4JFDD

Preservation of peptide specificity during tcr-mhc contact dominated affinity enhancement of a melanoma-specific tcr
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
196
structure length
196
Chain Sequence
KQEVEQNSGPLSVPEGAIASLNCTYSFLGSQSFFWYRQYSGKSPELIMFTYREGDKEDGRFTAQLNKASQHVSLLIRDSQPSDSATYLCAVNDGGRLTFGDGTTLTVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title T-cell receptor specificity maintained by altered thermodynamics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 34
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 2013-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jfdD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jfdD02
1NGPL 1NANH 1GHFL 3FHQA 3O45B 3G5ZB 4NHUA 4XBPB 5A2KH 4OF3A 5I1LB 3F62A 3QUMH 5GJTL 4EI5D 1QFHA 3WXVH 1K4CA 1PAMA 1I85A 4LQ1A 4KZDH 5AYQA 4KMTH 2BHZA 5L7XH 2ZCKL 4KAQH 4LCWA 2FZ3B 2VN7A 3ZTNH 1RHHB 3ECBB 2NXZB 1JGLH 5H37H 3X12B 2H32B 1BVLB 1A14L 5D8JH 3T0BA 4XI5C 3VWJB 4UT7H 4Z0XB 1A7OL 1NMCC 4YGAB 3V4PL 2VXSL 5H35A 5D70H 2HT3D 4PP1D 3F5WA 4YHKL 3SCMA 1M6OB 1EHNA 3BSZH 1J0JA 3FN3A 1U8PB 3WLBA 1HXMB 5D7JA 4QRRB 4R3SB 4J3WA 1CDIA 4K07A 1T0MA 2X1OA 5DD6A 3QZWB 1MRCH 3SJVA 5EULV 7FABH 1SJVA 4A6YL 5F3HA 1C5DA 1WWWX 5H2BB 4X9FA 3O3BB 4R96A 5MHSE 1EJOL 1NQBA 3DXAD 4YK4B 2FJGA 5KVEL 5D6DC 3CIQA 3UDWA 1G9MH 5FYKH 4EN3B 5HTSA 4W4OA 2FEDD 2Y4SA 2Y07L 3NH7H 1LDPH 2ATPA 3KYNA 1ZT7A 1F3DH 3IU3B 3ZDYE 5HVFB 3O9WC 2OI9B 4QRTA 3SGJA 4I5BA 1W0VA 4PGEB 4P5MB 3O3EB 5GGTL 1AO7A 3S4SG 3TIDA 1QNZH 2F58L 5IB5A 5IEKB 43CAA 4BH8B 3SGEI 4QHKJ 2RQ8A 3QNXA 2BSSA 5GRZA 5F44A 2D3VA 4KROB 4XP5H 4OZGF 4FTVE 3VE0B 5C7XH 3HCVA 1N0LA 2VQUA 2WUCH 3PWLA 1N59A 2L7JA 5DK2B 1NFDA 1TTUA 1F42A 2Q7YA 1INQB 5I76B 5EWIH 2R0ZL 1HQ4A 3GBNH 1BZ7A 3NZ8B 4XGZA 1KYOK 1RJZA 1AIFB 3TESA 5HXMA 3SN6N 3D87B 4K9EH 4KI5D 2VLRA 3QEUA 5C07A 5TF0A 4MX7A 2JB5H 1CIDA 4NNYB 2Y72A 4M1GH 4XPHH 4XAWH 5EIVA 2VAJA 5ICYB 2X4SB 2VXVH 5BVPL 3OWEA 3CUPA 3FO2A 2FD6H 5KAQG 4DKDC 3MRCB 1OSPL 4QF1A 3GMPB 4XPGL 3GRWA 1NPUA 3FQUA 4I4WB 2NXZC 4LSPH 1CCZA 1CD0A 4GRMB 4LPVA 4ZG1A 1J1XL 2VWEE 2OS7A 3VWJC 2IBZY 5T33L 4KKCD 4Y4HB 4LOUC 1I9JL 3BZ4A 2Z92B 5DUPL 4MVBC 1BGXH 4QRUA 1H3XA 2FX8H 4RWYL 4WFGD 1DBJL 4KQ4H 5IW1B 2PTTA 5IB4A 4NDMA 1I9IL 4QKXB 4XNYL 2XV6B 1WBXA 4LVEA 2DJSA 3GNMH 3R1GL 4NQCB 3QIWB 2PCPA 2BCKA 3U1SL 3ARDA 1WIOA 5DFWH 3CMOH 2R2HB 2DQCL 3HC0A 1FNGA 5JMRA 4ELKB 4IHOA 3IDNB 4B5EA 1CXIA 5AWNH 3IETA 4K7PY 1NLDL 1UWEL 1HHHB 2R4SL 4EN3C 4JFFA 2R0KL 2C7UB 3LQAH 3IDGA 2A2QT 3GGWA 1S7WB 1UKQA 3VXOA 4NT6A 3O6KL 3HAEG 3QISA 5JPNB 1BF8A 1I4FA 1NLBL 3CXDH 5SWSD 1NGZB 3EKCA 2BSRA 1N5YL 3BKYL 4QXTA 3UYRL 3RX5A 2Z35B 1NEZG 4ZTOL 1A1NA 8FABB 1U3JA 2IF7A 3GO1L 5DFTA 2AJUL 2C3XA 2J6EH 1JMZA 5FUOH 1C12B 3KPSB 4N5EC 4KROC 2AQ1A 4XC1L 5CZXD 5I1KL 1R3JB 5E2VH 2DICA 1RUQL 1YPZB 1G9NL 3KR3L 4JZJA 4JO1H 2E6PA 1ZA3B 1DTUA 3HNVH 3JWDL 4N1EA 1YEJH 4Q2ZA 5KSAD 1CFQA 1YZZA 3QXDB 5CJXA 2IQAA 3SPVB 2WBJC 5EBMA 4ENEC 4XZUA 32C2B 1X4ZA 4UQ2B 4H5SA 5CS7A 4GSDH 1K8DA 1QSEE 3RWCB 5EO0A 1FZJB 2FBOJ 5J12B 3MUY1 5HY9B 3MLWL 1AXTH 3VXRE 4EBQH 4M8VA 4IRSB 4JPVL 1F90H 1A5FH 5I8KL 5I1EL 3I02B 3UBXA 1QR4A 3IJHB 4P49A 3Q5OA 1J5OL 5E1AA 5AZEL 3OR6B 3OKDA 1I1YB 4DVRH 4ZMAT 1QPPA 4KK6D 1CGSH 3LRSA 2DYPA 3BI9X 1KEMH 4JO3H 4HIXL 4PYGA 3RNKB 1HHIA 3QIWC 4MCZB 4ODHH 4Q6YA 2EC9T 4YFDB 4APQD 3MQIA 4NKMA 3TO4B 5IKCA 2PF6A 3G6JF 1OQXA 3OSKA 1PZ5B 4YDVB 5JOEA 4Y5XA 1CGVA 5D7LA 5I18H 1F11A 2W0PA 5AEAA 1U3HC 5GISL 5AYUH 4K55A 3V5HA 2QSQA 2ZSVA 5J6GA 1MCLA 4K2UL 1FYHB 4U4BA 1QEWA 4CAGA 1I7ZB 3ZKXB 4I3SH 1DJSA 4IM8A 3BWUC 1JYNA 3VI4F 5ISZE 1RJYA 3S35X 5I16A 2OL3A 2NLJA 3BIKA 4LSUL 1NUDA 4YDKL 3QCVL 4G8EB 2KUTA 4OKVB 2JCCA 3CSYB 1IKNA 1IC4H 3HI5H 5FIEA 3TPUA 3VGBA 1QPXA 4NUGL 4MNGE 1J0HA 1ZT4B 2UY6A 4LCUB 4HG4K 1XF5A 3UO1L 4MWFA 1KIUA 5JHDB 1A47A 5AUMB 1BVKA 4NM8L 3ETBF 1T89C 3L1OH 2BDNL 4LLVB 5C09A 3DTXB 4NKOA 3IT8D 5IQ9A 1ES0B 4O4YL 1IBGL 3FN0L 1NANI 4OFIA 4WUKL 1NSNL 1LK2A 2F54D 5I1IL 1FCGA 3O2WL 2VLMD 3H9SB 3C5JA 2OBGA 4HCRH 5HYQB 2CQVA 3ZE1E 2AJXH 4XCEA 1E4JA 3KLHD 2Y06L 3P0YH 5BZDB 3OAYK 2PYFA 4Y4KC 3P11H 4NNPL 3Q5TA 3S36L 1KCVL 3W0WB 4HS8L 5GGVL 2DL2A 4CUCA 3HRZA 2X44D 4X5WB 4UIKL 5F9DC 3EBAA 3OR7B 2YR3A 5DI8B 1WITA 2UWEB 2DQJL 2NYYC 4PBWD 2XT1B 2A73B 12E8L 3QA3A 4HSQA 4CMMA 2EDBA 5LG1A 4YNYB 4N9OB 2IAMA 1E4WH 2JK5A 5EZOH 2VLJA 5CEZE 3LDBB 2DQIL 3EHBD 4NRYB 2F8XC 4AG4L 4K8RC 4O2FB 3WIIH 3WJJC 3ROOB 3K2UL 3V2AR 4GG8A 1CBVL 1U8IA 3V8CA 4PUBH 5F7NC 3LD8C 2OM5A 1FNEB 2B2XH 1RZ8B 3OTTA 4WTXA 5I8EA 2YN3A 1OL0A 3TYGH 3OKKA 4FQLL 4AEHH 3FQRB 1TQBC 3O8XB 3G5VA 5EUOF 3VGAB 2C4FU 1F13A 3L9RB 1FG9C 5KJRL 2HH0H 2VZUA 1V3MA 4ZUTA 4N9GB 5E9DD 5F1NB 2X4QA 3CC5B 5LCVL 3ULUH 4PJ7F 2Q7NA 1W0WB 4L4TA 5CCKL 4RMTA 3VDCA 4F3FB 3MUGB 5DJAB 3MNVB 5FUZH 3GMQA 1JV5A 4E9LA 1U58B 1BBDL 1G7IB 2PYED 4OLZL 3C8KA 3GSWA 3RL2A 1D5MA 1QA9B 1U8MA 4LKCB 5L88H 3JV6A 2P5EE 2VDML 3KXFD 3NA9L 4JFHE 1NBZA 1CS6A 4QHMA 3G5YA 3WIHL 3KPTA 3T1WA 1VFAB 3ESVF 3N0PB 5DS8B 4NQVB 5HHXH 5L6YL 1FE8H 5K9OB 2EDEA 3O0RH 3N1QC 3QUKB 1J12A 1FFPB 1CD9B 4HS3B 1RAMA 4TULL 1EXUB 5D1QD 1K8IA 1T6WA 3SBWC 5C0AE 3OKEB 2E7MA 5C0FB 5E6IC 4XXDB 3QRGH 5EH1A 1AY1H 5INDB 4A6YA 1BIHA 3IDJA 5SWQA 4U7SA 2GAZA 5J1AA 2P8MB 2Q1EA 4H0HB 1UA6H 4DN3H 4PJ9A 3QQ4A 4L3CB 1J8HB 2A9ML 2NNAA 1YNLH 3PXHA 1I3RB 4WI3A 1EMTH 2R1WB 2E6JA 5ACMA 3KPOB 3TCXA 3RL1A 1GZQB 1INEH 1KPVB 4DKFL 3WNNA 3BQUA 1Q9LB 4NZDA 3HG1A 3MACH 3LDBC 3O4LE 1MFNA 1P7QA 2P5WA 5EUKB 5GGTA 4K7PL 1LP9B 1Y18A 4MA3B 2CJUL 1E27B 1GGUA 3EO9H 5GS0D 1YECL 1G7QB 4OTXL 2EDRA 3S97C 5B4MD 3C6SB 4YEFA 1QUNA 1TITA 3QEQE 2CIIB 2HLAB 3ZL4H 5HYSA 3VGAC 4DTGL 4WHYG 5DD3H 2PR4L 3MODH 3HKFA 3IRPX 4FQ2H 4MJIB 1S5IH 2ADJA 3VFUA 5FYJL 5DJ8B 4W68A 4RFEA 3UJIL 1S7XA 2Y5TA 3S8WA 1HKLH 4JFDB 3QWOA 3MA9L 2CMRH 4GJTB 1YDPA 1RD6A 1FV1A 2X4NA 5I8OL 3QUZB 3TYFB 4R4FH 5F88A 1JNLL 4CVZA 3P73A 5D1XB 1RULL 4X6BA 4J3OC 1UT9A 1DE4B 3Q6FA 5DEFB 5BZWB 4AQ1B 3TO2A 1U91A 3H7BA 2VKXA 3UTSD 4WFHE 2QQLH 3MGAA 5HDQH 5C08E 1I7TB 4R8WL 2EH7H 2G9HB 3V6OE 4RGMB 3ARPA 2X70B 2GITA 2PTVA 2R0WH 2CLRB 3GDBA 1KIPA 3IAGC 1IC1A 1I8KA 5DMKA 1RZIA 4G3YH 4E42A 2NY7H 2YUXA 1T1XA 1ZVSA 1G6RB 3WFCL 3MRHA 1IFHL 1QFUL 4P3CL 5TDNA 1XZ0B 4Z0BH 3BD3A 2WINA 4MJ5B 1MELA 1BAFH 2NY5H 5DT1H 5HHPA 4KHXH 4HH9A 5FK9A 4D0CA 3DI2B 4PB9H 3UTTD 3B9KA 4QRSA 5F7KC 1J18A 3H42L 1T22B 3VD9A 5CD5C 3P2TA 4LVNB 5FYLH 2P44B 2EIDA 4WU5B 5DRZB 4JRYB 4MAYA 4G6KL 1ERNA 3GUTA 4UINL 5TQ0L 3B3IB 2YUWA 3IDIA 3ZYIA 5JXAL 1ZHLB 1BD2A 1A9EB 2AQ2A 2QR0B 3MRDA 3MXWL 3W39B 5JW4N 3VXUD 1VGEL 2VLKD 3VCLA 1T66C 4EDWH 5EU3B 3U9UA 2BNRD 5I1DA 4UOW1 3C5ZD 5FKAA 2YMXL 4S0SD 4PS4H 4AIZA 2RCSL 3D18A 1JGVH 1OLLA 4JPKH 4NP4H 5ELIA 3SDYL 3HAEB 5GS1B 1HE7A 5AZ2H 4D9QD 1N26A 1FLRL 1L9NA 4GUPB 1BZ9A 1QOKA 4KMQA 4XCNA 1DVFD 4DUVA 1NGQL 3FN9A 1JPST 1FL6B 3OKMA 4G8GE 3WL9B 5DJZA 1WBZB 3LN9A 4HFUL 4N8CL 2BXYA 3MGTB 1GC1H 3MYZA 3OX8B 3CX5K 1I9RL 4MB3A 2AKRA 4KMLB 1AKJB 5J3HC 2Q86B 3EFDH 3QUZC 3M8OH 3T04D 2F53B 1N8ZA 3BP6B 3PL6A 2AJ3B 4GLRH 2X05A 5D1XC 4X6DA 1GPOH 1IGTB 4Q58C 4KVCH 4ODUA 1LQSR 3HE7B 1F00I 2N4IA 3MA7B 1CDYA 3GEWB 1R5IB 1TJIH 5IJKC 1REIA 4Z7QE 3TT3L 4PLKC 4RGMC 2H8PB 3WJLA 4I77H 5T3ZE 4OZIE 3HR5A 1EFXA 4L8CB 1G7PB 2HJKB 4X5XA 1KCLA 2NX5E 1FFNB 5IMOB 4IMKC 5F7DB 4NQED 3SO3C 2GTZA 4GW4A 3GKZA 5EOQL 4LL9A 5EZJB 4XNMB 1MRFL 3MRJA 4OF7A 4P5TD 2GYSA 3SQBA 1FZOB 5BXFB 2ATKB 4B41A 1A2YA 3VXSD 3KPLB 3SDDA 2Y23A 3H0TB 1FGVH 4RISL 2ZNXA 4KRLB 4XNZC 5LKNA 3REWA 3TIEA 5CHNB 4CJ0A 4PJAB 2J8UE 5DC4B 2NY3D 3PV7A 4WU7B 3L5JA 1M05A 3CFJB 3X11B 4NC2B 1QSZA 2R0LH 4XXCC 1WAAE 5K9JL 5FAAA 4HUVA 1ZHNB 5JQ6L 4CL7A 3G5XB 4S11A 2EO9A 3QUXD 5IJVB 5I0ZA 5HGAA 5F7LB 3X13B 4LHUB 2ITCB 3HC3L 4KY1L 5ESVA 1XF2A 5TQ2L 3REVA 1NC2B 1VACA 4HJGB 4U6YB 1A3LL 1MCBA 2NR6D 5L2JA 3MRBB 3RA7H 3QHTC 3AS2A 2DLFH 5CUSH 1MVUB 2ICWJ 5C0BD 3BZFB 3P0VH 3JSSA 5B3NA 2NMSA 2XZCH 4LEOA 2DQHL 1RIUL 1OAUH 2DTSA 3P30H 4NBZB 4FFYH 4NHUB 5A16A 4PJCA 5CJQL 4RAUB 4XMKL 1S9WA 5DZNA 1K4CB 3NABL 4XBEH 2A77L 2EE3A 1X7QA 1UEMA 3UX9B 4PJHE 4UTAL 4Y88A 3VXPA 4ZOEA 5I19L 3HLAA 1MCWW 4ODXA 4BZ2L 1T83C 5E0QA 5FGBA 1KTRL 3OB0K 4I1NB 4QCIB 5DRNB 1R5WA 2IQ9H 2ZNWA 5KVFL 1LEIA 5ID1A 5I1HL 3CXHK 5EU6E 5H35B 1OM3L 5EA0H 3O6FD 1XIWA 1IVLA 3SCMB 3ZKND 3CZJA 1Q38A 1ZEAL 3KG5A 4JFED 1TVHA 5HYFA 5D7JB 5ETUA 5CZVL 4KPHL 3P4OA 4I13B 1C7TA 1QSEA 1T0MB 3EYVA 5DD6B 3SJVB 1S7RA 4N68A 1C5DB 5TGBA 3RKPA 3V95A 4R96B 3NPSB 5HHNA 1UB5A 2BY0A 2FJGB 5HI3C 2QQNH 3K1KC 5D71H 1QHOA 4LRIA 4CU8A 1GL4B 1ZLSL 3UZQA 3AC0A 2VQTA 5T3ZL 1QSFB 2ATPB 3KYNB 1Q9OA 1ZT7B 2VE6B 3DETC 2A74A 4TSAH 5DJ0A 2NY2C 4MD4A 2VXUL 4QRTB 4I5BB 1W0VB 5CSBA 4YUEH 1AO7B 2BNUA 4S1DC 1HK6A 5IB5B 4CADA 3ARTA 2NXZD 3QNXB 2BSSB 1RU9L 2O26U 5FF6A 3HI6H 3BEVA 1UYWL 1B2WL 3MTRA 2OJZH 4M5YH 3VWJD 5DMGC 4PRIB 4LOUD 3HCVB 1N59B 1NFDB 4MVBD 1OTTC 2Q7YB 3WIHA 5BJTA 4XGZB 1HQ4B 1BZ7B 4YPGB 2XPGA 1CLCA 1RJZB 1YN7B 2PETA 3V6ZA 4XRCA 2OP4L 3QEUB 5C07B 4JPWH 4Z77A 1UWXK 2OK0L 5ISZA 2NTFA 1CQYA 3ZKSD 4LLQA 4X98B 3S5LA 4YDLB 4LSTL 3IFPB 3CUPB 3FO2B 4BELD 1I85C 5F1SA 1BBJA 3HE6D 5GGUA 3QG6B 1UXWA 2J4WH 2Q8BL 4QF1B 3A6CH 4H1LA 1MFBH 4EN3D 1MJ7L 3FQUB 5IT2H 4MNGA 3ULVH 4YHLH 4ZD3L 5DUMH 5LWYL 3DBXA 4JG1L 4OIIL 1VFUA 4YBLC 1T20A 2F5AH 4LSVH 4QRUB 1RY7B 3KNBA 2CUMA 3B2UC 3MLRH 1JRHH 2PTTB 3SCMC 5EN2A 5IB4B 1IEBB 4NDMB 5IEHA 1WBXB 5FFLA 5D7JC 5BS0E 4ZOAA 2CKBB 4KROD 1MCPL 4FZ8L 2GT9B 2LU4A 2BCKB 1KN2L 3ARDB 4WO4A 2E27H 4HEPG 4QRPE 3HC0B 2AJZA 4QEGA 4IHOB 3UJTL 1BEYH 3PQYE 2J8OA 3IETB 3NPSC 2VO5A 3NAAH 1DUYA 3IDUA 1K2DA 5CMAA 3UDWC 4UTBL 3I2CH 4W4OC 1J0KA 4JFFB 4MXVE 4PJ5E 1VFMA 5C71A 5D7IF 2XTLA 1QLEH 1SM3L 3IDGB 4DKEL 3GGWB 2Z8WC 3I6GA 3VXOB 3MXVL 1YJDH 5F1OB 4AH2B 2OZ4L 4P23B 1BPVA 1I4FB 4RWHA 5LQBH 4NC0B 3MLVH 4QGTA 3KDMB 2VAAA 3SGJC 2BSRB 4WI7A 4QXTB 2X09A 2X7LB 1A1NB 3F7RA 3WKML 4HD9A 3MLZL 1G1YA 2XRAH 4Z7WE 1ZGLP 4YFEA 3B2VH 3S7GA 4ZS7L 4W6WB 2I5YL 4Y4HD 1IQDA 4I0PB 3TJEH 3MRIA 2D4FA 5DQDL 4ONFH 5ALCH 2O5YL 3WDIA 1II4E 2PNDA 2XA8L 3K4AA 4MA7H 3P77A 5DFVC 2UYLA 4OLVL 3LS5L 1PEZA 4Q2ZB 1CFQB 4NQCD 4M48L 3QIWD 5T1KA 4PRDA 3IFOA 1I3GH 2IQAB 4PREA 5EBMB 1T2JA 4KRMB 4H5SB 1K8DB 4RSVA 1KULA 3SDXF 2FATH 2FX7H 5DD5H 1T21A 1KENH 3BT2H 4O2CB 4ETYA 4TNWF 4GLRI 1F3JA 2ZZUT 2G60H 5D72L 1YEDA 3S35H 1AH1A 2PO6A 2P5EA 1BWWA 4QXUL 2OX5A 5E1AB 1ZVHA 4P9ML 5DK0A 3OKDB 4DUWA 3LRSB 4LARH 3SQOL 2GJZA 4O58H 1ZTXH 2W9DL 3HMXL 1CG9B 2DYPB 2NY6B 3RGVA 2BJMH 3RDTB 4RCAA 3KPSD 1UQSB 1EV2E 4YO0A 1V05A 1ZGLB 4NKMB 3ARDC 3VJ6A 5HHQA 4PRAA 5C0AA 4Y5XB 4U1JA 1XT5A 5D7LB 4L8BA 5BMFH 4ODWA 5T1MA 1KTLA 5DD0H 3V5HB 2ZSVB 1JJUA 1ZA6A 3BHBA 4YXLL 1QEWB 1HILB 1BX2A 4Y19A 5DC9B 4MCYA 1RJYB 5I16B 3O2DH 1CE1L 3MBXH 1N2RA 1VDGA 2NLJB 1ZLWH 3BIKB 2WWMC 4F15B 1Q1JL 2ICWI 4ZDHA 3FL7A 2JCCB 4IRSD 1OLZA 3UJJL 3O4LA 4MJ2A 4Z7UF 3TPUB 4OLEA 5C2UB 4AEFA 4F7EA 1FIGH 35C8H 5EU5A 4R26L 1XF5B 1CLYH 4OCXH 5F6IB 4KUCD 4JZJC 2BRRL 4LPCA 3QEQA 3RVTC 1J1OL 2NY4B 1BVKB 1JFQH 3ARBA 3Q48A 2X9XA 5FDWA 5C09B 4FFVC 4NKOB 2DM3A 5IQ9B 3GJFH 4MZ3A 3HNSH 4I3RL 4K8RD 5CJXC 3TO4D 1Z0NA 1CLZL 5JOFB 1MQKH 3R06A 1A1MA 1QP1A 4CKVX 1VESA 1I1AC 1LK2B 1FPTH 3PWNA 4X6EB 4WNQA 2Z31B 4KHTH 3C5JB 5GS0H 3BRFA 5IFHL 1JPGA 3GMLA 4XCEB 2DM2A 1FAIH 3CFEA 2IG2H 3QO1A 4NN6B 2XACC 2PYFB 2C4XA 4JO2L 3I50L 5B8CA 5FKPA 4ELME 3IFNH 4DGYH 3HRZB 1UKTA 2BVUA 3L95A 4PJBF 5GJSH 4TTDD 1WUNT 5C08A 4N5UA 2YA0A 4JQIL 5CJOH 2B4CC 5CLWA 1CVRA 1MHHA 3V6OA 3NVQA 1HN1A 1NAMH 3QA3B 5GRYA 3RIAK 4A2MA 4OLXH 4OV5B 2NY6C 2ID5A 3CH8A 1JP5A 5GIRA 2JK5B 3P0GB 2VLJB 1TXKA 5E00A 5EZIL 1NKOA 3T77A 3RX8A 1EVUA 3F8UB 2ITDB 4JKPL 2RB8A 1EUTA 4JFOA 4YXHL 4GG8B 4OZHE 1KYOJ 1U8IB 5KVDH 2HMIC 2CK0L 4LGPB 4Y5XC 1RZJH 5JHDD 5I8EB 4OZFH 4CNIA 1IC5L 3G5VB 3IRZA 4M7ZC 3QFJE 4RGOL 4X7FC 1UM5L 4LPWA 4M93B 5A2FA 4ZUTB 2X4QB 1MCIA 3BWAB 1A4KA 1QFOA 3H9SD 2UZYB 4TPRL 4L4TB 1VPOL 4F15C 4V2CB 1E4XH 4G6JL 1BWMA 2YHGA 3GMQB 1JZ6A 2IALA 1JV5B 3VXMD 2BC4A 5D2LE 5HDLA 1IKNC 3T08A 5TFSL 3GJFK 1T1ZA 3W0WD 3IDXH 3EOYG 4DW2L 3C8KB 1MAJA 3RL2B 5HYJE 2H2SD 1ACZA 3EJYD 3JV6B 5ENWA 1A7NL 1X6NA 2BNQB 2F9BT 2W9LA 5FGCB 4WVRA 1NBZB 1A7QL 1ZHKA 3FB5A 4HPOL 5DTFA 4QHMB 1F4WL 4Z95L 5HD8C 3N06B 4PJ8A 3PWPB 2P47B 1C1EH 5F7EH 3CFCH 1KCRH 4G8GA 1EEZA 5IBLC 2YPLA 4XP1H 1J87A 1QRNE 4NQUA 5IFAH 1K8IB 4HLJA 1VEPA 3O8XD 4O02L 2XY1A 2R15A 1KTDA 4A6YB 3D39E 1IGMH 2ZCLL 3IDJB 3QDMA 5SWQB 3QXUA 2EDFA 5J1AB 1CFBA 4UT9H 1CDJA 5EPMA 3QXAB 3EIFA 2CRIA 4R6UA 1JI2A 2R2BA 3QQ4B 3DECA 5JIIA 3OJ2C 1K6QH 5JW5A 3TNNA 1M4KA 4Z7NE 4NC1E 1B4JL 2DKSA 4EXPX 4YHML 1GH7A 4X9BA 3RL1B 4PJGF 5EUOA 4OCSH 2R29H 3BXNA 3BQUB 1EVTC 4NO0A 2IAMC 2MPAL 2NX5A 1JRHI 3HG1B 3QB7C 5HGHB 5FO8B 3OKNA 1KJMA 2AEPH 2P5WB 5DJ2A 2BVTA 1Y18B 2R56L 1CQKA 2QSTA 2A6DA 2ZP0T 4ZSOE 4KK5D 3BX7C 5HDOA 5J9PA 3FRPA 3QYCA 3KAAA 4O5LL 4M93C 3W5MA 2J8UA 2VC2L 2ADJB 4PLNC 1KPRA 3VFUB 3MLYL 4RFEB 1S7XB 2XOTA 2Y5TB 1KB5H 3QWOB 1WAAA 2AXJA 4S10A 1FV1B 1A0QH 3K2MC 2XQBH 5F88B 3NFNA 4JN1L 5GZND 5KVGL 1F6AA 4CVZB 3VH8G 3P73B 4X6FA 1AJ7H 1OGTA 4X6BB 3E0GA 2ZJSH 1QBBA 3FO1A 5I15L 3Q6FB 4MYWB 5C6PB 3TO2B 1U91B 1NKRA 2BVQA 4Z78A 2R1XA 5E2UH 5E8OA 5ESQA 2P43B 2VL4A 1VEMA 5BV7H 3G08A 2IPUG 3QUML 4TVPD 5IVXF 4EZMA 1JZ4A 5HI4C 2GITB 2IH1A 4LMQI 3KYOA 1LVEA 1UJTA 3WXVL 1T66D 3FB7A 1I8KB 4KZDL 4KMTL 5DMKB 5L7XL 1RZIB 4KAQL 4E42B 3HPLA 3ZTNL 1T1XB 1NMAH 4QGYA 1MH5A 1KGCE 3MRHB 1JGLL 5TDNB 5IHUH 4HHAB 3TBVA 5D8JL 2WINB 1P7KA 2WWKT 4UT7L 5IK3A 1UACH 3AU1A 4MJID 2QKIA 4HH9B 5D70L 1W8OA 2OR9H 2V5RA 3B9KB 4RZCA 3DO7A 4PJHA 4PJ9C 3L5XH 4JM2F 2XQYK 1R24A 4JFDD 3U4AA 2X89D 4MAYB 4M62H 5JUEH 3GUTB 3DYPA 3GHBH 3QUZD 3IDIB 2OZ4A 1DZBA 3U7WH 5D1XD 1MRCL 3BQUC 3THMH 7FABL 3KPMA 5EU6A 4R90H 3VCLB 4GBXA 5JIHA 1NCTA 2KDGA 4G6FB 5I1DB 4MXQC 5FKAB 4N8VA 4AIZB 1G9ML 3D18B 5FYKL 3BH8A 3NH7L 4PLKD 1LDPL 4FHBD 4UOW0 1F2QA 3LKSA 1BZ9B 2ZCHH 1BF2A 3DV4A 4XCNB 3LEVH 1GAFH 4WTWA 2I9TA 1QNZL 1CLOL 5DJZB 1RZKL 3CJJA 3PP3K 4JRWA 3SKJH 5KG9A 2AKRB 3H3BC 2NTSP 1OD7A 3RRQA 3N50A 4WUUE 4XP5L 1N8ZB 5C7XL 3PL6B 2WUCL 3NCFB 4S1SH 1FYTE 4FXGA 3VGGA 5EWIL 3NZHH 1XGUB 3GBNL 4X5LA 5J6HA 4ODUB 4HWUA 2GJ6E 3WS6C 4JRYD 4K9EL 2F5BH 3X3GH 2V2WA 1L0QA 2Q20A 2JB5L 3QDJE 1CT8A 4FTVB 4M1GL 4KXZH 4XPHL 4XAWL 2XWJA 1NFIA 4HF5H 5DJ6A 3S37X 1I8LA 3HR5B 2GI7A 2VXVL 4X5XB 1L6ZA 2FD6L 5J56B 3TWCH 5E2JA 3HMXA 4G9DA 2VZ1A 1EAJA 4OM1H 5EBWA 3SO5A 3MRJB 4S2SA 3IKKA 1I8IA 4LSPL 3QPXH 4Y4FA 5CIPA 1A2YB 2EIBA 2YRLA 4IJ3B 3HHRB 3SDDB 4FQCH 4F7MA 4HW6A 5DR5H 1XCTB 4X7DC 2I60H 4GS7B 2CUHA 1BGXL 2FX8L 3U48A 4KQ4L 3B6SA 2DD8H 3B9KC 1C08A 3QUYD 1MFDH 3GNML 1M05B 4MAYC 2X9YA 1IAMA 4U6HA 3WS3A 3I6LE 2BX5A 5KBNC 3QJFA 3CMOL 4HUVB 2XNAB 1L7IH 4I48A 3D0LA 2A6JA 1LD9A 5AWNL 3HE7D 2ZSWA 1KC5H 3TBSA 2QLVB 3RZCA 1BFSA 4WTZA 5HGAB 5BS0A 5ESVB 4IS6B 4N90E 3REVB 3LQAL 2FHBA 4QRPA 3EO1A 1VACB 3HZYB 4Y5VA 1G9NC 4PD4K 1S9YA 3CXDL 2X5PA 3PQYA 5D7KE 3TN0A 2X10A 3U0TA 3ZMRA 3JWDC 4LEOB 5SV4A 4K3EH 5T3XD 1O7SA 2GEEA 4PRHA 4PJ5A 5HDBF 1BQHA 2J6EL 3LN5A 5FUOL 5A16B 1EA9C 3PL6C 1A7PH 1MWAA 5HI5D 1OOAA 1E4XI 5E2VL 2MFNA 1LO2H 3C8DA 1S9WB 4HX1A 4JO1L 5FA3A 5C0DA 3QDHA 3L3GB 2EDJA 1X7QB 1I1RA 3HNVL 5MEND 1YEJL 4YHKH 2NZ9C 3P9LA 2SEBA 4Z7WA 4ZOBA 3VXPB 1EO7A 3MGOA 4GG6E 3ARFB 1JF5A 4ODXB 5I71B 5HHMD 3WJLC 4N0RA 1R5WB 1FGNH 1LEIB 5ID1B 4ZO7A 3MLSH 5E8NA 1GIGH 1XIWB 1Y6NR 3C60A 4ZFZB 1AXTL 4LHUD 4XPAH 4OLWH 5JQHC 5ETUB 1F90L 1A5FL 3R0NA 3QCTH 1KT2A 3P4OB 5DMGD 4IJ3C 3SDDC 4QTHA 1P9MA 1QSEB 3EYVB 1MNUH 3SDCA 2A83A 4WI6A 3VGDA 4DVRL 3ULUE 4BZ1H 1CGSL 5C6TH 1S5HA 5TGBB 1JZ3A 1UENA 4HLZH 3VXRB 5F7HA 3GSVA 5HHNB 3D3VD 1UB5B 4LSSH 1KEML 4JO3L 2EEBA 3LSOA 4ODHL 2VWEC 2HYMA 5D9SA 3IGAA 2GCYA 1Q9OB 1RZGA 2A74B 5DJ0B 4MD4B 3TEUA 5I18L 1UM6H 4KI5F 3TC9A 3DUSA 5AYUL 2R0ZH 4V2BA 4HKZA 5I66A 2CRYA 3G04A 1FVEA 1MVFA 1P4IH 1QKZH 4CADB 1KTKE 4QTIH 4I3SL 2FECI 3H8NA 4R2GB 5FF6B 3BEVB 1AI1H 5KS9F 2DB8A 1IAIH 4IIQC 3SOBH 5DEGA 2OTWA 1SVZA 3L7FA 3SHSA 2CGRH 5BJTB 3SCMD 5F9JA 4I18A 2M1KA 1CTOA 4LPUA 5D7JD 4J4PA 2G5RA 1IC4L 3HI5L 2P8LA 4Z77B 2YD6A 5ISZB 2NTFB 1UZ6F 3VA2C 4LLQB 3SJVD 3R0MA 1JHKH 5T33H 3JXAA 4QRQA 1JF1A 3DV6A 5IBTH 1HNFA 3MNZB 1BBJB 3ZKMD 5CP3A 5GGUB 1UXWB 3L1OL 4H1LB 1I75A 5KSUA 2OXGA 3TVMA 4MNGB 1ZHBA 2FJFB 5I71C 5LGJA 4NRZA 1QSFD 3EDEA 5FGBC 1ZLUK 3VW3L 3DBXB 4HMEA 4JZOB 1EGJH 3B5HA 4HCRL 2Y5EA 1T20B 2AJXL 1XIWC 3P0YL 4LASH 2RHEA 3P11L 4CJ1A 1MQ8A 1PKOA 3HC4H 2FX9H 4PRID 4EUPG 2DWEA 3EW3B 3O6KH 2GY5A 5FUCE 1CDUA 5DHVA 2BOBA 2AJZB 3U2SB 5I2IA 3SKNA 2WZPD 1DUYB 3LHPL 1K2DB 1ND0A 5CMAB 5C07D 5TDPA 1E4WL 5EZOL 2IAND 4ELMA 2ESVA 4LRIC 4JRXD 3WIIL 3I6GB 3G6DH 3MRQB 4PUBL 15C8H 2B2XL 1O7VA 1P4LA 2VAAB 3KR3H 4NPYA 4HIHA 3TYGL 4AEHL 5F6HI 5KN5A 5DQ9B 1EJ6A 4FOMA 3FONA 4URTB 2I26N 4GRLD 1NCAL 2LE9A 1X5LA 4R2GC 5CINH 2HH0L 4OZHA 4X99B 1IQDB 4HFWA 3ULUL 3MCG1 2V6HA 2FHFA 4F80A 1WZ1H 3Q6GH 4MD5A 5FUZL 1NL0H 3P77B 2UYLB 4WW1A 5I9QB 3QFJA 3MREB 1U8KA 3BDBA 3OKYA 4PRDB 2F8VA 3IFOB 2WNGA 4PREB 3ARDD 2H41A 4G9FE 1YEGH 3BH9A 1OAYH 1UWGH 2A0LC 2YUZA 3INUH 3TBYA 1T21B 4AM0A 1S7UA 1F3JB 5D2LA 4KKLC 5HHXL 4BKLB 4G7VH 1FE8L 2E9BA 5HYEA 3NMEA 4JFFD 3O0RL 1JN6A 3PV6A 5HYJA 3KVQA 1A6WL 2PO6B 2C1PB 2P5EB 4DN4H 4P23D 3IS0X 1ORSA 1WFUA 5DK0B 2YPVH 4UB0H 5FGRA 5T1LA 4KXZI 4YHYB 3TJHC 1KXTB 3J7HA 2GJZB 1OSZA 3QRGL 4POZC 1GOGA 3QQ9C 4JFZH 1AY1L 4U2ZA 1ONQA 4PR5B 5D7IA 2F8OA 3RVWC 4YO0B 3VI3F 3MMEB 1UA6L 4WO4C 3VJ6B 4I0PD 4DN3L 5HHQB 5IGXH 4PRAB 1P84K 2ENSA 4CN4A 1YNLL 5C0AB 2WP3T 1BJ1J 4OUUB 3CK0H 1EMTL 3RVTD 4U1JB 3HZVA 4I2XE 1KXVC 5T1MB 1KTLB 1INEL 1ZA6B 3BHBB 4FFVD 2VLLA 4MJ6A 5DURB 4ZS6D 2QTEA 3Q3GB 3MACL 5JOPD 4WGVB 3JUYA 1BX2B 1ACYH 4RGND 1RK1A 3EO9L 4Z18A 1N2RB 4FG6C 3RWFA 3GSNH 1E28A 2D0FA 1MCKA 1N0XH 3ZL4L 4ZDHB 5IWLA 1ZWIA 1W72A 3ME0A 5DD3L 3O4LB 4JY5H 4KH2A 3MODL 4P46A 3ZYOA 4FRWA 4OI8A 4FQ2L 1ULVA 4D8PB 1S5IL 2ADGB 1S3KL 4O4YH 4F7EB 5I8CA 5EU5B 2VDNH 1WEJH 1ITCA 2E5EA 3C2SA 1HKLL 4JR9H 1IGYA 4JEGB 4ZSOA 4G6AC 4OCRH 1FNSH 3DRTA 4EIGB 2CMRL 1U41A 3QEQB 1IZJA 3ARBB 4R4FL 5E94A 1PG7H 5GGSY 3RDTD 2VR9A 2X2YA 2YZ8A 4LSRH 3K0WA 4N0YH 3HMWH 3R06B 1A1MB 1CTNA 4X7SL 3PWNB 1WZLA 4WNQB 1V7NH 5D7LD 3UTPD 1JPGB 2QQLL 3GMLB 5HDQL 4L4JA 3TBWA 3W5NA 3CFEB 3QO1B 4OFYA 3GI9H 2R9HD 4X0KA 1T7WA 4QXGH 4QT5A 5B8CB 3OXRA 2VERN 4R4NC 2E8ZA 4HWZA 4X7TA 4MNHA 4P3DB 1MJJA 4XNUH 4G3YL 2NPLX 3T0WA 1IGFH 5ACLA 3GBMH 3P4MA 3L95B 4R4BB 4YHYC 5C08B 4Z0BL 4RFNB 3CPLA 2KZWA 1MHHB 1HWGB 1BAFL 3BUTA 3JWNC 3WNPA 2NY5L 3RGVC 4AIOA 4Y2DA 5DT1L 1IM9D 5K9KA 5GIRB 3T2OA 2DIAA 4FFWD 2DIJA 4KHXL 4PLJC 5E00B 4HGWA 2YS4A 2X4PB 4OUOA 2WLYA 5HYIA 3S34L 4JFOB 5FYLL 2I9LA 5LCVH 1XFPA 3H7LA 1TLKA 4FXKB 1ZK9A 1YEEH 4JY4A 2NY4D 4TQEH 3HNTH 4CNIB 5C09D 4U3XA 3STZA 5M95B 2CDFB 4Z7UA 4D0BA 3D69A 3EDKA 1ITBB 4KJYA 5LAXA 4EDWL 3NCYP 1QQDA 4NNXB 2W38A 4WW2A 2Z31D 3DHMA 4PS4L 2J6EA 1DANU 4EEEA 1JGVL 4M9PA 4JPKL 4NP4L 3D9AH 4QWWC 5AZ2L 2BC4B 4KKAC 4HK3J 3QFDA 1T1ZB 2BSTA 5KZCD 2QSCH 2YKLH 1HXYA 5ENWB 1I3UA 3M45A 1GC1L 2HRLA 1IAII 1ZHKB 5CZKA 5I74B 1HWHB 1UG9A 3ZT7A 1H8OA 3EFDL 3M8OL 4D9RE 3QBTB 4NOFA 1F02I 2JF1A 2VLJD 4G8GB 1RZ7H 1GPOL 2DN7A 4KVCL 5EIIA 4JVUA 1C5BH 4XC3H 1TJIL 1A9BA 4WUUA 4IDJH 1JTOA 4M9OA 4CVUA 3DX9A 4I77L 2OCFD 1D6VH 1K5NA 3QDMB 4NQXB 1X5XA 3D85B 5B8CC 5EPMB 4OGXH 1X5HA 3IXTA 4C83A 5JIKA 4UAOB 1OCWH 2R2BB 1DLHA 2CLZA 3MBEA 3WE6A 4L4TD 5JW5B 3TNNB 1I1FA 2K7PA 3TF7C 5L0QB 4POYA 3V6OC 4OZIB 2BVYA 5EUOB 5IUSA 1FGVL 1ZKAA 3BXNB 3B8YA 4NO0B 4PJFF 2NX5B 4FQPA 2ZPKH 4DTGH 1RK0B 1NDGB 3OKNB 1OB1A 1KJMB 3EYQC 5C0CE 5C3LD 2W0KA 4NJAH 4BQBA 1GGBL 1QVOA 2BNQD 3VD3A 2A6DB 1TQCC 3T3ME 1J9CT 2R0LL 5I1JH 3PWPD 5F97E 4YFLI 2H6PA 4HUNB 4XVSH 1GZPB 5J9PB 4D3CH 4U1NA 4HJ0C 4OFDA 1NCBH 3GSUA 2ZUVA 2PW2A 2J8UB 1KPRB 4AJ0A 4ZUUA 3GMNA 1JGUH 3ZE0E 5HVWA 3QEHB 3ULVE 4RFOH 3HAEH 3DNKA 3NFNB 1F6AB 4X6FB 1OGTB 1G6VK 4FFZH 4UBDD 5CUSL 3FO1B 3RUGE 3P0VL 1JPFA 4HUUA 2XZCL 1CICA 2BVQB 2R1XB 1OAUL 1IKFH 5E8OB 1YA5A 2F15A 2WWKO 3P30L 3WFCH 5I74C 5ESQB 1WICA 5MEQB 4FFYL 4XMLH 2V2XA 4PJ8C 4PPTA 3G08B 3BQUD 1JNJA 2RAMA 5B39G 2IH1B 3HG1D 4HCRA 4HUKB 3UZEA 2DDQH 1XH3A 1YY8A 3OJMB 4XBEL 4GKNA 3O6MH 4FQJH 3HPLB 4M3JA 5HVGB 1MH5B 2P8PB 3S3PA 4ZPVA 3PHSA 5EOCH 4PJGA 3TBVB 1P7KB 3TZVA 4BH7A 2FYYA 5IK3B 5JXAH 2IQ9L 3AU1B 2QKIB 4BFIB 5EA0L 1G7MB 3CDYA 4KUZH 4UAOC 4RZCB 4PJHB 1MEXH 2FNBA 1R24B 2IMMA 1U8JB 2DLTA 4J3UA 1WJ3A 4S1RL 5EORH 5T3XH 3A6BH 5L0QC 4FXLA 4KTEH 1U8HA 1IEAA 1T03H 2AEIT 3KPMB 5EU6B 5TE6H 1OPGH 2YBRA 4GBXB 4H0GA 3V7MA 1ZXQA 2W65A 1IMHC 1H5BA 3BYYA 1P5UA 2DMBA 2QQNL 4N8VB 4ZYKA 2PN5A 1MAMH 4U7MA 5D71L 4F7CA 1RZFH 2KPNA 2B8OT 3PDDA 1MCRA 4W4NA 3V0WH 3QIUA 5FM5O 2ZWLT 4CN6A 4TSAL 1Q9KB 3DV4B 2Q76A 1XGQA 3O6LH 1DLFH 3T4YA 3PXJA 4K94H 3QCUH 2I9TB 4YUEL 4HUMB 2IGFH 5CBAA 2FWOA 4P3WA 2ZG3A 1VCAA 4KKBC 3HI6L 4X9GA 3CH1A 3IKCB 5EO1A 2OJZL 3BPOB 4M5YL 4R7NA 3WFEH 1KEGH 3BFOA 4J1UA 3S6CA 2NY0B 2V9QA 3NGBB 3VXQA 4FXGB 4M7LH 3L5HA 4H88H 3B9KD 1HHJA 5J6HB 3LN4A 1QYGH 4JHAH 5D7SH 4MAYD 1FO0H 2V2WB 3RX7A 3W11D 4JCLA 3T2PA 2XWJB 1NFIB 5DJ6B 4X6CF 1FVDA 5IB2B 3FQWA 5C0NC 4RISH 1MREH 4ZUVA 3NPZB 3MRGA 1MI5E 2FIRT 3KLAB 4G6FD 3VXNA 2BVEA 4I3GA 2J4WL 2WIIA 3I75A 3A6CL 1MFBL 5IT2L 1I8IB 2JE8A 4Y4FB 3X3FH 4G5ZH 4GKSB 1HCFX 2Z4QA 3ULVL 4YHLL 5DUML 3VRLF 4U1KB 1JUFA 5F93C 1ZLVK 4F7MB 4Y16A 5IM7A 4F9PA 2C1OA 2F5AL 4LSVL 5MHSD 1JRHL 3OAUH 2BP3A 5CJBA 1Q94A 4B50A 1E6JH 4H25A 4WHDA 4RA0C 1OP5H 2WM0A 4ORGA 4U6HB 1KLUA 3WS3B 4W81A 5D5MF 3QJFB 3VG0H 2E27L 5IHLB 5SX5H 4I48B 5I30H 3D0LB 2A6JB 4GBXC 4MHHG 1LD9B 4HWEH 1BEYL 4OAWA 2ZSWB 1UEYA 3TBSB 3NAAL 1CDCA 3RZCB 1ZT1A 3UAJC 5BS0B 4LCWE 3I2CL 4FTVD 1A1OA 3B9EA 5F8QC 4OI7A 1QLEL 1PLGH 4G6MH 1YJDL 4G7YH 1MJUH 4I0KA 3EO1B 4QRPB 1JK8B 4BSJA 2EZ0D 4Y5VB 3VFNB 5LQBL 1T7ZA 1M7IA 1S9YB 3MLVL 1WVZA 3PQYB 3U0TB 2J2ZA 4M6MH 4YDJA 3MROA 4EJ1C 5FB8A 1CK0H 4ONHB 2AEWA 3T0EA 4G42A 4PJ5B 2OYPA 2XRAL 3LN5B 2R1YA 3B2VL 3WDJA 4NWUH 1DSFH 4R9HA 1MWAB 5IBUG 3TJEL 3NGBC 4ONFL 5ALCL 4F33A 4HX1B 5C0DB 3Q1SH 1CXEA 4MA7L 1OM3H 3DVIA 4LCIH 4YZFE 3L3DA 4KGJA 1UB6A 3P9LB 3F58H 4Z7WB 1KF9B 1U93A 2R4RH 3FOMA 2DM7A 4Y4KA 3MGOB 4HMDA 1I3GL 5DD1H 3EJJX 4AL8H 1I8LC 1Q72H 1X5GA 2IPTH 4DKAA 2FATL 2FX7L 5DD5L 1KENL 2DLIA 3BT2L 1CDBA 5E8NB 3C60B 5JA9A 5MP6H 2GW5A 2G60L 4OQ1A 3S35L 4Y4FC 5JXED 3ILPA 4AMKH 5IMMB 4RRPG 1KT2B 1PYWA 43C9A 4QTHB 2EE9A 2FB4H 1AR1D 5BOZG 1B0GA 3SDCB 2A83B 3WJJA 1HYSC 2VJXA 1MFCH 1S5HB 4LARL 4O58L 1ZTXL 4KDTA 3GSVB 4TN9A 2BJML 3SKOB 4MNQD 1IE5A 4LIQE 2CKBH 3EYSH 2VLRE 4OM0H 4X4ZA 1U2CA 3IGAB 5D9SB 4UDUA 5JW3H 2GCYB 1VSCA 1FIEA 1RZGB 3LMJH 3NFPA 3MLUL 5HSFA 3FQTA 5BMFL 2VL5A 3DUSB 1EO8H 3L3IA 4U1HA 5DD0L 3TA3A 5I66B 1QFWH 2AK1H 4HKZB 3RZCC 3G04B 1H15A 1FVEB 4Y5YA 3ARFD 2O93L 2IBZX 1FZKA 1R3HA 5H94A 1D5IH 1SEQH 4IRZH 4PJDE 2HG5A 2E7HA 1EFQA 2CDEB 3N9GH 3T0VA 2WBWB 3O2DL 3MBXL 1UM4H 4Y5VC 3AREB 1X4XA 3L7FB 3QPQC 3TN0C 3KYKH 1OHQA 2VQ1A 4M8QA 4AYFA 3GMMA 4IOIB 5F9JB 4I18B 4WHYH 1EDQA 3GSOA 4YXKH 1HKFA 2P8LB 3HPJA 35C8L 1QSED 1Z5LB 1RI8A 1CLYL 4OCXL 3ALXA 4QY8A 3DXAA 3FFCD 3MYJA 4K7PX 3FFDB 1SVCP 1JF1B 3VXRD 3D25A 1JFQL 4MLSA 4RIRB 4U6XA 2MQCA 3O3DB 5KSUB 2ICEA 1P4BH 3HNSL 1LE5A 2MTPA 4FABH 5E99H 5LGJB 4M4PA 1MQKL 4NRZB 4PY8J 3EGSA 1YUHA 1FPTL 1UXSA 4KHTL 3CVHL 1GOFA 5GS0L 3BESR 4MA8H 3QZWG 1FAIL 3MZGB 2IG2L 1FN4A 3QIBD 3UTQA 1TTGA 4R2GD 2FLBT 2YD3A 1I8MA 3IFNL 2VISA 4ZNCD 4DGYL 1N6QH 1P9MC 4DKEH 1FDLH 4NQEE 2DWEB 3SDCC 5GJSL 4XNQA 5DHVB 4JY6A 4NYLA 2H2PD 5CJOL 5I2IB 3SKNB 1NAML 3CFKA 4PTUA 4OLXL 2BOCA 3LS4H 1ND0B 5TDPB 4GRWE 3RWEB 3UP1A 4ELMB 5EC2A 5ISZD 5HHOE 4DEPB 3RKDC 5K93A 1G9EA 2A0LD 5KVDL 3PGFH 2Q6WA 4JJHA 1RZJL 4MB4A 1P4LB 2DMCA 5IVZB 3NCCB 5A3ID 4JVPA 4NPYB 4HIHB 4CVXB 3V8OA 5KN5B 2CXGA 3V7AG 3GI8H 3RTQA 1KLFA 3TM6A 3MRLA 4U1MA 1FFOA 4OZHB 2A6KA 1IL1A 2AERT 3DHJA 1OTUC 3EDFA 3TJHD 1E4XL 1KG0A 4MD5B 3C9NA 4POZD 4I18C 3AFLA 6FABH 1RUAH 2RIKA 4WW1B 2K3TA 2H9GB 3WHXA 3QFJB 4J4PC 4ZOCA 3IDXL 3L3HA 3RY4A 4NFDA 5FECB 1U8KB 4BJLA 1ETZA 5KOVC 4ZNEE 4PJIE 4OCYH 4RDQF 4CW1A 5EOTA 2XIDA 1S7TB 3WNLA 5JLZA 1TETL 5J7CC 4JPIA 3TBYB 4EDXA 4AM0B 1HH6A 5B39B 5D2LB 2W9DH 5EFIB 3BKMH 3WHE1 1KFAH 1C1EL 1YEFH 1YQVH 4HIIA 5F7EL 3TV3H 4HLZG 4RMUA 3CFCL 1KCRL 1YPZF 3TVMC 3PV6B 5HYJB 2WP3O 5DRWA 1EX0A 4KK8C 3L3OB 2FL5B 1ORSB 3GFUA 5B21A 5IFAL 1KXQE 3NCJH 2VXTH 3EUUA 2D7OA 4NUJA 1XEDA 1FL3A 3DX7A 4MLIA 5GGRY 3UPRB 4P2RE 1OSZB 3U6RA 3DUUA 5E5UB 3I85A 3NN8A 3O4OB 5K33A 5CEZD 1ONQB 4PY7A 1IGML 4UT9L 2ZUSA 1QRNB 2MWCA 4JAMA 1QD0A 3RVVD 1SY6H 1FG2A 1BIIA 4G6AD 1K6QL 2DBJA 5KSAA 4FMKA 4JM4H 4JVWA 3HZVB 1KJ2B 1NGWA 2EC9U 2Z91A 4OCSL 2R29L 2VLLB 2Q3AA 1JHLH 3D39B 2NXYB 4J6RH 4YFLF 5I17A 3JWOC 4KUCF 4WI9A 4DEPC 2AEPL 2FECL 2X4UA 1RK1B 4KRPD 4QHLA 3GJEA 3VWKC 3OAZK 4TUOA 4OCWH 3RWFB 1E28B 4LDEB 3VGHA 4IEFB 5C0RL 2RBLA 1ZWIB 1W72B 4YHOH 4P46B 4R4ND 3EOTH 5T5NF 3DIFB 2PO6D 2P5ED 5GGSA 4JFHD 1I7RA 1JBJA 1KSRA 4MSWA 5I8CB 1WC7B 5CGYD 1KB5L 1IGYB 4ZSOB 2QEJA 3CVIH 4HKJA 3T3PE 3GMRA 3CU7A 3IJSA 1A0QL 1LK3H 1K4DB 2XQBL 1EERB 2L0DA 1A6AB 4FQHA 5M94B 5DJYA 1KPUA 3OL2A 4PLJD 1NC4B 2QSVA 2ZJSL 5JTWA 1FNFA 1FL5B 3RWDA 2H3NB 3V9FA 4KU1A 5C0AD 1HH9A 3MO1B 1FZMA 2AGJH 5E2UL 1QFPA 2ICES 1FBIH 3TBWB 5BV7L 3QSKB 5IB1A 1HHKA 3L3JA 3V4UH 4X0KB 4MXWH 1U8QB 4QT5B 1U92A 3OXRB 3RUGA 1PY9A 4X7TB 4MNHB 4NSKA 1MJJB 1OAZH 3MV9E 1CFNA 1NMAL 3P4MB 1MFAH 2EXYD 3PP4H 1SJEA 2AP2A 5IHUL 5J8OA 5T5NG 1YEIH 1CF8H 3X14A 4Y2DB 1UACL 5K9KB 4LK4A 2WQ8A 4GAYA 2OR9L 4HGWB 1UM5H 2W0LA 2P24A 1F4YH 4LRNH 3L5XL 2ADIA 1G9MC 5JUEL 4JY4B 3GHBL 4M1CC 3ARBD 1VB9A 4GAGH 3U7WL 3STZB 1SQ2N 3THML 5IHZA 1I9EA 2F54A 2NXYC 4ONOA 4D0BB 1X5JA 2YSSA 4R90L 4WWKD 4KJYB 2UWEF 1KIQB 4XWOD 5ERWB 1KUMA 2QADD 4WFEE 2KKQA 4ZXBA 4WW2B 1VADA 4N0CD 3RAJH 5LGHH 3HB3C 3VRIA 1QBMH 1YYMH 2BSTB 2ZCHL 4P46C 1Z2KA 3G6AA 3LEVL 1QFWI 1GAFL 5F1IA 1FRGH 1HXYB 3SKJL 4WFHD 4NO3A 5T5FH 4OQTH 3MJ9H 5C08D 5ITFA 3AGVA 3VMNA 1UVQA 2BVPA 3IU4H 5IBUB 1P69B 4JZNA 5HVHB 3CDGA 4XCYB 3BAEH 4DK3A 4S1SL 1JPSH 3NZHL 3EYQD 1HNGA 2AJVH 3MCKB 5EIIB 1JHTA 4G43A 2P5WE 2UZXB 2F5BL 3HZKA 3X3GL 5EZLA 4QYOB 4WUUB 1IC7H 2HT2D 5AAWA 3MZTA 3DX9B 1WV7T 4HF5L 1TIUA 4ODTH 1Z9LA 1FYTB 2L7UA 3FQNA 3VFSA 1HINH 1LO4H 3TWCL 2GJ6B 4XP9H 1DLHB 5DLMH 1B90A 3MBEB 1ODAA 4OM1L 1UZ8A 3V52H 3IDYB 1I1FB 3QPXL 3QDJB 5BVJA 3PWJA 2FJHB 3LKPB 4FQCL 4YEEA 3GIVA 3TH4T 3KXFA 5DR5L 3K81A 3KYAA 2I60L 2DLEA 5EBLA 3FKUS 1PG7W 1OB1B 3O9WB 3UYPA 1QVOB 3N1GC 4YHIB 4X4MA 1MFDL 4XX1E 5B22A 4QNPF 3LQAC 5ITBH 3O2DA 3HUJE 2H6PB 1L7IL 1PBYA 4U1NB 2LABA 1QLRA 1TVDA 4F58H 4TOYH 3GSUB 2PW2B 4M4RA 1KC5L 4ZUUB 2YWZA 4OF5A 4UIMA 3GMNB 4KGLA 1LO5A 4WEMB 25C8H 3E3QE 4OFKA 2D7TH 5ABDE 3O3AA 1LP9F 2CD0A 5A43C 2VYRE 2DAVA 3D85D 4GAFB 4HKBB 1AGFA 4XH2A 5E5RB 4M6NH 1JPFB 4HUUB 1CICB 4K3EL 4M6OH 1SYSA 1N64H 3A6OA 1B4RA 2W9EH 3GJFA 1QHPA 2HWZH 3IF1A 5H8DA 2P4AB 2V2XB 3DX6A 3PHQA 4UZGA 5FGSA 5HVHC 5JA8B 4NFBA 1A7PL 2ADFH 4P2OA 4NO0D 1T6VN 1PY4A 3QAZB 2NX5D 1KB9J 1LO2L 3U9PH 3K8KA 1BD2E 1P84J 5FCUH 1XH3B 1YY8B 4GKNB 1MUJA 5GGVY 5KSBF 3OBAA 3HZMA 4PJGB 5F9WC 3RWGA 4X80H 4GXVH 4UUJA 4PFEA 2I07A 3TZVB 2FYYB 4BH7B 2BFVH 4LDLB 1QLFA 1FGNL 2EYTA 3P4LA 3MLSL 4CDHA 1GIGL 1NAMA 5E03A 4ETQA 5C1MB 5IVNA 2GSIA 3WLWD 3MBEC 4XPAL 1OTSD 4GXUN 4OLWL 3IDYC 4GG6B 5KAQF 2O5ZH 3QCTL 4P2QD 4U3CA 1Z9OA 5ESAA 4S1QH 3U36A 2FO1A 1MNUL 1U8HB 1IEAB 4BZ1L 3UTSA 2LU3A 4OD2A 4MQXC 3GSRA 5LGKA 5C6TL 3KLDA 2OTUA 4X6DE 4OZFA 1IQWH 1H5BB 3DURA 4LSSL 1CLOH 1RZKH 1CD1A 4ZYKB 4QLRA 2E9JA 4EI6A 1A8JH 4XHJC 1U3ZA 2BHYA 2Q76B 1UM6L 1XGQB 2GQHA 3T4YB 5IVOA 1A6TA 3BP5A 3SDAD 1QKZL 1NMBL 1P4IL 2BK8A 2FWOB 4QTIL 1G0DA 3QH3B 4PJXF 3CH1B 1AI1L 5EO1B 3LCYA 1IAIL 4R7NB 3SOBL 1AHWA 2WBJB 1AC0A 4J1UB 4K23H 5HBBA 3RP1A 2CGRL 4ACPA 2HJFA 1JPTH 1HHJB 2X1QA 4XNXH 1XGYH 1KOAA 1CICC 1MJ8H 3LN4B 4IMLA 4AZ8A 4LKXA 3VXME 3K4DA 4PJDA 2DTMH 1R0AH 2E6QA 4U3HA 1TMCB 4KI1A 2BNRA 1FVDB 3QAZC 3C5ZA 5EU6D 4ODBD 3FQWB 1JHKL 3PDGA 4GBXD 4ZUVB 5IBTL 3SE4C 3MRGB 4M3KB 2WIIB 1G7JA 1QFWM 1Q0XH 1Z6JT 3I75B 4XMPH 4GQ9H 3UAJD 4PBXA 2BMKA 1DVFA 3R4DA 1JUFB 2QQKH 3TZVC 1EGJL 2BZDA 4Y16B 5IM7B 4NZUH 1TFHA 5GZOD 2C1OB 3I3EA 4EKXA 2W60A 5KTEH 1WFOA 3LRGA 3H3KA 4LASL 2VZ3A 1U3HB 2LTQB 1K85A 4HS6B 1Q94B 2KL6A 2OR8A 4H25B 1T2QH 3HC4L 5JMOC 4ORGB 2FX9L 2R69H 4KJWC 5CP7A 4D0DB 3ORJA 3KYMA 2NY0D 3LOWA 4U6VH 3MJ8A 4PV9A 1V3KA 4PJCE 2K7QA 5E70A 1UJ3C 3GSXA 4TNVF 1H5BC 1IT9H 2DQGH 3ZDXF 2H45A 1ZT1B 1JGEA 4P4RA 3VFMA 2XZZA 3ARWA 1FP5A 5FV2A 4NQEA 3UTZA 4D94A 4PJAF 3QIUC 3G6DL 2OJEA 3WNMA 3ULUC 3MLXH 1M7IB 15C8L 3E6HA 3VXSA 4YDJB 3MROB 2APWA 2AK4E 3ULSA 5GHWH 2DQUH 5FB8B 4X4XA 1BFVH 4Y4FD 1NGXB 1TJHH 2R1YB 5CINL 3I9GH 5HHOA 1T1WA 2GUOA 3CDCA 4UQ3A 4X6CA 1IEHA 3T0XA 1HYSD 3P4NA 3B9DA 1GRWA 4LQFH 5F96L 1I1AA 1AE6H 3C6LA 4LCYA 1WZ1L 3Q6GL 1NL0L 3AMKA 3AMLA 3L3DB 2J1KA 1P5VA 2DF3A 1UB6B 1A4JA 2B5IB 1U93B 4Y4KB 3FOMB 4CU7A 2VDRH 1LMKA 1JIBA 1PEWA 4Z7OE 4LDOB 5TJWK 1ZGLM 1YEGL 4YE4H 3DSNA 3VA6A 4ZTPH 4F2MA 4J8RA 1OAYL 1UWGL 3INUL 1WZMA 1VGKB 3RZCD 1NUFA 2XN9D 3CZFA 2VDQH 4Z8FH 2HTLD 1OQOA 4G7VL 1N6VA 1S78C 4H1LH 5EB9A 3ILPB 3VFOA 3ZT6A 4ZNEA 4PJIA 4G9FB 4JFPA 1PYWB 4DN4L 43C9B 3S3JA 4Y16C 4F9PC 1B0GB 2YPVL 4UB0L 2VITA 3LD8B 4PRPE 1WSST 2LTQC 4JFZL 4PJ5D 1TQBB 2WK2A 5C3TA 4LU5H 3H9HA 4KWUA 4AIXA 2XA3A 1DQMH 5FXCH 4LHUG 3NIGF 5IGXL 3EYUH 4UDUB 3TH3T 4M61B 5IMKA 3CK0L 3NFPB 3SY0B 1H9VA 3FAXA 1BVZA 1P1ZB 2XTJC 3FQTB 4P2RA 4U1IA 3L3IB 4U1HB 4KJQD 3TA3B 2DQDH 5KSBE 2A38A 1H15B 1K9TA 1JZ8A 4KDWA 4Y5YB 1HIMH 1FZKB 1KCSH 1FJ1A 5H94B 1DN0A 2X1XR 2HG5B 2J8HA 4KV5F 1ACYL 5FUCC 3VFPB 2R39A 4JFEA 2MCPH 3VMOA 4I2XB 3GSNL 5DUBA 3C60D 4M8QB 1N0XL 1ZANH 3GMMB 3AS3A 3SE3A 1DQDH 2XY2A 3T0EC 4HIJA 3ESUF 4JY5L 4DZBA 3GSOB 5CEZH 4FQXA 4DQOH 2VMFA 3HPJB 2ARWA 1GVIA 1F58H 2VDNL 1WEJL 4JR9L 4QY8B 3VW3H 1PFCA 3F7YB 1FNSL 3MYJB 4OCRL 4ZUWB 1RQ5A 4P4KD 5ALBL 4HAGA 3D25B 3EO0A 5I1LA 1DEDA 1PG7L 4R0LA 5E6IB 1LGVA 2B5IC 5KSVA 1HCVA 4LSRL 1LE5B 4J3XA 3JV4B 3V0VA 4N0YL 3HMWL 1MRDL 4OZGE 1H0DA 1YUHB 5FYJE 5IB3B 4YHPA 1V7NL 2J5LC 4LGRB 1BVLA 3NA4A 1H3TA 5CILH 4HXAH 3S96B 1FN4B 3RVUC 3U30B 2EXWD 2NY5C 3GI9L 1AXIB 1MCOH 4QXGL 2ILLA 3LHPH 5DYOB 5CKAA 3U83A 2VISB 4XNUL 1M6OA 1T7YA 1OARH 1IGFL 3GBML 3ARED 1TTFA 1OTUD 1SEBA 1H3PH 1YMHB 4XNQB 3KPNB 4JY6B 5J13C 4NYLB 3VD7A 3QJHA 1R5VB 2KQMA 3CX2A 3EJZD 4KDTC 2UUDH 3CFKB 4HT1H 4J4PD 3V79C 1FHGA 3GHEL 1TNNA 5EC2B 5JW4M 2EDHA 4QHKI 3MV9A 1L6XA 1NCAH 3HE6A 1HEZA 4O51B 1HDMB 3BPCA 2HP4A 2IH3A 3RY5A 2VZSA 5CGMA 2BY1A 1YEEL 2XG5A 5GPRA 1K3IA 3TA3C 3RVXC 4TQEL 3HNTL 4XTRD 1H8SA 3RY6A 3WKNA 3O11B 4Y5YC 2O61B 2DL9A 3RTQB 1FFQA 2HT3C 4H0IA 4P5MA 3O3EA 1J0IA 4PGCA 1DCLA 4U1MB 1FFOB 1GC1C 2LVCA 5IEKA 2A6KB 1JL8A 1IL1B 3JTTA 3FOLA 1CR9H 3T1FA 1KG0B 3D9AL 3LKNA 5BQ7A 3WHXB 3L3HB 2QSCL 5I76A 1INQA 1AQKH 2AI0H 3NZ8A 1ETZB 2YKLL 3LB6D 4JKMA 1A6WH 5EOTB 1M71A 2HVJA 3C2AH 5JLZB 2IPUK 5T3XE 4JPIB 1NEUA 4EDXB 2HKFH 5D93B 2FEDC 1HH6B 5AG9A 1JTTA 4TUJA 4P2YA 4NWTH 4KZEH 4HIIB 3KPPA 3PHOB 2J3SA 5GGRA 1RZ7L 2P7TA 5DRWB 4JKLA 3DYMA 3GMPA 3BKJL 1C5BL 1YC8A 3WHE0 5MENE 3C08H 4Y19E 4XC3L 2R2EA 4ESKA 4NUJB 4IDJL 1FL3B 4ZODA 3DX7B 3DUUB 1EUUA 3U30C 2WUBH 3NN8B 1D6VL 4Y4HA 5HHME 3DVNA 1T0PB 4PY7B 4GW1A 4OGXL 5IW1A 1PGRB 4JAMB 1OCWL 4RBPH 1X3DA 4A2LA 5DK3A 1FG2B 1BIIB 1EIBA 5KSAB 4E41E 2XQYG 4RAVB 1NGWB 2G2RB 3TP4A 5CKGA 4C57C 1AGBA 2ZOKA 2Z91B 4XWGH 2F19H 2R2HA 3QFJD 4P99A 5FYJU 3WUWA 3KS0H 4YAQA 5JIPA 1GGTA 2IMNA 2ZPKL 5I17B 3EYOB 2X4UB 4NJAL 1A3QA 1S3KH 1OWWA 4QHLB 5F9AC 3GJEB 1F4HA 2G75A 3D3VE 3DWTA 4TUOB 5CBEA 5I1JL 2AXGB 4WJ5A 2GSGA 3WNKA 3RBSA 4XVSL 3FAWA 3MV8E 4KKCC 1IRAY 4D3CL 3RTQC 5HYJD 1XGTB 5C0CB 1NCBL 3GMOB 1T7VA 5GGSB 5C8JA 3KS0J 4X7SH 8FABA 3G6JE 1JGUL 2V7HA 3WS6A 4HKJB 3GMRB 1ZV5A 4ZAKA 5IIEB 3IJSB 4RFOL 3HUJA 4FQIH 5HGBA 5B38A 4X8XA 2EDOA 3QWRA 4F37F 2KH2B 4FFZL 1QRND 3RWDB 1OD9A 2VRAA 5DA0B 1GGCH 1O0VA 1MIEH 4LPXA 3VI4E 3SO3B 2JCCF 1HH9B 1FZMB 3UBXG 3ARGD 1IKFL 3QXDA 1YMME 4LNVA 5D93C 4XMLL 4C4KO 3AS0A 1B88A 2BVOA 1CZ8L 3D39D 5IB1B 3LQZB 2Z8VC 3AM8C 1HHKB 3L3JB 4L3EE 4XNZB 1U92B 2DDQL 3U46A 3RUGB 3D2UB 4RBPK 3O6ML 4KV5E 4NKDB 4NSKB 1EEYB 4FQJL 3VFVA 1B9ZA 5IOPA 1CFNB 1FSKC 1JGDA 3S34H 5EOCL 4J12A 2XZAH 4OD3H 3PF2A 2XKUA 3HB3D 3VDAA 1I1YA 4P46D 5BOPA 1J86A 1V5JA 3WFDH 1F97A 4YPJA 4GAYB 4KUZL 2P24B 1MEXL 4MQ7A 2LU7A 2ADIB 4HPYH 4PJEF 5KSAC 5EORL 5T3XL 3A6BL 3TO4A 2P48B 4OIBA 3F6IA 4KTEL 5IHZB 1T03L 4JDZA 2V9TA 1NC4D 2YSSB 5TE6L 1OPGL 3FO0H 1D6EA 4NN5B 1DQTA 2PW1A 1MLCA 4FA8A 4NCC2 2YPLE 5DHXB 4ZXBB 3WEXB 1JYXA 2DI8A 3D6GA 2G5BA 1MAML 4GOSA 3S37L 4P48A 1RZFL 3RIFK 4Y1AD 3IJYA 2IANE 3V0WL 2EYRB 4JRXE 5IW6B 3NACH 1S8DA 1U0QA 4OZ4A 4OBRA 3AAZA 4KK6C 2DI9A 3O6LL 1DLFL 4K94L 3QCUL 3QDME 3DJ9A 4OKVA 4JFYA 5F1IB 2DQTH 4ERSH 2IGFL 1K3ZA 2APXA 4NO3B 5K59F 3QXVA 2YRZA 1UVQB 4N0FA 2BVPB 1ZT4A 3MRPA 3F12A 4LCUA 4XCFH 3WFEL 1KEGL 1Y6MR 3MRKB 4JZNB 1AGDB 1YN6A 3MR9B 4Y2DD 4JFQB 4BUHA 5EUOE 5IG7A 1LEKA 4M7LL 4H88L 3VXTB 5JHDA 5AUMA 3VFWA 1KGCD 1QYGL 2X4RA 1JHTB 1OGAE 4JHAL 5D7SL 1BMGA 4V1DE 4OGAD 4HV8A 1LHZA 3HZKB 1FO0L 1GYAA 2AV1A 1ES0A 3ULVC 4PJ7E 5EZLB 2VNCA 3RBGA 3CFIC 4HWNA 5HPMA 3EYFA 2QQQA 1MREL 3VFSB 5SX4H 3LAFA 5BZDA 3UCRA 4I9WE 3VXMA 3RWJB 1GGBH 1UZ8B 1RSFA 4PRNA 3IB4A 3X3FL 1MFEH 3PDOB 4G5ZL 5BVJB 4DOHE 3U4BH 1N3NA 1WFNA 2HKHH 1S9VA 3GIVB 4LEXH 4PIRF 4ZFGH 1MI5B 5EBLB 1J1PH 2NY2B 2Z8RA 3OAUL 5F9OH 4ZO8A 1LO0H 1E6JL 4R7DA 4EUPH 1YJDC 3BO8A 3VG0L 2DOCA 4IIQA 4XI5D 3ZE2F 3GSNA 3EOAA 1FNEA 5I30L 3F7PC 1QLRB 4HWEL 4NN5C 5TPWH 3P9WB 3O8XA 1JZ7A 4ZXBC 4DFHA 2IFGA 4UIMB 1OP3H 1LO5B 4WUUD 1PLGL 4LPTA 4G6ML 4G7YL 1MJUL 3O3AB 2AJSH 5B3JF 4QO1A 1FYTD 4RGNE 1Y0LA 2FBJH 5CEYA 3MUGA 1AGFB 4XH2B 5DJAA 2GJ6D 1L9MA 4M6ML 1PX3A 5A1AA 1LE9A 1CK0L 4LCWB 2IFFL 3GJFB 3QDJD 4L5FH 2NQCA 4NWUL 3SKMA 3IF1B 5KANG 1DSFL 3DX6B 4YIQA 4X9HA 4NM4H 4NKQB 4P2OB 1YC7A 4M03A 2VDKL 3H3PH 1Z3GH 4MQXD 4J3VA 4YBLB 3PIQA 3Q1SL 3O9WD 1X5FA 2AK4A 4LCIL 1MUJB 3F5WB 5GSVA 3O2VH 3F58L 4BSWA 2R4RL 3W82A 3WLBB 4S1RH 1IGJA 3HZMB 3MOAH 1FFPA 5TDOA 3RWGB 4LP5A 5DD1L 3LIZH 4AL8L 4JGJA 1Q72L 2I07B 4XHJD 2IPTL 1N7MH 2EYTB 4RMWA 1KELH 5FV1L 3T65A 5F3HB 5E24E 1XMWA 1NAMB 3SE9L 4ETQB 1KJ3H 2GSIB 5MP6L 5INDA 4KRNA 4X7EC 3I6LD 4AMKL 4IOFC 2Y9RT 5ESAB 3U36B 3LRHA 2FB4L 1NAKH 2E8YA 1I3RA 4O00A 1UADC 4XP6H 4OD2B 1MFCL 3GSRB 5HYSG 2OTUB 4C56E 4OZFB 4OGYH 1GZQA 1CICD 3LKRA 2W92A 3DURB 1OP3K 2DJUA 3TIDB 3BVNA 1FNHA 43CAB 3C5SA 3MFFA 5EUKA 2CKBL 3EYSL 2YD5A 4OM0L 4EI6B 1OVZA 5JW3L 1G7QA 5D7KD 3LMJL 2W07A 3PWLB 3C6SA 2VZOA 3L3KA 4PRPA 1EO8L 1A6TB 4MD0A 2JJWA 1QFWL 2AK1L 3BP5B 4QOKE 4QRRD 3S4SA 4LBEA 1D5IL 1SEQL 2VLRB 4IRZL 4MX7B 1AHWB 2HFFA 2AV7A 2Z93A 1U36A 3IS1X 3N9GL 4JFDA 1UM4L 2D2OA 2ORBH 5JHLL 3DPBA 3UPCA 2HJFB 5CD3A 3KYKL 1WIUA 2UZIH 5DVMA 5FHBH 4HKXA 5KSBA 4IMLB 4LKXB 4M1DH 1S7QA 4JDTH 4HC1H 4YXKL 4OLYH 3AS1A 4PJDB 3EDDA 1DE4A 4P2OC 2R8SH 1MWAH 3C5ZB 5GS0C 5HHVH 4MDJA 3K80A 3BZ4B 1FFRA 1DBMH 3UYOD 4XP4H 2APBA 4Q9RH 1G7JB 4TUKH 4PRBA 2E7BA 4XPFH 1CE6A 1P4BL 2AEQH 2BMKB 3ZDYF 4FABL 5E99L 1CI5A 4N5ED 2PCPB 2YUVA 2Z9TA 1XZ0A 1FNGB 4MA8L 3QI9A 4H8WH 2YWYA 4OT1H 3IAQA 2ICCA 4PRHE 2WBJD 1N6QL 5CP7B 4OZGA 5DEZA 4ENED 2CIKA 1FDLL 3KYMB 3MJ8B 4PV9B 4NT6B 1RZJC 3KLSA 4K3HA 4UNUA 3B43A 3LZFH 3K3QA 3GSXB 2BY2A 1Z0MA 3LS4L 4AQOA 4AT6A 1MAKA 4P4RB 1JGEB 2PXYA 2WBKA 3QO0A 3MUJA 4PJXA 3W39A 3GKWH 1SHMA 1TJGH 1WF5A 4L8DA 3MV7E 4NQEB 5EG6C 4EQ2A 3PGFL 5E7FA 3HAEA 5DHYA 5GS1A 4JZJB 2F74A 3TNMA 4GRWB 3GI8L 4U49A 3QT2A 5HHOB 1NEZA 1T1WB 2GUOB 4X4YA 1AHWC 3ES6A 4Y16D 3RI5F 4XZUB 3P4NB 3HFMH 3QUYA 1CGWA 1I1AB 2JLLA 3C6LB 4LCYB 2E7LA 5EO0B 4Z6AT 1RUMH 4WHTA 5BV7B 1TCRA 1U3HD 2A1WH 1XR9A 6FABL 1RUAL 4L4VE 3MC0A 1A4JB 3MOBL 4D2NA 1BFOA 2D03H 2A9NH 4P5KA 3UBXB 4OCYL 4M7JH 5E5MA 3MA7A 4J8RB 3C5ZC 4F2MB 1X9QA 4AY0A 1KIRA 2Y1VA 1R5IA 5IQ7H 2X42A 4P9HH 1CXHA 1D9KA 5DZLA 3CZFB 3BKML 3MSPA 1KFAL 1YEFL 1ED3A 1YQVL 4L8CA 3TV3L 3QULA 4YHNA 2AXHA 1RV6X 5C9KA 1DVFC 3VFOB 2C3VA 1HHIB 2EDXA 2XXCB 4JFPB 4PJIB 2Z0BA 1KCUH 4ONGH 5DGQA 5FA4A 5IKCB 2CH8A 5J0BA 4LHQB 3WDHA 3NCJL 4XAKE 2VXTL 3B5GA 3DI3B 2VITB 3MLUH 1F11B 2VDOH 3C09B 5SX4I 5J6GB 5FOBA 4M7ZB 3H9HB 4XCCH 1PDKA 2GHWB 2EIEA 1JNHA 1SY6L 5MENA 2Z8SA 5IMKB 4JM4L 2OL3B 4P2RB 4U1IB 3WN5A 4BYHA 2E3VA 4OKDA 4Q9QH 1JHLL 3QDGE 2VKWA 4Y4KD 3AB0B 4J6RL 5K9QI 4XBGA 5AAMA 1FJ1B 2CR6A 3JWOH 4OLUH 5D1ZA 5I75B 4N1CA 4DZ8A 1HSBA 1FCCA 3CD4A 4U1LA 1BREA 2JIXA 4LHUA 4E41A 4LVHC 4OCWL 6CGTA 5DUBB 4MWFB 2NYYD 1A6UH 4FZEH 2X1WL 4YHOL 4HIJB 3BW9A 4DZBB 4FQXB 1MVUA 3EOTL 4G9FD 4YQXH 2NW3A 5CAYB 1GXEA 3BZFA 5KVMC 1T7XA 1OT2A 2IJ0C 1KBGH 1QG3A 2NY3C 3D3VA 1FO0A 3C6LC 3CVIL 4HBCH 4Y2OA 3CVHH 5BV7C 1LK3L 3EO0B 4R0LB 3MV8A 3QG7H 1OAQH 4RAUA 5KSVB 5DSCA 2BSED 3V0VB 4GFTB 3QUXC 2VR4A 2ESVE 2QHRH 1H0DB 3G6JA 2AGJL 4YHPB 3DMMA 3LV3A 5TH2A 3T4AA 1FBIL 4LLAA 3RVXD 3TA3D 1OAXH 2M26A 1DN2A 4ZPTA 3HTLX 4QCIA 4K71B 5TE4H 5DRNA 3V4UL 4CMMB 4B0MM 4MXWL 2JJTA 2NR6C 2IAMB 4YH6A 5DO2C 1OAZL 1L7TH 5CFHA 4MDIA 3BZEA 4LGSB 3WO3B 1KLGA 1CGUA 1SEBB 2H26A 1ZLWK 1YMMA 1MFAL 1OAKH 3NCBB 3PP4L 2CLVA 3QJHB 2XWTA 5FHAL 5BRZE 1N5AA 3C09C 2P45B 1YEIL 3OKKB 1CF8L 2IWGA 4L3EA 3W2DH 4LNRA 3DRQA 3PWVA 5C70A 4JFXA 3AY4A 3MV9B 1X5KA 1F4YL 4JJ5A 3HE6B 4LRNL 1HEZB 3BPCB 3CMGA 2MOVA 1QZ1A 2IH3B 1OW0A 1G0XA 4KK9C 1KJ2H 3FB6A 4XPBH 5E6ID 1QSFA 4GAGL 2VE6A 3AB0C 2M2DA 3QQNA 3ZE1F 4M7LT 2R23A 3ZHDA 3O6FC 5I75C 4PGCB 3GSWB 1D5MB 1U8MB 5J1TC 4H26A 5GQBA 3ZKNC 3JTTB 3RWIA 3FOLB 2I27N 3AUVA 1HYRC 2DBLH 2N7AA 2XICA 1TETH 3T1FB 1OF2A 1F5WA 3G5YB 5IROA 3RAJL 3LKNB 3WXWH 5BQ7B 3S5LG 3SE3C 4PRIA 1H8NA 1SBBA 5LGHL 1QBML 1YYML 1W72H 3HRPA 4AEEA 4FQXC 3ZSSA 2CK2A 4YPGA 4LSQL 4H1LG 2EDQA 4PGBA 5L2KE 1F3DJ 1FRGL 1P6FA 1YN7A 5D7IE 5T5FL 1GSMA 4OQTL 3MJ9L 1M71B 2HVJB 4KFZC 3QHFH 5J06A 2IANA 3L5WA 3IU4L 5FYKE 4JRXA 4TUJB 4R0LC 5F3BA 1FC1A 3BAEL 4X98A 3KPPB 4M7KH 3KJ6H 1MCNA 1BZQK 4L3AA 5GGRB 3IFPA 1JPSL 3BE1H 4KQ3H 3UROR 5CSZA 2AJVL 2EIZA 1C7SA 2P7TB 2GAZB 3QG6A 4PJ9B 3ZDZF 2R2EB 2NNAB 1J88A 5D96B 4GRLA 1IC7L 2EKSA 2VH5H 4OD1H 1PKQE 3ARXA 1WCQA 4K71C 4ODTL 2N1KA 4P59H 3LPGA 3DVNB 3RTQD 4GW1B 4KTYA 1HINL 1LO4L 3T0AA 1BQUA 1OGAA 4XP9L 1IEBA 1P7QB 4V1DA 3IXAA 5DLML 3V52L 4PJ7A 5JNYA 4FN0A 2CKBA 3SDXE 2GT9A 1CL7H 1AGBB 2ZOKB 5C0RH 4DWHA 2CPCA 5HYSB 3M1BA 5GXBB 3QR2A 3WUWB 3CSGA 4YAQB 4WI4A 3HE6C 4YK4C 1GGIH 2G75B 3BOVA 5CBEB 1WIPA 4LLDA 3UTOA 5E56A 5ITBL 4WJ5B 4MNQE 1YDPB 2GSGB 3UZVB 3TT1H 2X4NB 4AH2A 2JB6A 1TENA 4KC3B 4P23A 3RY6C 5GGQH 5J11B 1D5BA 2XZQH 5CWSA 3KDMA 5FM5M 4F58L 5ILTH 2OI9C 4TOYL 4JHZA 2XKSA 4Y89A 2EEAA 5C8JB 2VUOA 1EZVY 3N1MC 1W2KT 1X44A 1J8HD 2X7LA 4HIEA 4NO2A 5CD5D 2J7LA 2V7HB 3H7BB 5DQJA 25C8L 4ZAKB 4D9RD 2D7TL 3HUJB 4MB5A 1EH9A 4I0PA 5HGBB 5B38B 4HH8A 3DGGA 1NDMA 1W8NA 2DKMA 1KIPB 2ZUUA 4M6NL 4M6OL 2MQ3A 1N64L 5A40E 1T4KA 2W9EL 4LVOB 3UC0H 1FQ9C 1ZVSB 1LWRA 3DGCR 2HWZL 3M17A 2CDGA 1IJ9A 1FVCA 2BVOB 2ADFL 2RR3A 3T2QA 3U9PL 4F7TA 2C3WA 5FCUL 3FFCE 5HHPB 3U46B 1PQZA 4O2CA 4Z7UE 5FK9B 4D0CB 4QRSB 3VFVB 5IOPB 1B0WA 4XB8A 1JGDB 2E9IA 1CU4H 5D96C 3ZO0A 5HJ3A 5J3HD 4X80L 4C54A 4GXVL 4Y4HC 1MOEA 2BFVL 1WTGT 3K8LA 1BD2B 5C0CD 3MRDB 4HG4J 3HN3A 3VRJA 5FYKU 4WFFE 4NN7B 1T0NA 4BM7A 1MY7A 1CG9A 4K3DH 4MQ7B 3VFTA 3ARYA 1MY5A 3U9UB 3DX8A 3OAYH 3RDTA 4M02A 1UQSA 5E2TH 2O5ZL 4TVSa 1ZGLA 3GB7A 4S1QL 5EDXA 4TRPH 4DGVH 4UT6L 2FR4A 2DRUA 4C55A 5I1AA 4JDZB 1B6DA 2YZ1A 3RZWA 1D6EB 4XVJH 2OMBA 1MSPA 2VUYA 1IQWL 3JUZA 2PW1B 1MLCB 3OKMB 3UEZA 2Y7QA 2G5BB 3ULVD 4PJBE 4N8PA 1HILA 4YDIH 3IJYB 2FRGP 5LVEA 5J11C 1S8DB 4OZ4B 4N0UA 3JV0A 4YC2B 3D2UD 3AAZB 3V5DA 4X6DB 4C56A 3UXFA 4JFYB 3QNYA 1IM9A 3FQXA 3R8QA 4N0FB 1CVSC 4ZAKC 5JW4R 3MRPB 3F12B 5C0IA 1F2XK 1QACA 2CXKA 3FO9A 2B1AH 2ARJQ 2KQNA 5DWUH 1YN6B 2AJYH 2NY1B 4K23L 1IAOA 5IG7B 1LEKB 1EFXB 1EHLH 5F8RC 1JPTL 2YA1A 4XNXL 1XGYL 3VFWB 1MJ8L 2J88H 2X4RB 4QOKA 2GTZB 4GW4B 4LVOC 4D9LH 4HV8B 1BQSA 2P49B 2AV1B 3D1MC 3E3QC 1E6OH 2DTML 1R0AL 5JOFA 3LEYH 2H32H 4X6EA 2RGSA 2Z31A 5HPMB 3EYFB 5J12C 4GMSH 3ZZ1A 4M00A 3REWB 3TIEB 5MEOA 4NQDE 4NQSA 3OG6B 5DJCA 4XMPL 1Q0XL 4ZXBD 2H1PH 4GQ9L 4IRSC 4JO4H 4K3GA 4PJEA 3VXMB 5I1CL 4PRNB 2EH8H 3U0WH 1AKJD 2ZG2A 2QQKL 1N3NB 1SY6A 2F53D 1S9VB 1JE6A 5F1KC 5DZOA 4NZUL 1NBQA 1DQJA 5KTEL 4NN7C 2X6MA 4OV5A 4U1SA 1R6VA 5DGRA 4TSCH 1T2QL 4OIAA 1NBVH 4R7DB 2R69L 3TO4C 1XF2B 4DAGH 2ITDA 3BO8B 3IYLW 4U6VL 4IIQB 3HI1A 3GSNB 3EOAB 2P42B 4W70A 3WIFA 4J3TA 4UMGA 5L2JB 4PV8A 4Z7QF 1IT9L 4OZIF 2DQGL 3ZDZE 3ZKXC 4TSBH 3VG9B 3TGXA 3S3SA 3MRFA 5EU7E 3J8F7 4NBXB 4M43H 3BWAA 4PJGE 3MPCA 3MLXL 4PJCB 3QHZH 1Y0LB 4JGUA 4YC2C 4TTDC 5CEYB 5F21B 5TE7H 4K3JH 2PTUA 5GHWL 1LE9B 2DQUL 1DQLH 1BFVL 5HI3D 1TJHL 3I9GL 4LF3A 4IOFD 4PGDA 3HLAB 3MV7A 4HK0A 4HWBH 5E7BA 3SKMB 2AW2A 4YIQB 2J8UF 2BNQA 2NY1C 4LQFL 1MI5D 3DETD 1AE6L 1EK3A 2NY2D 1FC2D 2D0GA 3PIQB 1WAAF 2APTA 2AK4B 3EZ8A 3PWPA 4S1DD 5GSVB 4BSWB 2O5XH 4JANA 1TNMA 1G0YR 1TVHB 4UNTA 2VDRL 1IGJB 2HT4C 4MQTB 1MCWM 5TDOB 4YE4L 3ZKQD 2NW2A 4ZTPL 1NC2D 1XGRA 4Q6IA 2I24N 1CN4A 2VDLH 2D7PA 3FHAA 1OTTD 3HS0A 3T65B 1S7RB 2EC8A 2DJ4A