4JF9A

Crystal structure of the wild type red fluorescent protein lanrfp (branchiostoma lanceolatum)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
217
structure length
216
Chain Sequence
SPLPATHDLHISGSINGHEFDLEGSGKGNAKEGYQELHLKSNKGDLSFSPWILVPNIFYQYLPFPDGAMSPYQAAMHDGSGYVMHRSMQFEDGAMLHSDHRYIYKGNHIKGEFRLTGSGFPADGPVMTNSLTAADWCVDKLLYPNDNTIIGKFDWTYTTTSGKRYQSDVQTNVTFGKPIAADILKKQPMFVFRKVELKHTKTELNFKQWQKAFQDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Red fluorescent protein blFP-R5
publication title Structure of the red fluorescent protein from a lancelet (Branchiostoma lanceolatum): a novel GYG chromophore covalently bound to a nearby tyrosine.
pubmed doi rcsb
source organism Branchiostoma lanceolatum
molecule tags Fluorescent protein
total genus 64
structure length 216
sequence length 217
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 4jf9A00
2YDZA 3AKOA 4RYWA 4TZGA 1KYRA 5HBDA 5DPIA 2B3PA 5F9GA 2C9IA 3KCSA 1F09A 2IE2A 2EMOA 2PXSA 1XMZA 4W72A 4JEOA 4JGEA 4GOBA 2OTEA 3DQIA 2YE1A 4Q9XA 5DQMA 1Q4DA 2OTBA 4ZF4A 1S6ZA 2EMDA 1RMMA 1QYFA 2G6YA 4ANJA 3NF0A 5DPGA 3ADFA 2DUFA 4Z4MA 3DQ4A 4KEXA 4W6MA 3U0KA 2QLGB 2A54B 3BX9A 4HVFA 1JBZA 4GF6B 2HQZA 3CD1A 1JC0A 4ORNA 3BXBA 4B30A 2H5PA 3CD9A 3EK4A 5HZOA 1H4UA 2A56B 3EVRA 3W1CA 2H6VA 1EMGA 1W7TA 4KA9A 1EMMA 4W73A 2AH8A 1GFLA 4W69A 3SSKA 5DQBA 3CFAA 2GW3A 1CV7A 2H8QA 4KPIA 1Q4AA 4ZBLA 4W7XA 4KW4A 3NT3A 3LVCA 4DXPA 2FWQA 5LK4A 4W7AA 2ZMWA 4R6BA 3DQLA 3DPXA 3SSLA 3OSQA 4AR7A 4IK8A 4N3DA 5DTZA 1ZGQA 3SSPA 5FHVA 4DXQA 1W7UA 4DXOA 2VADA 4OY4A 1KYSA 2VVJA 1ZUXA 4ZB1A 4ZINA 4PPLA 3EVVA 2ICRA 3RWTA 1YZWA 2A50B 4KGFA 3DPWA 2DUEA 3DQHA 3GJ2A 5BTTA 2DUGA 1EMFA 1QYOA 3DQMA 1QYQA 4W6DA 3EVUA 2GW4B 3PJBA 4W6HA 2IOVA 3DQEA 4OQWA 1OXFA 3UG0A 2Z1OA 3SSVA 3ST0A 4W75A 4IK4A 3SVNA 2Z6YA 4P1QA 3IP2A 4W6AA 3LSAA 2IB5A 1W7SA 3ZUJA 1RMPA 2HRSA 3O77A 1OXDA 3DQCA 3SG4A 4IK5A 4KW9A 3SV5A 4LQUA 2V4EB 1YJFA 2ZMUA 3DQDA 4KF5C 3VK1A 4W77A 3E5WA 2WHSA 3ZULA 2C9JA 3SS0A 4ZIOA 2O24A 2OKWA 3MGFA 3K1KA 2QLIA 4W6OA 2G3OA 4XOVA 4H3NA 5BT0A 4ZFSA 2AWJA 2AWKA 5DRFA 4EN1A 4KGEA 5FVIA 2QU1A 3DQ2A 4XL5A 1HCJA 2HFCA 5HZUA 5FVGA 3CBEA 5DPHA 1C4FA 2ZO6A 2A48A 3DQ1A 3VHTA 2G6EA 4KF5A 3SRYA 4DKNA 4AS8A 1Q4BA 4W74A 2VVIA 2HQKA 4L12A 3EKJA 4UTSA 4GESB 2RH7A 1QY3A 4W6JA 1EMAA 2WISA 3PJ7A 3DQAA 3DQ5A 4LW5A 2YE0A 3NEZA 3SG7A 2QT2A 1B9CA 2WURA 2G3DB 5HW9A 4OHSA 3DQ6A 4W6GA 2G16B 3LVDA 1ZGOA 4W7DA 1XA9A 2P4MA 2YFPA 3WLDA 3ZUFA 4Q7TA 3UFZA 5H87A 4Q7UA 3SVDA 4ZF3A 3CFFA 1GGXA 4H48A 4W6BA 3DPZA 3GB3A 4W7EA 2G2SB 1RRXA 3OGOA 4DXNA 2AWLA 2OJKA 4XOWA 4Q7RA 3SG2A 2Q57A 1ZGPA 3EVPA 3SSTA 3SVEA 2A47A 3ED8A 1H6RA 4IK1A 1Q4CA 3BXAA 4J88A 1GL4A 3M22A 4EDOA 1JBYA 5H89A 4PPKA 4IZNA 5EXUA 2AHAA 4LJDC 3SG3A 5EB6A 3DQKA 3U0NA 2A53B 2DD9A 4H3MA 5DU0A 3I19A 3NEDA 5DY6A 5FVFA 3AI4A 4XGYA 4LJCA 2DD7A 3LS3A 3GJ1A 2EMNA 5HZSA 3P8UA 4XVPA 2WSNA 4RYSA 2WIQA 2PXWA 3G9AA 5DPJA 4J89A 4W6CA 5J2OA 2WHTA 1JC1A 4LJDA 4ZF5A 4B30B 1EMKA 4R6DA 5BQLA 2QLGA 3VICA 2H5OA 5DTLA 1MYWA 3CGLA 5H88A 2DUIA 4W7CA 5EXBA 2Q6PA 4HE4A 3EK7A 3DQNA 3ZTFA 3SG6A 3U8CA 3ST4A 4H3LA 2H5QA 1YJ2A 4W6LA 4KF4A 5KTGA 3WLCA 3RWAA 3U8AA 4DXMA 4J8AA 3ST2A 1MOUA 3V3DA 4BDUA 3LA1A 4W6NA 3H1OA 4Z4KA 4W6IA 4EDSA 2DDDA 4DXIA 1BFPA 3AI5A 5EB7A 3SVUA 1UISA 4HQCA 3DQUA 1Q4EA 2G6XA 5DTYA 3SVBA 2HJOA 3SVSA 4EMQA 2BTJA 5BTTB 2WHUA 3EKHA 3SVRA 4HQ8A 1KYPA 3OSRA 2A52B 2H5RA 3LF3A 3W1DA 5AQBB 3E5TA 4W6TA 3TMRA 2A46A 2HGYA 4KW8A 1QXTA 3SVOA 4KAGA 4W6KA 3EK8A 5LTPA 1KP5A 1XAEA 3U8PA 2AWMA 3P28A 4W6RA 1YFPA 3DQ8A 2V4EC 3BXCA 3GL4A 3ST3A 1F0BA 1YHGA 3M24A 1Z1QA 5EXCI 3WCKA 4EULA 3O78A 3PIBA 2QZ0A 2ARLA 1RMOA 4TZAA 3GEXA 4JF9A 5HZTA 1EMBA 1Q73A 2JADA 3DQFA 2Z6XA 5EHUA 4U2VA 1EMEA 2VVHA 3DQ7A 5DTXA 5HGEA 3PJ5A 3SSYA 2V4EA 4JC2A 4RTCA 2QRFA 4IK9A 1XSSA 4L13A 2QLHA 3VHTB 3DQJA 4JRBA 4OGSA 2IB6A 3TMTA 2O29A 3IR8A 2HGDA 5DRGA 2WSOA 2DUHA 1MOVA 3KCTA 4HQ9A 3H1RA 4LQTA 1RM9A 4B5YA 2OGRA 3SSHA 3A8SA 1Z1PA 2DDCA 2O2BA 2FZUA 4JFGA 3U0MA 2Z6ZA 5EJUA 1EMCA 2FL1A 2OKYA 3SVCA 1G7KA 4W7FA 2VAEA 2GX2A 4W7RA 1YHHA 2GX0A 5T3IA 4DKMA 4W6SA 3U0LA 3DQ3A 2H9WA 2QLEA 4Q9WA 3DQOA 3LF4B 4PPJA 5EBJA 2VZXA 5LTRA 3E5VA 4L1IA 1HUYA 4W6FA 3S05A 4I2YA 2Y0GA 2POXA 4P76A 4W76A 1EMLA 3CFHA 4W6PA 3DQ9A 5LTQA 3SG5A 4IK3A 4H47A 3CB9A 3LVAA 4LJBA 4NWSA 4W6UA 1XQMA 2G5ZB 4PFEA 3NT9A 2HPWA 2HCGA 1OXEA 4OJ0A 2ZO7A 2B3QA 1YHIA
chains in the Genus database with same CATH superfamily
2YDZA 3AKOA 4RYWA 4TZGA 1KYRA 5HBDA 5DPIA 2B3PA 5F9GA 2C9IA 3KCSA 1F09A 2IE2A 2EMOA 2PXSA 1XMZA 4W72A 4JEOA 4JGEA 4GOBA 2OTEA 3DQIA 2YE1A 4Q9XA 5DQMA 1Q4DA 2OTBA 4ZF4A 1S6ZA 2EMDA 1RMMA 1QYFA 2G6YA 4ANJA 3NF0A 5DPGA 3ADFA 2DUFA 4Z4MA 3DQ4A 4KEXA 4W6MA 3U0KA 2QLGB 2A54B 3BX9A 4HVFA 1JBZA 4GF6B 2HQZA 3CD1A 1JC0A 4ORNA 3BXBA 4B30A 2H5PA 3CD9A 3EK4A 5HZOA 1H4UA 2A56B 3EVRA 3W1CA 2H6VA 1EMGA 1W7TA 4KA9A 1EMMA 4W73A 2AH8A 1GFLA 4W69A 3SSKA 5DQBA 3CFAA 2GW3A 1CV7A 2H8QA 4KPIA 1Q4AA 4ZBLA 4W7XA 4KW4A 3NT3A 3LVCA 4DXPA 2FWQA 5LK4A 4W7AA 2ZMWA 4R6BA 3DQLA 3DPXA 3SSLA 3OSQA 4AR7A 4IK8A 4N3DA 5DTZA 1ZGQA 3SSPA 5FHVA 4DXQA 1W7UA 4DXOA 2VADA 4OY4A 1KYSA 2VVJA 1ZUXA 4ZB1A 4ZINA 4PPLA 3EVVA 2ICRA 3RWTA 1YZWA 2A50B 4KGFA 3DPWA 2DUEA 3DQHA 3GJ2A 5BTTA 2DUGA 1EMFA 1QYOA 3DQMA 1QYQA 4W6DA 3EVUA 2GW4B 3PJBA 4W6HA 2IOVA 3DQEA 4OQWA 1OXFA 3UG0A 2Z1OA 3SSVA 3ST0A 4W75A 4IK4A 3SVNA 2Z6YA 4P1QA 3IP2A 4W6AA 3LSAA 2IB5A 1W7SA 3ZUJA 1RMPA 2HRSA 3O77A 1OXDA 3DQCA 3SG4A 4IK5A 4KW9A 3SV5A 4LQUA 2V4EB 1YJFA 2ZMUA 3DQDA 4KF5C 3VK1A 4W77A 3E5WA 2WHSA 3ZULA 2C9JA 3SS0A 4ZIOA 2O24A 2OKWA 3MGFA 3K1KA 2QLIA 4W6OA 2G3OA 4XOVA 4H3NA 5BT0A 4ZFSA 2AWJA 2AWKA 5DRFA 4EN1A 4KGEA 5FVIA 2QU1A 3DQ2A 4XL5A 1HCJA 2HFCA 5HZUA 5FVGA 3CBEA 5DPHA 1C4FA 2ZO6A 2A48A 3DQ1A 3VHTA 2G6EA 4KF5A 3SRYA 4DKNA 4AS8A 1Q4BA 4W74A 2VVIA 2HQKA 4L12A 3EKJA 4UTSA 4GESB 2RH7A 1QY3A 4W6JA 1EMAA 2WISA 3PJ7A 3DQAA 3DQ5A 4LW5A 2YE0A 3NEZA 3SG7A 2QT2A 1B9CA 2WURA 2G3DB 5HW9A 4OHSA 3DQ6A 4W6GA 2G16B 3LVDA 1ZGOA 4W7DA 1XA9A 2P4MA 2YFPA 3WLDA 3ZUFA 4Q7TA 3UFZA 5H87A 4Q7UA 3SVDA 4ZF3A 3CFFA 1GGXA 4H48A 4W6BA 3DPZA 3GB3A 4W7EA 2G2SB 1RRXA 3OGOA 4DXNA 2AWLA 2OJKA 4XOWA 4Q7RA 3SG2A 2Q57A 1ZGPA 3EVPA 3SSTA 3SVEA 2A47A 3ED8A 1H6RA 4IK1A 1Q4CA 3BXAA 4J88A 1GL4A 3M22A 4EDOA 1JBYA 5H89A 4PPKA 4IZNA 5EXUA 2AHAA 4LJDC 3SG3A 5EB6A 3DQKA 3U0NA 2A53B 2DD9A 4H3MA 5DU0A 3I19A 3NEDA 5DY6A 5FVFA 3AI4A 4XGYA 4LJCA 2DD7A 3LS3A 3GJ1A 2EMNA 5HZSA 3P8UA 4XVPA 2WSNA 4RYSA 2WIQA 2PXWA 3G9AA 5DPJA 4J89A 4W6CA 5J2OA 2WHTA 1JC1A 4LJDA 4ZF5A 4B30B 1EMKA 4R6DA 5BQLA 2QLGA 3VICA 2H5OA 5DTLA 1MYWA 3CGLA 5H88A 2DUIA 4W7CA 5EXBA 2Q6PA 4HE4A 3EK7A 3DQNA 3ZTFA 3SG6A 3U8CA 3ST4A 4H3LA 2H5QA 1YJ2A 4W6LA 4KF4A 5KTGA 3WLCA 3RWAA 3U8AA 4DXMA 4J8AA 3ST2A 1MOUA 3V3DA 4BDUA 3LA1A 4W6NA 3H1OA 4Z4KA 4W6IA 4EDSA 2DDDA 4DXIA 1BFPA 3AI5A 5EB7A 3SVUA 1UISA 4HQCA 3DQUA 1Q4EA 2G6XA 5DTYA 3SVBA 2HJOA 3SVSA 4EMQA 2BTJA 5BTTB 2WHUA 3EKHA 3SVRA 4HQ8A 1KYPA 3OSRA 2A52B 2H5RA 3LF3A 3W1DA 5AQBB 3E5TA 4W6TA 3TMRA 2A46A 2HGYA 4KW8A 1QXTA 3SVOA 4KAGA 4W6KA 3EK8A 5LTPA 1KP5A 1XAEA 3U8PA 2AWMA 3P28A 4W6RA 1YFPA 3DQ8A 2V4EC 3BXCA 3GL4A 3ST3A 1F0BA 1YHGA 3M24A 1Z1QA 5EXCI 3WCKA 4EULA 3O78A 3PIBA 2QZ0A 2ARLA 1RMOA 4TZAA 3GEXA 4JF9A 5HZTA 1EMBA 1Q73A 2JADA 3DQFA 2Z6XA 5EHUA 4U2VA 1EMEA 2VVHA 3DQ7A 5DTXA 5HGEA 3PJ5A 3SSYA 2V4EA 4JC2A 4RTCA 2QRFA 4IK9A 1XSSA 4L13A 2QLHA 3VHTB 3DQJA 4JRBA 4OGSA 2IB6A 3TMTA 2O29A 3IR8A 2HGDA 5DRGA 2WSOA 2DUHA 1MOVA 3KCTA 4HQ9A 3H1RA 4LQTA 1RM9A 4B5YA 2OGRA 3SSHA 3A8SA 1Z1PA 2DDCA 2O2BA 2FZUA 4JFGA 3U0MA 2Z6ZA 5EJUA 1EMCA 2FL1A 2OKYA 3SVCA 1G7KA 4W7FA 2VAEA 2GX2A 4W7RA 1YHHA 2GX0A 5T3IA 4DKMA 4W6SA 3U0LA 3DQ3A 2H9WA 2QLEA 4Q9WA 3DQOA 3LF4B 4PPJA 5EBJA 2VZXA 5LTRA 3E5VA 4L1IA 1HUYA 4W6FA 3S05A 4I2YA 2Y0GA 2POXA 4P76A 4W76A 1EMLA 3CFHA 4W6PA 3DQ9A 5LTQA 3SG5A 4IK3A 4H47A 3CB9A 3LVAA 4LJBA 4NWSA 4W6UA 1XQMA 2G5ZB 4PFEA 3NT9A 2HPWA 2HCGA 1OXEA 4OJ0A 2ZO7A 2B3QA 1YHIA
chains in the Genus database with same CATH topology
2YDZA 3AKOA 4RYWA 4TZGA 1KYRA 5HBDA 5DPIA 2B3PA 5F9GA 2C9IA 3KCSA 1F09A 2IE2A 2EMOA 2PXSA 1XMZA 4W72A 4JEOA 4JGEA 4GOBA 2OTEA 3DQIA 2YE1A 4Q9XA 5DQMA 1Q4DA 2OTBA 4ZF4A 1S6ZA 2EMDA 1RMMA 1QYFA 2G6YA 4ANJA 3NF0A 5DPGA 3ADFA 2DUFA 4Z4MA 3DQ4A 4KEXA 4W6MA 3U0KA 2QLGB 2A54B 3BX9A 4HVFA 1JBZA 4GF6B 2HQZA 3CD1A 1JC0A 4ORNA 3BXBA 4B30A 2H5PA 3CD9A 3EK4A 5HZOA 1H4UA 2A56B 3EVRA 3W1CA 2H6VA 1EMGA 1W7TA 4KA9A 1EMMA 4W73A 2AH8A 1GFLA 4W69A 3SSKA 5DQBA 3CFAA 2GW3A 1CV7A 2H8QA 4KPIA 1Q4AA 4ZBLA 4W7XA 4KW4A 3NT3A 3LVCA 4DXPA 2FWQA 5LK4A 4W7AA 2ZMWA 4R6BA 3DQLA 3DPXA 3SSLA 3OSQA 4AR7A 4IK8A 4N3DA 5DTZA 1ZGQA 3SSPA 5FHVA 4DXQA 1W7UA 4DXOA 2VADA 4OY4A 1KYSA 2VVJA 1ZUXA 4ZB1A 4ZINA 4PPLA 3EVVA 2ICRA 3RWTA 1YZWA 2A50B 4KGFA 3DPWA 2DUEA 3DQHA 3GJ2A 5BTTA 2DUGA 1EMFA 1QYOA 3DQMA 1QYQA 4W6DA 3EVUA 2GW4B 3PJBA 4W6HA 2IOVA 3DQEA 4OQWA 1OXFA 3UG0A 2Z1OA 3SSVA 3ST0A 4W75A 4IK4A 3SVNA 2Z6YA 4P1QA 3IP2A 4W6AA 3LSAA 2IB5A 1W7SA 3ZUJA 1RMPA 2HRSA 3O77A 1OXDA 3DQCA 3SG4A 4IK5A 4KW9A 3SV5A 4LQUA 2V4EB 1YJFA 2ZMUA 3DQDA 4KF5C 3VK1A 4W77A 3E5WA 2WHSA 3ZULA 2C9JA 3SS0A 4ZIOA 2O24A 2OKWA 3MGFA 3K1KA 2QLIA 4W6OA 2G3OA 4XOVA 4H3NA 5BT0A 4ZFSA 2AWJA 2AWKA 5DRFA 4EN1A 4KGEA 5FVIA 2QU1A 3DQ2A 4XL5A 1HCJA 2HFCA 5HZUA 5FVGA 3CBEA 5DPHA 1C4FA 2ZO6A 2A48A 3DQ1A 3VHTA 2G6EA 4KF5A 3SRYA 4DKNA 4AS8A 1Q4BA 4W74A 2VVIA 2HQKA 4L12A 3EKJA 4UTSA 4GESB 2RH7A 1QY3A 4W6JA 1EMAA 2WISA 3PJ7A 3DQAA 3DQ5A 4LW5A 2YE0A 3NEZA 3SG7A 2QT2A 1B9CA 2WURA 2G3DB 5HW9A 4OHSA 3DQ6A 4W6GA 2G16B 3LVDA 1ZGOA 4W7DA 1XA9A 2P4MA 2YFPA 3WLDA 3ZUFA 4Q7TA 3UFZA 5H87A 4Q7UA 3SVDA 4ZF3A 3CFFA 1GGXA 4H48A 4W6BA 3DPZA 3GB3A 4W7EA 2G2SB 1RRXA 3OGOA 4DXNA 2AWLA 2OJKA 4XOWA 4Q7RA 3SG2A 2Q57A 1ZGPA 3EVPA 3SSTA 3SVEA 2A47A 3ED8A 1H6RA 4IK1A 1Q4CA 3BXAA 4J88A 1GL4A 3M22A 4EDOA 1JBYA 5H89A 4PPKA 4IZNA 5EXUA 2AHAA 4LJDC 3SG3A 5EB6A 3DQKA 3U0NA 2A53B 2DD9A 4H3MA 5DU0A 3I19A 3NEDA 5DY6A 5FVFA 3AI4A 4XGYA 4LJCA 2DD7A 3LS3A 3GJ1A 2EMNA 5HZSA 3P8UA 4XVPA 2WSNA 4RYSA 2WIQA 2PXWA 3G9AA 5DPJA 4J89A 4W6CA 5J2OA 2WHTA 1JC1A 4LJDA 4ZF5A 4B30B 1EMKA 4R6DA 5BQLA 2QLGA 3VICA 2H5OA 5DTLA 1MYWA 3CGLA 5H88A 2DUIA 4W7CA 5EXBA 2Q6PA 4HE4A 3EK7A 3DQNA 3ZTFA 3SG6A 3U8CA 3ST4A 4H3LA 2H5QA 1YJ2A 4W6LA 4KF4A 5KTGA 3WLCA 3RWAA 3U8AA 4DXMA 4J8AA 3ST2A 1MOUA 3V3DA 4BDUA 3LA1A 4W6NA 3H1OA 4Z4KA 4W6IA 4EDSA 2DDDA 4DXIA 1BFPA 3AI5A 5EB7A 3SVUA 1UISA 4HQCA 3DQUA 1Q4EA 2G6XA 5DTYA 3SVBA 2HJOA 3SVSA 4EMQA 2BTJA 5BTTB 2WHUA 3EKHA 3SVRA 4HQ8A 1KYPA 3OSRA 2A52B 2H5RA 3LF3A 3W1DA 5AQBB 3E5TA 4W6TA 3TMRA 2A46A 2HGYA 4KW8A 1QXTA 3SVOA 4KAGA 4W6KA 3EK8A 5LTPA 1KP5A 1XAEA 3U8PA 2AWMA 3P28A 4W6RA 1YFPA 3DQ8A 2V4EC 3BXCA 3GL4A 3ST3A 1F0BA 1YHGA 3M24A 1Z1QA 5EXCI 3WCKA 4EULA 3O78A 3PIBA 2QZ0A 2ARLA 1RMOA 4TZAA 3GEXA 4JF9A 5HZTA 1EMBA 1Q73A 2JADA 3DQFA 2Z6XA 5EHUA 4U2VA 1EMEA 2VVHA 3DQ7A 5DTXA 5HGEA 3PJ5A 3SSYA 2V4EA 4JC2A 4RTCA 2QRFA 4IK9A 1XSSA 4L13A 2QLHA 3VHTB 3DQJA 4JRBA 4OGSA 2IB6A 3TMTA 2O29A 3IR8A 2HGDA 5DRGA 2WSOA 2DUHA 1MOVA 3KCTA 4HQ9A 3H1RA 4LQTA 1RM9A 4B5YA 2OGRA 3SSHA 3A8SA 1Z1PA 2DDCA 2O2BA 2FZUA 4JFGA 3U0MA 2Z6ZA 5EJUA 1EMCA 2FL1A 2OKYA 3SVCA 1G7KA 4W7FA 2VAEA 2GX2A 4W7RA 1YHHA 2GX0A 5T3IA 4DKMA 4W6SA 3U0LA 3DQ3A 2H9WA 2QLEA 4Q9WA 3DQOA 3LF4B 4PPJA 5EBJA 2VZXA 5LTRA 3E5VA 4L1IA 1HUYA 4W6FA 3S05A 4I2YA 2Y0GA 2POXA 4P76A 4W76A 1EMLA 3CFHA 4W6PA 3DQ9A 5LTQA 3SG5A 4IK3A 4H47A 3CB9A 3LVAA 4LJBA 4NWSA 4W6UA 1XQMA 2G5ZB 4PFEA 3NT9A 2HPWA 2HCGA 1OXEA 4OJ0A 2ZO7A 2B3QA 1YHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YDZ A;  3AKO A;  4RYW A;  4TZG A;  1KYR A;  5HBD A;  5DPI A;  2B3P A;  5F9G A;  2C9I A;  3KCS A;  1F09 A;  2IE2 A;  2EMO A;  2PXS A;  1XMZ A;  4W72 A;  4JEO A;  4JGE A;  4GOB A;  2OTE A;  3DQI A;  2YE1 A;  4Q9X A;  5DQM A;  1Q4D A;  2OTB A;  4ZF4 A;  1S6Z A;  2EMD A;  1RMM A;  1QYF A;  2G6Y A;  4ANJ A;  3NF0 A;  5DPG A;  3ADF A;  2DUF A;  4Z4M A;  3DQ4 A;  4KEX A;  4W6M A;  3U0K A;  2QLG B;  2A54 B;  3BX9 A;  4HVF A;  1JBZ A;  4GF6 B;  2HQZ A;  3CD1 A;  1JC0 A;  4ORN A;  3BXB A;  4B30 A;  2H5P A;  3CD9 A;  3EK4 A;  5HZO A;  1H4U A;  2A56 B;  3EVR A;  3W1C A;  2H6V A;  1EMG A;  1W7T A;  4KA9 A;  1EMM A;  4W73 A;  2AH8 A;  1GFL A;  4W69 A;  3SSK A;  5DQB A;  3CFA A;  2GW3 A;  1CV7 A;  2H8Q A;  4KPI A;  1Q4A A;  4ZBL A;  4W7X A;  4KW4 A;  3NT3 A;  3LVC A;  4DXP A;  2FWQ A;  5LK4 A;  4W7A A;  2ZMW A;  4R6B A;  3DQL A;  3DPX A;  3SSL A;  3OSQ A;  4AR7 A;  4IK8 A;  4N3D A;  5DTZ A;  1ZGQ A;  3SSP A;  5FHV A;  4DXQ A;  1W7U A;  4DXO A;  2VAD A;  4OY4 A;  1KYS A;  2VVJ A;  1ZUX A;  4ZB1 A;  4ZIN A;  4PPL A;  3EVV A;  2ICR A;  3RWT A;  1YZW A;  2A50 B;  4KGF A;  3DPW A;  2DUE A;  3DQH A;  3GJ2 A;  5BTT A;  2DUG A;  1EMF A;  1QYO A;  3DQM A;  1QYQ A;  4W6D A;  3EVU A;  2GW4 B;  3PJB A;  4W6H A;  2IOV A;  3DQE A;  4OQW A;  1OXF A;  3UG0 A;  2Z1O A;  3SSV A;  3ST0 A;  4W75 A;  4IK4 A;  3SVN A;  2Z6Y A;  4P1Q A;  3IP2 A;  4W6A A;  3LSA A;  2IB5 A;  1W7S A;  3ZUJ A;  1RMP A;  2HRS A;  3O77 A;  1OXD A;  3DQC A;  3SG4 A;  4IK5 A;  4KW9 A;  3SV5 A;  4LQU A;  2V4E B;  1YJF A;  2ZMU A;  3DQD A;  4KF5 C;  3VK1 A;  4W77 A;  3E5W A;  2WHS A;  3ZUL A;  2C9J A;  3SS0 A;  4ZIO A;  2O24 A;  2OKW A;  3MGF A;  3K1K A;  2QLI A;  4W6O A;  2G3O A;  4XOV A;  4H3N A;  5BT0 A;  4ZFS A;  2AWJ A;  2AWK A;  5DRF A;  4EN1 A;  4KGE A;  5FVI A;  2QU1 A;  3DQ2 A;  4XL5 A;  1HCJ A;  2HFC A;  5HZU A;  5FVG A;  3CBE A;  5DPH A;  1C4F A;  2ZO6 A;  2A48 A;  3DQ1 A;  3VHT A;  2G6E A;  4KF5 A;  3SRY A;  4DKN A;  4AS8 A;  1Q4B A;  4W74 A;  2VVI A;  2HQK A;  4L12 A;  3EKJ A;  4UTS A;  4GES B;  2RH7 A;  1QY3 A;  4W6J A;  1EMA A;  2WIS A;  3PJ7 A;  3DQA A;  3DQ5 A;  4LW5 A;  2YE0 A;  3NEZ A;  3SG7 A;  2QT2 A;  1B9C A;  2WUR A;  2G3D B;  5HW9 A;  4OHS A;  3DQ6 A;  4W6G A;  2G16 B;  3LVD A;  1ZGO A;  4W7D A;  1XA9 A;  2P4M A;  2YFP A;  3WLD A;  3ZUF A;  4Q7T A;  3UFZ A;  5H87 A;  4Q7U A;  3SVD A;  4ZF3 A;  3CFF A;  1GGX A;  4H48 A;  4W6B A;  3DPZ A;  3GB3 A;  4W7E A;  2G2S B;  1RRX A;  3OGO A;  4DXN A;  2AWL A;  2OJK A;  4XOW A;  4Q7R A;  3SG2 A;  2Q57 A;  1ZGP A;  3EVP A;  3SST A;  3SVE A;  2A47 A;  3ED8 A;  1H6R A;  4IK1 A;  1Q4C A;  3BXA A;  4J88 A;  1GL4 A;  3M22 A;  4EDO A;  1JBY A;  5H89 A;  4PPK A;  4IZN A;  5EXU A;  2AHA A;  4LJD C;  3SG3 A;  5EB6 A;  3DQK A;  3U0N A;  2A53 B;  2DD9 A;  4H3M A;  5DU0 A;  3I19 A;  3NED A;  5DY6 A;  5FVF A;  3AI4 A;  4XGY A;  4LJC A;  2DD7 A;  3LS3 A;  3GJ1 A;  2EMN A;  5HZS A;  3P8U A;  4XVP A;  2WSN A;  4RYS A;  2WIQ A;  2PXW A;  3G9A A;  5DPJ A;  4J89 A;  4W6C A;  5J2O A;  2WHT A;  1JC1 A;  4LJD A;  4ZF5 A;  4B30 B;  1EMK A;  4R6D A;  5BQL A;  2QLG A;  3VIC A;  2H5O A;  5DTL A;  1MYW A;  3CGL A;  5H88 A;  2DUI A;  4W7C A;  5EXB A;  2Q6P A;  4HE4 A;  3EK7 A;  3DQN A;  3ZTF A;  3SG6 A;  3U8C A;  3ST4 A;  4H3L A;  2H5Q A;  1YJ2 A;  4W6L A;  4KF4 A;  5KTG A;  3WLC A;  3RWA A;  3U8A A;  4DXM A;  4J8A A;  3ST2 A;  1MOU A;  3V3D A;  4BDU A;  3LA1 A;  4W6N A;  3H1O A;  4Z4K A;  4W6I A;  4EDS A;  2DDD A;  4DXI A;  1BFP A;  3AI5 A;  5EB7 A;  3SVU A;  1UIS A;  4HQC A;  3DQU A;  1Q4E A;  2G6X A;  5DTY A;  3SVB A;  2HJO A;  3SVS A;  4EMQ A;  2BTJ A;  5BTT B;  2WHU A;  3EKH A;  3SVR A;  4HQ8 A;  1KYP A;  3OSR A;  2A52 B;  2H5R A;  3LF3 A;  3W1D A;  5AQB B;  3E5T A;  4W6T A;  3TMR A;  2A46 A;  2HGY A;  4KW8 A;  1QXT A;  3SVO A;  4KAG A;  4W6K A;  3EK8 A;  5LTP A;  1KP5 A;  1XAE A;  3U8P A;  2AWM A;  3P28 A;  4W6R A;  1YFP A;  3DQ8 A;  2V4E C;  3BXC A;  3GL4 A;  3ST3 A;  1F0B A;  1YHG A;  3M24 A;  1Z1Q A;  5EXC I;  3WCK A;  4EUL A;  3O78 A;  3PIB A;  2QZ0 A;  2ARL A;  1RMO A;  4TZA A;  3GEX A;  4JF9 A;  5HZT A;  1EMB A;  1Q73 A;  2JAD A;  3DQF A;  2Z6X A;  5EHU A;  4U2V A;  1EME A;  2VVH A;  3DQ7 A;  5DTX A;  5HGE A;  3PJ5 A;  3SSY A;  2V4E A;  4JC2 A;  4RTC A;  2QRF A;  4IK9 A;  1XSS A;  4L13 A;  2QLH A;  3VHT B;  3DQJ A;  4JRB A;  4OGS A;  2IB6 A;  3TMT A;  2O29 A;  3IR8 A;  2HGD A;  5DRG A;  2WSO A;  2DUH A;  1MOV A;  3KCT A;  4HQ9 A;  3H1R A;  4LQT A;  1RM9 A;  4B5Y A;  2OGR A;  3SSH A;  3A8S A;  1Z1P A;  2DDC A;  2O2B A;  2FZU A;  4JFG A;  3U0M A;  2Z6Z A;  5EJU A;  1EMC A;  2FL1 A;  2OKY A;  3SVC A;  1G7K A;  4W7F A;  2VAE A;  2GX2 A;  4W7R A;  1YHH A;  2GX0 A;  5T3I A;  4DKM A;  4W6S A;  3U0L A;  3DQ3 A;  2H9W A;  2QLE A;  4Q9W A;  3DQO A;  3LF4 B;  4PPJ A;  5EBJ A;  2VZX A;  5LTR A;  3E5V A;  4L1I A;  1HUY A;  4W6F A;  3S05 A;  4I2Y A;  2Y0G A;  2POX A;  4P76 A;  4W76 A;  1EML A;  3CFH A;  4W6P A;  3DQ9 A;  5LTQ A;  3SG5 A;  4IK3 A;  4H47 A;  3CB9 A;  3LVA A;  4LJB A;  4NWS A;  4W6U A;  1XQM A;  2G5Z B;  4PFE A;  3NT9 A;  2HPW A;  2HCG A;  1OXE A;  4OJ0 A;  2ZO7 A;  2B3Q A;  1YHI A; 
#chains in the Genus database with same CATH topology
 2YDZ A;  3AKO A;  4RYW A;  4TZG A;  1KYR A;  5HBD A;  5DPI A;  2B3P A;  5F9G A;  2C9I A;  3KCS A;  1F09 A;  2IE2 A;  2EMO A;  2PXS A;  1XMZ A;  4W72 A;  4JEO A;  4JGE A;  4GOB A;  2OTE A;  3DQI A;  2YE1 A;  4Q9X A;  5DQM A;  1Q4D A;  2OTB A;  4ZF4 A;  1S6Z A;  2EMD A;  1RMM A;  1QYF A;  2G6Y A;  4ANJ A;  3NF0 A;  5DPG A;  3ADF A;  2DUF A;  4Z4M A;  3DQ4 A;  4KEX A;  4W6M A;  3U0K A;  2QLG B;  2A54 B;  3BX9 A;  4HVF A;  1JBZ A;  4GF6 B;  2HQZ A;  3CD1 A;  1JC0 A;  4ORN A;  3BXB A;  4B30 A;  2H5P A;  3CD9 A;  3EK4 A;  5HZO A;  1H4U A;  2A56 B;  3EVR A;  3W1C A;  2H6V A;  1EMG A;  1W7T A;  4KA9 A;  1EMM A;  4W73 A;  2AH8 A;  1GFL A;  4W69 A;  3SSK A;  5DQB A;  3CFA A;  2GW3 A;  1CV7 A;  2H8Q A;  4KPI A;  1Q4A A;  4ZBL A;  4W7X A;  4KW4 A;  3NT3 A;  3LVC A;  4DXP A;  2FWQ A;  5LK4 A;  4W7A A;  2ZMW A;  4R6B A;  3DQL A;  3DPX A;  3SSL A;  3OSQ A;  4AR7 A;  4IK8 A;  4N3D A;  5DTZ A;  1ZGQ A;  3SSP A;  5FHV A;  4DXQ A;  1W7U A;  4DXO A;  2VAD A;  4OY4 A;  1KYS A;  2VVJ A;  1ZUX A;  4ZB1 A;  4ZIN A;  4PPL A;  3EVV A;  2ICR A;  3RWT A;  1YZW A;  2A50 B;  4KGF A;  3DPW A;  2DUE A;  3DQH A;  3GJ2 A;  5BTT A;  2DUG A;  1EMF A;  1QYO A;  3DQM A;  1QYQ A;  4W6D A;  3EVU A;  2GW4 B;  3PJB A;  4W6H A;  2IOV A;  3DQE A;  4OQW A;  1OXF A;  3UG0 A;  2Z1O A;  3SSV A;  3ST0 A;  4W75 A;  4IK4 A;  3SVN A;  2Z6Y A;  4P1Q A;  3IP2 A;  4W6A A;  3LSA A;  2IB5 A;  1W7S A;  3ZUJ A;  1RMP A;  2HRS A;  3O77 A;  1OXD A;  3DQC A;  3SG4 A;  4IK5 A;  4KW9 A;  3SV5 A;  4LQU A;  2V4E B;  1YJF A;  2ZMU A;  3DQD A;  4KF5 C;  3VK1 A;  4W77 A;  3E5W A;  2WHS A;  3ZUL A;  2C9J A;  3SS0 A;  4ZIO A;  2O24 A;  2OKW A;  3MGF A;  3K1K A;  2QLI A;  4W6O A;  2G3O A;  4XOV A;  4H3N A;  5BT0 A;  4ZFS A;  2AWJ A;  2AWK A;  5DRF A;  4EN1 A;  4KGE A;  5FVI A;  2QU1 A;  3DQ2 A;  4XL5 A;  1HCJ A;  2HFC A;  5HZU A;  5FVG A;  3CBE A;  5DPH A;  1C4F A;  2ZO6 A;  2A48 A;  3DQ1 A;  3VHT A;  2G6E A;  4KF5 A;  3SRY A;  4DKN A;  4AS8 A;  1Q4B A;  4W74 A;  2VVI A;  2HQK A;  4L12 A;  3EKJ A;  4UTS A;  4GES B;  2RH7 A;  1QY3 A;  4W6J A;  1EMA A;  2WIS A;  3PJ7 A;  3DQA A;  3DQ5 A;  4LW5 A;  2YE0 A;  3NEZ A;  3SG7 A;  2QT2 A;  1B9C A;  2WUR A;  2G3D B;  5HW9 A;  4OHS A;  3DQ6 A;  4W6G A;  2G16 B;  3LVD A;  1ZGO A;  4W7D A;  1XA9 A;  2P4M A;  2YFP A;  3WLD A;  3ZUF A;  4Q7T A;  3UFZ A;  5H87 A;  4Q7U A;  3SVD A;  4ZF3 A;  3CFF A;  1GGX A;  4H48 A;  4W6B A;  3DPZ A;  3GB3 A;  4W7E A;  2G2S B;  1RRX A;  3OGO A;  4DXN A;  2AWL A;  2OJK A;  4XOW A;  4Q7R A;  3SG2 A;  2Q57 A;  1ZGP A;  3EVP A;  3SST A;  3SVE A;  2A47 A;  3ED8 A;  1H6R A;  4IK1 A;  1Q4C A;  3BXA A;  4J88 A;  1GL4 A;  3M22 A;  4EDO A;  1JBY A;  5H89 A;  4PPK A;  4IZN A;  5EXU A;  2AHA A;  4LJD C;  3SG3 A;  5EB6 A;  3DQK A;  3U0N A;  2A53 B;  2DD9 A;  4H3M A;  5DU0 A;  3I19 A;  3NED A;  5DY6 A;  5FVF A;  3AI4 A;  4XGY A;  4LJC A;  2DD7 A;  3LS3 A;  3GJ1 A;  2EMN A;  5HZS A;  3P8U A;  4XVP A;  2WSN A;  4RYS A;  2WIQ A;  2PXW A;  3G9A A;  5DPJ A;  4J89 A;  4W6C A;  5J2O A;  2WHT A;  1JC1 A;  4LJD A;  4ZF5 A;  4B30 B;  1EMK A;  4R6D A;  5BQL A;  2QLG A;  3VIC A;  2H5O A;  5DTL A;  1MYW A;  3CGL A;  5H88 A;  2DUI A;  4W7C A;  5EXB A;  2Q6P A;  4HE4 A;  3EK7 A;  3DQN A;  3ZTF A;  3SG6 A;  3U8C A;  3ST4 A;  4H3L A;  2H5Q A;  1YJ2 A;  4W6L A;  4KF4 A;  5KTG A;  3WLC A;  3RWA A;  3U8A A;  4DXM A;  4J8A A;  3ST2 A;  1MOU A;  3V3D A;  4BDU A;  3LA1 A;  4W6N A;  3H1O A;  4Z4K A;  4W6I A;  4EDS A;  2DDD A;  4DXI A;  1BFP A;  3AI5 A;  5EB7 A;  3SVU A;  1UIS A;  4HQC A;  3DQU A;  1Q4E A;  2G6X A;  5DTY A;  3SVB A;  2HJO A;  3SVS A;  4EMQ A;  2BTJ A;  5BTT B;  2WHU A;  3EKH A;  3SVR A;  4HQ8 A;  1KYP A;  3OSR A;  2A52 B;  2H5R A;  3LF3 A;  3W1D A;  5AQB B;  3E5T A;  4W6T A;  3TMR A;  2A46 A;  2HGY A;  4KW8 A;  1QXT A;  3SVO A;  4KAG A;  4W6K A;  3EK8 A;  5LTP A;  1KP5 A;  1XAE A;  3U8P A;  2AWM A;  3P28 A;  4W6R A;  1YFP A;  3DQ8 A;  2V4E C;  3BXC A;  3GL4 A;  3ST3 A;  1F0B A;  1YHG A;  3M24 A;  1Z1Q A;  5EXC I;  3WCK A;  4EUL A;  3O78 A;  3PIB A;  2QZ0 A;  2ARL A;  1RMO A;  4TZA A;  3GEX A;  4JF9 A;  5HZT A;  1EMB A;  1Q73 A;  2JAD A;  3DQF A;  2Z6X A;  5EHU A;  4U2V A;  1EME A;  2VVH A;  3DQ7 A;  5DTX A;  5HGE A;  3PJ5 A;  3SSY A;  2V4E A;  4JC2 A;  4RTC A;  2QRF A;  4IK9 A;  1XSS A;  4L13 A;  2QLH A;  3VHT B;  3DQJ A;  4JRB A;  4OGS A;  2IB6 A;  3TMT A;  2O29 A;  3IR8 A;  2HGD A;  5DRG A;  2WSO A;  2DUH A;  1MOV A;  3KCT A;  4HQ9 A;  3H1R A;  4LQT A;  1RM9 A;  4B5Y A;  2OGR A;  3SSH A;  3A8S A;  1Z1P A;  2DDC A;  2O2B A;  2FZU A;  4JFG A;  3U0M A;  2Z6Z A;  5EJU A;  1EMC A;  2FL1 A;  2OKY A;  3SVC A;  1G7K A;  4W7F A;  2VAE A;  2GX2 A;  4W7R A;  1YHH A;  2GX0 A;  5T3I A;  4DKM A;  4W6S A;  3U0L A;  3DQ3 A;  2H9W A;  2QLE A;  4Q9W A;  3DQO A;  3LF4 B;  4PPJ A;  5EBJ A;  2VZX A;  5LTR A;  3E5V A;  4L1I A;  1HUY A;  4W6F A;  3S05 A;  4I2Y A;  2Y0G A;  2POX A;  4P76 A;  4W76 A;  1EML A;  3CFH A;  4W6P A;  3DQ9 A;  5LTQ A;  3SG5 A;  4IK3 A;  4H47 A;  3CB9 A;  3LVA A;  4LJB A;  4NWS A;  4W6U A;  1XQM A;  2G5Z B;  4PFE A;  3NT9 A;  2HPW A;  2HCG A;  1OXE A;  4OJ0 A;  2ZO7 A;  2B3Q A;  1YHI A; 
#chains in the Genus database with same CATH homology
 2YDZ A;  3AKO A;  4RYW A;  4TZG A;  1KYR A;  5HBD A;  5DPI A;  2B3P A;  5F9G A;  2C9I A;  3KCS A;  1F09 A;  2IE2 A;  2EMO A;  2PXS A;  1XMZ A;  4W72 A;  4JEO A;  4JGE A;  4GOB A;  2OTE A;  3DQI A;  2YE1 A;  4Q9X A;  5DQM A;  1Q4D A;  2OTB A;  4ZF4 A;  1S6Z A;  2EMD A;  1RMM A;  1QYF A;  2G6Y A;  4ANJ A;  3NF0 A;  5DPG A;  3ADF A;  2DUF A;  4Z4M A;  3DQ4 A;  4KEX A;  4W6M A;  3U0K A;  2QLG B;  2A54 B;  3BX9 A;  4HVF A;  1JBZ A;  4GF6 B;  2HQZ A;  3CD1 A;  1JC0 A;  4ORN A;  3BXB A;  4B30 A;  2H5P A;  3CD9 A;  3EK4 A;  5HZO A;  1H4U A;  2A56 B;  3EVR A;  3W1C A;  2H6V A;  1EMG A;  1W7T A;  4KA9 A;  1EMM A;  4W73 A;  2AH8 A;  1GFL A;  4W69 A;  3SSK A;  5DQB A;  3CFA A;  2GW3 A;  1CV7 A;  2H8Q A;  4KPI A;  1Q4A A;  4ZBL A;  4W7X A;  4KW4 A;  3NT3 A;  3LVC A;  4DXP A;  2FWQ A;  5LK4 A;  4W7A A;  2ZMW A;  4R6B A;  3DQL A;  3DPX A;  3SSL A;  3OSQ A;  4AR7 A;  4IK8 A;  4N3D A;  5DTZ A;  1ZGQ A;  3SSP A;  5FHV A;  4DXQ A;  1W7U A;  4DXO A;  2VAD A;  4OY4 A;  1KYS A;  2VVJ A;  1ZUX A;  4ZB1 A;  4ZIN A;  4PPL A;  3EVV A;  2ICR A;  3RWT A;  1YZW A;  2A50 B;  4KGF A;  3DPW A;  2DUE A;  3DQH A;  3GJ2 A;  5BTT A;  2DUG A;  1EMF A;  1QYO A;  3DQM A;  1QYQ A;  4W6D A;  3EVU A;  2GW4 B;  3PJB A;  4W6H A;  2IOV A;  3DQE A;  4OQW A;  1OXF A;  3UG0 A;  2Z1O A;  3SSV A;  3ST0 A;  4W75 A;  4IK4 A;  3SVN A;  2Z6Y A;  4P1Q A;  3IP2 A;  4W6A A;  3LSA A;  2IB5 A;  1W7S A;  3ZUJ A;  1RMP A;  2HRS A;  3O77 A;  1OXD A;  3DQC A;  3SG4 A;  4IK5 A;  4KW9 A;  3SV5 A;  4LQU A;  2V4E B;  1YJF A;  2ZMU A;  3DQD A;  4KF5 C;  3VK1 A;  4W77 A;  3E5W A;  2WHS A;  3ZUL A;  2C9J A;  3SS0 A;  4ZIO A;  2O24 A;  2OKW A;  3MGF A;  3K1K A;  2QLI A;  4W6O A;  2G3O A;  4XOV A;  4H3N A;  5BT0 A;  4ZFS A;  2AWJ A;  2AWK A;  5DRF A;  4EN1 A;  4KGE A;  5FVI A;  2QU1 A;  3DQ2 A;  4XL5 A;  1HCJ A;  2HFC A;  5HZU A;  5FVG A;  3CBE A;  5DPH A;  1C4F A;  2ZO6 A;  2A48 A;  3DQ1 A;  3VHT A;  2G6E A;  4KF5 A;  3SRY A;  4DKN A;  4AS8 A;  1Q4B A;  4W74 A;  2VVI A;  2HQK A;  4L12 A;  3EKJ A;  4UTS A;  4GES B;  2RH7 A;  1QY3 A;  4W6J A;  1EMA A;  2WIS A;  3PJ7 A;  3DQA A;  3DQ5 A;  4LW5 A;  2YE0 A;  3NEZ A;  3SG7 A;  2QT2 A;  1B9C A;  2WUR A;  2G3D B;  5HW9 A;  4OHS A;  3DQ6 A;  4W6G A;  2G16 B;  3LVD A;  1ZGO A;  4W7D A;  1XA9 A;  2P4M A;  2YFP A;  3WLD A;  3ZUF A;  4Q7T A;  3UFZ A;  5H87 A;  4Q7U A;  3SVD A;  4ZF3 A;  3CFF A;  1GGX A;  4H48 A;  4W6B A;  3DPZ A;  3GB3 A;  4W7E A;  2G2S B;  1RRX A;  3OGO A;  4DXN A;  2AWL A;  2OJK A;  4XOW A;  4Q7R A;  3SG2 A;  2Q57 A;  1ZGP A;  3EVP A;  3SST A;  3SVE A;  2A47 A;  3ED8 A;  1H6R A;  4IK1 A;  1Q4C A;  3BXA A;  4J88 A;  1GL4 A;  3M22 A;  4EDO A;  1JBY A;  5H89 A;  4PPK A;  4IZN A;  5EXU A;  2AHA A;  4LJD C;  3SG3 A;  5EB6 A;  3DQK A;  3U0N A;  2A53 B;  2DD9 A;  4H3M A;  5DU0 A;  3I19 A;  3NED A;  5DY6 A;  5FVF A;  3AI4 A;  4XGY A;  4LJC A;  2DD7 A;  3LS3 A;  3GJ1 A;  2EMN A;  5HZS A;  3P8U A;  4XVP A;  2WSN A;  4RYS A;  2WIQ A;  2PXW A;  3G9A A;  5DPJ A;  4J89 A;  4W6C A;  5J2O A;  2WHT A;  1JC1 A;  4LJD A;  4ZF5 A;  4B30 B;  1EMK A;  4R6D A;  5BQL A;  2QLG A;  3VIC A;  2H5O A;  5DTL A;  1MYW A;  3CGL A;  5H88 A;  2DUI A;  4W7C A;  5EXB A;  2Q6P A;  4HE4 A;  3EK7 A;  3DQN A;  3ZTF A;  3SG6 A;  3U8C A;  3ST4 A;  4H3L A;  2H5Q A;  1YJ2 A;  4W6L A;  4KF4 A;  5KTG A;  3WLC A;  3RWA A;  3U8A A;  4DXM A;  4J8A A;  3ST2 A;  1MOU A;  3V3D A;  4BDU A;  3LA1 A;  4W6N A;  3H1O A;  4Z4K A;  4W6I A;  4EDS A;  2DDD A;  4DXI A;  1BFP A;  3AI5 A;  5EB7 A;  3SVU A;  1UIS A;  4HQC A;  3DQU A;  1Q4E A;  2G6X A;  5DTY A;  3SVB A;  2HJO A;  3SVS A;  4EMQ A;  2BTJ A;  5BTT B;  2WHU A;  3EKH A;  3SVR A;  4HQ8 A;  1KYP A;  3OSR A;  2A52 B;  2H5R A;  3LF3 A;  3W1D A;  5AQB B;  3E5T A;  4W6T A;  3TMR A;  2A46 A;  2HGY A;  4KW8 A;  1QXT A;  3SVO A;  4KAG A;  4W6K A;  3EK8 A;  5LTP A;  1KP5 A;  1XAE A;  3U8P A;  2AWM A;  3P28 A;  4W6R A;  1YFP A;  3DQ8 A;  2V4E C;  3BXC A;  3GL4 A;  3ST3 A;  1F0B A;  1YHG A;  3M24 A;  1Z1Q A;  5EXC I;  3WCK A;  4EUL A;  3O78 A;  3PIB A;  2QZ0 A;  2ARL A;  1RMO A;  4TZA A;  3GEX A;  4JF9 A;  5HZT A;  1EMB A;  1Q73 A;  2JAD A;  3DQF A;  2Z6X A;  5EHU A;  4U2V A;  1EME A;  2VVH A;  3DQ7 A;  5DTX A;  5HGE A;  3PJ5 A;  3SSY A;  2V4E A;  4JC2 A;  4RTC A;  2QRF A;  4IK9 A;  1XSS A;  4L13 A;  2QLH A;  3VHT B;  3DQJ A;  4JRB A;  4OGS A;  2IB6 A;  3TMT A;  2O29 A;  3IR8 A;  2HGD A;  5DRG A;  2WSO A;  2DUH A;  1MOV A;  3KCT A;  4HQ9 A;  3H1R A;  4LQT A;  1RM9 A;  4B5Y A;  2OGR A;  3SSH A;  3A8S A;  1Z1P A;  2DDC A;  2O2B A;  2FZU A;  4JFG A;  3U0M A;  2Z6Z A;  5EJU A;  1EMC A;  2FL1 A;  2OKY A;  3SVC A;  1G7K A;  4W7F A;  2VAE A;  2GX2 A;  4W7R A;  1YHH A;  2GX0 A;  5T3I A;  4DKM A;  4W6S A;  3U0L A;  3DQ3 A;  2H9W A;  2QLE A;  4Q9W A;  3DQO A;  3LF4 B;  4PPJ A;  5EBJ A;  2VZX A;  5LTR A;  3E5V A;  4L1I A;  1HUY A;  4W6F A;  3S05 A;  4I2Y A;  2Y0G A;  2POX A;  4P76 A;  4W76 A;  1EML A;  3CFH A;  4W6P A;  3DQ9 A;  5LTQ A;  3SG5 A;  4IK3 A;  4H47 A;  3CB9 A;  3LVA A;  4LJB A;  4NWS A;  4W6U A;  1XQM A;  2G5Z B;  4PFE A;  3NT9 A;  2HPW A;  2HCG A;  1OXE A;  4OJ0 A;  2ZO7 A;  2B3Q A;  1YHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...