4JFCA

Crystal structure of a enoyl-coa hydratase from polaromonas sp. js666
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
257
structure length
257
Chain Sequence
b'GAIKSTSEGQTLILTLSNPEFRNALGPEIYAAGIEALNAAENNPEIRSVVITGEGAVFCAGGNLQRLQANRREAPEVQAQSIEGLHNWIDSIRTYPKPVIAAVEGAAAGAGFSLALACDFVVAASNAVFVMSYSTVGLSPDGGGSWSLARSLPRALASELLMGGERISAQRLHDLGLVNKVASAGDALSEALRMAGQLNARAPNALASIKELINEASSNTLSQQLACERDHFVRNLHHSNGGEGIAAFLGKRTPQYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-CoA hydratase
publication title Crystal structure of a enoyl-CoA hydratase from Polaromonas sp. JS666
rcsb
source organism Polaromonas sp. js666
molecule tags Lyase
total genus 89
structure length 257
sequence length 257
ec nomenclature ec 4.2.1.17: Enoyl-CoA hydratase.
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 4jfcA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4jfcA01
3BEZA 4L6WA 3KTHA 3H0JA 4MOUA 1K39A 4JYJA 3IB9A 3V5EA 3ZWCA 2DEOA 5E0NX 1MJ3A 5C90A 1NZYB 3T88A 4ELSA 2Q35A 3P5MA 3DJAA 1X0UA 2Q2XA 1PIXA 4ASIA 4IZBA 2IEXA 2VSUF 2X24A 2J5SA 3QXIA 1K32A 1DUBA 1XX4A 4Q1IA 2ZL3A 3QKAA 3T89A 3KQFA 4EMPA 3U9SB 3TZ3A 4RYFH 5INFA 4GM2A 5G1QA 2J5IA 3OT6A 3GKBA 3QWDA 3KTGA 2EJ5A 4OLQA 1WDLA 1XO6A 2ZL0A 1TG6A 1FC9A 3V5IA 4K2NA 1O8UA 3FF6A 3MT6A 2A7SA 2HW5A 3SLLA 4JCRA 4Q0GA 4JVTA 5JBXA 4U1AA 2FW2A 4MXIA 3PEAA 2VSUA 4U0GA 3KTJA 2PBPA 4ELWA 3K8XA 4U19A 4K3WA 5IKLB 2VSSF 1UYTA 3Q1TA 4OG1A 5DU4A 1Y7OA 2J5IB 5KJPA 2VSUC 2J5II 3R0OA 2PPYA 3GMAA 4KPKA 2FBMA 2J5GA 3GLMA 5INGA 3TRRA 5CTBA 3MOYA 4ZDCA 4HC8A 1XNVA 3FDUA 1YG8A 1UYRA 4I42A 3TVUA 5G1RA 1HNOA 4NNQA 3H0UA 3NJBA 3WG5A 4JFCA 3MYBA 2VSSA 5C9GA 2F6QA 3U9RB 4JCTA 3RRVA 4Z0MA 1XNYA 4ZU2A 2J5GD 3RSIA 3H02A 3T3WA 1FC6A 3GF7A 2VREA 1RJMA 3ZW9A 2CBYA 3TLFA 1ON3A 5DTWA 2BZRA 4WYOB 3SWXA 3OC7A 4B3IA 3HP0A 1UYVA 4FN7A 2A81A 3DORA 1J7XA 4ZDFA 5CTCA 4ZDDA 3IAVA 2F9IA 1XNWA 3T8BA 3QXZA 2A7KA 4F47A 3M6MA 4DI1A 4RCNA 3M6NA 5E0SA 3P2LA 2DUBA 3HE2A 3T8AA 3PGQA 1EF9A 3JU1A 1EF8A 3LAOA 3ZWBA 3L3SA 4JSBA 4KD6A 3Q0GA 4U0HA 1YG6A 1FCFA 4HNKA 3U9TB 1N6DA 4K29A 5DZKA 4QIIA 4JCSA 1ON9A 3P85A 1PJHA 1WZ8A 4MI2A 4NEKA 3ZW8A 1FC7A 3R9TA 4FB8A 2ZQRA 2F9IB 4FN8A 3ISAA 2WTBA 1VRGA 1SZOA 4ZDBA 4IZCA 3BPPA 2QQ3A 2VSUE 4B3JA 3Q7HA 5G1SA 4KNPA 4GHNA 5INIA 3HLN1 1Q52A 4KWBA 1W2XA 4I52A 3NJDA 5FIFA 2PG8A 3KTKA 2F9YA 3RSTA 3PE8A 4FNDA 5JBWA 2CE3A 3ZWAA 5DUFA 2NP9A 4WCZA 1RJNA 4RYFA 3MFMA 3N6RB 3IBBA 3QYRA 4EMLA 5DL1A 3K50A 4QIJA 5MGBA 5DU6A 4QFEA 3OMEA 5FUSA 1EY3A 4WZ8B 3TV5A 3H0SA 2W3PA 1WDKA 2VSSE 3H0QA 5KDRA 3HINA 3G64A 5DU8A 3R9QA 3R6HA 5DKPA 4JWVA 1Q51A 2F9YB 3QK8A 3R9SA 3TVWA 4YLHA 3I47A 1OD2A 4JOTA 4JJTA 3STAA 4B3HA 5DTPA 1DCIA 2FZSA 3HRXA 1N6FA 4L8KA 4FZWA 4I4ZA 2ZL4A 3KTIA 1WDMA 4JYLA 3GF3A 3H81A 4FJWD 2D3TA 3TT7A 2VX2A 4JCQA 5E0SH 5DUCA 1JXZA 4IZDA 3VIVA 5KDRB 4OMRA 1UYSA 3LKEA 4ZDEA 4U0GH 4FZWC 2X58A 1HZDA 2UZFA 1NZYA 3QMJA 4G2RA 3Q0JA 2F6IA 4ELXA 3QREA 1HNUA 2C8TA 1UIYA 2GTRA 5DZKH 4EMMA 1OD4A 1N6EA 2Q34A 2ZQQA 1SG4A 4FNBA 3TT6A 3BF0A 3ST9A 3PZKA 2ZL2A 4U18A 3TDCA 4LK5A 1TYFA
chains in the Genus database with same CATH superfamily
3BEZA 4L6WA 3KTHA 3H0JA 4MOUA 1K39A 4JYJA 3IB9A 3V5EA 3ZWCA 2DEOA 5E0NX 1MJ3A 3AM1A 5C90A 1Y64B 1NZYB 3T88A 4ELSA 2Q35A 3P5MA 3DJAA 1X0UA 2Q2XA 1PIXA 4ASIA 4IZBA 2IEXA 2VSUF 2X24A 2J5SA 3QXIA 1K32A 1DUBA 1XX4A 4Q1IA 2ZL3A 3QKAA 3T89A 3KQFA 4EMPA 3U9SB 3TZ3A 4RYFH 5INFA 4GM2A 5G1QA 2J5IA 3OT6A 3GKBA 3QWDA 3KTGA 2EJ5A 4OLQA 1WDLA 1XO6A 2ZL0A 1TG6A 1FC9A 3V5IA 4K2NA 1O8UA 3FF6A 3MT6A 2A7SA 2HW5A 3SLLA 3A4MA 4JCRA 4Q0GA 3W8IB 4JVTA 5JBXA 4U1AA 2FW2A 4MXIA 3PEAA 2VSUA 4U0GA 3KTJA 2PBPA 4ELWA 3K8XA 4U19A 4K3WA 5IKLB 2VSSF 1UYTA 3Q1TA 5HUQA 4OG1A 5DU4A 1Y7OA 2J5IB 5KJPA 2VSUC 2J5II 3R0OA 2PPYA 3GMAA 4KPKA 2FBMA 2J5GA 3GLMA 5INGA 3TRRA 5CTBA 3MOYA 4ZDCA 4HC8A 3ADCA 1XNVA 3FDUA 1YG8A 1UYRA 4J2UA 4I42A 3TVUA 5G1RA 4NNQA 1HNOA 3H0UA 3A4LA 3NJBA 3WG5A 4JFCA 3MYBA 2VSSA 5C9GA 2F6QA 3U9RB 4JCTA 3RRVA 4Z0MA 1XNYA 4ZU2A 1UX5A 2J5GD 3RSIA 3H02A 3T3WA 1FC6A 3GF7A 2VREA 1RJMA 3ZW9A 2CBYA 3TLFA 1ON3A 5DTWA 2BZRA 4WYOB 3SWXA 3RQFA 3OC7A 4B3IA 3HP0A 1UYVA 4FN7A 2A81A 3DORA 1J7XA 4ZDFA 5CTCA 3RQEA 4ZDDA 3IAVA 2F9IA 1XNWA 3W8HB 3T8BA 3QXZA 2A7KA 4F47A 3M6MA 4DI1A 4RCNA 3M6NA 5E0SA 3P2LA 2DUBA 3HE2A 3T8AA 3PGQA 1EF9A 3JU1A 1EF8A 3LAOA 3ZWBA 3L3SA 4JSBA 4KD6A 3Q0GA 4U0HA 1YG6A 1FCFA 4HNKA 3U9TB 1UX4A 1N6DA 4K29A 5DZKA 4QIIA 4JCSA 1ON9A 3P85A 1PJHA 1WZ8A 4MI2A 4NEKA 3ZW8A 1FC7A 3R9TA 3L8JA 4FB8A 2ZQRA 2F9IB 4FN8A 3ISAA 2WTBA 1VRGA 1SZOA 4ZDBA 4IZCA 3BPPA 2QQ3A 2VSUE 4B3JA 3Q7HA 5G1SA 4HDTA 4KNPA 4GHNA 5INIA 3HLN1 1Q52A 4KWBA 1W2XA 4I52A 3NJDA 5FIFA 2PG8A 3KTKA 2F9YA 3RSTA 3BPTA 3PE8A 4FNDA 5JBWA 2CE3A 3ZWAA 5DUFA 2NP9A 4WCZA 1RJNA 4RYFA 3MFMA 3N6RB 3IBBA 3ADDA 3QYRA 4EMLA 5DL1A 3A4NA 3K50A 4QIJA 5MGBA 5DU6A 4QFEA 3OMEA 3L8IA 5FUSA 1EY3A 4WZ8B 3TV5A 3O4XE 3H0SA 2W3PA 1WDKA 2VSSE 3H0QA 5KDRA 3HINA 3G64A 5DU8A 3AJMA 3R9QA 3R6HA 5DKPA 4JWVA 1Q51A 2F9YB 3QK8A 3R9SA 3TVWA 4YLHA 3I47A 1OD2A 4JOTA 4JJTA 3STAA 4B3HA 5DTPA 1DCIA 2FZSA 3HRXA 1N6FA 4L8KA 4FZWA 4I4ZA 2ZL4A 3KTIA 1WDMA 4JYLA 3GF3A 3H81A 3IRBA 4FJWD 2D3TA 3TT7A 4GEHB 2VX2A 4JCQA 5E0SH 5DUCA 1JXZA 4IZDA 3VIVA 5KDRB 2P63A 4OMRA 1UYSA 3LKEA 4ZDEA 4U0GH 4FZWC 2X58A 1HZDA 2UZFA 1NZYA 3QMJA 4G2RA 3Q0JA 2F6IA 4NARA 4ELXA 3QREA 1HNUA 2C8TA 1UIYA 2GTRA 5DZKH 4EMMA 1OD4A 1N6EA 3RQGA 3ADBA 2Q34A 2ZQQA 1SG4A 4FNBA 3TT6A 3BF0A 3ST9A 3PZKA 2ZL2A 4U18A 2YJGA 3TDCA 4LK5A 1TYFA
chains in the Genus database with same CATH topology
3BEZA 4L6WA 3KTHA 3H0JA 4MOUA 1K39A 4JYJA 3IB9A 3V5EA 3ZWCA 2DEOA 5E0NX 1MJ3A 5C90A 1NZYB 3T88A 4ELSA 2Q35A 3P5MA 3DJAA 1X0UA 2Q2XA 1PIXA 4ASIA 4IZBA 2IEXA 2VSUF 2X24A 2J5SA 3QXIA 1K32A 1DUBA 1XX4A 4Q1IA 2ZL3A 3QKAA 3T89A 3KQFA 4EMPA 3U9SB 3TZ3A 4RYFH 5INFA 4GM2A 5G1QA 2J5IA 3OT6A 3GKBA 3QWDA 3KTGA 2EJ5A 4OLQA 1WDLA 1XO6A 2ZL0A 1TG6A 1FC9A 3V5IA 4K2NA 1O8UA 3FF6A 3MT6A 2A7SA 2HW5A 3SLLA 4JCRA 4Q0GA 4JVTA 5JBXA 4U1AA 2FW2A 4MXIA 3PEAA 2VSUA 4U0GA 3KTJA 2PBPA 4ELWA 3K8XA 4U19A 4K3WA 5IKLB 2VSSF 1UYTA 3Q1TA 5HUQA 4OG1A 5DU4A 1Y7OA 2J5IB 5KJPA 2VSUC 2J5II 3R0OA 2PPYA 3GMAA 4KPKA 2FBMA 2J5GA 3GLMA 5INGA 3TRRA 5CTBA 3MOYA 4ZDCA 4HC8A 1XNVA 3FDUA 1YG8A 1UYRA 4J2UA 4I42A 3TVUA 5G1RA 1HNOA 4NNQA 3H0UA 3NJBA 3WG5A 4JFCA 3MYBA 2VSSA 5C9GA 2F6QA 3U9RB 4JCTA 3RRVA 4Z0MA 1XNYA 4ZU2A 2J5GD 3RSIA 3H02A 3T3WA 1FC6A 3GF7A 2VREA 1RJMA 3ZW9A 2CBYA 3TLFA 1ON3A 5DTWA 2BZRA 4WYOB 3SWXA 3OC7A 4B3IA 3HP0A 1UYVA 4FN7A 2A81A 3DORA 1J7XA 4ZDFA 5CTCA 4ZDDA 3IAVA 2F9IA 1XNWA 3T8BA 3QXZA 2A7KA 4F47A 3M6MA 4DI1A 4RCNA 3M6NA 5E0SA 3P2LA 2DUBA 3HE2A 3T8AA 3PGQA 1EF9A 3JU1A 1EF8A 3LAOA 3ZWBA 3L3SA 4JSBA 4KD6A 3Q0GA 4U0HA 1YG6A 1FCFA 4HNKA 3U9TB 1N6DA 4K29A 5DZKA 4QIIA 4JCSA 1ON9A 3P85A 1PJHA 1WZ8A 4MI2A 4NEKA 3ZW8A 1FC7A 3R9TA 4FB8A 2ZQRA 2F9IB 4FN8A 3ISAA 2WTBA 1VRGA 1SZOA 4ZDBA 4IZCA 3BPPA 2QQ3A 2VSUE 4B3JA 3Q7HA 5G1SA 4HDTA 4KNPA 4GHNA 5INIA 3HLN1 1Q52A 4KWBA 1W2XA 4I52A 3NJDA 5FIFA 2PG8A 3KTKA 2F9YA 3RSTA 3BPTA 3PE8A 4FNDA 5JBWA 2CE3A 3ZWAA 5DUFA 2NP9A 4WCZA 1RJNA 4RYFA 3MFMA 3N6RB 3IBBA 3QYRA 4EMLA 5DL1A 3K50A 4QIJA 5MGBA 5DU6A 4QFEA 3OMEA 5FUSA 1EY3A 4WZ8B 3TV5A 3H0SA 2W3PA 1WDKA 2VSSE 3H0QA 5KDRA 3HINA 3G64A 5DU8A 3R9QA 3R6HA 5DKPA 4JWVA 1Q51A 2F9YB 3QK8A 3R9SA 3TVWA 4YLHA 3I47A 1OD2A 4JOTA 4JJTA 3STAA 4B3HA 5DTPA 1DCIA 2FZSA 3HRXA 1N6FA 4L8KA 4FZWA 4I4ZA 2ZL4A 3KTIA 1WDMA 4JYLA 3GF3A 3H81A 4FJWD 2D3TA 3TT7A 2VX2A 4JCQA 5E0SH 5DUCA 1JXZA 4IZDA 3VIVA 5KDRB 4OMRA 1UYSA 3LKEA 4ZDEA 4U0GH 4FZWC 2X58A 1HZDA 2UZFA 1NZYA 3QMJA 4G2RA 3Q0JA 2F6IA 4NARA 4ELXA 3QREA 1HNUA 2C8TA 1UIYA 2GTRA 5DZKH 4EMMA 1OD4A 1N6EA 2Q34A 2ZQQA 1SG4A 4FNBA 3TT6A 3BF0A 3ST9A 3PZKA 2ZL2A 4U18A 2YJGA 3TDCA 4LK5A 1TYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BEZ A;  4L6W A;  3KTH A;  3H0J A;  4MOU A;  1K39 A;  4JYJ A;  3IB9 A;  3V5E A;  3ZWC A;  2DEO A;  5E0N X;  1MJ3 A;  5C90 A;  1NZY B;  3T88 A;  4ELS A;  2Q35 A;  3P5M A;  3DJA A;  1X0U A;  2Q2X A;  1PIX A;  4ASI A;  4IZB A;  2IEX A;  2VSU F;  2X24 A;  2J5S A;  3QXI A;  1K32 A;  1DUB A;  1XX4 A;  4Q1I A;  2ZL3 A;  3QKA A;  3T89 A;  3KQF A;  4EMP A;  3U9S B;  3TZ3 A;  4RYF H;  5INF A;  4GM2 A;  5G1Q A;  2J5I A;  3OT6 A;  3GKB A;  3QWD A;  3KTG A;  2EJ5 A;  4OLQ A;  1WDL A;  1XO6 A;  2ZL0 A;  1TG6 A;  1FC9 A;  3V5I A;  4K2N A;  1O8U A;  3FF6 A;  3MT6 A;  2A7S A;  2HW5 A;  3SLL A;  4JCR A;  4Q0G A;  4JVT A;  5JBX A;  4U1A A;  2FW2 A;  4MXI A;  3PEA A;  2VSU A;  4U0G A;  3KTJ A;  2PBP A;  4ELW A;  3K8X A;  4U19 A;  4K3W A;  5IKL B;  2VSS F;  1UYT A;  3Q1T A;  4OG1 A;  5DU4 A;  1Y7O A;  2J5I B;  5KJP A;  2VSU C;  2J5I I;  3R0O A;  2PPY A;  3GMA A;  4KPK A;  2FBM A;  2J5G A;  3GLM A;  5ING A;  3TRR A;  5CTB A;  3MOY A;  4ZDC A;  4HC8 A;  1XNV A;  3FDU A;  1YG8 A;  1UYR A;  4I42 A;  3TVU A;  5G1R A;  1HNO A;  4NNQ A;  3H0U A;  3NJB A;  3WG5 A;  4JFC A;  3MYB A;  2VSS A;  5C9G A;  2F6Q A;  3U9R B;  4JCT A;  3RRV A;  4Z0M A;  1XNY A;  4ZU2 A;  2J5G D;  3RSI A;  3H02 A;  3T3W A;  1FC6 A;  3GF7 A;  2VRE A;  1RJM A;  3ZW9 A;  2CBY A;  3TLF A;  1ON3 A;  5DTW A;  2BZR A;  4WYO B;  3SWX A;  3OC7 A;  4B3I A;  3HP0 A;  1UYV A;  4FN7 A;  2A81 A;  3DOR A;  1J7X A;  4ZDF A;  5CTC A;  4ZDD A;  3IAV A;  2F9I A;  1XNW A;  3T8B A;  3QXZ A;  2A7K A;  4F47 A;  3M6M A;  4DI1 A;  4RCN A;  3M6N A;  5E0S A;  3P2L A;  2DUB A;  3HE2 A;  3T8A A;  3PGQ A;  1EF9 A;  3JU1 A;  1EF8 A;  3LAO A;  3ZWB A;  3L3S A;  4JSB A;  4KD6 A;  3Q0G A;  4U0H A;  1YG6 A;  1FCF A;  4HNK A;  3U9T B;  1N6D A;  4K29 A;  5DZK A;  4QII A;  4JCS A;  1ON9 A;  3P85 A;  1PJH A;  1WZ8 A;  4MI2 A;  4NEK A;  3ZW8 A;  1FC7 A;  3R9T A;  4FB8 A;  2ZQR A;  2F9I B;  4FN8 A;  3ISA A;  2WTB A;  1VRG A;  1SZO A;  4ZDB A;  4IZC A;  3BPP A;  2QQ3 A;  2VSU E;  4B3J A;  3Q7H A;  5G1S A;  4KNP A;  4GHN A;  5INI A;  3HLN 1;  1Q52 A;  4KWB A;  1W2X A;  4I52 A;  3NJD A;  5FIF A;  2PG8 A;  3KTK A;  2F9Y A;  3RST A;  3PE8 A;  4FND A;  5JBW A;  2CE3 A;  3ZWA A;  5DUF A;  2NP9 A;  4WCZ A;  1RJN A;  4RYF A;  3MFM A;  3N6R B;  3IBB A;  3QYR A;  4EML A;  5DL1 A;  3K50 A;  4QIJ A;  5MGB A;  5DU6 A;  4QFE A;  3OME A;  5FUS A;  1EY3 A;  4WZ8 B;  3TV5 A;  3H0S A;  2W3P A;  1WDK A;  2VSS E;  3H0Q A;  5KDR A;  3HIN A;  3G64 A;  5DU8 A;  3R9Q A;  3R6H A;  5DKP A;  4JWV A;  1Q51 A;  2F9Y B;  3QK8 A;  3R9S A;  3TVW A;  4YLH A;  3I47 A;  1OD2 A;  4JOT A;  4JJT A;  3STA A;  4B3H A;  5DTP A;  1DCI A;  2FZS A;  3HRX A;  1N6F A;  4L8K A;  4FZW A;  4I4Z A;  2ZL4 A;  3KTI A;  1WDM A;  4JYL A;  3GF3 A;  3H81 A;  4FJW D;  2D3T A;  3TT7 A;  2VX2 A;  4JCQ A;  5E0S H;  5DUC A;  1JXZ A;  4IZD A;  3VIV A;  5KDR B;  4OMR A;  1UYS A;  3LKE A;  4ZDE A;  4U0G H;  4FZW C;  2X58 A;  1HZD A;  2UZF A;  1NZY A;  3QMJ A;  4G2R A;  3Q0J A;  2F6I A;  4ELX A;  3QRE A;  1HNU A;  2C8T A;  1UIY A;  2GTR A;  5DZK H;  4EMM A;  1OD4 A;  1N6E A;  2Q34 A;  2ZQQ A;  1SG4 A;  4FNB A;  3TT6 A;  3BF0 A;  3ST9 A;  3PZK A;  2ZL2 A;  4U18 A;  3TDC A;  4LK5 A;  1TYF A; 
#chains in the Genus database with same CATH topology
 3BEZ A;  4L6W A;  3KTH A;  3H0J A;  4MOU A;  1K39 A;  4JYJ A;  3IB9 A;  3V5E A;  3ZWC A;  2DEO A;  5E0N X;  1MJ3 A;  3AM1 A;  5C90 A;  1Y64 B;  1NZY B;  3T88 A;  4ELS A;  2Q35 A;  3P5M A;  3DJA A;  1X0U A;  2Q2X A;  1PIX A;  4ASI A;  4IZB A;  2IEX A;  2VSU F;  2X24 A;  2J5S A;  3QXI A;  1K32 A;  1DUB A;  1XX4 A;  4Q1I A;  2ZL3 A;  3QKA A;  3T89 A;  3KQF A;  4EMP A;  3U9S B;  3TZ3 A;  4RYF H;  5INF A;  4GM2 A;  5G1Q A;  2J5I A;  3OT6 A;  3GKB A;  3QWD A;  3KTG A;  2EJ5 A;  4OLQ A;  1WDL A;  1XO6 A;  2ZL0 A;  1TG6 A;  1FC9 A;  3V5I A;  4K2N A;  1O8U A;  3FF6 A;  3MT6 A;  2A7S A;  2HW5 A;  3SLL A;  3A4M A;  4JCR A;  4Q0G A;  3W8I B;  4JVT A;  5JBX A;  4U1A A;  2FW2 A;  4MXI A;  3PEA A;  2VSU A;  4U0G A;  3KTJ A;  2PBP A;  4ELW A;  3K8X A;  4U19 A;  4K3W A;  5IKL B;  2VSS F;  1UYT A;  3Q1T A;  5HUQ A;  4OG1 A;  5DU4 A;  1Y7O A;  2J5I B;  5KJP A;  2VSU C;  2J5I I;  3R0O A;  2PPY A;  3GMA A;  4KPK A;  2FBM A;  2J5G A;  3GLM A;  5ING A;  3TRR A;  5CTB A;  3MOY A;  4ZDC A;  4HC8 A;  3ADC A;  1XNV A;  3FDU A;  1YG8 A;  1UYR A;  4J2U A;  4I42 A;  3TVU A;  5G1R A;  4NNQ A;  1HNO A;  3H0U A;  3A4L A;  3NJB A;  3WG5 A;  4JFC A;  3MYB A;  2VSS A;  5C9G A;  2F6Q A;  3U9R B;  4JCT A;  3RRV A;  4Z0M A;  1XNY A;  4ZU2 A;  1UX5 A;  2J5G D;  3RSI A;  3H02 A;  3T3W A;  1FC6 A;  3GF7 A;  2VRE A;  1RJM A;  3ZW9 A;  2CBY A;  3TLF A;  1ON3 A;  5DTW A;  2BZR A;  4WYO B;  3SWX A;  3RQF A;  3OC7 A;  4B3I A;  3HP0 A;  1UYV A;  4FN7 A;  2A81 A;  3DOR A;  1J7X A;  4ZDF A;  5CTC A;  3RQE A;  4ZDD A;  3IAV A;  2F9I A;  1XNW A;  3W8H B;  3T8B A;  3QXZ A;  2A7K A;  4F47 A;  3M6M A;  4DI1 A;  4RCN A;  3M6N A;  5E0S A;  3P2L A;  2DUB A;  3HE2 A;  3T8A A;  3PGQ A;  1EF9 A;  3JU1 A;  1EF8 A;  3LAO A;  3ZWB A;  3L3S A;  4JSB A;  4KD6 A;  3Q0G A;  4U0H A;  1YG6 A;  1FCF A;  4HNK A;  3U9T B;  1UX4 A;  1N6D A;  4K29 A;  5DZK A;  4QII A;  4JCS A;  1ON9 A;  3P85 A;  1PJH A;  1WZ8 A;  4MI2 A;  4NEK A;  3ZW8 A;  1FC7 A;  3R9T A;  3L8J A;  4FB8 A;  2ZQR A;  2F9I B;  4FN8 A;  3ISA A;  2WTB A;  1VRG A;  1SZO A;  4ZDB A;  4IZC A;  3BPP A;  2QQ3 A;  2VSU E;  4B3J A;  3Q7H A;  5G1S A;  4HDT A;  4KNP A;  4GHN A;  5INI A;  3HLN 1;  1Q52 A;  4KWB A;  1W2X A;  4I52 A;  3NJD A;  5FIF A;  2PG8 A;  3KTK A;  2F9Y A;  3RST A;  3BPT A;  3PE8 A;  4FND A;  5JBW A;  2CE3 A;  3ZWA A;  5DUF A;  2NP9 A;  4WCZ A;  1RJN A;  4RYF A;  3MFM A;  3N6R B;  3IBB A;  3ADD A;  3QYR A;  4EML A;  5DL1 A;  3A4N A;  3K50 A;  4QIJ A;  5MGB A;  5DU6 A;  4QFE A;  3OME A;  3L8I A;  5FUS A;  1EY3 A;  4WZ8 B;  3TV5 A;  3O4X E;  3H0S A;  2W3P A;  1WDK A;  2VSS E;  3H0Q A;  5KDR A;  3HIN A;  3G64 A;  5DU8 A;  3AJM A;  3R9Q A;  3R6H A;  5DKP A;  4JWV A;  1Q51 A;  2F9Y B;  3QK8 A;  3R9S A;  3TVW A;  4YLH A;  3I47 A;  1OD2 A;  4JOT A;  4JJT A;  3STA A;  4B3H A;  5DTP A;  1DCI A;  2FZS A;  3HRX A;  1N6F A;  4L8K A;  4FZW A;  4I4Z A;  2ZL4 A;  3KTI A;  1WDM A;  4JYL A;  3GF3 A;  3H81 A;  3IRB A;  4FJW D;  2D3T A;  3TT7 A;  4GEH B;  2VX2 A;  4JCQ A;  5E0S H;  5DUC A;  1JXZ A;  4IZD A;  3VIV A;  5KDR B;  2P63 A;  4OMR A;  1UYS A;  3LKE A;  4ZDE A;  4U0G H;  4FZW C;  2X58 A;  1HZD A;  2UZF A;  1NZY A;  3QMJ A;  4G2R A;  3Q0J A;  2F6I A;  4NAR A;  4ELX A;  3QRE A;  1HNU A;  2C8T A;  1UIY A;  2GTR A;  5DZK H;  4EMM A;  1OD4 A;  1N6E A;  3RQG A;  3ADB A;  2Q34 A;  2ZQQ A;  1SG4 A;  4FNB A;  3TT6 A;  3BF0 A;  3ST9 A;  3PZK A;  2ZL2 A;  4U18 A;  2YJG A;  3TDC A;  4LK5 A;  1TYF A; 
#chains in the Genus database with same CATH homology
 3BEZ A;  4L6W A;  3KTH A;  3H0J A;  4MOU A;  1K39 A;  4JYJ A;  3IB9 A;  3V5E A;  3ZWC A;  2DEO A;  5E0N X;  1MJ3 A;  5C90 A;  1NZY B;  3T88 A;  4ELS A;  2Q35 A;  3P5M A;  3DJA A;  1X0U A;  2Q2X A;  1PIX A;  4ASI A;  4IZB A;  2IEX A;  2VSU F;  2X24 A;  2J5S A;  3QXI A;  1K32 A;  1DUB A;  1XX4 A;  4Q1I A;  2ZL3 A;  3QKA A;  3T89 A;  3KQF A;  4EMP A;  3U9S B;  3TZ3 A;  4RYF H;  5INF A;  4GM2 A;  5G1Q A;  2J5I A;  3OT6 A;  3GKB A;  3QWD A;  3KTG A;  2EJ5 A;  4OLQ A;  1WDL A;  1XO6 A;  2ZL0 A;  1TG6 A;  1FC9 A;  3V5I A;  4K2N A;  1O8U A;  3FF6 A;  3MT6 A;  2A7S A;  2HW5 A;  3SLL A;  4JCR A;  4Q0G A;  4JVT A;  5JBX A;  4U1A A;  2FW2 A;  4MXI A;  3PEA A;  2VSU A;  4U0G A;  3KTJ A;  2PBP A;  4ELW A;  3K8X A;  4U19 A;  4K3W A;  5IKL B;  2VSS F;  1UYT A;  3Q1T A;  5HUQ A;  4OG1 A;  5DU4 A;  1Y7O A;  2J5I B;  5KJP A;  2VSU C;  2J5I I;  3R0O A;  2PPY A;  3GMA A;  4KPK A;  2FBM A;  2J5G A;  3GLM A;  5ING A;  3TRR A;  5CTB A;  3MOY A;  4ZDC A;  4HC8 A;  1XNV A;  3FDU A;  1YG8 A;  1UYR A;  4J2U A;  4I42 A;  3TVU A;  5G1R A;  1HNO A;  4NNQ A;  3H0U A;  3NJB A;  3WG5 A;  4JFC A;  3MYB A;  2VSS A;  5C9G A;  2F6Q A;  3U9R B;  4JCT A;  3RRV A;  4Z0M A;  1XNY A;  4ZU2 A;  2J5G D;  3RSI A;  3H02 A;  3T3W A;  1FC6 A;  3GF7 A;  2VRE A;  1RJM A;  3ZW9 A;  2CBY A;  3TLF A;  1ON3 A;  5DTW A;  2BZR A;  4WYO B;  3SWX A;  3OC7 A;  4B3I A;  3HP0 A;  1UYV A;  4FN7 A;  2A81 A;  3DOR A;  1J7X A;  4ZDF A;  5CTC A;  4ZDD A;  3IAV A;  2F9I A;  1XNW A;  3T8B A;  3QXZ A;  2A7K A;  4F47 A;  3M6M A;  4DI1 A;  4RCN A;  3M6N A;  5E0S A;  3P2L A;  2DUB A;  3HE2 A;  3T8A A;  3PGQ A;  1EF9 A;  3JU1 A;  1EF8 A;  3LAO A;  3ZWB A;  3L3S A;  4JSB A;  4KD6 A;  3Q0G A;  4U0H A;  1YG6 A;  1FCF A;  4HNK A;  3U9T B;  1N6D A;  4K29 A;  5DZK A;  4QII A;  4JCS A;  1ON9 A;  3P85 A;  1PJH A;  1WZ8 A;  4MI2 A;  4NEK A;  3ZW8 A;  1FC7 A;  3R9T A;  4FB8 A;  2ZQR A;  2F9I B;  4FN8 A;  3ISA A;  2WTB A;  1VRG A;  1SZO A;  4ZDB A;  4IZC A;  3BPP A;  2QQ3 A;  2VSU E;  4B3J A;  3Q7H A;  5G1S A;  4HDT A;  4KNP A;  4GHN A;  5INI A;  3HLN 1;  1Q52 A;  4KWB A;  1W2X A;  4I52 A;  3NJD A;  5FIF A;  2PG8 A;  3KTK A;  2F9Y A;  3RST A;  3BPT A;  3PE8 A;  4FND A;  5JBW A;  2CE3 A;  3ZWA A;  5DUF A;  2NP9 A;  4WCZ A;  1RJN A;  4RYF A;  3MFM A;  3N6R B;  3IBB A;  3QYR A;  4EML A;  5DL1 A;  3K50 A;  4QIJ A;  5MGB A;  5DU6 A;  4QFE A;  3OME A;  5FUS A;  1EY3 A;  4WZ8 B;  3TV5 A;  3H0S A;  2W3P A;  1WDK A;  2VSS E;  3H0Q A;  5KDR A;  3HIN A;  3G64 A;  5DU8 A;  3R9Q A;  3R6H A;  5DKP A;  4JWV A;  1Q51 A;  2F9Y B;  3QK8 A;  3R9S A;  3TVW A;  4YLH A;  3I47 A;  1OD2 A;  4JOT A;  4JJT A;  3STA A;  4B3H A;  5DTP A;  1DCI A;  2FZS A;  3HRX A;  1N6F A;  4L8K A;  4FZW A;  4I4Z A;  2ZL4 A;  3KTI A;  1WDM A;  4JYL A;  3GF3 A;  3H81 A;  4FJW D;  2D3T A;  3TT7 A;  2VX2 A;  4JCQ A;  5E0S H;  5DUC A;  1JXZ A;  4IZD A;  3VIV A;  5KDR B;  4OMR A;  1UYS A;  3LKE A;  4ZDE A;  4U0G H;  4FZW C;  2X58 A;  1HZD A;  2UZF A;  1NZY A;  3QMJ A;  4G2R A;  3Q0J A;  2F6I A;  4NAR A;  4ELX A;  3QRE A;  1HNU A;  2C8T A;  1UIY A;  2GTR A;  5DZK H;  4EMM A;  1OD4 A;  1N6E A;  2Q34 A;  2ZQQ A;  1SG4 A;  4FNB A;  3TT6 A;  3BF0 A;  3ST9 A;  3PZK A;  2ZL2 A;  4U18 A;  2YJG A;  3TDC A;  4LK5 A;  1TYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...