA A;  1PFF A;  4ZM4 A;  1TOI A;  3DZZ A;  5FT4 A;  1AHG A;  1I41 A;  3G8M A;  3PDB A;  1SZU A;  4AO9 A;  4WP0 A;  2YKY A;  1DJ9 A;  1X29 A;  1AKA A;  2CJH A;  1M6S A;  2BYJ A;  3FZ6 A;  4ATQ A;  2HP1 A;  3TFU A;  1AKB A;  1BJO B;  1UU1 A;  4M2J A;  3GBX A;  2QA3 A;  3FQ7 A;  2WKA A;  1WYT B;  2D64 A;  1O61 A;  1KMK A;  2VMV A;  1W7M A;  5E4Z A;  4XAU A;  1E5F A;  2VGS A;  3TFT A;  1RVU A;  3RBF A;  3AV7 A;  4IY7 A;  1AHY A;  3UWC A;  3M5U A;  1IUG A;  1JS6 A;  4E1O A;  4ITX A;  1Z7D A;  3KGW A;  3N75 A;  3WCN A;  1YJZ A;  1SPA A;  5EUN A;  2X5F A;  2CFB A;  5E3K A;  3KGX A;  2VGT A;  4ZM3 A;  1AHX A;  3NYS A;  5G2Q A;  2VGU A;  4LW2 A;  2DKJ A;  4EB5 A;  1I48 A;  1JG8 A;  4IYO B;  5AX8 A;  2GSA A;  1YOO A;  4ZDL A;  1H1C A;  1FC4 A;  1MDZ A;  3T32 A;  3F0H A;  2YRI A;  3CQ5 A;  4JEV A;  2OGE A;  1DKA A;  1GCK A;  1W7L A;  5IWQ A;  4XJO A;  1Z3Z A;  3E77 A;  4WBT A;  4ZAS A;  2CIN A;  2AAT A;  3HBX A;  4FFC A;  1W23 A;  2VI8 A;  4U2H A;  3H14 A;  3MAU A;  3VAX A;  3K7Y A;  1MAP A;  1OHW A;  1ORD A;  1TAT A;  1D7U A;  2VMY A;  2YKV A;  1WYV B;  3DOD A;  3BS8 A;  3GET A;  1DTY A;  1PMM A;  2C81 A;  2YCP A;  3DXV A;  4R2N A;  3PD6 B;  4ZLV A;  3PIU A;  1TOJ A;  1ASG A;  3ELP A;  3I16 A;  2BIG A;  1AIB A;  2VMP A;  2YRR A;  3AEM C;  3EZS A;  2OGA A;  3FFR A;  4Y0I A;  1M7Y A;  8AAT A;  2BWP A;  1D7R A;  4A0H A;  2CTZ A;  3FTB A;  4PFN A;  5EAV A;  3RQ1 A;  4A0F A;  4LNL A;  1RVY A;  4MQQ A;  1BKG A;  1YJY A;  2BIE A;  1XI9 A;  3E2F A;  5G4I A;  1LC5 A;  1B8G A;  1X0M A;  2AY4 A;  2Z9W A;  3RUY A;  3EI7 A;  1LK9 A;  3HLM A;  2GMS A;  4CBR A;  2ZY5 A;  1N31 A;  3NYU A;  2YHK A;  4GSA A;  4QGR A;  4OBU A;  4M2K A;  1GEY A;  1B9H A;  3FCR A;  3BV0 A;  4A6T A;  1G7X A;  1S09 A;  1MLZ A;  2VMR A;  3LG0 A;  3LVM A;  4Q31 A;  2O1B A;  5BJ3 A;  2CH2 A;  3AEM A;  1AIA A;  4CXQ A;  1ASF A;  3D6K A;  5FT8 A;  1DGE A;  3NYT A;  1FG3 A;  1D2F A;  1V2E A;  2DKB A;  2ZSM A;  3BWN C;  1AMR A;  2FNI A;  4N0B A;  1C4K A;  3CQ6 A;  4F5H A;  2ZY4 A;  4IW7 A;  1GC4 A;  3DRD A;  4RIZ A;  5HDM A;  3OP7 A;  4BHD A;  2VI9 A;  4B98 A;  4WB0 B;  1BJ4 A;  3DXW A;  3E2Z A;  1EQB A;  2JJH A;  3ACZ A;  1B9I A;  3B1E A;  1IJI A;  3ZRR A;  1VJO A;  3MAF A;  3VK4 A;  2AY3 A;  4MKJ A;  5EIG A;  3EI5 A;  3WKR A;  3GJU A;  4A6R A;  2D5Y A;  4BA5 A;  5D5S A;  1IBJ A;  2DGK A;  4OT8 A;  2F8J A;  1LS3 A;  3W1I A;  4H51 A;  1FG7 A;  4E3R A;  1CQ6 A;  1GC2 A;  1IX7 A;  1ASC A;  1GC3 A;  2O0R A;  2W7H A;  3F9T A;  2JJF A;  3A2B A;  1S06 A;  3BWN A;  3GWP A;  1AX4 A;  1V2D A;  2BYL A;  3AAT A;  2PO3 A;  3NTJ A;  4WXB A;  1ASB A;  1V72 A;  2DGM A;  4PVF A;  2X8U A;  2FYF A;  2Z9U A;  1CS1 A;  3HMU A;  2X5D A;  1IX6 A;  1CQ7 A;  2W8U A;  4LC3 A;  1TOG A;  2BI5 A;  3NNK A;  2R0T A;  4O6Z A;  1S0A A;  1C0N A;  3FFH A;  3LVK A;  3BWO A;  3BCA A;  1ASD A;  9AAT A;  1IVR A;  2AY6 A;  1AMS A;  5FT6 A;  1ASN A;  2AY8 A;  5K8B A;  3B8X A;  2W7M A;  3TAT A;  1ARH A;  2BI2 A;  4UOY A;  4UHO A;  2W7J A;  4GRX A;  2ORD A;  2VMS A;  3EI9 A;  4F5G A;  1DFO A;  2HOR A;  3IF2 A;  1ECX A;  3AOW A;  4Q76 A;  3CBF A;  4EB7 A;  1BJW A;  4WYC A;  3G0T A;  2GB3 A;  2QB3 A;  1O69 A;  1XEY A;  2PB2 A;  2C44 A;  3NUI A;  2Z9V A;  1BT4 A;  2ZSL A;  1AY5 A;  3EI8 A;  4AZJ A;  5G0A A;  1D7S A;  1OHV A;  2VLF A;  2BWO A;  3NX3 A;  5DJ1 A;  3WLX A;  2FNU A;  3BB8 A;  3MAF B;  5EIG B;  1CQ8 A;  2PB0 A; 
#chains in the Genus database with same CATH topology
 2ZC0 A;  1DGD A;  2BI3 A;  3B1D A;  3BC8 A;  4ZDO A;  1YIZ A;  2AY9 A;  2JG2 A;  3QBO A;  4WYD A;  3UE8 A;  5M4D A;  3EUC A;  1BQA A;  2E7I A;  1TOK A;  2JJE A;  1GD9 A;  2AY2 A;  2W8J A;  4N0W A;  4XQ2 A;  4E3Q A;  3AEP A;  3MAD A;  1ZOD A;  4K2M A;  3QGU A;  1JS3 A;  5TF5 A;  3B1C A;  4RLG A;  3WY7 A;  4P7Y A;  1SFF A;  1LC8 A;  1RV3 A;  2EGY A;  3A8U X;  3E6G A;  1B5P A;  2R5C A;  4RKD A;  4U1T A;  5EUE A;  1GBN A;  2VGW A;  3HVY A;  2W8T A;  4ITG A;  4TV7 A;  4ZAH A;  1V2F A;  1LW5 A;  5G09 A;  1G4V A;  4RIT A;  4RM1 A;  1C9C A;  3H7F A;  3NU8 A;  4BA4 A;  1ASM A;  4GDY A;  4W91 A;  3FVS A;  4JEZ A;  2AEV A;  2BHX A;  1ZOB A;  3P6K A;  3GZD C;  1T3I A;  4F5F A;  7AAT A;  1M4N A;  3PDB B;  2HP2 A;  3L8A A;  1WKG A;  2Z1Y A;  3JTX A;  4F5K A;  2GQN A;  1H0C A;  3FRK A;  1BW0 A;  4CXR A;  1BS0 A;  4P3M A;  2WK7 A;  3VK3 A;  3FQA A;  1S07 A;  1KL2 A;  2VIB A;  4LNM A;  2NMP A;  3A9X A;  4F5I A;  2OAT A;  5EAA A;  3AEO A;  4WLH A;  5M46 A;  1AKC A;  1C7O A;  1G7W A;  2AY7 A;  2HUU A;  3KE3 A;  4GE4 A;  2YKX A;  1QGN A;  4WYG A;  5DX5 A;  2W7I A;  3LV2 A;  1ARS A;  2VYC A;  2R2N A;  2Z9X A;  4OMA A;  4R5F A;  1SF2 A;  2CH1 A;  4OC9 A;  1YAA A;  3IHJ A;  3ASA A;  2OQX A;  1SVV A;  4JF0 A;  4RKC A;  1ART A;  3ZRQ A;  1VEF A;  4RJ0 A;  3VOM A;  3GZD A;  4XJM A;  2QSR A;  3JZL A;  4KYO A;  1ZC9 A;  4B9B A;  3H9X A;  2XBN A;  3I4J A;  1WKH A;  1AHE A;  2AY5 A;  2CJD A;  3ZZK A;  4AO4 A;  4CVQ A;  2D7Z A;  2JGT A;  1J04 A;  3LVJ A;  1AAM A;  2VGV A;  1E5E A;  3WX9 A;  4WXG A;  1AJR A;  2EZ2 A;  4Q75 A;  4WLJ A;  2D7Y A;  1ASE A;  5EFS A;  4MQP A;  3WZF A;  5BJ4 A;  3PGY A;  2ZUK A;  1W3U A;  4RAE A;  2FM1 A;  1MDO A;  2VLH A;  1PMO A;  5JAY A;  4OYT A;  2JIS A;  2BIA A;  1QJ5 A;  4ZSY A;  5M4B A;  1ASL A;  4Y0H A;  3RBL A;  3F6T A;  3HQT A;  5I92 A;  3G7Q A;  1D7V A;  3I5T A;  2EYQ A;  2R5C B;  2CB1 A;  1KKJ A;  2Z20 A;  2ZY2 A;  4DQ6 A;  3AOV A;  3ATH A;  2EZ1 A;  2FQ6 A;  4K2I A;  3ELE A;  2ZYJ A;  4IYO A;  4UHM A;  3JWB A;  1UU0 A;  5EUD A;  1OXP A;  1O4S A;  1I43 A;  2DGL A;  1BQD A;  1QIS A;  2Q7W A;  2YKU A;  4KXK A;  4DGT A;  1ARG A;  1ASA A;  2VMU A;  2HUF A;  1B5O A;  1AY4 A;  2BKW A;  4LNJ A;  3AEL A;  1U08 A;  1M0O A;  3USF A;  1AJS A;  4F5M A;  2EPJ A;  3PPL A;  2OKK A;  1I29 A;  1YIY A;  5HHY A;  4ZDP A;  1WYV A;  4ADE A;  3FKD A;  2D66 A;  3EZ1 A;  1YNU A;  4DBC A;  3GR9 A;  2VMO A;  3MEB A;  1UKJ A;  3PDX A;  2OKJ A;  3E2Y A;  5F8V A;  4ATP A;  2BWN A;  4IXZ A;  1M32 A;  2QMA A;  4ADD A;  3FZ7 A;  1BJN A;  1OAT A;  2D65 A;  4AH3 A;  3TCM A;  3CAI A;  1GC0 A;  5G4J A;  4JE5 D;  3HDO A;  4XJL A;  2CST A;  1DJU A;  4MY5 A;  4OBV A;  1AAW A;  3FQ8 A;  4HVK A;  2HZP A;  4ZSW A;  1N8P A;  2X3L A;  1TAR A;  2E54 A;  2D63 A;  3E2Z B;  1P3W A;  1MGV A;  4ZWV A;  4IXO A;  4A0R A;  4KAM A;  3UAK A;  3FZ8 A;  4E77 A;  1KL1 A;  1AMQ A;  2EH6 A;  3LY1 A;  2HOY A;  4F4E A;  3N5M A;  1AHF A;  1J32 A;  1ELU A;  1LKC A;  1W7N A;  4W5K A;  3FVX A;  3PJ0 A;  1OHY A;  3JU7 A;  3RI6 A;  4R5Z A;  4GE7 A;  4ADC A;  4EMY A;  2Z67 A;  3E9K A;  5E5I A;  3AEJ C;  1C7G A;  1PG8 A;  2GMU A;  4IXS A;  3Q8N A;  4JEW A;  2WB6 A;  2VMZ A;  4MQR A;  4BMK A;  5J8Q A;  3HL2 A;  1KMJ A;  4XEW A;  4TN4 A;  4WB0 A;  1VP4 A;  1C7N A;  1B4X A;  2V1P A;  5D95 A;  3WGC A;  4UQV A;  2TPL A;  4PIW A;  2CY8 A;  3TQX A;  4A72 A;  4EU1 A;  3BCB A;  2E7U A;  2D61 A;  2A1V A;  1LW4 A;  2JJG A;  2RFV A;  1WYU A;  2FN6 A;  4Q6R A;  3VK2 A;  3DR4 A;  3LVL B;  3DR7 A;  2QBT A;  2DOU A;  3PA9 A;  3WGB A;  3N4R A;  3QPG A;  1KKP A;  4A6U A;  2E7J A;  1M0Q A;  1LC7 A;  1X28 A;  1AJS B;  4W1V A;  3W1H A;  2YOB A;  1CJ0 A;  3AEJ A;  3RCH A;  1UU2 A;  1ARI A;  2ZP7 A;  2FKI A;  3EIA A;  3PAA A;  2DR1 A;  4F5J A;  4WYA A;  3ECD A;  4K2B A;  3MC6 C;  4ZWM A;  1TOE A;  1EG5 A;  1SZK A;  2W8V A;  4ISY A;  4JE5 A;  1QJ3 A;  1CZC A;  1JF9 A;  2WK8 A;  3R4T A;  3EIB A;  1M0N A;  4MKK A;  4RJY A;  4GEB A;  4TMR A;  3GSB A;  4WD2 A;  4XJP A;  2W7F A;  2VMX A;  1GDE A;  3WKS A;  2W7L A;  3QI6 A;  5DB5 A;  4OCA A;  5HXX A;  1GEW A;  4Y0D A;  3AEN A;  3NRA A;  3OKS A;  1MLY A;  4MSO A;  2QB2 A;  3L44 A;  1QIR A;  1DJE A;  2ZJG A;  3EI6 A;  4J5U A;  2HOX A;  1O62 A;  3FVU A;  3P1T A;  2CAN A;  3W1J A;  3DYD A;  1OXO A;  2EO5 A;  3R9A A;  4WYE A;  1WST A;  2R5E A;  5LH9 A;  4F5L A;  3QM2 A;  3N7N A;  2ZY3 A;  2C7T A;  1BJO A;  2VMQ A;  3MBB A;  3NUB A;  5DJ9 A;  2V0Y A;  4HF8 A;  3MC6 A;  1WYT A;  1IAY A;  1SZS A;  1TAS A;  2HUI A;  3ZRP A;  1AMA A;  1M0P A;  4FL0 A;  3BN1 A;  1Y4I A;  2AY1 A;  2AEU A;  2XH1 A;  3NDN A;  5G2P A;  5M49 A;  3II0 A;  4JEX A;  4JEY A;  2VMW A;  4GE9 A;  1AY8 A;  4PFF A;  4XK1 A;  1AIC A;  2WK9 A;  2W7E A;  2Z61 A;  3A9Z A;  3LWS A;  3K40 A;  1G4X A;  4BQ0 A;  3QN6 A;  4JF1 A;  1QIT A;  2BI1 A;  4A0G A;  3ASB A;  3K28 A;  4L0O A;  3QHX A;  2VGZ A;  2VMT A;  2QLR A;  2YCN A;  1GEX A;  3N0L A;  4A00 A;  3B46 A;  5F9S A;  1YJS A;  3FDD A;  3JWA A;  1CZE A;  1WYU B;  2Z1Z A;  5C6U A;  3N4X A;  2YCT A;  2W8W A;  3BCX A;  1RV4 A;  1MDX A;  4J8L A;  3N4S A;  1IX8 A;  3FD0 A;  1TPL A;  1X2A A;  3WCO A;  2VMN A;  3DU4 A;  4MGR A;  2C0R A;  4LW4 A;  3JW9 A;  3RCH B;  4ADB A;  5KTB A;  1CL2 A;  3VP6 A;  4UHN A;  3HT4 A;  4W8I A;  2HOZ A;  3NU7 A;  2W7K A;  4W1W A;  2G6W A;  4M2M A;  4CBS A;  2CJG A;  3PD6 A;  5FT5 A;  3CQ4 A;  3DC1 A;  3ISL A;  4I8A A;  1S08 A;  3GZC A;  4AZK A;  3MKJ A;  4IX8 A;  2BI9 A;  4EFF A;  1ELQ A;  1MAQ A;  2W7D A;  3KKI A;  4NOG A;  3AEN B;  2W7G A;  3FSL A;  1QZ9 A;  4WYF A;  4W1X A;  3ZZJ A;  4R8D A;  2O7C A;  4WXF A;  4OTL A;  2VIA A;  3A9Y A;  5LHA A;  1IAX A;  1N2T A;  1EJI A;  1CL1 A;  3FDB A;  5EQC A;  3COG A;  4AOA A;  1PFF A;  4ZM4 A;  1TOI A;  3DZZ A;  5FT4 A;  1AHG A;  1I41 A;  3G8M A;  3PDB A;  1SZU A;  4AO9 A;  4WP0 A;  2YKY A;  1DJ9 A;  1X29 A;  1AKA A;  2CJH A;  1M6S A;  2BYJ A;  3FZ6 A;  4ATQ A;  2HP1 A;  3TFU A;  1AKB A;  1BJO B;  1UU1 A;  4M2J A;  3GBX A;  2QA3 A;  3FQ7 A;  2WKA A;  1WYT B;  2D64 A;  1O61 A;  1KMK A;  2VMV A;  1W7M A;  5E4Z A;  4XAU A;  1E5F A;  2VGS A;  3TFT A;  1RVU A;  3RBF A;  3AV7 A;  4IY7 A;  1AHY A;  3UWC A;  3M5U A;  1IUG A;  1JS6 A;  4E1O A;  4ITX A;  1Z7D A;  3KGW A;  3N75 A;  3WCN A;  2G7J A;  1YJZ A;  1SPA A;  5EUN A;  2X5F A;  2CFB A;  5E3K A;  3KGX A;  2VGT A;  4ZM3 A;  1AHX A;  3NYS A;  5G2Q A;  2VGU A;  4LW2 A;  2DKJ A;  4EB5 A;  1I48 A;  1JG8 A;  4IYO B;  5AX8 A;  2GSA A;  1YOO A;  4ZDL A;  1H1C A;  1FC4 A;  1MDZ A;  3T32 A;  3F0H A;  2YRI A;  3CQ5 A;  4JEV A;  2OGE A;  1DKA A;  1GCK A;  1W7L A;  5IWQ A;  4XJO A;  1Z3Z A;  3E77 A;  4WBT A;  4ZAS A;  2CIN A;  2AAT A;  3HBX A;  4FFC A;  1W23 A;  2VI8 A;  4U2H A;  3H14 A;  3MAU A;  3VAX A;  3K7Y A;  1MAP A;  1OHW A;  1ORD A;  1TAT A;  1D7U A;  2VMY A;  2YKV A;  1WYV B;  3DOD A;  3BS8 A;  3GET A;  1DTY A;  1PMM A;  2C81 A;  2YCP A;  3DXV A;  4R2N A;  3PD6 B;  4ZLV A;  3PIU A;  1TOJ A;  1ASG A;  3ELP A;  3I16 A;  2BIG A;  1AIB A;  2VMP A;  2YRR A;  3AEM C;  3EZS A;  2OGA A;  3FFR A;  4Y0I A;  1M7Y A;  8AAT A;  2BWP A;  1D7R A;  4A0H A;  2CTZ A;  3FTB A;  4PFN A;  5EAV A;  3RQ1 A;  4A0F A;  4LNL A;  1RVY A;  4MQQ A;  1BKG A;  1YJY A;  2BIE A;  1XI9 A;  3E2F A;  5G4I A;  1LC5 A;  1B8G A;  1X0M A;  2AY4 A;  2Z9W A;  3RUY A;  3EI7 A;  1LK9 A;  4H63 Q;  3HLM A;  2GMS A;  4CBR A;  2ZY5 A;  1N31 A;  3NYU A;  2YHK A;  4GSA A;  4QGR A;  4OBU A;  4M2K A;  1GEY A;  1B9H A;  3FCR A;  3BV0 A;  4A6T A;  1G7X A;  1S09 A;  1MLZ A;  2VMR A;  3LG0 A;  3LVM A;  4Q31 A;  2O1B A;  5BJ3 A;  2CH2 A;  3AEM A;  1AIA A;  4CXQ A;  1ASF A;  3D6K A;  5FT8 A;  1DGE A;  3NYT A;  1FG3 A;  1D2F A;  1V2E A;  2DKB A;  2ZSM A;  3BWN C;  1AMR A;  2FNI A;  4N0B A;  1C4K A;  3CQ6 A;  4F5H A;  2ZY4 A;  4IW7 A;  1GC4 A;  3DRD A;  4RIZ A;  5HDM A;  3OP7 A;  4BHD A;  2VI9 A;  4B98 A;  4WB0 B;  1BJ4 A;  3DXW A;  3E2Z A;  1EQB A;  2JJH A;  3ACZ A;  1B9I A;  3B1E A;  1IJI A;  3ZRR A;  1VJO A;  3MAF A;  3VK4 A;  2AY3 A;  4MKJ A;  5EIG A;  3EI5 A;  3WKR A;  3GJU A;  4A6R A;  2D5Y A;  4BA5 A;  5D5S A;  1IBJ A;  2DGK A;  4OT8 A;  2F8J A;  1LS3 A;  3W1I A;  4H51 A;  1FG7 A;  4E3R A;  1CQ6 A;  1GC2 A;  1IX7 A;  1ASC A;  2KFP A;  1GC3 A;  2O0R A;  2W7H A;  3F9T A;  2JJF A;  3A2B A;  1S06 A;  3BWN A;  3GWP A;  1AX4 A;  1V2D A;  2BYL A;  3AAT A;  2PO3 A;  3NTJ A;  4WXB A;  1ASB A;  1V72 A;  2DGM A;  4PVF A;  2X8U A;  2FYF A;  2Z9U A;  1CS1 A;  3HMU A;  2X5D A;  1IX6 A;  1CQ7 A;  2W8U A;  4LC3 A;  1TOG A;  2BI5 A;  3NNK A;  2R0T A;  4O6Z A;  1S0A A;  1C0N A;  3FFH A;  3LVK A;  3BWO A;  3BCA A;  1ASD A;  9AAT A;  1IVR A;  1KAF A;  2AY6 A;  1AMS A;  5FT6 A;  1ASN A;  2AY8 A;  5K8B A;  3B8X A;  2W7M A;  3TAT A;  1ARH A;  2BI2 A;  4UOY A;  4UHO A;  2W7J A;  4GRX A;  2ORD A;  2VMS A;  3EI9 A;  4F5G A;  1DFO A;  2HOR A;  3IF2 A;  1ECX A;  3AOW A;  4Q76 A;  3CBF A;  4EB7 A;  1BJW A;  4WYC A;  3G0T A;  2GB3 A;  2QB3 A;  1O69 A;  1XEY A;  2PB2 A;  2C44 A;  3NUI A;  2Z9V A;  1BT4 A;  2ZSL A;  1AY5 A;  3EI8 A;  4AZJ A;  5G0A A;  1D7S A;  4K05 A;  1OHV A;  2VLF A;  2BWO A;  3NX3 A;  5DJ1 A;  3WLX A;  2FNU A;  3BB8 A;  3MAF B;  5EIG B;  1CQ8 A;  2PB0 A; 
#chains in the Genus database with same CATH homology
 2ZC0 A;  1DGD A;  2BI3 A;  3B1D A;  3BC8 A;  4ZDO A;  1YIZ A;  2AY9 A;  2JG2 A;  3QBO A;  4WYD A;  3UE8 A;  5M4D A;  3EUC A;  1BQA A;  2E7I A;  1TOK A;  2JJE A;  1GD9 A;  2AY2 A;  2W8J A;  4N0W A;  4XQ2 A;  4E3Q A;  3AEP A;  3MAD A;  1ZOD A;  4K2M A;  3QGU A;  1JS3 A;  5TF5 A;  3B1C A;  4RLG A;  3WY7 A;  4P7Y A;  1SFF A;  1LC8 A;  1RV3 A;  2EGY A;  3A8U X;  3E6G A;  1B5P A;  2R5C A;  4RKD A;  4U1T A;  5EUE A;  1GBN A;  2VGW A;  3HVY A;  2W8T A;  4ITG A;  4TV7 A;  4ZAH A;  1V2F A;  1LW5 A;  5G09 A;  1G4V A;  4RIT A;  4RM1 A;  1C9C A;  3H7F A;  3NU8 A;  4BA4 A;  1ASM A;  4GDY A;  4W91 A;  3FVS A;  4JEZ A;  2AEV A;  2BHX A;  1ZOB A;  3P6K A;  3GZD C;  1T3I A;  4F5F A;  7AAT A;  1M4N A;  3PDB B;  2HP2 A;  3L8A A;  1WKG A;  2Z1Y A;  3JTX A;  4F5K A;  2GQN A;  1H0C A;  3FRK A;  1BW0 A;  4CXR A;  1BS0 A;  4P3M A;  2WK7 A;  3VK3 A;  3FQA A;  1S07 A;  1KL2 A;  2VIB A;  4LNM A;  2NMP A;  3A9X A;  4F5I A;  2OAT A;  5EAA A;  3AEO A;  4WLH A;  5M46 A;  1AKC A;  1C7O A;  1G7W A;  2AY7 A;  2HUU A;  3KE3 A;  4GE4 A;  2YKX A;  1QGN A;  4WYG A;  5DX5 A;  2W7I A;  3LV2 A;  1ARS A;  2VYC A;  2R2N A;  2Z9X A;  4OMA A;  4R5F A;  1SF2 A;  2CH1 A;  4OC9 A;  1YAA A;  3IHJ A;  3ASA A;  2OQX A;  1SVV A;  4JF0 A;  4RKC A;  1ART A;  3ZRQ A;  1VEF A;  4RJ0 A;  3VOM A;  3GZD A;  4XJM A;  2QSR A;  3JZL A;  4KYO A;  1ZC9 A;  4B9B A;  3H9X A;  2XBN A;  3I4J A;  1WKH A;  1AHE A;  2AY5 A;  2CJD A;  3ZZK A;  4AO4 A;  4CVQ A;  2D7Z A;  2JGT A;  1J04 A;  3LVJ A;  1AAM A;  2VGV A;  1E5E A;  3WX9 A;  4WXG A;  1AJR A;  2EZ2 A;  4Q75 A;  4WLJ A;  2D7Y A;  1ASE A;  5EFS A;  4MQP A;  3WZF A;  5BJ4 A;  3PGY A;  2ZUK A;  1W3U A;  4RAE A;  2FM1 A;  1MDO A;  2VLH A;  1PMO A;  5JAY A;  4OYT A;  2JIS A;  2BIA A;  1QJ5 A;  4ZSY A;  5M4B A;  1ASL A;  4Y0H A;  3RBL A;  3F6T A;  3HQT A;  5I92 A;  3G7Q A;  1D7V A;  3I5T A;  2EYQ A;  2R5C B;  2CB1 A;  1KKJ A;  2Z20 A;  2ZY2 A;  4DQ6 A;  3AOV A;  3ATH A;  2EZ1 A;  2FQ6 A;  4K2I A;  3ELE A;  2ZYJ A;  4IYO A;  4UHM A;  3JWB A;  1UU0 A;  5EUD A;  1OXP A;  1O4S A;  1I43 A;  2DGL A;  1BQD A;  1QIS A;  2Q7W A;  2YKU A;  4KXK A;  4DGT A;  1ARG A;  1ASA A;  2VMU A;  2HUF A;  1B5O A;  1AY4 A;  2BKW A;  4LNJ A;  3AEL A;  1U08 A;  1M0O A;  3USF A;  1AJS A;  4F5M A;  2EPJ A;  3PPL A;  2OKK A;  1I29 A;  1YIY A;  5HHY A;  4ZDP A;  1WYV A;  4ADE A;  3FKD A;  2D66 A;  3EZ1 A;  1YNU A;  4DBC A;  3GR9 A;  2VMO A;  3MEB A;  1UKJ A;  3PDX A;  2OKJ A;  3E2Y A;  5F8V A;  4ATP A;  2BWN A;  4IXZ A;  1M32 A;  2QMA A;  4ADD A;  3FZ7 A;  1BJN A;  1OAT A;  2D65 A;  4AH3 A;  3TCM A;  3CAI A;  1GC0 A;  5G4J A;  4JE5 D;  3HDO A;  4XJL A;  2CST A;  1DJU A;  4MY5 A;  4OBV A;  1AAW A;  3FQ8 A;  4HVK A;  2HZP A;  4ZSW A;  1N8P A;  2X3L A;  1TAR A;  2E54 A;  2D63 A;  3E2Z B;  1P3W A;  1MGV A;  4ZWV A;  4IXO A;  4A0R A;  4KAM A;  3UAK A;  3FZ8 A;  4E77 A;  1KL1 A;  1AMQ A;  2EH6 A;  3LY1 A;  2HOY A;  4F4E A;  3N5M A;  1AHF A;  1J32 A;  1ELU A;  1LKC A;  1W7N A;  4W5K A;  3FVX A;  3PJ0 A;  1OHY A;  3JU7 A;  3RI6 A;  4R5Z A;  4GE7 A;  4ADC A;  4EMY A;  2Z67 A;  3E9K A;  5E5I A;  3AEJ C;  1C7G A;  1PG8 A;  2GMU A;  4IXS A;  3Q8N A;  4JEW A;  2WB6 A;  2VMZ A;  4MQR A;  4BMK A;  5J8Q A;  3HL2 A;  1KMJ A;  4XEW A;  4TN4 A;  4WB0 A;  1VP4 A;  1C7N A;  1B4X A;  2V1P A;  5D95 A;  3WGC A;  4UQV A;  2TPL A;  4PIW A;  2CY8 A;  3TQX A;  4A72 A;  4EU1 A;  3BCB A;  2E7U A;  2D61 A;  2A1V A;  1LW4 A;  2JJG A;  2RFV A;  1WYU A;  2FN6 A;  4Q6R A;  3VK2 A;  3DR4 A;  3LVL B;  3DR7 A;  2QBT A;  2DOU A;  3PA9 A;  3WGB A;  3N4R A;  3QPG A;  1KKP A;  4A6U A;  2E7J A;  1M0Q A;  1LC7 A;  1X28 A;  1AJS B;  4W1V A;  3W1H A;  2YOB A;  1CJ0 A;  3AEJ A;  3RCH A;  1UU2 A;  1ARI A;  2ZP7 A;  2FKI A;  3EIA A;  3PAA A;  2DR1 A;  4F5J A;  4WYA A;  3ECD A;  4K2B A;  3MC6 C;  4ZWM A;  1TOE A;  1EG5 A;  1SZK A;  2W8V A;  4ISY A;  4JE5 A;  1QJ3 A;  1CZC A;  1JF9 A;  2WK8 A;  3R4T A;  3EIB A;  1M0N A;  4MKK A;  4RJY A;  4GEB A;  4TMR A;  3GSB A;  4WD2 A;  4XJP A;  2W7F A;  2VMX A;  1GDE A;  3WKS A;  2W7L A;  3QI6 A;  5DB5 A;  4OCA A;  5HXX A;  1GEW A;  4Y0D A;  3AEN A;  3NRA A;  3OKS A;  1MLY A;  4MSO A;  2QB2 A;  3L44 A;  1QIR A;  1DJE A;  2ZJG A;  3EI6 A;  4J5U A;  2HOX A;  1O62 A;  3FVU A;  3P1T A;  2CAN A;  3W1J A;  3DYD A;  1OXO A;  2EO5 A;  3R9A A;  4WYE A;  1WST A;  2R5E A;  5LH9 A;  4F5L A;  3QM2 A;  3N7N A;  2ZY3 A;  2C7T A;  1BJO A;  2VMQ A;  3MBB A;  3NUB A;  5DJ9 A;  2V0Y A;  4HF8 A;  3MC6 A;  1WYT A;  1IAY A;  1SZS A;  1TAS A;  2HUI A;  3ZRP A;  1AMA A;  1M0P A;  4FL0 A;  3BN1 A;  1Y4I A;  2AY1 A;  2AEU A;  2XH1 A;  3NDN A;  5G2P A;  5M49 A;  3II0 A;  4JEX A;  4JEY A;  2VMW A;  4GE9 A;  1AY8 A;  4PFF A;  4XK1 A;  1AIC A;  2WK9 A;  2W7E A;  2Z61 A;  3A9Z A;  3LWS A;  3K40 A;  1G4X A;  4BQ0 A;  3QN6 A;  4JF1 A;  1QIT A;  2BI1 A;  4A0G A;  3ASB A;  3K28 A;  4L0O A;  3QHX A;  2VGZ A;  2VMT A;  2QLR A;  2YCN A;  1GEX A;  3N0L A;  4A00 A;  3B46 A;  5F9S A;  1YJS A;  3FDD A;  3JWA A;  1CZE A;  1WYU B;  2Z1Z A;  5C6U A;  3N4X A;  2YCT A;  2W8W A;  3BCX A;  1RV4 A;  1MDX A;  4J8L A;  3N4S A;  1IX8 A;  3FD0 A;  1TPL A;  1X2A A;  3WCO A;  2VMN A;  3DU4 A;  4MGR A;  2C0R A;  4LW4 A;  3JW9 A;  3RCH B;  4ADB A;  5KTB A;  1CL2 A;  3VP6 A;  4UHN A;  3HT4 A;  4W8I A;  2HOZ A;  3NU7 A;  2W7K A;  4W1W A;  2G6W A;  4M2M A;  4CBS A;  2CJG A;  3PD6 A;  5FT5 A;  3CQ4 A;  3DC1 A;  3ISL A;  4I8A A;  1S08 A;  3GZC A;  4AZK A;  3MKJ A;  4IX8 A;  2BI9 A;  4EFF A;  1ELQ A;  1MAQ A;  2W7D A;  3KKI A;  4NOG A;  3AEN B;  2W7G A;  3FSL A;  1QZ9 A;  4WYF A;  4W1X A;  3ZZJ A;  4R8D A;  2O7C A;  4WXF A;  4OTL A;  2VIA A;  3A9Y A;  5LHA A;  1IAX A;  1N2T A;  1EJI A;  1CL1 A;  3FDB A;  5EQC A;  3COG A;  4AOA A;  1PFF A;  4ZM4 A;  1TOI A;  3DZZ A;  5FT4 A;  1AHG A;  1I41 A;  3G8M A;  3PDB A;  1SZU A;  4AO9 A;  4WP0 A;  2YKY A;  1DJ9 A;  1X29 A;  1AKA A;  2CJH A;  1M6S A;  2BYJ A;  3FZ6 A;  4ATQ A;  2HP1 A;  3TFU A;  1AKB A;  1BJO B;  1UU1 A;  4M2J A;  3GBX A;  2QA3 A;  3FQ7 A;  2WKA A;  1WYT B;  2D64 A;  1O61 A;  1KMK A;  2VMV A;  1W7M A;  5E4Z A;  4XAU A;  1E5F A;  2VGS A;  3TFT A;  1RVU A;  3RBF A;  3AV7 A;  4IY7 A;  1AHY A;  3UWC A;  3M5U A;  1IUG A;  1JS6 A;  4E1O A;  4ITX A;  1Z7D A;  3KGW A;  3N75 A;  3WCN A;  2G7J A;  1YJZ A;  1SPA A;  5EUN A;  2X5F A;  2CFB A;  5E3K A;  3KGX A;  2VGT A;  4ZM3 A;  1AHX A;  3NYS A;  5G2Q A;  2VGU A;  4LW2 A;  2DKJ A;  4EB5 A;  1I48 A;  1JG8 A;  4IYO B;  5AX8 A;  2GSA A;  1YOO A;  4ZDL A;  1H1C A;  1FC4 A;  1MDZ A;  3T32 A;  3F0H A;  2YRI A;  3CQ5 A;  4JEV A;  2OGE A;  1DKA A;  1GCK A;  1W7L A;  5IWQ A;  4XJO A;  1Z3Z A;  3E77 A;  4WBT A;  4ZAS A;  2CIN A;  2AAT A;  3HBX A;  4FFC A;  1W23 A;  2VI8 A;  4U2H A;  3H14 A;  3MAU A;  3VAX A;  3K7Y A;  1MAP A;  1OHW A;  1ORD A;  1TAT A;  1D7U A;  2VMY A;  2YKV A;  1WYV B;  3DOD A;  3BS8 A;  3GET A;  1DTY A;  1PMM A;  2C81 A;  2YCP A;  3DXV A;  4R2N A;  3PD6 B;  4ZLV A;  3PIU A;  1TOJ A;  1ASG A;  3ELP A;  3I16 A;  2BIG A;  1AIB A;  2VMP A;  2YRR A;  3AEM C;  3EZS A;  2OGA A;  3FFR A;  4Y0I A;  1M7Y A;  8AAT A;  2BWP A;  1D7R A;  4A0H A;  2CTZ A;  3FTB A;  4PFN A;  5EAV A;  3RQ1 A;  4A0F A;  4LNL A;  1RVY A;  4MQQ A;  1BKG A;  1YJY A;  2BIE A;  1XI9 A;  3E2F A;  5G4I A;  1LC5 A;  1B8G A;  1X0M A;  2AY4 A;  2Z9W A;  3RUY A;  3EI7 A;  1LK9 A;  4H63 Q;  3HLM A;  2GMS A;  4CBR A;  2ZY5 A;  1N31 A;  3NYU A;  2YHK A;  4GSA A;  4QGR A;  4OBU A;  4M2K A;  1GEY A;  1B9H A;  3FCR A;  3BV0 A;  4A6T A;  1G7X A;  1S09 A;  1MLZ A;  2VMR A;  3LG0 A;  3LVM A;  4Q31 A;  2O1B A;  5BJ3 A;  2CH2 A;  3AEM A;  1AIA A;  4CXQ A;  1ASF A;  3D6K A;  5FT8 A;  1DGE A;  3NYT A;  1FG3 A;  1D2F A;  1V2E A;  2DKB A;  2ZSM A;  3BWN C;  1AMR A;  2FNI A;  4N0B A;  1C4K A;  3CQ6 A;  4F5H A;  2ZY4 A;  4IW7 A;  1GC4 A;  3DRD A;  4RIZ A;  5HDM A;  3OP7 A;  4BHD A;  2VI9 A;  4B98 A;  4WB0 B;  1BJ4 A;  3DXW A;  3E2Z A;  1EQB A;  2JJH A;  3ACZ A;  1B9I A;  3B1E A;  1IJI A;  3ZRR A;  1VJO A;  3MAF A;  3VK4 A;  2AY3 A;  4MKJ A;  5EIG A;  3EI5 A;  3WKR A;  3GJU A;  4A6R A;  2D5Y A;  4BA5 A;  5D5S A;  1IBJ A;  2DGK A;  4OT8 A;  2F8J A;  1LS3 A;  3W1I A;  4H51 A;  1FG7 A;  4E3R A;  1CQ6 A;  1GC2 A;  1IX7 A;  1ASC A;  2KFP A;  1GC3 A;  2O0R A;  2W7H A;  3F9T A;  2JJF A;  3A2B A;  1S06 A;  3BWN A;  3GWP A;  1AX4 A;  1V2D A;  2BYL A;  3AAT A;  2PO3 A;  3NTJ A;  4WXB A;  1ASB A;  1V72 A;  2DGM A;  4PVF A;  2X8U A;  2FYF A;  2Z9U A;  1CS1 A;  3HMU A;  2X5D A;  1IX6 A;  1CQ7 A;  2W8U A;  4LC3 A;  1TOG A;  2BI5 A;  3NNK A;  2R0T A;  4O6Z A;  1S0A A;  1C0N A;  3FFH A;  3LVK A;  3BWO A;  3BCA A;  1ASD A;  9AAT A;  1IVR A;  2AY6 A;  1AMS A;  5FT6 A;  1ASN A;  2AY8 A;  5K8B A;  3B8X A;  2W7M A;  3TAT A;  1ARH A;  2BI2 A;  4UOY A;  4UHO A;  2W7J A;  4GRX A;  2ORD A;  2VMS A;  3EI9 A;  4F5G A;  1DFO A;  2HOR A;  3IF2 A;  1ECX A;  3AOW A;  4Q76 A;  3CBF A;  4EB7 A;  1BJW A;  4WYC A;  3G0T A;  2GB3 A;  2QB3 A;  1O69 A;  1XEY A;  2PB2 A;  2C44 A;  3NUI A;  2Z9V A;  1BT4 A;  2ZSL A;  1AY5 A;  3EI8 A;  4AZJ A;  5G0A A;  1D7S A;  4K05 A;  1OHV A;  2VLF A;  2BWO A;  3NX3 A;  5DJ1 A;  3WLX A;  2FNU A;  3BB8 A;  3MAF B;  5EIG B;  1CQ8 A;  2PB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...