4JFED

Preservation of peptide specificity during tcr-mhc contact dominated affinity enhancement of a melanoma-specific tcr
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
197
structure length
197
Chain Sequence
b'QKEVEQNSGPLSVPEGAIASLNCTYSFLGSQSFFWYRQYSGKSPELIMFTYREGDKEDGRFTAQLNKASQHVSLLIRDSQPSDSATYLCAVNDGGRLTFGDGTTLTVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title T-cell receptor specificity maintained by altered thermodynamics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2013-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jfeD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jfeD02
5KAQG 1ZAGA 4MYWB 4I4WA 3D3VB 2HVJA 4TRPL 5DJDB 3QUYC 1CGSL 4FZ8L 2R2EB 2R23A 5MERA 4PTUA 1FG9C 3MJ8B 3QHZH 5C0IB 3VXUA 1W0WB 1WWWX 2V7HB 4GQ9L 2AJSL 2A6KB 2X4OA 4LSUL 4MJID 1GC1C 5DI8A 2ICCA 1X4YA 1RZGA 5CEYB 5E24E 4S0SD 5BXFA 5DFTA 2BVTA 1RULH 5F6HJ 3EKCA 3IT8D 2ERJB 3KLDA 5HHMD 1CXIA 4BQBA 3BQUC 4YH6A 5IW3A 2C1PA 3E2HC 4EDXA 3CXDH 3PGFL 3CDGB 4HH9A 1SEQH 5DVLA 5D1XA 3V6FB 3OKOB 4Y5XB 3QHFL 3BH8B 1PGRB 4Q0XH 1DANT 4HLZG 1AXIB 1XEDA 1GC1H 2LFGA 5GGVL 4WGVB 4PRIA 3VGGA 1IAIH 3ARDD 4Z78B 1AO7A 3KYMA 4X6BA 3QWOA 1AD9A 4CKVX 5JPNB 4HWZA 5EU6D 1NUFA 5ANMB 3O0RH 1QD0A 4DKFH 5HDBE 4QRRD 1N8ZA 4OLYH 5F7WC 5TF1H 3TJEH 4HS6B 4L29B 4OCRH 3SE3C 5HDOA 2NY4B 3FB7A 3SN6N 4EI5C 3Q6FA 5C3TA 5E8PB 2EEAA 2IWGA 3PXJA 3CIQA 2A77H 1EO7A 4RAUB 1E6JH 2DJ4A 3JV0A 2HFEB 4DKEH 3RWHB 1OWWA 5C0AA 1AGBB 1HNFA 1M7IB 3EDKA 3L95A 4XVTH 3RHWK 4U7SA 4Y2DB 1VDGA 3S34H 1C5BL 4ALAH 2YR3A 3SKJL 4R7NA 3VFOB 4EI6A 1BWWA 1ORQB 4KQ4L 3P4OA 4FQJL 2G9HB 5ALBL 1I3GH 2F8XC 1C8PA 2MJWA 2P5WB 3UTQB 3S37X 5HHOB 1QFHA 1OQOA 1VFOA 2NW2A 3WFEL 5EOCJ 1PFCA 4HS3B 1U9KA 1KJ3H 2M2DA 7CGTA 4L4TB 5LAXA 3MNZA 1UWGL 1ZS8B 3WIHH 1FP5A 5EIVA 5CMAA 3TESA 1NBQA 2UVFA 4KQ3H 3W81A 1RUMH 3I3DA 2CK0H 5KVEL 2VXTH 2YEZA 1JJUA 4PY8J 1KENH 1RJLB 1WF5A 4NHUB 4GS7C 3UDWA 2UYLA 3KDMA 4GSDH 5FDWB 1ZT7A 3MXWL 4GAGH 1ZHLA 3TGXA 3TT3H 1S7WA 4X7SL 5TDPA 3UBXA 2IH3B 3RFZC 1WGOA 2D31A 3LV3A 3HB3D 2OR8A 2XACC 3ZE0E 2QQLL 1CLZL 4J3TA 1CL7I 4F57L 4M48L 2COQA 5T5NG 3LH2H 1E4KC 4APQA 3VFTB 3MRCB 5BZDB 3KYAA 4L1HA 1KCSH 4XRCB 4ZODA 1TJHL 1TNNA 2W65B 1IM3B 3FB5A 2M26A 1EEYA 3PIQB 5FHBL 3FO2B 4OZGA 1TTFA 1G1CA 3AMLA 3ZKNC 1IM9B 4M9OA 2B1HL 2W9DL 4ZO8A 3IJYA 2E7CA 1G9MC 3WIFA 2YOCA 5EZOH 1QLEL 1T66C 2UWEA 5DFWH 1UCBL 3G04A 4Y88A 4JREC 1NBZB 4GBXD 2GY7B 5DSCA 1X6LA 4FFWC 4W6WB 3BP7B 1UVQB 1T5WA 4P9HL 4HIHA 2ZSVB 3LKQB 4NKOB 3RWEA 3RP1A 4RWYL 5T1DL 3CUPA 1IKNA 3GSVA 1MVUB 3KPRD 1N0XH 4HUWA 3MODL 3FFCA 4ORZC 3CU7A 1L9NA 2WIIB 5FGBC 3VXRE 4N0YH 1MJ7H 4MXWL 4QXGH 4GAJH 4M6OH 1TZGL 4WV1C 1UM5L 3QIBA 2QR0B 1RUKH 5IJKA 1G9MH 2ZCLH 2X4SA 2WBJC 1MLBA 2F19L 3TBTB 4UBDC 4HGWA 2ZOKB 4YDIL 5DQDH 4MCYB 3ZYOA 1NCNA 1SJEA 3B4NA 5CBEB 1CDUA 1MCPL 2R4SH 3HE7D 3N06B 5F9OH 5IG7A 4MDIB 4I18A 4HULB 4ZAKC 3CMGA 2R9HC 2YWZA 3VI3E 4DN3L 3FAWA 1PYWA 2DQUH 5FOBB 3G5YA 5I71C 4HX1A 1Q38A 4ZSOA 2PCPA 5HI5C 4OZ4A 4YPJA 4XMKH 4LCCC 4P23D 2AGJL 2GSGA 4UINH 3IU4H 4MLSA 1FRGL 4TUJB 2Y4SA 4BQ8A 1U6AL 3O6KL 4MA8L 4W81A 3TNMB 2ADFH 3U0PA 3PQYB 4XC1L 2KH2B 3EOYG 3RX8A 3SGJA 4NP4H 3R8QA 3RU8H 3U46B 3BZFB 3G5VB 5HDQL 3MBEC 4XNUH 4ZFFB 3IB4A 3KJ6H 5CJOL 4DCQA 3DSFH 1DN0A 3LCYA 5T1KB 2I07A 3IDXH 1AHWC 3LRHA 5CGMA 5J9PA 1JZ5A 2HT4D 3E3QC 1MHHB 4E42B 1MHEB 2AJUL 3T2NL 2E3VA 4B7IA 2YS4A 3UTSA 3CFDA 4U1GC 3S96B 3D3VD 2L0DA 3ZKSD 4OV5B 2MPAH 3T0WA 1JWUB 3O41B 4GXUM 2A2QT 5D5MF 1SYSB 1MCRA 1A1OB 3VFRB 5GISL 5DEGA 1FGNL 1NGQL 2XTJB 5KG9B 1KLGA 2J5LB 5GS2D 2EYSA 5A1AA 1IGJB 2AV1B 3W11D 4OV6F 2FL5A 4OKVA 1QP1A 2MQ0A 4UNUA 1A9BB 3VCLA 1CI5A 4R0LC 5MENE 1E6OL 3C5ZD 3QDGB 1XGRB 3QCVH 2Z8RA 2XQYK 5KZCB 1U8PB 2I60L 1Q9LB 3M17A 1J5OL 4OLEA 2DLEA 4XHJD 3RZCB 1LO4L 5B4MD 5IV2A 1NFDB 3IETA 3UXFA 1FE8H 3N0PB 3T3ME 5I2IA 2RAMA 1P4LB 3EIFA 4MJ2A 4R2GB 5CWSB 3O2WL 4QCIB 2EYTB 2F15A 4TOYL 4FQXB 2VABB 4XNQB 3QEHB 3A6OA 4MX7B 5A40E 5DD0H 3ARTA 3MJ7B 1MCSA 3QQ3B 1CR9L 1C5CH 1KB9K 3Q6GL 2B2XL 2IANB 5IMKB 1FZKB 3QPXH 1AY1L 5DJ2A 1G84A 5K9OB 3OR6B 1NCTA 5GSVB 4P5KA 2EDOA 2NY4D 2R2HA 2RCSH 2ZKHL 1NLDL 3QDMB 4PRIE 4X4YA 2JCCA 5KSBB 1GHFL 1QBAA 1A9EA 4OIIL 4RIRA 4HKBB 3S5LG 5I17A 1V7MH 4NNYA 4OCXL 4XMLL 4Y2DD 4N0UB 4JLRA 2VH5L 1BD2B 1EXUB 4I9WD 4K7FA 4LK4A 4LIQE 4C54A 2WLZA 3FONB 2Y6SD 3DETD 5T3XL 3FKUS 5EUOA 4NQEB 3Q0HA 4KMTH 1RIVH 4NPYA 5E8OA 4RGOH 2D7OA 2P5WD 3FT3B 1LK2A 2OYPA 4ZPVB 5HHOD 1J9CT 4F7CA 4ZTOL 5FA4B 1YEGH 5I1CH 5AWNH 4Q9RL 2ZPKH 4L4TD 4MDJB 2EXYC 1RUAH 1JGUH 3ARZA 3BVNA 4ZYKB 4F15C 4YUEH 4D9QD 5KN5A 3HCVA 2B0SL 2ADGA 1OTUD 2V9TA 3NCFB 5KVDL 3VGAB 3K3QA 4ZUWA 3VJ6B 1JYNA 1AGEB 4PBVC 1D5IH 1QFUH 1CCZA 4LVHC 5FHAH 5ADPH 4LCYB 2XICA 4O51B 1A1MA 2IMMA 4P59L 1LEKB 3HNSL 4HEME 4HUKB 1KXTB 1U93A 2H32H 3DTXA 3HNTH 1FC1A 5C07B 1T5XA 4KRLB 2Y1VA 4KKCC 5IUSA 3C6SA 3FJTA 3BPCB 3W0WA 1V3KA 3E8UH 1MCWW 5FKAB 1PEWA 3MLWL 3X3GH 1AD0B 5IGXL 1YNLH 4LLYA 1GGCL 1SEBA 1MQKH 1HHIB 1QUNA 4P99A 1S9XB 1F6AA 1LE9A 5IFHL 5IBTL 1A6TA 1KTRL 1OY3B 3N1MC 3NMEA 5EZJA 3MLUH 4H0GA 1LK3H 2BCKA 4PJHA 2HKFH 3P9LB 2OL3H 3FT2B 1IM9D 1GOHA 4LL9A 1SY6H 4R26H 3U48A 2NX5E 4X8JB 4ELME 1QFWM 4FNLL 5H35A 5E9DB 3ILQD 5EZLA 4JVUA 3SGDH 4I8DA 2BERA 5A43C 2CLZA 2UZXB 3AU1A 1J0JA 2WWMD 3REVA 4EUPA 1DFBL 1X5FA 2VDRH 1LEIB 1T21B 5CD5D 2ZUWA 3TN0C 1U8OA 2PUQT 1D6EB 5MEOB 3HS0B 3OAYK 3L5XH 1NJ9A 5J6GA 3QI9C 3PWPE 3KPSE 5I30H 4NO0B 3T1FA 2EEBA 2X4RA 2YK1H 3AXLB 4ZOEA 5HI3D 5EN2A 1KC5H 5E94A 5JMOC 1NMAH 2BY0A 2ZUUA 3EOBA 5GRJL 3RBSA 3U2SA 4D9LH 1ZSDB 2XWBA 3F8UB 5D7JA 4EOWL 1IGCH 4JO3L 2ICWB 1QQDA 3R4DA 3QQ9C 2AW2A 1F11A 1UXWA 3FFCE 4B0MM 2FO4A 1ADQA 3G6DL 4FTVA 4KZEL 3PV7A 3BKYH 3LEVL 3EO1A 3NABH 2AV7A 1INEL 5KSAC 4YIQA 3V4PH 4GW4B 3MRPB 5D7IF 3QYCA 1CZ8H 3N9GH 4XXCC 2Y5EA 1T1XB 1IGML 2MKWA 1F2QA 4PJ8B 1T2XA 5IHUH 2VNCA 4CJ1A 4HK3N 1DQLH 5FV1L 1U3ZA 4HDIB 3GJFB 1HIMH 4G3YH 2DQIH 5DQ9A 5DMGD 3KWWB 4FQHB 5T1KD 1ETZA 2Q8AL 5EUKB 1WAAE 4JFEB 1AFVL 4YDLB 4ZD3L 2VC2L 2DI8A 3HFML 4OGZA 4ODSL 4U1HB 1I8MA 3U7WH 1YECL 2VE6B 4XVJH 3AREA 2VZVA 3DBXA 2EE2A 1AR1D 1H3VA 1JNNH 4PLNC 3PP4H 3FZUD 4YWGL 4N8VB 1OARL 4QRPB 4JPWL 4U6HB 5SWQB 3BZEB 3RPIB 1GL4B 4Y5VC 3DXAA 1DEDA 3VFGH 1GOGA 1KIQB 2XTJD 4Q2ZB 2EECA 4FFVC 2BJML 3Q5YA 1N4XH 4HLZH 3G6JF 4MGXA 4YJZL 5C0RH 5J7CC 2J8OA 2EE3A 3ZDZE 5GS1A 2B5IC 2GITB 4MCZA 1MFDL 2X7LA 3L3KA 5GZOD 3CMOL 4NFBA 3NZHL 4BZ1L 1NGYB 5TE6H 1BWMA 4D0BB 2VXVL 4X6DA 2C3VA 2X4TA 3WFHB 4S2SA 3QDGD 1KTDB 2BRRH 4PJCE 1Q0YL 1FCGA 2A9MH 1KOAA 1NGPH 4PTTB 1IAOA 2OZ4A 1WBZB 5KZCD 2GTWA 4YR6A 1G7QB 5D96B 4JE4B 1A0QL 3BFOA 1R3JB 2Y7QA 3RZCD 4C83A 2FX9L 2A83A 4LLQA 5D1QB 3UTZB 3IXTB 4QYOB 3NFPB 5KVMC 4IRSC 4JPVL 3EGSB 4BK5A 4AH2A 1U91A 5IIEB 4U2YA 3DYPA 3GB7A 4PRHA 1J8HA 3MGOA 4R2GD 3GKZA 3ZSSA 3EW3B 4FQXD 2K3TA 4ONGL 3U30B 3HNVL 4WW1B 2P45B 4B53A 5KS9A 4S11A 2P43B 2ORBL 5D8JL 1IAKA 3VH8A 3JTTB 2IAND 4ODWA 3FQNB 5T3ZL 2NTFA 3V0VA 5I75B 2NY6C 3V6ZB 2DWDB 5D1ZB 2QADC 4ZO6A 1GXEA 3VFSB 3U36A 1IEBB 4PR5B 2EICA 3T0EC 4F7TB 3F7PC 1OTTD 5FUCE 1ADQL 3H9HB 1MUJB 3QDMD 5C0GB 4FQCH 1JRHH 3DI2B 2EDRA 3CDCA 1A7QH 2VN4A 4WI4A 2PXYC 4Y4FC 4L4VA 3WFCL 2P5EA 1RZ7L 3OKDA 5A3ID 4OCWL 4ZNCD 1BD2D 4KK8C 1OPGH 2R1XA 1C1EH 1EUUA 1ND0A 4D8PA 3HI5H 2BNRB 1NDGB 2VISA 3O4OC 4JKPH 4Z7VE 4HW6A 3L9RA 2IPUK 2JJWA 4LSTL 1QRNE 5I8EA 3T65B 3KLSA 2J1KA 2OJEA 4X7EC 2P46B 1A4KB 4JM2A 4P2OD 4OLXL 1DQDL 3OBAA 4KVNL 4HGMA 3OKMB 4RMWA 4WI5A 4MA7H 3HAEB 2DQFA 5E2VH 3QXDB 1S9YB 4XBEL 3CC5B 4XZUB 3IF1A 1U3JA 4ZUVA 3BESR 1BVLB 3MXVH 1S5HB 5FYJH 4PLJC 3HHRB 1IL1A 4Q6IC 1CQKA 2HT2C 1MREL 2NNAA 3L5HA 5GPRA 3RL1A 4CMMA 4YAQA 4HUUB 1CLOH 3ECBA 1B6UA 5FYLE 3DO7B 2NPLX 4HV8B 4LCUB 5FO9B 4OZHB 3QG7H 5DEFA 3VGHA 2XIDA 5J56B 4X98B 1F8TL 4U1JA 3WFDL 2BVOB 1KJMA 4LCIH 2ITDB 5D2LB 1ZMYA 1RJZA 5HPMB 3VXQB 3AAZA 3G08B 1DQML 5CD3B 5C70A 2CPCA 2WWKT 4K8RL 4M6NL 1XCQA 2B4CL 5TDNB 2VDOH 5BQ7A 2OZ4L 3FB6A 1XIWD 4PJ5E 4DGYL 1UGNA 2VIRB 4G5ZL 1IFHH 1F4XH 5KBNC 2HLAA 2O93L 4LVEA 4WUUA 4GXVH 3D25B 2GCYB 4U7MA 1TDQA 4RAHA 2J8UB 4JPKH 1WFNA 3AGVA 2QHLA 4X4ME 1CE6A 1J0ZA 2PW1B 5J8OA 1ZGLA 3FCTA 2KL6A 2EO9A 1S9WB 4M4RA 3O9WC 3UO1L 5JW5A 3ULSA 5B39G 4CMHB 3C2SA 3PHQA 1MNUH 3QIUC 3KPQB 3VWKB 4P4KA 4GG8A 1CIDA 2XV6B 1IILE 4Q9QH 4NO0D 4QTIL 3W2DH 1AGDA 2ITCA 3B2UD 4PB9H 5DGQA 3ROOB 4YHKH 5E95B 3LD8B 5D2NA 1HQRA 4ZQKB 3MGTA 3PDDA 3VRJB 2BDNL 1KPUA 4Z0XA 2YMXH 1X9QA 3OKYA 3D39E 3MUJA 4PJAF 2H8PB 4XPTH 2PF6A 4OBSA 3OR7B 1OAZL 5ICXB 2AXGA 1ZANH 3VRLF 3E6HB 5AUMB 5TQ0H 4G8IA 1CL7L 5SWZE 4I48B 5F1OB 1L6ZA 4LLUB 4MQXD 3HA0A 5C2UB 2MCG1 4HHAA 3ZT7A 1O7SA 3QRGH 2W9EL 2NY1B 3ARPA 5CEZD 5I9QC 1C7TA 2JB5H 5F7EH 2D9CA 3KAAA 4PJIA 2DKMA 1A3LL 1W72B 1ED3A 4JFED 1MPAL 1JWMB 5HTSA 1UJ3C 3KYKL 1DVFA 2HWZH 4KMQA 4Z7NF 1CFTB 5DUBB 4LVNB 4AIOA 1EHLH 1D5XB 3C09B 3SKNB 5C9JB 5FYKH 2D0FA 4HXAL 3MJ8A 4QRPD 2FR4A 2BVPA 2V7HA 3FOLA 3IAGC 3ULVL 3NZ8B 4OF7A 3MRFA 4L9LB 5BS0B 4O58H 1U36A 5E6IB 4YK4B 2FSEA 2VLRB 1BZ9B 5HHXL 4P4RA 5HI4C 2FZ3A 1NH6A 3BIKB 1I8IA 1GOFA 3IDNB 4GAYA 1BQHA 2XPGA 4JFOA 3OKOA 4MSWB 4Y5XA 5F70A 4MJIE 3BH8A 2GEEA 5EO9B 5D1QD 2X4QA 4MXVF 4PYHA 1S5IH 1ONQB 1RJCA 2X09A 5HHME 5I19H 4DJMA 1EEZA 1F00I 4MJ6B 4KAQL 3X17A 5JPNA 3LKOB 4ONHB 3WLBB 4HFUH 1A1NB 1AIFB 3CFKB 4YHYB 1PZ5A 2BSED 3U7YL 1FFNA 5E03A 2VMFA 4NZUH 5FA3B 4OLZH 1UZ6F 5D1ZD 3C08H 2NLJB 5E8PA 3SKMA 1JPGB 3IKCB 4GLRH 5GS0C 1K4DA 1KN4H 5C6TH 1UEYA 2HFEA 4PJXB 1BZ7B 1GGIL 5EU6E 4DGIL 2BVYA 5IROA 4JB9H 3MZTA 3AY4A 4PJ7F 4GKOA 4QRRE 1UFUA 2CIKB 1U95B 2HN7A 4JPIB 5CZVH 3FHAA 1MIEL 1T0MB 1ORQA 5EOCH 2XQYG 4NJ9H 5GJSH 2G9HA 3MLXH 4WW2F 2Y06H 2OX5A 4M43L 2BNRD 1ZLSH 3SDXE 1B0RA 2VTFA 1RZIA 3TZVD 3C5SA 5GS0H 1XGTB 4LPWA 4K7PX 2FH6A 1P4IL 2V9RA 1XF4A 2Y5TA 3H42L 1K8DA 2ZUSA 2ZUXA 3EYFA 3QCUH 1TCMA 3MRMA 2DMBA 2EIBA 3EHBD 1M7DA 1I9JL 2LU7A 3GSWB 1YEDB 4FFZL 1AKJA 1E4XH 3ELAT 4R90L 1DUZB 2YPLA 3T77A 3RTQB 4J12A 1LP9E 1FGVL 4NHUA 4OGXH 1TPXB 3GSRB 4WW2C 4L3CA 1FO0H 3M1BA 4HJGB 1NL0H 1NFIA 1YMMB 4KTDL 5F89B 5K9QI 5EOQL 2IH3A 5BZWA 3GGWA 2Z92A 5FUOH 1TETL 2Q1EA 1RD6A 4WO4B 2ZOLB 2DQEL 1LEGA 3MRNA 4UIKL 3MBXH 4M1CC 4JZJA 5DWUH 1XGQB 1CFSB 4G7YH 3WXVL 2X05A 4FABH 1T7ZA 4Z8FH 1F4HA 4G9DB 1FSKC 1LMKA 3GHEL 2JELH 5SWSB 3ARGC 2XG4A 3PV6A 3KYOB 3PIQA 3K4AA 5L9DH 3F7YB 3L7EA 3K0WA 4UT7L 3L5JA 3ARVA 3JBG7 1MI5B 4U0RB 1G9NL 4JHBA 1CF8H 5BW7A 1PZUB 1W8OA 2YPKB 1JTOA 1TTGA 4K94L 2V5SA 1VFAB 4KK9C 3BP7A 4U4BA 3TWCH 4WI9A 4NKOA 2WINB 1OP3K 1R3LB 4JQVA 2C1OB 3GSNB 3RJQB 5IVXB 1BZQK 1CD0A 5INDB 2YD6A 1JF5A 3VMNA 2P4AB 3EDDA 4LF3B 4WFFD 2NYYD 1LNUA 1A8JH 3DUHA 3NBNA 3BEWA 3QJHA 3VWKD 2XI9A 1FL3B 2VXQL 2CIIB 2VLLA 1UA6H 4MCYA 3QUZA 2BSSA 3MV8B 3RDTB 3KPRE 2CKBH 5CBEA 1MIMH 4L5FL 1H3XA 3ZTJG 4EN3B 4I0PC 5D4QA 2FHCA 4MDIA 4OFKA 1PG7X 5HGDA 4WY7H 4LLMB 5KTEH 3UJJL 1I1AC 3EJYD 3BISA 4UV7L 1QPXA 2V5YA 2K1MA 1HYSC 3P9MB 5DT1H 5CZKA 2FGZA 4HUMB 1U8JA 2DTMH 3HUJB 5JHDA 4OD1H 3PQYA 2W0FA 5K59F 1DSFL 1OSPL 2OTUB 1IC7L 5TQ2L 1HINH 2Z31B 3V0AC 1MCOH 3U46A 3U0WH 4WTZA 1DR9A 5I76B 3MACL 3UJTH 3O6ML 2NY1D 1MWAH 4M7JH 5I1KL 3OB0K 4AZ8A 2D3VA 2OR7A 4M7ZC 1MHHA 1G7HA 1JIBA 3D0VA 4F3FB 1C12A 5IEKB 1ZEAL 5EZIH 3FO0L 4Z0BL 5D72L 3BJ91 5D71H 4UTBL 3MRJB 2BNQB 4LPUA 4UV4L 1SYSA 3OXSB 1WTGT 1CLCA 2WQRA 4MVBD 3P77B 3SGKC 1NEZA 5ERWB 5DMKA 1ERNA 3I75A 1VKXB 2BMKA 4IHOA 1ZA6B 5I18H 2EDYA 3S35H 3RUGB 2J6EA 4JGUA 1FNAA 1JNLH 5MP6L 1MJ8L 2NR6C 5J3HD 3D3VE 5BS0D 1I7RA 3GMLA 5E6ID 5IESH 1I9IL 1S7RB 5ITFB 3KS0J 5J6HA 1YY8A 3DURA 2VLRD 5HYSB 5MEQA 4OAWA 2Q8BH 4PLKD 4YXHL 4F58L 2R1YB 2ZNWA 4RAVB 5F9JB 3IGAB 2WBWB 5EBMA 3MCKB 1F6FB 4LSRL 4F2MB 4N5ED 4TSBH 2CKNA 3WLWD 2AEQL 3SE8H 1UZ8A 1HHGA 4N1HB 5HHVL 1EFXA 3RWIB 4GMSL 5HDLA 5ILTH 5DFVD 5BJTA 2GTZA 4X5WB 3INUL 2VABA 4XNQA 3RHWF 3RWFB 4MAYB 3MOBL 4KROB 3QQ3A 2WAHA 4JM4L 3GUTB 4AEFA 5L88L 2WUBL 1YPZB 1JUFA 2FGWH 1EPFA 1H3TA 5IMKA 4PYGA 4YGVA 1FZKA 1X5GA 3NAAH 4L8DB 1KEGL 1VFBA 5GSVA 1RJYB 1HN1A 5CHNB 5L6YL 2FX8H 2DAVA 4JQIL 4KK6D 4P9MH 8FABA 3UC0L 4G80A 2AXJA 1A7OL 2ARJA 5IFJA 4DGVL 4M62L 3ARBA 5DVNA 1N5YL 1GZQA 4UILL 3J7HA 5ANME 3CH1A 4XBGB 3MLSL 4GFTB 1FNFA 1EXUA 3PWNA 1S7UB 4LVOC 1Q8MA 1UG9A 3ZHDA 3MROB 3BT2H 2FD6H 3FONA 4GKSA 2FEEI 2K9UA 4NQEA 5GGVY 3TLRA 3OAZK 4RMRA 5EULV 3OB8A 4M7LH 4YXKH 3TO4B 1U8QA 5F6IC 1VEMA 4HXBH 1HXMB 1X5KA 4NRXA 1RHFA 2F54A 1TQCC 3GSXA 3ORJA 1XFPA 3BD4A 3C6LA 1Z3GL 2HJKA 5DZOA 2V9QA 5DJ0B 3CZFB 2YUWA 3T2PA 3DX7A 4I9WE 2O5XL 4U6YB 3UPRA 1G6RH 5C7XH 3DVGB 1OW0C 4MD4B 5JDSB 5C0FB 2CMRH 4LFHG 4MJ5A 3LN9A 4R4NC 3VWJC 1JWSB 2J8HA 1XF2B 1NGZB 3SDAC 4YHNB 1RK1A 1I7UB 3BD3A 3VJ6A 2A0LD 2P5WE 3RTQD 2CSPA 4LCYA 4X6EB 3B5GA 2DN7A 5HHOE 4O51A 4LQFH 1IC4H 3RX5A 1KIPB 3ZE1F 5C07A 3W9DA 4QHKI 3HZYB 4L4TE 4AT6B 1BBDL 4ERSL 3X11B 4J4PC 1YMMD 4O9HH 1QA9B 4D9QE 3MLYH 3O11A 2J6EL 3SE3A 4WO4D 4WTWA 4JFZL 3PWJA 5JUEL 5FKAA 4XVSH 4XC3H 1MEXL 1JYWA 4KHTH 2WMPA 1AD0A 4L8SA 4QRTA 3C5JB 4WI3A 2O5YL 3HLAA 5LGJB 1HCVA 4DVRL 1RURL 1MLCB 3AROA 4HWNA 4JKLA 4D0CB 3GMMB 3PHOB 4ETQB 1JRHI 1S9XA 1CFNA 4WWKC 5FUZH 2DLTA 3WIHA 1MFAH 1ZKAA 2Q6WA 5IB3B 3KLAB 3THMH 3BXNB 1TJIL 2HH0H 1BM3H 2ZJSH 4CL7A 2EIZA 1MI5D 5C08B 3B9KA 4PGZA 4PGBB 3RVXD 3CFIC 1U8LB 3TO2A 2DQDH 5E9DA 4LSVH 2H9GB 5ICYA 5I16A 2IAMA 4NQXA 2OR9H 4LLWB 4UQ3A 4POYA 1RVFL 3KPLB 3EOTH 4UOJA 3HE6C 2BFVH 1FHGA 1LO0H 2D0GA 4PRNB 5JTWA 1MCIA 4KVCH 4XCFL 2FLBT 3HS0A 5LKNA 5DO2D 2XKNA 1INQA 1B4JH 1JPFB 2R1WB 3K4ZA 2GHWB 5FM4A 3AXLA 4OM1L 1V7NL 3SCMB 2YXMA 5I15L 3BHBA 5CS7A 2KKQA 4Y2OA 7FABL 4KI5D 4TRPH 5B38B 3WS6C 5CJXC 1CGSH 1Z9LA 1ZSDA 4Q0XL 3HR5B 5DJCA 1WISA 3MV8D 3RDTD 3GBNL 3IDMA 1ODAA 2LQRA 3U0TA 1KTLB 3X3FH 5F3HB 4GQ9H 4EN3D 3ZLQC 2AJSH 4XTRD 4OM0L 3WJJC 1RUPL 3L6FA 4LSUH 2VB5A 3OPZL 4NNXA 3RA7L 2YSSB 4DQOL 3O0RL 1RU9L 5GGQL 4MMZC 3KPOB 3CFBA 3AB0C 4DKFL 4L3AA 2MCPL 3HMWL 1IEAB 3DRQA 4ZOCA 3J8F7 1ZT1B 3PGFH 4DVBB 1BVKB 3DX6B 3DVIA 3L5WB 4PJ8A 1FNGB 4Y16C 5D6DA 4OLUL 2HTKC 3QHFH 2UZIL 4N8CL 4PJGA 4U1LA 3BH9B 4G8EB 4KGLA 4YDVB 5F96L 4OUUA 3QUXC 3BGMA 3PJSA 4NRZB 3WDJA 3RVVD 2IQ9L 4FQHA 5GGVH 2YKLL 2MOVA 1EIBA 1B4RA 3U83A 4JDVB 4XVUC 5IQ9B 1D6VL 5KANI 1FV1B 4PJBB 4WU7B 3D18B 4U1KB 4XGZB 2VE6A 3QUMB 5TE7H 4M6ML 2BNQD 3HC0B 2A6JB 3OXRA 3MCG1 3LQZB 4JO1L 2WW8A 2IMNA 3BE1H 4U6HA 5SWQA 3RPIA 1OB1B 4NQCB 4H5SB 1XH3A 4LNVA 1H0DA 2WBJA 4HPOL 1WBXA 1YY9D 4JFXA 1KTKE 3JSSA 5HXMA 4TSCL 5C0EB 2IF7A 4LHUB 1KPVA 4N0RA 2ZUQC 2DM4A 3DWTA 4FHBD 1UH4A 4IRJC 5IR1B 4KQ3L 2B1AL 4C56B 4KMLB 1A3RH 3BQUB 1OQXA 3FN9A 1C5BH 1M6OA 4PJFB 3SKJH 5KOVC 5GGSB 3WFHA 2Q7YB 4ZAKA 4KQ4H 4HBQA 2EYRA 1FH5L 1MCLA 4L8CA 4M5YL 4LNRB 4FQJH 4PTTA 5ALBH 1JN6B 2XTJE 4OFIA 3WFZA 1I1FB 5CIPH 3BO8B 1CIUA 3UTZA 3LKNA 5EU5B 3NFPA 3I50L 4KZDL 4HIEA 2V17L 3WFEH 4NN7C 1EVUA 2Z0BA 3LH2L 3DV4B 3N1FC 1UWGH 3QDGE 1KCSL 4MXQC 2BY3A 4WJ5B 4MAYD 1FN4A 5DDHA 1OTSC 3VFMB 3UYRL 4OIBA 1AC0A 1ZVYA 5KVEH 4ZFGL 1JV5A 1U8NB 4RQQB 2IQAB 5FF6B 3SE4A 3MRKA 3NCJL 1NFDE 4IDJL 4JO4L 5GSRB 4KUCD 3LHPH 1KGCD 3ZYIA 3QNYA 4PR5A 1HILB 3SKOA 3MXWH 4U1MB 1IRAY 3LB6D 4F7TA 4FQIL 1D5BB 3H9HA 4X7SH 1MUJA 5C0GA 2V6HA 3H7BB 5CSGA 4QOKB 3CJJA 5DURB 5ESAB 2QQLH 1CLZH 5IBUB 2VZUA 4ODUB 4M48H 4F57H 2SEBB 2IANE 4QHMA 4JDZB 5BRZA 4P9HC 1BBJB 3UTPD 2FECI 2X2YA 3M45A 3ARXA 1N0XL 3L3GB 2G75B 4Z77B 1NDGA 1YN6A 4PJEB 5FHBH 3NOIA 3QDME 1CK0H 5KSBE 2GT9B 4JO2L 3TO4D 5FECA 4NFDA 1UB6A 1RUKL 4Y4HB 1RZ8A 2R0WL 2W9DH 3OKKB 2FB4L 1H3WM 3I2CL 1WZ1L 4N0UE 1XF1A 1UCBH 4LARL 1BD2E 1UC6A 5D5MA 3CU1A 2VSDA 3L3DA 3CC5A 4MB4A 3OKEB 5DJYB 3L3IB 4H8WL 5T1DH 4G9FB 3VXNB 4GS7B 4LKXB 3MODH 3RKDD 5I1IL 1N59B 3TVMA 2F53B 32C2B 4JCLA 4X4XB 5B8CC 5C6PB 1SQ2N 4MXWH 1S8DB 4JFFA 4XMKL 4HV8A 1TZGH 1VGKB 3DX9A 2XTLA 4OZHA 3RWJA 1UM5H 5MEPA 5E70A 4NWUL 3BKJH 2ADFL 2ZCKL 3EJZD 1LGVA 2F19H 3VFPB 4X98A 2APVA 5J1AB 1RHHA 2KUTA 3MRRB 5EC1B 1INDL 2HTLC 4PG9A 2CDEB 4DW2L 5HPMA 3VXQA 4JRXB 1MCPH 4HLJA 4K23L 3G08A 3EAKA 4ZNEA 3UTTB 3V9FA 5TDNA 3HPJA 4G42B 2PETA 5DLMH 5I8KH 3MLTB 4FMFA 4DN3H 1Y18A 1NC2B 2IADB 2EXWD 5ALCL 5F9WC 2DKSA 1KLUB 5C08D 2DMCA 4GJTB 3U4EB 1T4KA 3D25A 2GCYA 2UWEF 2AGJH 2YA0A 4JREB 2BHYA 1U6AH 3O6KH 4MA8H 5L2KB 1F4YH 1GVIA 1ZWIA 3FO9B 1K9TA 3MRBB 5HDQH 3HC3L 4KKBC 3DGGB 4PGDB 1HQ4A 4NQDA 3RVWD 3MNWA 3VXPB 1JE6A 1QEWB 1S9WA 4PY8I 3RY4A 2UY7A 4CN6A 3D69A 4G8GB 2HLFC 1ORSA 1AGCB 4WV1B 2AJUH 3T2NH 2NY0B 4HIJB 2EDJA 5AG8A 5DQJB 3QCVL 3HG1B 4HPYL 1H8SA 4FQQB 2HP4A 2N56A 5EDXA 5CUSL 1H5BC 3SCMD 4DFIA 4EVNB 5JW4N 5HYJB 1CXKA 1WIOA 2QQNL 4S1QL 5DRZB 1K3ZA 1VPOL 4ZQKA 3G5ZA 3O3AA 5FM5O 1W0VA 5GISH 3ZT6A 2PYFB 4V2CB 5A2JH 1FGNH 1NGQH 1N26A 1CXLA 3OX8B 1BAFH 1KCLA 2DS4A 15C8L 1IAIM 4YHZL 2H8PA 2Z4QB 2VSCA 43C9B 3JV6B 2AJZB 4TUOA 1YEIL 3O6LL 3QG6A 5I71B 3V5HB 3OR7A 2RIKA 5TGBB 3OAYH 4N9GB 1C5CL 1JP5A 4QT5B 5L0QC 3S88L 3QIBC 2CGRL 1A6UL 1E6OH 1KIRB 5F1SA 5IJKC 2Y07L 3PDGA 3TYGL 4NQVB 1AI1L 2I60H 5I66A 2JF1A 1J5OH 3K46A 2HFFA 5DUML 1NLBL 3MBEB 5IFAL 5I1LB 2KBGA 5E2WL 2O61A 2FWOB 1IQDB 1FPTH 3QBTB 1JL8A 1X5YA 4I18C 4YO0B 1NBVL 4DK6A 3O2WH 2W0PA 4TOYH 3L3HB 1XR8B 2PO6B 1JWMA 5DK2B 5K9KB 2MWCA 3FQUA 1UM6L 1D5MB 1LE5B 6FABL 1CR9H 2EC9U 5EBLB 4OLVH 5IHLB 4QRUB 2B2XH 4NKMB 3S4SA 3TN0A 1CFTA 1W2KT 2I24N 1R5IB 4KMTL 3QUYD 5E5MA 1AY1H 1HYRC 3RGVC 3TIEA 1FNSL 1QHPA 1FVCB 5CEZE 3H7LA 4PJCF 1QBML 4XP4L 1OAXL 5I8OL 2ZKHH 2FH8A 1A6AB 3I02B 4NQCD 1BQLH 1NLDH 4JFEE 1GHFH 1YEGL 3NZ8A 5AWNL 2A6DB 1Z0NA 2C4XA 4L9LA 4LHUD 4XCNB 4OIIH 5DD6A 3X13B 5C0BA 1DL7L 4XMLH 4OCXH 1X4XA 2BRQA 3V6BR 4KJWC 3GMNA 4WVRA 5JZ7C 4OZIE 2VH5H 3QH3A 4C56D 2IPTL 3BQUD 2VZTA 4KY1L 2VL4A 1D5IL 4NN6B 4ORGA 3IDNA 4JFHD 3H3KA 4QRPE 4HUXB 3OF6D 1R3IL 3FRPG 3TBWB 2Y23A 1BX2A 3V5KB 3WD5H 1DEEA 2OTWA 4U1NB 3O3DB 5IW1B 3VFUB 2ED7A 3IDJA 4ZTOH 1ONQA 1EEQA 1K8IA 2APBA 4FS0A 2AQ1A 4Q9RH 1NGXB 1T04B 1I1YB 2B39A 3CX5K 1AIFA 3EOAB 5ENWA 1HH6B 2CLRA 3IYLW 3TA3A 1PKQA 3VFVA 2B0SH 5DJZB 3IJHA 5ISZA 5KVDH 4AG4L 3FTGB 3NTCL 4N0CC 5J0BA 4HZLB 3DIFA 4XCYA 3EO0A 4YHPB 4P59H 4XP5L 4DTGH 2IPKA 2CXKA 3GI9L 4Z7VF 2OXGA 2X70B 3MV7A 4EXPX 1I8KB 2A6IB 2B20A 4PJXA 1BZ7A 3JTSB 1N2RB 2FO1A 2BX5A 2VOTA 5C0CA 3PG2A 4QOKD 1G7JB 5DURD 5FUCC 2LU4A 4O5LL 4F7EB 2AXHA 3SDCB 1TFHA 5EU7C 3MLWH 2CIKA 4X0KB 3BPNC 3MRHA 1NMCB 4JFQB 2GY5A 1T0MA 4CNIA 5IGXH 2DQHH 1A14H 3C9NA 5EUOF 4JEGB 3IAPA 4RCAA 2EDKA 2H32B 5IFHH 1IZJA 1VA9A 2E9JA 5JNYA 4H25A 1JMXA 4OJFL 1KC5L 4Y4HD 3U79A 1NMAL 5EG6C 2X1QA 4PV8B 4PGCB 5DMYA 1W72L 4YFEA 3EDFA 4FNLH 1U8KB 2NY3C 4BSWA 1JI2A 1WQVT 2BNRE 3SEPA 4HMDA 5GRUL 1BQHG 5JXEA 2X9YA 2VDQL 1HHJB 1DFBH 1II4E 3NABL 4G9FD 3G6JA 2AI0L 4PP2A 4P5TA 1AXSB 4X6CE 5I6XC 4YE4H 1RK0A 2F53D 3AS0A 3DUUB 1JZ7A 5IJVB 3S98A 4L3EA 3V4VL 4QWWC 2BY1A 4Y5YC 2ZOLA 5DD1L 4ZXBB 2WLYA 5ESQB 5GRJH 2N7AA 2XA8L 5IK3A 1YMHA 2APFA 1T22B 4EOWH 3E6FA 3P0VL 5HHNB 5SWSA 1FFPA 3ROLA 3KYOA 4JRXD 1I8LC 4G3YL 1GSMA 4NNPL 4BH7B 3UTTD 3G6DH 2QSVA 4A6YH 4Y4FA 4KZEH 2PXYA 3F7YA 3QUKB 3LEVH 1BECA 4PV9B 4OZHE 4Y19B 1INEH 1NC2D 4ACPA 1A5FL 3BW9B 3S8WA 3NFNB 4XVJL 3GEWB 2FCBA 4AM0A 4I3GA 4ODVL 2VLJA 4LEOB 1T66D 2KQMA 1K4CA 5D2LE 5FYLH 3T0BA 1IGMH 3PP4L 4FOMA 4HKJA 5L2KD 2YZ8A 3HZVA 4RISL 3VXSA 4TNVK 2FEEL 4KUZH 3VFGL 2QSCL 4QNPE 5IVXA 3PGCA 4UQ2B 1QSZA 5E0QA 3LS4L 3BUTA 3DVFA 2Q8AH 1LWRA 4G8GD 3EYQC 4FP8H 3P30L 3QI9B 4PREB 2YHGA 2W92A 2J8UE 4ODSH 4LEXL 4P5MA 4Y1AA 3HG1D 5AD0A 4UBDD 3QIWB 1ZK9A 5HYJD 1PQZB 3RDTA 5CGYC 3NH7L 4IIQC 5HPOA 1I7ZB 4YLQT 3BWAA 1CDJA 1KT2A 4WFFE 2DQJL 4LLMA 4LAJH 2BOBB 1BFOA 4GKNA 5F44A 2BJMH 5J1TC 3I9GL 5KSAB 1JK8B 4LAQL 4DFHA 4R3SA 1MFDH 3P9MA 4X7TA 3T4YB 3NZHH 4BZ1H 2XG5A 3C8KB 5C8JA 1S3KL 2VXVH 4K07A 3KYNB 3OGOE 1Q0YH 3VE0B 2OTUA 2XNAB 2Z31A 1EBAA 5TDOA 2JIXB 4P46C 4K3JL 1A0QH 5D7JC 3MBED 1BFTA 3ZDYF 2V2TB 5DS8A 4JPVH 1KXQE 3CSYB 3W39A 5GGRA 3VFWB 4AQ1B 4JN2A 1U8MA 4HKZA 4N1EA 1AR2A 2Q87A 4ELMB 1SJXA 1JGDB 4ONGH 4M3KB 2C3WA 3ZHKA 5D7IB 2VN7A 3HNVH 2ESVB 1S7TA 2R29L 2A73A 5E2UL 2YD5A 2ORBH 3PDOA 4WUKL 3IU3A 4JKPL 2FBOJ 4F7MA 3X12A 5IB2B 3T09A 4QGTA 4JG1L 5ERWA 3OJVC 3QIUA 3CX2A 3KS0H 4Y5VB 4N0FB 2X42A 1EAPA 1ADQH 2ARJQ 4O02L 3QQ4B 4TYUA 1MAML 2YWYA 1TVHB 3WO3B 5JOPD 4RX4A 5E2VL 2ZUYA 3MV9B 1IAMA 3LEXA 4HBCL 3D85B 1RZ7H 1U8HB 4JRYA 4RGNC 2VDKH 4OCWH 4X6DF 5FYJL 2Z35A 5FKPB 2XWJA 2WK2A 2HFGL 4F33B 2XN9A 1EDQA 2R2BB 4LPVA 3IGAA 4DKAA 2AKRB 4L8BB 4F2MA 2EDNA 3B83A 3D1MC 3D48R 1EHAA 1IC5L 2EH7H 3QNZB 3C2AL 4EJ1C 1Q1JH 4JFPA 4IRSB 3SO3C 5BS0E 3GSNL 5H8DA 3RWIA 1M71A 4OLXH 1URLA 1DQDH 4JJ5A 2GK0A 4KVNH 3QB7C 2C3XA 2VLRE 3WHXB 4V1DD 2ED9A 3VXOA 1WZMA 5IF0B 3IVKB 4XBEH 1YPZA 3S3SA 5KS9F 4YHML 4D0DA 5FCSH 1ZLWK 4NKIL 4XT1C 4CDHA 1L0YA 5I8CB 1BF8A 4K8RC 2B4CC 4PJAA 5L8LB 2QLVB 1MCEA 5GZND 3ZZ1A 1RJYA 2O5ZL 4R97C 4M1GL 1MREH 3TCLB 1JGEB 3R1GL 3P2TA 1IFHL 1F4XL 3T0EB 1AE6L 4XCCL 2PYEA 1NGWA 3A67L 3QDJD 1N3NB 1CDGA 3SBWA 4P2QB 4JZNA 5HHPB 1F8TH 4GRMA 4IDLA 4JFDA 3WFDH 1G7IA 3MTRA 3LVEA 3SDCD 3PWUA 3TH4T 2CDFA 4H1LB 4X9GA 5LG1A 3ARQA 2YPVL 4X99A 4M6NH 4K8RH 2ADJA 2B4CH 1NEZG 1MCFA 1T1WB 2C5DC 4WNQA 3TO4A 4PJXE 4DGYH 4G5ZH 4XNZC 3SDDB 3F6LA 4O2CB 3GMQB 1U3HA 5IP4A 4PB9L 1GZPA 4YBHA 1RMFH 4QRSB 2EXYD 2YRPA 5JORA 2IG2L 1XF2A 5TH2A 4ODTL 3BDXA 3ZO0A 3AM8C 3TV3L 4YHNA 3QEUA 4Q6IB 3H8NA 3QDHA 4CN1A 4NOFA 5C0DA 4XBPB 3I3EA 4X6EA 1Z5LA 3WNPA 2YD7A 1Q72H 4KH2A 3UO1H 3B3IB 5E8DL 2R56L 4OZFB 3NIGE 2HJFA 4RFNB 4KC3B 2P8PA 1K2DB 3D5OF 4LLVB 4ZUTB 1FLRH 4KKCD 4QTIH 2E9BA 3CFJB 2CDGB 5JQ6L 4PJDB 4ZXBD 2R8SL 4MB5A 4M7LT 5ACMA 3C5JA 2WQ8A 5LGJA 2BDNH 4BSVB 4NO3B 3ULVF 2DD8L 1YMME 4CVXB 4HT1H 3ZE2E 3V6OA 3BXNA 3D2UA 4HF5L 2XOTA 3MMEB 4Y19D 1OAZH 3QJFB 4U6XA 2HWZL 1OP5H 5TE4L 2BK8A 2OMNA 4XNMB 2VR9A 1EHLL 4M3JA 4XH2B 1EFQA 1FO0A 3S36X 1C5DB 4IMLA 2ARWA 3KPMB 2FECL 4ZDHA 2W9EH 2AP2A 4Z7QE 2PTVA 3WV0A 4W4OA 3GSQA 1YEKL 1MI5E 2D03H 3QWRA 3O9WB 4LHJB 2FRGP 3ULVC 1S9VB 4LCWA 1A3LH 5F88B 1U41A 2LE9A 1LDSA 1MPAH 2X89D 3OAUL 3QI9D 1F2XK 5ECJE 1JZ2A 3RNKA 3WS3B 1OGAA 5IB5B 4DUWA 3KYKH 4QKXB 1MFBL 1X5HA 1VEOA 5IOPA 5B38A 3QXAA 4GBXC 1HOCA 3QIWD 5SX5H 5IM7B 1AC6A 4HXAH 2DWEA 3VGEA 4E41B 5F3HA 4QHNB 2NW3B 1T1YA 2ZWLT 1BIHA 4YC2C 3ULVH 4UTAL 3VD4A 4PRBB 1OF2B 2VO5A 5KSAD 4KI5E 3ARGA 4R8WL 3BEVA 3VFNA 5HHXH 1FG2A 3H9SA 4P4KC 1IEAA 2BC4B 5FO7B 3MV8E 1M05B 4OT1L 3DX6A 5JA9A 2D4DA 1ZA3B 1WITA 1FNGA 4O2EB 4XX1G 2GQHA 3C08L 5D2NC 4CW1B 2JIXD 5FGSA 3HE7C 4KRPC 5I9QB 1KV3A 5I0ZA 1QO3B 5T1LB 4PJIF 2MTPA 2PTTA 2VLMD 4NQUA 5C09B 3KNBB 4ISVA 4RGMB 3HUJE 4KAQH 5CZVL 2VLKA 1JZ6A 5E4EC 1TQBC 5C92A 1SJHB 5HJ3A 1UJ3B 2ZSWB 3D18A 3HPLA 3UJIL 1GJIA 5K33A 3U7YH 5EOCL 4XGZA 5IEHB 3RVTC 4P23C 4HMCA 4NJ9L 1WWAX 3EFFA 1X7QA 2ESVD 4U1SB 1HH9B 5HGAB 2A6JA 2Y06L 3O4LD 1KLFA 5ELIA 4QRQB 1FZMB 2Y72A 4JFYB 4XPGL 5D9SB 3OKNA 3E1F1 1QLFA 1J12A 3BPOC 1N6VA 3VG0L 3OB0H 3OHXB 5DZLA 2HT4C 5IR1A 1UADC 2BNQE 3MV9D 1PSKL 4RZCA 1TZHA 4WDIA 3D85D 4MQSB 4PJFA 2QHRL 1S7XA 5GGSA 5GGUB 4POUB 1MIEH 1A4JB 1MWAA 1I1AA 4P2RA 2NQCA 3BZ4A 3QEQB 4RBPH 5IVNA 4GO6B 1QSFA 1U92B 4LNRA 5BVJA 2DBJA 3GIZH 1A2YA 4M43H 1FO0L 5DRNA 3RUGE 2PNDA 4UDTA 1QSEB 4NFCA 1P4IH 4IRSD 1D9KA 2NXZC 4LRIA 1CT8B 3H42H 1A6WL 3W11C 5JA8B 3I85A 5DWUL 4JQXA 4MMXC 2DTSA 3I84A 4FABL 1XT5A 4Z7UB 1U3YA 4K9EH 3C60A 2ERJC 1I9JH 4FFZH 1AGFA 4R90H 4BFIB 1R5VB 4LP5A 3TNNB 4PS4L 1CICA 5L9DL 5CBAA 3LKSA 4IOSD 1UWXK 3I6GB 2NY6D 5GSRA 1I9EA 3IFPB 3QO1A 4Y5XC 5IB4A 2VERN 1XGPB 3T0ED 4KTDH 2DQGH 5GS2H 2X10A 5EOQH 1TETH 1PBYA 2M1KA 3KGRA 5IMMA 2DQEH 4CADB 4O2FB 1YPZE 4K94C 4P2QD 4UIKH 4EKXA 3F58L 1IGTB 4XCEA 4HUVB 1Z9SA 4JDZA 5J12C 3WXVH 1JFQL 4AEHL 1T0NB 3GHEH 4PRDB 1VERA 4KK8D 1I85C 1KGCE 2YN3A 5CJQL 4N8VG 5F7DB 1F45A 2E8YA 3AFLA 5HGHA 5DRWB 3RWCB 4DUVA 4UT7H 3GM0A 5ADOL 3DV6B 2JJUA 3FQXB 4Y4HA 4J6RL 3SDDD 4M9PA 4TULL 4OF3A 2NXYB 1FZJA 4JZOB 4U6TA 3V8CA 4P57A 5F3BB 2FJHB 2GFBA 4WU5B 3WHE1 1BIIB 3UTPE 2E8ZA 1S7SB 5IROC 3NIFF 3ZTNL 3QUML 1IGFL 4MJIB 3L3IA 4WY7L 1OAYL 4JGMA 4PLJD 4LDEB 5HGBB 1ZV5A 3ETBF 1YYML 4FXKB 4PJ9B 1U58B 1CDHA 3KJ4C 2HT2D 4WW2B 1UB5A 4M8QB 3M07A 5CAYB 5DT1L 2YBRA 1DQQA 2E7HA 3WMSA 4ELKB 1NCCL 4R96B 1OSZB 1QR1A 3GIVB 3VFPA 5AYUH 2CUMA 1MCOL 3MUGB 4AENB 4JDTL 1KULA 1ZHKA 2CDEA 5HY9B 2OQJB 4JRXA 1OTUC 3UJTL 4L5FH 1C08B 3UTTA 5KSUA 1XF3B 4PGJA 3EDJA 3ARDB 1E27B 1RIUL 3UJJH 1G6RA 1GAFH 3ULUL 4PBXA 4UV7H 4LDOB 3IFOB 5ESVA 1HCFX 1H9VA 3FFDA 1OCWH 1WVZA 4NBZB 1BF2A 4QRRB 1OWRM 2DLIA 4NUJA 4WHCA 4TTDC 1Y0LA 2DRUA 1I7TA 1DSFH 1OSPH 2CKBB 4OD3L 1IC7H 5EOTB 5TQ2H 2ICEB 2VZSA 5ID0A 1NAMA 4QHKJ 4NO5A 4NQTA 3S35L 1ZLUK 1P7KB 3DGGA 3NIDF 4PGDA 3MACH 3O6MH 3FOMB 1KB5A 4OSUL 2AK4B 1VHPA 5K9QG 5I1KH 1HI6B 2FEDC 3O9WD 4G8GA 5C08E 4BFBD 3LZFH 3SDAA 4NM8L 5CP7A 4KKNA 4OD2A 5EU3A 1ZEAH 5BW7C 1I4FB 3FO0H 4Z0BH 4FQQA 3HAEG 5D72H 4UTBH 2GKIA 4EVNA 1JGVH 3TJHD 4I2XB 2YRZA 4UV4H 2UY6A 1FVEA 3ILQC 2NZIA 3BP5B 1YQ2A 3RY6A 2FIKB 3QFDB 4ZPTB 4I0PB 4J4PA 5B39A 3RY5A 1PEZA 2OJZL 2PYFA 2WWMC 2X4NA 4E41D 3OX8A 4JQVC 3PE9A 3EYVB 4FZEL 5CD5C 5MP6H 1MJ8H 2AJZA 2ZG3A 2Q76A 3MOQA 5TGBA 1NDMA 3HC4L 3MREA 1I9IH 3PABB 2OMBA 2FGWL 3QA3B 1KIRA 4QTHB 3RNQA 1XR9A 2VDML 4YXHH 4F58H 4PP1C 3X14B 4UIMA 5GIRB 4G43B 1DJSA 5IQ7H 3HR6A 3ZKXC 4P9ML 5FYKD 4D9RD 1JHTB 1QLRB 4F7PB 3QEGL 1JI1A 2ADIA 5I1HL 1RAMA 5HHVH 1YNTB 5FV2A 4W70A 5T1LD 5F1IB 4GMSH 3T8XA 2XZQL 4JRWA 5C09D 3G5XB 3L5IA 1CXEA 3OJDA 1A6PA 1XR8A 2PO6A 3OKLB 5DK2A 1VADA 3MRQB 3MOBH 4TVPD 1D5MA 2EKSB 4JM4H 3P4NB 5L88H 4GG6B 2WUBH 4ZOBA 4R9HA 4YPGB 3F7VA 5EO1A 3TYFB 1KEGH 1Q9WB 1S7QA 1FVCA 4FFYL 1S78C 5J89A 1QACA 2FLRT 1WLHA 4XNXL 4NKDA 4DZBB 3I02A 3JWOC 4JQIH 3VXRA 1MFNA 1WFUA 4KK5C 2IJ0C 4X6FB 2P8LB 3CCHA 3UC0H 1A7OH 4DGVH 4M62H 5DMGC 1G6RL 5CJXA 2I9TB 4PJBE 5CZXD 3JV4A 1N5YH 4UILH 3X13A 2VITA 3TFKC 2W0LA 3U9PL 3MLSH 1HEZB 1BMGA 3TBYB 3OV6A 2EIDA 3BMWA 3RVUC 4WFGD 3GSUB 1QFWH 3QEQD 5FM5M 4NQCE 1LO5A 1MAJA 4JHWL 3V5KA 1P5UA 3BN9C 4MNGB 4U1NA 4P3DB 3HI1B 3WN5B 1NAML 3WEXA 3JWOH 1RFDL 1NFDF 3VFUA 1QSED 1KB5L 2J5LC 2V2XA 1Z3GH 2BHZA 4C56E 2O5XH 4KHTL 3GSOB 4PJFE 5CKGA 3RKPA 5C71A 4JFHE 5EWIL 1KACB 1X5JA 2HJLB 3WXWH 2BSTA 1NKOA 2VDLL 4W4NA 3L7FA 1OM3H 4WENB 3FTGA 2BZDA 5FUZL 5KSVB 5CSZA 2EDDA 2VQUA 1G0XA 4G7VL 2HH0L 3RZCC 2X70A 3QO0A 1XZ0B 1BBDH 2X6MA 2ZZUT 4ERSH 1MFCL 1UKQA 1DQJB 1QFOA 2MQ3A 2FJGA 5DXWA 2G5BA 4JFZH 4R2GC 4XXDA 3NPSB 4FQXC 3GBML 1HKLL 4PGEA 5DRXA 4LVOB 4MQ7B 4NUGL 1F6LL 3QULA 1WEJL 2ZCHH 4J3VA 1LVEA 2BFVL 3A6CL 4ZUUA 1RURH 4DVRH 5DJXB 4NYLB 1GGTA 1HXYB 4I3SL 5F6IB 3MUHL 3VXMB 4OI9A 3VXTB 5I1DA 4G6KL 4TSAL 5GJTL 1CXHA 4QOKE 1TJIH 5FCUL 1MCNA 1TQCB 1OTTC 1E0OB 3T0VA 1KF9B 2DLFL 2D7TH 4AL8L 3VGDA 2NXYD 3MRLA 3VRIA 3ARBC 5MENA 1U8KA 4LP4A 3TP4A 2C7UB 3GMRB 1OGTA 4UAOB 3R0NA 4NJAL 3EYOB 3X3FL 3VW3L 4PJEE 5EBWB 4MNHB 1RVFH 4Y4KB 3B5HA 3CD4A 3QFJD 3FT4B 5EC2B 1PD6A 4UI2A 1AXSA 2W9LA 1JPSL 4PJ9D 5J06A 3O45A 4XCFH 3PWLB 3WE6A 4QF1B 2W91A 4J3SA 4BH8B 4RFOH 3C5ZB 4TPRL 2RR3A 4OM1H 1V7NH 3BP4B 4FQLL 5I15H 3C6LC 2KPNA 7FABH 4QHUB 3LMJL 2BVQB 4I0KA 3NN8A 5CSBA 1NC4B 1R3KB 4G9FE 3GBNH 4WHTA 4KTEL 2F53E 1HSBB 4AK1A 4XHQA 4OM0H 1RUPH 4WWKB 4JANB 4U2ZA 1P7QB 5JW3L 3OPZH 3O6FA 4PV9A 1FYTD 3RA7H 4DQOH 4EBQL 1RU9H 1YN7A 5GGQH 5TE7L 3LDBC 4LEOA 2MCPH 3HMWH 2H6PA 5H2BB 1ES0B 4JRXE 1F97A 3BE1L 3UTTE 1IZKA 3DJ9A 4OLUH 1ZHNB 3QWQB 4KK9D 1I9RL 1C16A 1E28B 4Z5RB 4L8SC 2UZIH 4N8CH 3SJVB 1PVHA 3HE6B 5F96H 5IVZA 5B3JE 4KJQD 5FK9A 2IQ9H 1D3CA 5B3NA 4NDMB 2AK4D 4N5UA 2XFXB 5CEXB 2YKLH 1I3VA 3R06A 1A3RL 1D6VH 1CTNA 5L2KE 2X9WA 3B9KC 1S9KC 4FG6D 1MH5B 5C0JB 2ATKA 2MNUA 4M6MH 4HK0B 5I73C 3S36L 4HMEA 1UXSA 3LAFA 1KNOB 2CUIA 1A6ZA 1FNEB 5B8CA 4NZTL 4JO1H 3Q1SL 5KVFH 1I7ZA 2HG5A 1FJ1B 3W5MA 5J1SC 1K5NA 1LO3L 2IAMC 4I0PD 4G8GE 1EO8L 4NO2A 4K71C 4HPOH 3IDIA 4NCC1 5DUPL 5AEAA 4TSCH 1P84J 3L3OB 5D7LD 1KCRL 4WHYG 3HG1E 5JPMA 5BCAA 1HYSD 4QY8B 3V79C 5HYJE 2B1AH 3DVNA 4D2NA 2ATPB 2C26A 3WL9B 2A9NL 3B2UC 5HD8C 4BKLB 4Y16B 1FH5H 3PNWA 4M5YH 3LHPL 3MYJB 2RJMA 2YD9A 4PJGF 5LGHH 1TJGL 3PL6A 2IFGA 4YDJB 3KXFB 3QUXB 1F3JA 4D3CL 3BDYL 2UUDH 4M61B 3I50H 4KZDH 2V17H 3T4AA 3CSYA 5DYOB 1G7MB 4HIIB 4ONOA 4XPHH 4HQQL 2NX5A 3G9AB 4MNQB 4ELMA 3LQMA 4QHLB 2F8OA 2DYPB 3UYRH 1CBVL 1ZVHA 3P0GB 2Q3ZA 4J1UB 4ZFGH 3H6JA 4MQXC 1CK0L 2FYYB 2YXFA 3NCJH 4IDJH 4JO4H 4PJ8C 1A7NL 5D6DC 4Z7OE 3LRSB 4MWFB 3K2UL 4FQIH 3I6KB 1H5BA 3NA4A 5INCB 1I3UA 5M7QA 3PWPA 4X7FC 3KPSA 1TVHA 5FOJA 1QVOA 2NR6D 3MV9A 1DE4A 2DLHA 2G60L 2ILLA 4YDLC 1DBJL 1P1ZA 4URTB 4I4WB 4J23A 3RZWA 2HVJB 4JY4A 4H8WC 3CVHB 1JVKA 2X1OA 4LIQL 1YJDL 5DJAB 3STZB 3W9EA 2OLDA 4PUBH 5IB1A 2R23B 5MERB 1P53A 4PTUB 5D6CA 4R4FL 1V3LA 1AJ7L 4JO2H 1EHNA 5JOPE 3VXUB 1P2CA 1UQSB 2R0WH 3BKJL 2FB4H 2X4OB 5IKCB 4NN7B 4HC1A 5KANG 5DI8B 3I2CH 1WZ1H 1RZGB 2DDQL 4LARH 3BGAA 3LSOA 1H3UA 1OD9A 2EDHA 1DBKL 2MSPA 2C1PB 4LPYA 4H8WH 1FFRA 5I8CA 5DLML 5I8KL 4HH9B 5D1XB 2A74B 4EZMA 5I1IH 2DM7A 4NC0B 5D96C 1CLYL 4V1DE 1WAAA 3MJ6A 5JDJA 1MHPL 5D1QC 1FIEA 3CFEA 1N3NA 3RGVA 4NWUH 2ZCKH 1F4YL 3FO1A 2QKIA 1AO7B 3KYMB 4X6BB 4O4YL 1AD9B 4HWZB 5CJBA 1INDH 3U30C 3QP3A 4DW2H 3IKKA 5IMOB 4K23H 3MFGB 3MJ9H 1N8ZB 3ILPA 1Y6NR 4X80H 5I75C 3KPPA 3UYOD 3SE4C 4IOFC 3VXMD 3L3JA 3Q6FB 3QDJE 1U0QA 5ALCH 1VACB 3QCTL 2F5AL 5CJ8A 1D5ZB 1B0GA 1WJ3A 2H45A 1MRFH 4RMQA 3VD9A 5HYSG 3L95B 5DVMA 4PJCA 4OFYD 4MD0B 1H8NA 5DHYA 4GRLA 5IVOA 1CD9B 4X83A 4EI6B 5E4IA 3HC3H 1BAFL 4Y4KD 4R4BA 5HHQB 1ZTXL 3BP6A 2VDPL 1MFEL 5I1AA 3B9EA 3WIIL 4OZHF 3DUSB 1Z2KA 1FZOB 4LLVA 1HHKA 4M7KL 2D4FA 1OVZA 1TNMA 1YYLH 1KCVL 3LKRB 4HPYH 3CFJA 5CUSH 2ZG2A 3MNZB 3EHBC 4LSQL 2D7PA 2QQNH 3OL2A 4S1QH 3QDAA 3MA7A 3NCMA 1VPOH 5CMAB 4R6UA 1AQKL 4TNVF 1FPTL 1NC4D 1UENA 1XCTA 3MRIA 2Q86A 2XY2A 1WIPA 3WSQH 4WWKD 15C8H 4YHZH 1P7QD 2UYLB 3TVMC 3MMEA 3KDMB 1Q0XL 3O6LH 1YEIH 1ZT7B 1UJTA 2VQTA 1ZHLB 1VESA 1S7WB 5TDPB 4OLVL 3UBXB 1PY4A 4PRPD 2QSQA 2D31B 4HC1L 3S88H 2XQBH 2CGRH 1A6UH 2QV2A 4JY6A 4U3XA 4XPFL 4XNMA 2J8UF 2Y07H 3O3EB 1MRCL 3CDYA 4XH2A 3TYGH 3HAEH 1AI1H 4APQB 5DUMH 1NLBH 3KPMA 1X5AA 5IFAH 4Z7VA 1BQLL 5E2WH 1OAQH 4R7DB 3FB5B 3SJVD 4Y19E 3HE6D 1DUYA 4ZFZA 1EEYB 1QRNA 1JZ8A 4UOW0 1NBVH 4OZGB 3T3PF 3BRDA 2E6QA 1P9MC 4DUXA 1UM6H 3WS3A 6FABH 4A6YA 3WIFB 4WEBL 2UWEB 1TVBA 2R0ZL 3G04B 3DROB 3WD5L 4Q74A 5DSCB 1FNSH 3RQ3A 3LN5A 1QBMH 4XP4H 2HYMA 1T5WB 1OAXH 1QTYT 5I8OH 4P2OB 2NW3A 3RWEB 4Y5YA 1R6VA 3CUPB 3GSVB 3FQWA 4GAFB 4TN9A 4HUWB 4Z76A 3F12A 4HSQA 3N1QC 4CMHC 4Z7WB 1ZLVH 2NYYC 1MCDA 1DL7H 2VDNH 3P73A 4NN5B 5L0QB 4YFDB 1I8LA 2G2RA 3QIBB 3SPVB 2IPTH 5FO7A 2X4SB 4KY1H 1HWGB 4HGWB 4O2EA 4Y16D 1L7IL 1R3IH 5EFIA 2QQQA 4DTGL 1SJEB 1BLNB 4PJ5A 2YUZA 3KXFD 3QUXD 1PLGL 3LQAL 4N68A 4Y8DC 3ET9F 3RWGB 3EJYC 4HWBL 2W60A 2AEWA 1R3HB 1PYWB 3RAJL 1V3JA 3V7MA 1A7PH 3G5YB 1SJHA 3ARFA 3MUZ1 4MNQD 4HX1B 1WC7A 4ZSOB 4TTGA 4OZ4B 3DMMA 2DQHL 1A14L 4U1SA 2DYPD 4X4MA 4QRQA 5H94A 4AG4H 1XIWB 3NTCH 3U0PB 3QRFM 3CGTA 3WO4C 2IFFL 4XP5H 2VLME 4LOUD 2CJUH 1CDYA 1PY9A 3GI9H 3HRZA 1TTUA 4DCQB 5KAQF 5GHWH 1MJJA 1DN0B 2I07B 5JLZB 5J9PB 5D7IE 3BKML 4IIQA 2ESVE 4IRJD 2Z8WC 4O5LH 3O4LE 4UZGA 1A7RL 1T6WA 1XGYL 3SOBL 3UTSB 5B38G 3CFDB 3WHE0 3FRUA 3QEQA 2W38A 2WWKO 1NSNL 3D39A 4LVNC 4YE4L 2QBWA 3C09C 3FQRB 1KN2H 4LLDA 3IDGB 5DEGB 1NCBL 1KLGB 3VXUD 2EYSB 3MV9E 4OJFH 2X4PB 5E2TL 5GGTH 2Z91A 4YBQC 1W72H 3DHMA 4P46A 4QXTB 4L9LC 5SWZA 2GAZA 4MXQD 4OKVB 4YK4C 1UYWL 4NC2B 1OTSD 5GRUH 2FJFA 3K4DA 4A6YL 4LBEA 3CLFH 2VDQH 3I6GA 4JN1H 3M17B 2AI0H 5D1XD 5EIIA 4N5EC 1LDPH 3O2DA 1CD1A 2APTA 4G6JH 3WLWC 3MRDB 1XGPA 5IV2B 4GW1A 3IETB 4PJXF 5I2IB 2AXFA 5FYLL 3V4VH 5DMIL 2H2SC 5DFVC 4E5XA 3SQOL 5FAAA 5DD1H 5L2JA 2ZNXA 4O2FA 2Q3AA 2XA8H 1AO7D 4K3HA 4HUVA 3BPNB 4KTYA 2W1NA 4KUZL 3P0VH 3TA3C 4UB0L 4NNPH 3FN0H 1ZLWH 5A16A 5F7DA 3T0EE 5DJ2B 1CE1H 3RWCA 4FP8L 3T1WA 4TVSa 2Q20A 1MELA 2VL5A 2R2HB 3UEZA 4LHUG 4ODHH 4DOHB 1A5FH 4P2QE 3TIDA 4X4YB 5E99H 2JCCB 4OZIB 2OXHA 2P44B 4JZOA 3ZKMC 4ODVH 1A9EB 2XZCL 5HYFA 4RIRB 1QFWI 2MMXA 5C0AD 2JK5A 2NY3B 1WT5A 1S7SA 4TVPL 1ZVSA 4RISH 4LKCA 4M00A 1KSRA 4KKAC 43CAA 4WIQA 1CFQB 4MJIA 4YQXL 4K7FB 4ZFOA 4TUKH 2QSCH 5HGBA 5DK0A 2F58L 4YBLC 5I6XB 3HI6L 5EUOB 4X8XA 1WBYB 1QKZL 4I5BA 3LS4H 3SY0A 1LQSR 4U3CA 4Q58C 5E8OB 3P30H 1PW3A 1G0DA 1LK2B 1MY5A 1SM3L 2DQCL 3ZE2F 5AZEL 4ELKA 4F7CB 4LEXH 2VKXA 3GIVA 3RIFF 4B5EA 2HVKA 2AJYL 3NGBC 3BVNB 5CLWA 5KN5B 3NH7H 5HY9A 1U2CA 2OQJA 1ZOXA 5D7SH 1NEUA 2ADGB 5JXEC 5JO5A 2D2OA 2A0LC 2DQJH 2A38A 3ARDA 4ZUWB 4WHDA 4Z7QF 5GGRY 5CFHA 1QBBA 4IMKA 4P5TC 2OI9C 1TPXC 3I9GH 5EU6A 4KRMB 3IFOA 4LAQH 1U93B 3DTXB 5T5NF 1KPRB 4XWGL 2YA1A 4PJDE 4XP6L 5IBUG 1FAIL 4QRRA 3C6SB 1S3KH 3W0WB 4WO4C 3CPLA 1L9MA 3GMPA 4FXGA 4APQD 4K3JH 5CCKL 3SDXA 4PRAA 4LLYB 5H37G 1FNLA 4KKBD 5IVXF 3FOMA 4POZC 1DBBH 5E00B 1LD9A 3VMPA 1F6AB 1LE9B 3K8KA 2HLFD 3O2DL 1A6TB 5EZJB 3AM8A 5ACZA 5E08L 2BCKB 4PJHB 4U0RC 4M93C 2VDKL 2VJXA 1T89A 4WHYH 1T1ZA 4XPAL 4XMPL 2N7BA 5EA0H 3UAJD 4MD5B 4KI5F 4XI5D 2D7NA 2R29H 3UBXI 5E2UH 4I2XA 2IALB 5H35B 4WUKH 4CU6A 3TZVB 5IW6B 2CLVA 4IOIB 1LP9A 5EZLB 4JG1H 3GMOB 2EH7L 1Q1JL 4X6CB 2CLZB 3AU1B 2V7NA 3REVB 3BUYA 2GUOA 1YNKL 5DA4A 4EUPB 3DECA 3EYVA 3KPNA 5FM8A 1CGUA 4CAGA 4O02H 1MAMH 1U8OB 3FFCD 5DO2C 1SHMA 2RFXA 5J6GB 1NJ9B 4HBCH 2I9LA 3M8OL 3PABA 2YC1B 3QA3A 3HUJF 2F74A 4QTHA 3QIBD 5EN2B 5E94B 1FL5A 2HFGH 3WUWB 4KI5C 3EOBB 4FQ1H 4E41E 3QPQC 4G43A 3S37L 3U2SB 2P8MA 4OIAA 2XWBB 4UT6L 5D7JB 3RDTC 1QQDB 1IC5H 4MJ4A 5SX4H 1UXWB 4ZFOL 2FNBA 3C2AH 4G6AC 4XTRC 3NCBB 3GSNH 4OCSH 4FTVB 5F1IA 3EO1B 4BELD 3UTOA 2AV7B 3V5DA 4BK4A 4YIQB 3NACL 4X5LA 1JNHA 2EKSA 5GXBB 3P4NA 1JF6A 4YXLL 4YHMH 1WCBA 3B2VH 4NKIH 5FYKE 4D9RE 3EYUL 1IMHC 5T3XD 4ONFL 4UU9A 2O5ZH 4NQSB 4M1GH 4S1RH 2Y36L 2Z31C 1SYVA 4GRWB 3R1GH 4P3CL 1WWCA 1AE6H 4XCCH 5C09E 1CS6A 3D87B 3A67H 4GBXA 3QHTC 4TVPE 5DQ9B 1M1SA 4GUPA 4OF5A 1RMFL 3MFFA 4NRYA 3CK0L 3U9UA 3ESVF 3IFLL 5JZ7D 4KJWD 3B6SB 3PWVB 3TBYA 2AABH 4RGNB 1B90A 2X1XR 3KPRA 1I8MB 5C9KA 2YPVH 5F1NA 3UTSD 3WKNA 3AREB 1NCWL 1FVDA 1Q72L 5F7FA 5ICZA 3OZ9L 3TBVA 3HI1A 1A47A 3ZL4L 4MA3B 1X3DA 3P4LA 1FLRL 1YY9C 3DXAB 1KJVA 4WFGE 1FNHA 3B8YA 5GS1B 4MCZB 2X7LB 2NY5L 2HJLA 3ARRA 3HE7A 3L3KB 3SDYL 3QEQE 5C1MB 2IG2H 3FRPA 4HKXB 1YPZF 4XAKD 3L1OL 4ODTH 4F80A 1AQDB 3TV3H 1BOGA 4KJYA 4S2SB 1BQUA 3LN4A 4N0CD 4HT1L 4R97B 1QSEE 2GTWB 4YR6B 1HDMB 4GW5A 1NUNB 1GRWA 5E8DH 2R56H 2Y7QB 3OGCA 1BJMA 2B7DT 4C83B 3V52L 4P23A 2A83B 3P4MA 4LLQB 5F1KC 5F21B 1Q9KA 1DQJA 2HMID 3UMTA 2FX7L 4EEEA 1U91B 1ULVA 3GB7B 1TXKA 4PRHB 1TZIB 1J8HB 4Z7UE 5JQ6H 2R8SH 3EO9L 1U2HA 1O0VA 2ICWI 4KROC 5E8EA 3ESUF 4Z6AT 1F4WL 5KS9B 1IAKB 3VH8B 2D03L 4LU5L 2BP3A 4ODWB 2BY2A 1KJ2A 3V0VB 1FFOA 3LEYL 2DD8H 2EE9A 1UWXH 1CDIA 2EC9T 2J12B 4HF5H 3O2VH 1OAUL 1RZJH 3GO1L 3D3VA 1J7VR 3GK8L 5JW4Q 4YHOL 3DYOA 5DJDA 5TE4H 1JMZA 4WI8A 3PXHA 2LTQB 3SBWC 2R2EA 2NY3D 3UX9B 3VGFA 1IJ9A 3OKDB 5C0IA 1W0WA 4I0CC 4YGAB 2A6KA 4MNHA 4BFGA 3IFNL 4Y4KA 5BO1H 3FT4A 4D8PB 3F7QA 1YEKH 5CEYA 3BIAX 4S1DD 2VISB 3PWLA 4OTXL 3L9RB 3TO4C 1N7ML 4BH8A 3C5ZA 3WYRA 3OAUH 5I8EB 2KDGA 4M5ZL 4JM2B 4N9OB 3CDGA 4QWWD 4XP1L 1U3HC 3QXVA 3V6FA 5C6WH 4OFVA 4PJ7E 1MFBH 2VZ3A 4XWOC 1N64L 3OG4B 2DQFB 1X5ZA 1R24B 2PTUA 5DC9B 4CVWA 2N1KA 1MCJA 1EERB 1HSBA 4ZUVB 2NTSP 4KU1A 1IL1B 2BNUB 1NBYB 4UTAH 4Z78A 1RQ5A 1JPTL 1PJ9A 2NNAB 4YEFA 5EO0B 2AEIT 4CMMB 3RL1B 4YAQB 5ANMA 1I85A 4R8WH 4HS8L 4NM4L 3EJZC 4OT1H 3W0WD 4HS6A 1VB9A 2HRLA 4KXZI 4L29A 4U1JB 1KYOJ 3ALWA 4W6XB 1CYGA 1KJMB 5D93B 2DMKA 3KR3L 1RJZB 4RAUA 4FQ2L 2WNGA 3AAZB 1FYTE 5MI0C 2VR5A 3RWHA 2KZWA 1REIA 1AGBA 1M7IA 5BQ7B 2EDQA 4Y2DA 2EXWC 3EYQD 4LGPB 3V6OC 1P6FA 5BV7B 1G1YA 1J1OL 3LIZL 4V2BA 9CGTA 1BFVL 3UJIH 3VFOA 2HLAB 1MH5A 1EGJA 5GGSY 4WUUB 2DOCA 3GIZL 2AJVL 2VUOA 1TLKA 1X6NA 1UWEH 4QGYA 4DK3A 4XPGH 2P5WA 3UTQA 1P7HL 3MUY1 2Z8SA 2AK4E 5HHOA 1VGEL 4HS3A 3BPLC 4YC2B 1ZLUH 3RVWC 4L4TA 1JTTA 3FCTB 3MLZL 1KJ2L 4W4OC 1ZS8A 1K6QL 4NSKB 3ULSB 3VG0H 1YC7A 3PHQB 2VXUL 5CILL 4K9EL 3HN3A 1PSKH 4I2XE 4YHLL 4P4KB 4D94A 2QHRH 3WL9A 4KKLC 3SCMC 1G0YR 4PG2C 1RJLA 3JZ7A 1L0XA 5EH1A 5T3ZD 5FDWA 3MGTB 2GIYA 4KRPB 1GH7A 2DQGL 4U1IB 5D7LE 1BJ8A 5D7JD 1OP5K 1RZFL 3MR9B 1MJUH 2E7MA 5FYKU 4KDTC 5CLTA 1A6WH 4FTVD 3T0DA 2EDFA 2GJ6B 5BZDA 3VFTA 3MRCA 2R4RL 2BVEA 4XRCA 3GI8L 2J2ZA 3N85L 2CQVA 2W65A 1IM3A 3ARUA 2AXGB 4S1SL 4PS4H 3FO2A 2FYYA 4W68A 1Z0MA 2X9XA 4HHAB 1IM9A 4TQEL 2DB8A 2DJSA 3DI3B 5GRXG 1H15B 1B88A 4PJIB 5SX5K 1NBZA 1CGWA 4GG6E 1N0LA 4M1DL 1UVQA 3F58H 4MB3A 2D7QA 2ZSVA 3LKQA 4PJFF 1JFQH 4AEHH 4KV5F 1IVLA 4RGND 1MVUA 5K59E 1DVFB 5CJQH 3CVHA 3ARED 5DJAA 3STZA 5DTFB 2WIIA 1H3PH 3ULUF 4HAFA 5CGTA 2FR4B 5ADOH 2BVPB 2QR0A 1UQSA 3FOLB 2NXZB 4J6RH 3MYZA 5IKCA 3TBTA 1GGBH 3DXAD 4TULH 2ZOKA 5AYUL 3MRFB 5J13B 5JHLL 2FSEB 1F58H 1XMWA 3ZTNH 1EGJL 3QUMH 5EORL 2OK0L 1IGFH 4P4RB 4MNGE 1OAYH 2FZ3B 3NCCB 1I8IB 2QQKL 4LLAA 4GAYB 1BQHB 1GAFL 1KG0B 2XPGB 3EFDL 1RSFA 4JFOB 1YYMH 2A74A 4K8RD 4OKDA 2EDEA 4CBPA 5FOBA 3ULUC 3CVIH 5FIEA 3VI4F 1OCWL 4FXLA 1BOYA 4X7DC 4Z18A 3CLEL 4TUJA 2X4QB 1NCCH 3TNMA 4MA1C 1D9KC 4LRIC 5LQBH 3AS1A 1EEZB 2GSIB 4JQXC 4PRHD 1J8HD 2YD2A 5J12B 4JDTH 3BZFA 2J88L 3IJSB 3G5VA 1F42A 1PZ5B 4ZFFA 5IMOA 4CU7A 1FFNB 5DD3L 3C60C 5T1KA 4PJEF 5AAWA 1CICC 1RIUH 3LZFL 1L7TL 5K9JL 3ULUH 4E42A 1MHEA 2WP3T 3SKMB 5HVFB 1VACA 1K4DB 5HVHB 2BXYA 4AIZB 3S96A 4RBPK 3H9YA 1D5ZA 1JGVL 3UZEA 4OV5A 1JWUA 2OSLB 3O41A 1A1OA 3VFRA 4MD0A 4L4VD 4OD3H 2P5ED 2HN7B 3BYTA 5KG9A 1EBPA 2R0KL 3VXME 1CU4L 1QBLL 1IGJA 2DL9A 2IGFL 4ZTPL 3KJ4B 2AV1A 4OSUH 1NANI 5HHQA 5LWYL 2NY2B 3C8HA 2EH8L 3QAZB 2J4WL 3O8XB 1B0RB 1RZIB 4BUGA 3C5SB 1B2WH 1A9BA 2YZ1A 4H20H 3DUSA 4NM8H 1FZOA 3QDGA 1XGRA 4Y4HC 4L1DA 2XXCB 1XF4B 2Y5TB 1VCAA 3LKRA 4JM2D 4OQTL 1K8DB 1U8PA 1Q9LA 3EYFB 1CDBA 1T20B 3MRMB 2JJSA 5IQ7L 3RZCA 5HDBF 1F3RB 1M7DB 3K8LA 4PY7B 1NFDA 1AKJB 5BMFL 2OJZH 4KI1A 2VYRE 1P4LA 3T77B 2YPLB 5CP3A 2E5EA 1DBML 5I1EL 3CVHL 5E56A 1ZGLM 5CWSA 4FZEH 4QCIA 2EYTA 1LHZA 4FQXA 5H37H 1RUQH 3I6LD 5B3JF 3QEHA 4MX7A 4L3CB 3O3UN 3MJ7A 3M1BB 25C8L 2FHBA 2EZ0C 3HC4H 1NFIB 5IWLC 1EZVY 4RRPG 5BZWB 3GGWB 2IANA 2Z92B 5C2BH 3O3EA 5K9OA 1LEGB 2VDMH 3MRNB 3OR6A 4H1LG 4JZJB 1JHKH 5HYEA 1I1RA 3QDMA 2B8OT 5KSBA 4R7DA 3GDBA 3PV6B 3QEGH 5E2JA 5F93C 1NFKA 5I1HH 1Z9OA 3ULVD 4HKBA 3ZE1E 3L7EB 4PRPE 2J3SA 2XZQH 4N0UA 1BD2A 4UDUB 4K3EL 3LPGA 4NBXB 5IT2L 1YEEH 2J7LA 1QFWL 4WUUD 4ODBD 3DROA 1Q94B 3BKCL 3SJVE 2DLGA 1NCDL 4FFYH 3JWOL 4OB5L 1BP3B 3FT3A 1DBAH 4XNXH 4P2OA 4ZPVA 2AQ2A 4PLOB 2FBJL 3P0YL 5FA4A 4OZFG 3BJLA 1EH9A 1FAKT 2PW2B 4MDJA 4ZYKA 4Z7WA 1R5WB 3ZE0F 5EPMB 1LNUB 3WXWL 5I74B 3U9PH 3BEWB 2JJVA 3QJHB 1OM3L 2NY0C 3SPVA 4P4KD 2AQ3A 4DZ8B 1AGEA 3BDBA 3UPCA 4NC1E 4HFWB 5J4MA 1FIGL 2VLLB 1G9EA 1N5AB 1LEKA 4OF0A 3QUZB 5LVEA 2BSSB 4JHWH 2CRZA 3ZKXB 3RY6C 1BLNA 1NAMH 4KRPD 1RFDH 4H0HB 4Z7OF 2OP4L 5HGDB 3BPCA 5DHVB 1KB5H 4X5XB 3RWGA 2F5BL 1JF1B 4F9LA 1R3HA 2GJ6D 3B8SA 1CTOA 5EWIH 1G6VK 2ZCHL 4J8RB 3RVTD 1U8JB 2VDLH 5JHDB 1HHIA 4BQ6A 3MCLL 4YFLI 1XIWA 2A1WL 2W0FB 3KPTA 1IGYB 5F8RC 4HIXL 3KXFE 2C9AA 2H41A 1ZGLP 4G7VH 1IBGL 3P9LA 3FT2A 4PD4K 5D70H 3MQIA 4MQTB 2VAAB 2D7TL 2V2WB 3HZMB 1MFCH 4X8JA 4MNQE 2JJTC 5JLZA 4ENED 3IDUA 2RGSA 1KCUH 2C4FT 5HVGB 3GBMH 1G7HB 1HKLH 3D0VB 2PO6C 1C12B 3QR2A 4NUGH 3BAEL 5ETUB 1WEJH 1JTPA 3A6CH 1T21A 1FORL 1LEIA 1DVFD 1KBGL 4LDLB 5FO8B 5MEOA 1D6EA 1WWBX 5JIIA 4I3SH 2LAAA 5TFSL 3FQRA 3NA9L 4G6KH 1NEZB 4RFOL 4TSAH 5GJTH 3IDGA 3VI3F 4Q97A 5DMKB 1CGXA 4NO0A 3I75B 2D7MA 2DQTL 2BMKB 4IHOB 5FCUH 4BUHA 3G9VA 3HMXA 2NXZD 2DJUA 2QSTA 2DLFH 2X4PA 3HZKB 1NCUA 1CD8A 4AL8H 4QXTA 4K3DL 3UYPA 4F8QA 1I7RB 2ICWA 3GMLB 1P69B 4NJAH 5J6HB 1EA9C 1YY8B 3DURB 3MRGB 5FGRA 4DN4L 3VW3H 4IJ3B 5MEQB 4OAWB 5SX4I 1FL6B 3V0WL 4NN6C 12E8L 2CK2A 3VXUE 1JPSH 5EBMB 3AS3A 3MRDA 4GW4A 3MRPA 1UZ8B 1HHGB 3QZWB 4XNYL 4TPRH 1EFXB 3U1SL 1T1XA 4FQLH 3JVGA 5BJTB 2GTZB 4IS6B 1NUGA 2GJJA 3LMJH 2VQ1B 4AMKH 5F7KC 4HDIA 1JUFB 3GJFA 4HWEL 4DAGL 4KTEH 4YGVB 5HVWA 3KWWA 1VFBB 5E5UB 5EUKA 1BPVA 5GZNC 4JFEA 3TT1L 1DLHB 5JW3H 2FATL 5IHZB 4U1HA 4EBQH 8FABB 1AO7E 4OZIA 4G80B 5IFJB 2ARJB 1A02N 5MHSD 3ARBB 3QUYB 3ME0A 3CSGA 1GZQB 4N8VA 5KVFL 3CH1B 4QRPA 1T80A 2YRLA 3SDCC 3BZEA 2EDLA 1I9RH 3PWNB 1CFQA 4N90D 1NMCC 4Q2ZA 1KIQA 3OWEA 1J87A 4GKSB 1H3GA 2AS5M 2H2PC 1WBYA 3T3MF 2QTEA 2NY2D 2AJXL 2GITA 2IEPA 1U8QB 4MS8D 3O8XD 3STBA 4NRXB 3TEUA 3RBGA 1NGYA 3MZGB 5C0AE 3E2HB 4D0BA 3MJ9A 3KVQA 2F54B 3GSXB 5L7XL 3C6LB 1KTDA 2HJKB 4P3WA 3DX7B 2YD3A 4JKKA 3WDHA 3UPRB 1WBZA 1W0YT 4YHIB 2E27L 1G7QA 3S36H 4CN4A 1R3JA 4NZTH 5LGHL 3N50A 4MJ5B 3DHJA 3Q1SH 2FHFA 5D1QA 3IXTA 4QYOA 2HA1A 1LO3H 1RK1B 5T1MB 5HYQB 1AKJD 3EGSA 1EO8H 2YPLD 4LHQB 5IIEA 5DUPH 4XPHL 2GK2A 1KELH 4M8VA 1KCRH 4AEIL 1KPRA 4WW1A 3W9DB 5F7HA 3HMXL 3LDBB 4LMQE 5LCVL 3JTTA 3O11B 2NCMA 3FQNA 2A9NH 3V6ZA 2DWDA 3PWJB 5D1ZA 4ZXBC 4EI5B 4TTDD 3VFSA 1IEBA 4L8SB 4MLIA 4QRTB 3HLAB 1TJGH 4MZ3A 1IKFL 4D3CH 3BGFC 3BDYH 4HJJL 4UT9L 5E00A 2CO7B 1CFNB 2FEDD 1T6VN 4B41A 2Q6WB 4G8FB 4HQQH 3O6FC 1KFAH 2EIZB 3B9KB 2VXSH 4MD5A 2BNRA 5I73B 1RY7B 2IALA 3TO2B 1CBVH 3B9AA 3TZVA 5IW6A 4PUBL 2DL2A 4IOIA 1T83A 1YJDC 5ICYB 3GMOA 1A7NH 5I16B 2IAMB 4NQXB 4X6CA 3VGBA 4UQ3B 3T65A 5CEZL 3CZJA 3K2UH 1A4KA 4K71B 4AYFA 4OZGE 2QL1A 4J3WA 1F90L 3RPKA 3OKMA