4JFED

Preservation of peptide specificity during tcr-mhc contact dominated affinity enhancement of a melanoma-specific tcr
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
197
structure length
197
Chain Sequence
QKEVEQNSGPLSVPEGAIASLNCTYSFLGSQSFFWYRQYSGKSPELIMFTYREGDKEDGRFTAQLNKASQHVSLLIRDSQPSDSATYLCAVNDGGRLTFGDGTTLTVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title T-cell receptor specificity maintained by altered thermodynamics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
total genus 35
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2013-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jfeD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jfeD02
2V5SA 5DO2C 2WUCL 4KZEL 2IAMC 2NY2B 5I17A 3GSQA 2ZKHH 3ECBA 3V2AR 2XPGA 3MO1B 2OMBA 3U6RB 1IGYA 3RZCC 3BH8B 2ZUVA 3QEUB 1JZ8A 1RURH 3GIVA 2H26B 3O4OB 5IJKA 3OJVC 1SY6L 4HFUL 4UAOC 5IFAH 3UTZB 4Y2DD 3VA6A 2FIKA 1UB5B 4P48A 5A1AA 3GHBH 1QTYT 5INCB 4G8GA 4UNVA 4YXLL 5CJQL 4MA1B 1QUNA 4JFPA 5LGJA 5C0BA 4Y19D 2EO1A 4F2MA 5FO9A 4KJQC 2HRLA 2ZNXA 1FL3B 5GGQL 5TE4H 2ZP0T 4RMRA 1TJIL 1FG2B 4MHHI 1HHGB 3W5MA 3LN4B 3MOBH 1BP3B 1WC7B 2P7TA 4QRTB 3AFLA 3MBED 5JOFA 4WI5A 1ODAA 3HZMA 3OF6D 4FOMA 4KQ3H 4BQCA 4BSVA 4O5LL 1XR9A 3LKNA 4UUJB 1IGIH 3LQAH 3H9SB 1F3RB 2ITDA 1MVUA 4YZFF 1I9IH 4FQ1H 4K7PX 3Q2CA 5E8OB 3UJJH 1GOGA 4MAYD 1KC5L 3MRJA 4NQDA 3PQYA 1YEEH 4QCIA 2X1WL 4PGCB 3SDYL 3J8F7 5D71H 5EUOB 2B2XH 2XN9E 4C54A 3O2WL 4YAQA 1GYAA 1RUAL 2AJUL 2ZCKH 3ARVA 5I18L 4PP2B 1K3IA 3WJLC 4QRRD 3T4YB 3EJYC 2MKLC 4HIJB 1GAFH 2IANE 5E9DB 3DXAD 3QJFA 1NCDH 2B4CH 3B3IB 3C5ZA 4WW2A 5IBLD 4QHKJ 3L3HA 4O00A 4ZAKD 1KTDB 5I73B 2BNUB 1IC5L 4LRIC 3TN0B 4FQJH 1RUML 4ODVH 1A1OB 4ODSL 3U36A 1EH9A 5FYLD 4E5XA 1AR1C 3S96A 3JV6A 1ZOXA 2B5IC 3ARZA 4YDIH 4YXHH 3O4LA 4PRIA 1CXEA 4FFZL 5E0QA 5KG9B 3MNVB 2I60L 2R23B 2NYYC 2L7UA 1E6JL 1QA9A 5C0NC 1U3HC 3RWFA 1FORL 2P8MA 2R0LL 2VLLB 5I71C 2OTUB 1S9XB 2BC4B 4JDVA 2Z31B 2NXZD 4ZPTB 3G6DH 4H26A 2PO6C 3OG6B 4GG8B 4A2LA 5EBLA 1YEHL 2Z8RA 2HFFA 3X12B 1LP9F 3RUGA 2IFGA 1D9KD 5D7JC 3N1FC 1OAYH 2EXWC 2E9WA 5BQ7B 4WV1A 4N68A 1DBML 3O8XD 4S1QL 3RFZC 2AK4A 1A3QA 4QXGH 1A6WL 3P9MB 4YDJA 5TDPA 4YDVB 4KROC 3FO9B 1IC7H 1RUQH 5F7DA 3MACH 4F15B 1P2CB 3SDAD 2X4TA 3BXNA 3ZTNL 4R7NB 3PGDB 3ZKNC 1UWGH 4PJ5E 3F58L 1QSEB 4UU9B 5FKPA 3HC0A 2YWZA 5J7CC 3RGVB 2R0KH 3ILQD 2GFBB 4YHZH 4M6NL 2FZ3B 4HIIA 4JFEB 3VI3F 2X1QA 4HH8A 3RZWA 3MGAA 2H1PL 4IS6A 2I9LB 1E4WH 2Y9RT 2NXYC 5BW7A 4UQ3B 3BKCL 3ZDYF 1OQOA 4XP5H 4JFOB 1OT1A 1B0RA 1WSST 3BKML 4QXWA 4R4BB 1JPTL 4XPAH 1HINL 1UM5H 1R3HB 1RZ7H 3VWKA 2X44D 1XR9B 5E1HB 3S34H 2BHZA 1HCFX 3S35L 2CXKA 1A6ZB 2EKSA 5C3LD 4XPFL 4HJGA 3T3PE 2GJJA 2LABA 4ZS7H 3STZB 3DI3B 1BQHG 3OSKA 2OTPA 3LKQB 3B6SA 4WDIB 1A6PA 3LKNB 3RL1B 2CUIA 1MCQA 5F7LB 5FEBA 2HRPH 3U7YL 4MLSA 2DQHL 4QRRE 4YPJA 3TO2B 3B2VH 3RWIB 4GAYA 5KSBE 3KLHC 3O6LL 3LN4A 3BD5A 3L95A 5JHDE 3CUPB 1HXYB 4K23H 4FNLH 1DDHB 1QR1B 3NACH 1I8MA 1BGXL 4QLRA 3JVGA 1GVIA 3A6BH 4OCSL 1J05B 5I1EH 1IGFH 5EZIH 1T83C 2EDNA 2AXFB 4MCZB 3TIDA 2DKUA 1R24A 4N8VA 3FB5B 4ENEC 3MV9B 3UTZA 1DQML 1NGQL 4K3JH 3BRGC 4HK0A 4PGJA 1T80A 4HPYL 1QSEA 4UU9A 3HG1E 2Z8VC 4C83A 1WAAA 1WZLA 3V8OA 4HS8L 4S2SA 1AGCB 2M26A 4BJLA 4JR9H 3HG1A 4GG6B 1ES0B 4Y5VC 1OSZB 3UPAA 3PQYD 3FO9A 4M61B 1EUTA 1L0QA 4PLJC 2I26N 3QAZB 2NNAB 5HHVH 1QFWL 1G6RL 3DVIA 2J4WH 1VEOA 4L5FL 5FDYA 1C16B 4JFFA 2NYYD 1CT8B 5J11C 2HFGL 2PCPA 3DMMC 4S1DD 3WV0A 1SYVB 1UJ3A 4QY8A 1NGPH 1Y6NR 4PG9A 1QFOA 5HYQB 5SWZD 2NR6C 4GFTB 3B9DA 1FL5B 4MA3A 4D8PB 1LE9B 2WINA 1JTOA 5T33L 2W38A 3MUHL 3T08A 3RBGA 3RZCB 1BFOB 1QO3B 3GSOB 2HJKB 5A43C 1FN4A 5KSUB 1BX2A 2AS5M 2IAMD 3CDCA 5DR5H 3L5XL 2FECI 2UZIH 3W0WE 5C07D 2V9TA 2IC2A 4R26H 5IQ9B 3V7AG 1CGTA 1S9YB 1U8QA 4Z7NE 3PQYE 1KGCD 5D93B 3RI5K 4Z7WF 4GKOA 4MJ2A 3P4MB 4D0BB 4YXLH 3BRDA 1P4IH 2GKIA 4HQQH 3FN0L 4LDLB 2VDQH 4LVEA 3TJHD 3BEVB 3C08L 4ZYKA 3RRQA 4H1LB 4DN3H 2PN5A 1IAKA 2WSKA 1EEYB 3RIAK 4KZDH 2MPAH 4AEIL 2VAAA 1U41A 1I3VA 4CGTA 1R5VA 5IVXE 2VXVH 4PJBA 2J12B 1T2JA 5C0EB 5FUZH 3DV6A 1I3GL 5AD0B 1RU9H 2VLMD 4K7PL 5MHSD 2O5ZL 4L8SB 5D1QA 4EUPB 4HH9B 3ARGD 4X9BA 3GI9L 2CDGA 3IFNL 1L0XA 4IRJC 3MV7D 1Q9LB 2X41A 4K3EH 3QO1B 1LK3L 5DEGB 2HFFB 2X4NB 2Q1EA 4M6AA 2Q76A 1AGDA 4JPWL 4I2XB 3PXHA 5ALBL 5TH2B 1ZMYA 3B5HA 4TVPH 1GGCH 4DEPC 3BX7C 4N0CD 3BP7A 3PE9A 1CYGA 3RHWK 3RX5A 3EJZD 2Z0BA 4OM1H 3IXAB 3SCMD 4GS7C 3LEVH 5F89B 3NOIA 1QRNE 2BOCA 3T77B 2B4CL 2YK1H 1RQ5A 5ITBH 2IBZY 1QRNA 3GBNH 3U0PA 3SGEH 3DNKA 2NY3B 4Y5YB 2Q7YA 3BE1L 3EO9L 5BS0A 1JYXA 2Z8WC 3PF2A 2MWCA 4PJFA 3L3HB 4ODSH 5E2TL 1NPUA 3K4ZA 1H15B 2E7BA 1OD7A 3PDGA 3RDTA 4JM2A 5DUPL 5JR1H 5AYUL 1YEGL 3TT1L 3IT8D 1I8MB 4X6DB 1DBJL 1U8JB 4AM0B 1FL6A 4EI6B 4PJDF 4KK6C 1AI1H 1SJVA 5ERWB 1HKLH 1MJJB 3WEXA 3LKPA 3L5HA 1ZLVH 1P9MA 3MYJA 3S36H 1F4XH 4FABL 1AKJD 4YHLL 3SHSA 3CPLA 3BXNB 3MV8A 3X3GL 2LQRA 4FXKA 2VR9A 4Q6IA 2FHCA 2HT3D 5IFHL 3U4BL 5A2FA 1K8IA 5C86A 1ZT4A 1OGAD 2DM3A 5B38A 2ERJB 2GSGA 4NJ9H 4MNQE 1JBJA 5HGBB 2A0LC 4UIMA 3ULUH 3IU3B 2BNQB 3VFRB 4JRXB 2BOBB 5KBNC 4W70A 3UYRL 1O5DT 3WFDL 4YX2H 2APFA 4HW6A 3VXOB 4RDQG 4X8JB 5ADOL 4ZUWB 2W9EH 4QRRA 1X5LA 4WIQA 3U9UB 3T0DA 1FFNB 5I1KL 1YPZE 4HHAA 3QUZD 2BNRA 4I48B 1WFUA 2V5TA 4UT6H 3T0VA 5CEZD 2DTSA 4HUMB 4C4KO 1XCTA 3IAPA 4WUKH 4YHML 2J5LC 3AVEA 4KRPB 2G2RB 2VDKH 2X4OB 2P8PB 1AIFA 1ZTXL 4XPTL 1YJDC 4P3CH 5J6GB 3VXRE 2VITA 2VIRB 1F3DH 4LLUB 4RMQA 3TWCL 3CSYB 1MREL 3S37L 5BVPL 1N5YL 4XVTH 1U8MB 3SPVA 1YY9D 5FA3A 2R56L 4X6DF 5GGTA 5D7SH 1MHEB 2WUBL 3QDJB 1HSAA 1OAUL 3VRLE 4GW4B 3HE6D 1NC2A 2CLVB 2GUOA 3QDMA 1JN6B 1AQDA 4MNQD 3GGWB 3OXRB 4L8DA 3WIFB 1PZ5B 4QGTA 1QLRA 3C6SB 4GXVL 1M1SA 1Y0LA 1OAXL 2B1HH 5GJTL 1CF8L 3KJ6L 1NFDE 3TZVA 4HXAH 4LCCA 5I19H 4XMLH 3KJ4C 2G75A 3O6LH 2PYFA 4NSKB 1QRND 3TNMB 4BZ1H 2BCKA 4HD9A 3QQ4B 4K8RL 4A6YB 2VLJE 4ZFGH 2HVKA 5FECB 4NGHH 1B4JL 5AUMA 1HSBA 1MRFH 4PJ7A 1HHKB 1K8IB 2X9WA 3EKCA 4G42A 4QRPB 5SX4H 5GS0D 1U93B 3T04D 1INQA 4MA1C 1EXUA 2YD6A 1IVLA 2FR4B 1A6ZA 1KELL 2NXYB 4HULB 3NA9L 4MNGA 4ZSOA 5C0DB 3QIUB 3TBYA 5AG9A 4DFHA 4QEGA 3OAYK 1OTTD 1B0RB 2Y07L 5D7KD 4GW5B 3GRWL 3MFGB 5I76A 4YLQT 4F9PC 2KH2B 2QLVB 4LLMB 3WD5L 2VABA 4BZ2L 4LSVL 4M48L 1E28B 5E94B 3EYUL 3RAJL 5KSAD 3GSNA 3NZHL 2WQ8A 1E4XL 3P0VH 3ZT7A 1YEIL 1VKXB 1CL7H 3VRIB 1ZLWH 2VISB 1ITCA 3V52L 3O45A 3BH8A 5IK3B 5GSVA 3DMMD 4S1DC 2R2EA 3FJTA 4PJDB 1JRHH 4AIXA 4UT9L 3MROB 1AY1L 1NEZG 4X4YA 2DQJH 4PJBE 4OF6A 3ISWA 1UKSA 5DJ6B 4JCLA 4LCWA 3TVMC 5E1AA 3QWQB 5C07A 4PJAF 3GIZL 5D2NA 3RVUD 1YA5A 2VQ1A 1WFTA 3DVFA 4X7SH 3QULA 3GJFK 5E4EC 3ZYZA 1Q94A 2PYFB 5A2IH 3WN5A 3TH3T 4I2XA 4Y1AE 3U7WH 3WO4B 3D9AL 4ONFH 2OL3H 3O41B 1ZV5A 3IDIA 3QIBC 2ZUQB 1MOEA 3C08H 1SBSL 2JTDA 3FAWA 3WIHL 1QBAA 2NY5L 1R5VB 3MXWL 5CKGA 3X3FH 1X4ZA 5GS3A 3WNNA 3EYSH 1PX3A 2PF6A 2VXVL 1CE1H 1S9VB 4F3FB 2DQFA 4ZXBB 3VXMD 3ECBB 3IFPB 5DJAB 3VGAB 4P2RE 4H5SB 5CBEA 4YNYA 5H35B 3ORJA 4PJIE 1C5DB 1HWGB 1MAML 2CO7B 3BJLA 4NO0A 4K3EL 3P40A 2FX8L 4ZNCD 2AQ3A 5DD6A 1FNHA 2WIIB 4K3GA 5DUBA 4R90L 3BPOB 4ORGB 1I1AC 3IAQA 1A4KB 4OIIL 2JK5A 3BO8A 3PWJA 2J6EA 2K1MA 3BEWA 3QBTB 1J87A 3OZ9L 5DMGD 1YUHA 2HMIC 1WITA 3BQUA 3H3PL 4JO3H 5C6TH 3HI1B 3T0EE 4TUJA 2D7MA 4XPGH 1FC1A 5IW1A 3LS4L 3V8CA 4G7VL 5E70A 1N7MH 1A1MB 1QQDA 1VHPA 1FFQA 5HHPA 3OTTA 3SCMC 2B8OT 3I84A 1MCPL 3BUYA 1FG9C 4HKBA 4NJAL 4NNXA 1IGJB 3EZ8A 4ZODA 4WI4A 3TBVB 4LNRB 4UMGA 1DBAL 3PWPA 3U0WL 2YBRA 3UDWA 4PJ5D 1A6VL 1MJ8H 4RAUB 4FTVA 1ZEAH 5CGYD 1YEKL 4J3UA 1K6QH 4GRWH 4JFED 3UDWC 4Y2DB 4FQ2L 3IGAB 4PS4L 3GNMH 5GZNC 3IDGA 1WGOA 4EVNB 1W8OA 2BNRE 3AC0A 4JFHD 4Z76A 3RQ3A 4P49A 5LJYH 1CU4L 3JZ7A 2Q7YB 5BS0B 5JOPD 1NL0H 2DM7A 3VXRB 2DMCA 1SEBB 2X4UB 3GSNL 2Z92B 1YEJL 3T0ED 3MV8D 5T3ZH 2UYLA 1OVZA 4G6KH 1UZ8B 3NCYP 1KLUB 4GKSA 4JN2A 4BKLB 4LOUC 4P3DB 4Q9RL 4JPIA 4WEMB 1MIEL 4NO3A 5I0DA 4PREA 4OFIA 1NCCH 5T3ZD 3FONB 2V9QA 1AO7A 2H6PB 1MPAH 3QUZA 1RK0B 2YSSB 4JLRB 4NCDA 2J5LB 4R7DA 4OBRA 4Z7VF 5HYEA 1IAIM 2VDPH 2YZ8A 4UOJA 1VFUA 3F65A 1LO0L 2IPUK 1G7IA 3KPLB 4LSQH 5HGAB 1CI5A 2QSCH 4DAGH 1JZ6A 1K2DB 3K1KC 3B5TA 3ILQC 2UY6A 5BZDB 4G9DA 3FQXB 4P3CL 2IQAA 3VWKD 1MFBL 4XBPA 5GRJH 4RA0C 5BVPH 1N5YH 4JVWA 3WFCL 4YO0B 1I8LC 4XZUB 5ICXA 1MFAL 4ODXB 1BZ7B 3STLA 4U6HA 1C7TA 1YPZB 3Q1SH 4RISH 3S37X 1P1ZB 2XWJB 3VXSA 2VABB 1AGBA 4X6CB 4ETYA 3HNTL 4Z0XA 1IMHC 2IANA 1I9JL 2IAND 1KB5A 3CVIL 1DBBL 4JKWA 1FO0H 4P46B 5DFVC 2BXYA 5FA4B 3MGOB 1F4WL 3C5ZD 4XGZA 1I7TA 4PJBF 4NGHL 1B4JH 1YDPB 3PDOB 1INQB 5B8CC 1QLFB 5I8OH 4JN1H 4KKLD 1PQZA 1K8DB 4LAQH 3QFJB 1ZWIB 4LSUH 4YDVA 3RZCD 4GOSA 1HSBB 2VQTA 1FYTA 1I7ZA 5DRWB 3VCLB 3DURB 2FHBA 3BIKA 3RBSA 3BIBX 1CK0L 2H45A 5IB4B 5J4MA 4WJ5A 3OKOA 4GMSL 5EC1A 1J1PL 4X6DE 3QUXD 5IT2H 4F9LC 3T3PF 5CD3A 3IETA 3RGVD 3GO1L 2OK0L 4JDTH 1RUKH 4LIQH 2C3WA 2DKMA 3GSXB 1AXTL 1XCQA 4C83B 3ZYIA 4MA7L 3ULUD 1MLCA 1JTPA 3BPNC 1T1YA 4DN4H 1NMAL 3P0VL 4HWBH 3QWRA 1EHAA 3FB5A 3HUJB 3EBAA 5FYJD 2FO1A 3JWDH 4RZCB 1KTKE 43CAB 4GBXA 3KDMB 4IRSD 4O2EA 1F6FB 1I1YA 4JO1H 4LP5A 2LFGA 3SKJH 1J12A 2ADFH 4U1MA 4QOKE 2NW3A 43C9A 1CD9B 35C8H 1RMFH 1KG0B 1BZ7A 3P0YH 4RGNB 3RY6A 5C7XH 3WJLA 3ARGB 3W9DB 4LP4A 2YRPA 3TBTB 2FJHA 1XF5A 5CWSB 1CZ8L 3S3PA 4LSSH 3UPRB 1H3PH 5EO1B 3T4YA 1MJ7H 3FZUD 3PL6D 2ESVB 2HFEB 2NZ9C 4C55A 3O9WA 3KYNB 1UGNA 2NY5C 4QHNA 3R1GL 1JPGA 4GMTH 5GS0L 1A7PH 1F42A 4PBVC 3MYZA 1UVQA 3PHQB 3RWIA 5HPMA 4O58H 3ZKND 1JV5A 4Q9BA 4D2NA 3LIZH 1ZA3A 1SBSH 3LQAC 3QZWG 1Q0XH 5IV2A 4HCRL 1S7RA 3EYVB 4NBXB 4PJFF 4WNQB 5IW1B 1FZMB 2HP4A 3QUZB 1ZHNA 1LO3H 1QFUL 1C8PA 2EH8L 1EHLL 2JK5B 3CX5K 1VFBB 5EWIH 5J57B 1CE1L 5D1ZB 2BSTA 4JZJB 3WFBL 2K7QA 1W0VB 1VFMA 4O5LH 3TBSA 2AGJL 4WV1C 1MHPL 3TNNB 2RGSA 5KN5B 4HUUB 5HHQA 3HS0A 2CKBL 5KVEL 4J7RA 5MEQA 3IF1A 1FNLA 3ARDB 5J9PA 3FRUB 2AEWA 5FO8A 2X4TB 3WLWC 1UZ6F 3OPZL 5IW3A 2FWOB 1N3NB 1YEEL 3RL2A 2XYCA 4XP4L 5CP3H 1DLHA 3HE6B 1CTOA 4NQUA 5D71L 1ERNA 2E7MA 2H26A 1QLEH 4PJCF 5FM5O 4FG6C 4KI5D 1H3UA 3D39E 4X4ME 3RVXC 4ISVB 5H2BB 2VDOH 3VFMB 5DK2B 5E95B 1BOGA 5JHDB 1JK8A 1N7ML 3CVHH 5SX5K 1T89A 1F90H 3V5KB 4GKZA 2E27L 3ZT5A 5DD3L 2YUVA 4Q58C 4G9FE 3BP6A 2X10A 5DMIH 4LPYA 2Q87A 3BP5B 5I1IL 1M05A 1RUMH 5SX4I 3U0WH 1ZS8A 2EH7L 5L6YH 3O11A 3RWHA 3SDCB 1FNSL 4LGRB 3ZLQC 4M7KL 3FQNB 2ZSVA 3RA7L 3QCUH 3QO1A 4TVSa 2YC1A 1C08B 5BO1H 2OR9L 2HN7A 2WWKT 4N0FB 1BLNB 1KJ2B 3TGXA 5F7HA 1A9BA 4J8RB 1GHFL 3VFTA 2IALA 4UNTA 2M2DA 4U6YB 5D7IB 1ADQL 5DRNB 3HNSH 1T0NB 1F4YH 5L0QC 1KJ2H 3QO0A 5DGQA 1UG9A 1PSKH 3NAAL 3G6DL 3BGFC 1P4BH 1WIOA 5I16A 2WIIA 4YBLC 3LRHA 3QJHA 2GJZB 2W0PA 5KSAB 4G6KL 1O7SA 1AGBB 1KJMB 4HUKB 4U1KB 5C0FB 1G7PB 1S78D 2QQLL 4M03A 1NSNL 2XV6B 4OLUL 1OD9A 1QBMH 4YXKH 3T65B 4WEUD 2YPVH 4KJWD 4ODXA 1BM3H 4Y2OA 2DDQL 3OG4B 4F7EA 4XZUA 2ORBH 3EDEA 5EC2A 3MACL 3N85L 5HYSB 2NR6D 2IPUG 4WVRA 2WWMD 2A9NH 1KJ3L 2W60B 1AD9B 1U3ZA 5IB1A 2EXYC 5HVGB 3WNPA 3VG9C 1U8PB 1T4KA 2X7LB 3P9LA 4NRZB 2A0LD 4WUUA 1LDSA 4Y16B 2CRYA 3BPLB 3GEWB 1PKQE 2VLJD 4Y16C 1WV7T 4OZHF 2CGRL 1A7BA 4Y7MA 1QVOB 3FTGB 4JO4H 2CXGA 2CIIB 2EC8A 1EBAA 2YD4A 3GRWA 5E5UB 4GXUN 3MRPA 5D1XB 4XP5L 3FT3A 3PP3K 1AGFA 3V4VH 2W65B 4R9HA 2FBJL 5IMLA 2VZ1A 5FK9A 4XPAL 1SEQH 4EXKA 1UVQB 1AXSA 4R4FH 3QFJD 2HG5A 1JWMA 4AH2B 2R1WA 3TJEH 4LSTL 1J0JA 4NFDA 1ZGLM 2A74B 3QRGH 3RNKB 4G8FB 4P99A 2NY7H 1BQUA 4G80B 5C0ND 3V5KA 4MA8L 4TN9A 4M61A 2JF1A 2APTA 3IJSA 1FGNH 1JPFB 1TJHH 1OAZH 1D5ZB 3B2VL 3KXFD 4OAWA 3S4SB 1NCBL 5INCA 4ISVA 2FGWL 2Y06H 1CS6A 5CD5D 3HG1D 5I1HH 1BFVH 4LASL 3BYTA 43C9B 5J56B 2FHFA 3B9KB 5ICZB 3MOAL 4KTDL 1JVKA 4QT5A 3G5XA 5J11B 3O8XC 1U58A 1XGYL 1KN4L 4KTYA 3A67H 5E2UL 1U9KA 3A6BL 3CK0L 3P77B 1KOAA 3AU1B 4JN1L 3UZQA 5KS9A 1MUJB 4Y8DC 4TULH 3W81A 4LLQA 4Z7NF 5DJCB 2AABH 3TNNA 1MCOH 2Q3ZA 3MODL 4N0CC 1MY5A 5GJSH 4KK5C 4FQXB 2J8OA 3AS3A 2YMXH 3F7VA 5JUEL 2EIZA 2VDNH 2FEDC 4WJ5B 2IBBA 3O81A 3T2NH 2IEPA 5GQBA 5HD8C 3IDXH 5F96L 4JANB 2O61A 1KN2L 1DEDA 3C09C 2XWBA 2IBZX 3MCG1 3LD8C 3NCYS 4OZIE 3D3VB 1L6XA 3QDGE 1I1AB 5FGCB 4BFIA 4OZIA 3VG0H 2J88H 2X4QB 2D7TL 3RNQA 1ZVSB 4ORZC 5E5MB 1ACYH 1S5HB 1RAMA 3D87B 3UTTB 4EDXB 4OKVB 3CH1A 5T33H 1ZHBA 2YKLH 2DLFH 1RI8A 4CNIB 2H32H 2XN9B 3FT2B 4LAJH 4F7EB 3RDTB 3QUKB 3V5HA 4EQ3A 1DQTA 3LZFL 3GHEH 4IMKA 3S7GA 5DR5L 4G43A 1IE5A 1MCRA 3STLB 2X4RB 5JW4N 4HIHB 1JYNA 1AIFB 4R26L 3ULUF 3UC0L 3R1GH 3F7PC 1JHLH 1CFVH 3TLRA 1N3NA 3EOAB 5HHMD 3WO4C 1KCUL 1G6VK 4F8TA 1G9NL 1S3KH 1DUYB 5EU6D 3HZYA 2IG2H 4OCRH 4JM4L 4WEBH 2UWEA 1XCQB 5EFIB 4UTAH 3UTPD 1T1WA 2CLRB 4EIGB 3ZYJA 2R8SH 2BVQA 4WU7B 3RNKA 2Q6WA 5ESQA 5C07B 3QXDA 2PW1B 3V0WH 2APWA 1SYVA 3FO1B 4JGUA 4GRMA 2A83A 2HG5B 1WWCA 3BSZL 5DVLA 2R4SL 4JB9L 3UXFA 2CRIA 4KJYB 4JFFE 1M7DA 4NCC2 4D0CB 4OJFL 5DD1H 1KIUA 2FLBT 4MXWH 3AUVA 2AGJH 1NGZB 4PJGB 3DYMA 3GI9H 4HC1L 3WKNA 1IKFH 1F2XK 4K94H 1YNTB 4U1HB 5KVEH 4E5XB 4TPRL 5HHXH 3ULVC 3WHE1 2GQHA 1EEZB 4ELMF 3MLVH 4X9FA 1LO2H 4DVBB 3S36X 3VRIA 1WCBB 2CKNA 2ZOLB 3EJJX 3TN0A 2R1XA 1KT2A 4NUGL 2WBWB 2ZWLT 3RL2B 3WN5C 3UX9B 4KI5F 5EZLA 2XQYK 3B3IA 5D4QA 5M7QA 4HFWB 3PJSA 5DJZB 1H0DB 5FYKH 1WISA 4PJAB 4D94A 5DO2D 4MS8C 5GGRB 3MCKA 4HV8A 2NTFA 5DD3H 3T65A 1A7NH 1HQ4A 1U8LA 2WV3A 3Q3GB 3MRHB 1U42A 1NMCC 1IL1A 1QR4A 2DLTA 1XH3A 4OGXH 3ZDXF 2GJZA 4L29A 4LLVB 5ANME 5HHOD 1VFBA 5E2JA 3NTCL 4HBCH 5ANMA 4Y4KC 2VNCA 2OR9H 1BAFH 2P1YA 5HDBE 3HUJE 1OTTC 4PTTA 1CICA 4X8XA 1E27B 1ZT1A 3MJGX 3VD5A 3MUGB 3PGCA 4UDUB 3S9DB 2HJFB 1RZ8A 1P7KB 3S36L 2VLJB 3M8OL 1W0WB 4YUEH 4ZUTB 5GZND 4LDEB 1J5OH 1XT5A 2F74B 3FCTB 4CU8A 3EGSB 2H2PD 3D85D 4JHWH 4C56D 4OCWL 2XI9A 4G8IA 4WGWB 4OLUH 4POYA 1QHOA 4OLEA 4PJ9C 1IC4H 5A40E 8FABB 1QKZL 4JZNB 3ARTA 4IS6B 1Q1JH 3KS0J 1RJYA 1XGPA 3VFMA 3HG1B 1A21A 4I0PC 3BGAA 4KVNL 3U4EB 5CCKL 3I9GL 1J1OL 4HJ0D 5HY9B 1HH6B 3RX7A 5C0AA 2VLKD 3SCMB 3OR6A 1IAMA 3CFEA 3G9VA 4OLVL 3ARBD 5TDPB 1JJUA 1OP3H 2NMSA 1X5YA 3O4OC 4OD2B 1RJLB 2ZCLL 4QNPE 3SOBH 4F58L 4OLXH 1R6VA 3NIDF 3SBWA 5C08D 3VRJA 2H3NA 5LGHL 5F72S 1JHTA 1FNFA 2CUMA 5BVJB 3QUKA 1FNGB 2YPKA 3TFKC 3KPNB 3TWCH 3KWWB 1BIIB 1T2QH 3TCLA 4Y89A 2BRRH 3TBWB 4WFFD 1VEMA 5D7SL 4P9HC 1U36A 1GGUA 4FP8H 4ETQA 2NY3D 1BBJA 3OB0K 1XGRA 1MVUB 1IEBA 2OL3A 1BVZA 4M43H 5KG9A 1U91B 3EAKA 1L7IL 5CINL 1U8HA 2FIRT 1FGNL 2AJSL 4LSRL 2DQDL 1KTLB 5D2LE 4GRLC 2IAMA 3U36B 4GXVH 3MUGA 4PJHF 3CAFA 1HI6B 2XWBB 1XEDA 4LU5L 4FQXA 4YEFA 2OS7A 3PWJB 1LO5B 2BNUA 5INDB 2EIZB 3QUMH 1ZGLB 1YC7A 1KN4H 4A2MA 3NH7L 1F3DJ 4G3YL 4J23A 5SV3A 4P2CG 5CJXC 1AP2A 3WBDA 1RJCA 4PGBA 3CXHK 5AZEL 1CDBA 5E8NB 5FKAB 5T3XE 4P3DA 4GLRI 3I3DA 5JO5B 2DN7A 3O2VH 4MS8D 3FB6A 3MRLB 2QR0B 2XZQL 5SWQA 5E8EB 4O2FA 5HVHC 1FIGH 4UV4H 5F9JB 2DQFB 1HDMB 4NZUL 3WUWG 3PJSB 4DVBA 2HKFH 5IGXH 1I1YB 3QCVH 1AXIB 1FVDA 4AJ0A 2KZ1B 2GCYB 1KENH 3WS6A 5JA9A 1CLOH 3VXRA 3T2NL 3CSBA 4QXTA 1EJ6A 3F7YB 2E7LA 2XWTA 3CFCL 2NLJB 4LSVH 2O5XL 1EDQA 5MP6H 2IQ9H 4WO4C 4JDZB 1BQLH 5GGSA 3MLYH 4CMMA 1FLTX 4AENB 3U2SA 3GI8L 4HS6B 3VE0A 1YY9C 5IB5A 1RZJC 5HGDB 1II4E 4LCIL 5FUOH 2RR3A 5JQ6L 4P4RB 4YHYB 1UM4H 3V95A 3PWPB 3L5IA 3MLRH 1ETZA 1JRHL 1NC2D 3FONA 4AK1A 3QUYA 1NGYB 5FB8B 4L4VA 3VCLA 1HEZA 1S7WB 2EDXA 2EDWA 4D3CL 3L3GB 1H8NA 2X9YA 1QQDB 4Q6IC 4XNZC 5GHWH 3RVWC 1OAKH 3O6MH 1J0YA 5D5ME 3LB6D 3ULVF 5C0JB 1WBYA 2CMRH 4ZUUA 2QBWA 15C8H 2UYLB 3RVVD 2A77H 2BRQA 5AAMA 2CLZB 5FA4A 4I77H 4JHZA 4P46A 4G5ZL 5F6IB 5CZVL 2D9QB 1N5AB 3V4PL 5D1XC 4OLYL 3NCEB 1R3KB 4JPVH 2E9BA 3HZVB 5CJQH 2WK2A 2QSQA 4GAFB 3X14A 3RIFK 3X17A 2J7LA 3KLAA 5E94A 1Y6KR 2COQA 1EVUA 1LHZA 1YN7B 4OFPA 3EYQC 4GRWE 1X3DA 3ZSTA 3PWVB 5K9QI 1AKJA 3OKMB 4Z9KB 4XNQB 4NQVB 3QDGB 1I1AA 2C5DC 3NCCB 3DXAA 2GJ6E 4N0YH 3KG5A 4KK9D 2FO4B 4OJFH 5DD1L 5E5MA 1Q9WB 1JNNL 2JB6B 1CD1A 4HKZA 3VXOA 2J3SA 3EDJA 3F8UB 3GSVB 5DVKA 4LPXA 5E56A 4LKCA 1YQVL 3RUGB 1GOHA 3S3JA 3TA3A 1OPGL 4OQTH 3HPLA 3WS3A 4PJ8B 3B4NA 1SY6A 3UYPA 1JRHI 3GMPA 4RFOH 5KSBA 3GMQA 4KJPD 2EZ0C 1KCVL 2PCPB 4M02A 1XGUA 2IGFL 3D85B 5E6ID 4PJEE 5DTFB 5E03A 5GGUA 4HZAA 1H3GA 4LOUD 2QQNH 4K9EH 2YPLE 5I8CB 2ZJSH 1ZAGA 2V6HA 1LEIA 1QLRB 2GITA 1AGCA 1MAJA 3QZWB 3HR6A 1CG9A 4EI6A 3K1DA 2A6DA 4FG6D 3EO0B 2AV7A 4WI8A 5D72H 5F3HA 1N6QL 5F7WC 4IMLB 1BMGA 4CDGC 4OGXL 3OR7A 4KVCH 5BMFL 5TPWL 3QWRD 1DSFH 4ZG1A 4H8WC 2J8UA 1INDL 1E6OH 4LCYB 3NTCH 2W1NA 4HBCL 4NN6C 3UTSD 5MEQB 3LAFA 4TRPL 5GGSY 4F7MB 3WNKA 3CNKA 3GJEB 4Y4KD 5LG1A 2X1OA 3T3ME 5CIPB 1X9QA 4QOKA 1KJVB 3VXSD 1FORH 2R0LH 5E8NA 3VI4E 5CFHA 5J13B 2K3TA 1G84A 5DJXA 1HEZB 1KEML 3NGBC 5F7EH 1A0QH 2QKIA 4MQSB 1Z9OA 1YYML 3QFJE 3U7AA 3V6OA 3CSGA 1FYTD 1MLBB 4PJ8C 1MY7A 1M71A 3ZDYE 3R0NA 5DJ8B 4KXZH 4M5ZL 4YHKH 3P3YA 1VCAA 4HS6A 1R5WA 2GHWB 3QP3A 3VFGH 1U8OA 1A1MA 3INUH 4CKVX 4RSVA 4NC2B 2CSPA 3BJ91 1JPGB 4LLDB 4NZTL 3ZE1E 1WC7A 2P7TB 4JKLA 4L9LA 2PTVA 3F7YA 3BW9B 4QRPE 3KXFE 5JW4M 2R29H 3SE9H 1TZGH 4KK8C 3ILPA 4Q6IB 1V3KA 1FL3A 3AREC 1I3UA 4Q2ZA 3G9AB 3SDXA 3MV8B 5HYJE 4KKLC 3OJ2C 5BJTB 3SDXE 4WI3A 1JGLL 2APVA 3RHWF 2ESVE 1LGVA 1LO0H 3DGCR 3BI9X 4FXGA 3QUYD 3PL6C 1KYOJ 1V7NH 3JBG7 5FKAA 1FDLH 4JKMA 3L3KB 3DBXB 5C3TA 1R3JA 3RI5F 3N1MC 4OZGB 3G6AB 4RAVB 2X70B 3OR6B 3OB0H 4MJ5A 1G7MA 2OLDA 1J0KA 2CLZA 4MNGB 1IFHL 5DF0A 3T0WA 3IB4A 3MJ8B 1Y6MR 3SO3C 4N0FA 2WLZA 3T4AB 5I75B 5KOMC 3OL2A 2FX7H 4EOWH 1HYSD 3VDCA 4OZIF 1JL8A 2V2TA 3WKML 2XZAL 2OXHA 3CVIH 3OKOB 4ZPTA 5FB8A 5HYJD 2DL9A 4JRXD 2Z31C 2YWYA 4CBPA 2WAHA 4KJPC 4ZNEE 3M1BB 4G9FA 4JO2H 1A2YA 4F7TA 1F8TH 4DGVL 4P4RA 3K3QA 3E3QC 2R2BB 3VXRD 3C6LC 3RTQD 1ZLSL 1DE4A 2B0SH 4GRWF 4OCSH 5E6ZA 3UBXB 2VKWA 1MI5A 5DJ6A 3L3JA 1AO7E 1OY3B 1M05B 5AZEH 5AG8A 3TT3H 2OTUA 4NO5A 4E9LA 3OXRA 3TH2T 1A4JB 2ADIB 1P69B 3ZMRA 3ZKMD 4L3CA 5C08A 4OLZH 5EORH 5BS0E 1MQ8A 5DRXA 2X05A 4MGXA 4GMSH 1FIGL 4UV4L 1JF1B 2NY2D 4OM0H 5IB2B 3FQRB 2VIRA 3GO1H 2OK0H 3HI6L 5F7FA 2GYSA 4AEEA 5HY9A 4PLKD 5KN5A 1PD6A 2O5XH 5DVOA 4EI5B 3B8SA 4NM4H 2AKRA 1A9EA 3X14B 1FV1A 3OKLA 4HIXH 5D2LF 2PYEE 5CEZL 3ARDA 1R3KA 1MH5A 2BXZA 2VXQH 3ZKQD 2DWEA 4QCIB 3GDBA 3QJFB 1NFIB 4LCIH 4JEGB 3TBSB 1DDHA 5ADPH 2UV3A 3E6HB 4KRMB 5DMJB 2ADFL 2NTSP 1GPOL 35C8L 4BFIB 3KHOA 4X9HA 1ZA3B 5C7XL 1Q72H 2I5YL 2XKSA 2BP3A 4RIRA 2Z9TA 3WLWD 1FNEA 5FYKE 3VFWA 1ZHNB 5GISL 3H9SA 1ND0B 4LSSL 1BBJB 1MJ7L 3QXVA 3L9RB 2P42B 3DGGB 1CFNB 3MRBB 2D7PA 3QIBB 5HDOA 1WEJL 2BSSB 3GB7B 3I6GA 5EIIB 1N6UA 1DVFD 1RULH 3D5OF 5LGJB 5D7IE 1FZJB 1TCMA 2DQIL 4PRPE 4AENA 2ZUWA 1IAIL 4PJEA 1KEGL 5C09D 4FRWA 3FRPG 3MLTA 4BA8A 2EYTA 1HHIB 5F97E 4MX7A 2YPLA 5HYIA 5A16A 5IW6A 3WCYA 5C0BB 4KZDL 2EH8H 2V17H 3SGKA 3QSKB 2FGZA 4EI5C 1T3FB 1YNKL 4IOSD 4TSCH 4RZCA 1FZOB 2CRZA 4QTHA 1UB5A 4DQOL 4KI5E 1RU9L 3BPCA 1D5IH 5SWSB 5I1CL 1B90A 3PWNA 4LGPB 1EO7A 4N9GA 4FZEH 5CJOH 3WFZA 3O2DH 1PJ9A 2AXFA 4MCZA 3TIDB 5BV7H 4XNXH 2J8UE 4XCNA 3SKNA 1OL0A 3X11A 4R6UA 4DFIA 2W9DH 3MREB 3KPSE 4QHUB 4ONGL 4LEOA 4CNIA 1Z9LA 1KCVH 1TVBA 4PGDA 3KPSA 4GLRH 1B0WA 3DPBA 4F8QA 6CGTA 4G8GE 1CXLA 4XNUH 5FUCE 1R3LB 1QLEL 3NIGF 5FGCE 3QA3B 3RNQB 3MLZL 3D3VE 2QQNL 4K9EL 3FO2A 4KUZL 2XG5A 3UTTD 1C5CH 5C0RL 2AAVA 1UWXK 1P84K 5ID0B 2Y7QA 2YRLA 4RWYL 4NKDA 3LHPH 2YK1L 3RZCA 4XBGB 4TUJB 3GMLA 3EYOB 4NQXB 5E2WH 2E9JA 1JGEB 3STZA 5DJDA 2WUCH 2CR3A 1CDHA 3MFFA 3QFDB 4LHUD 3S96B 4U31A 1KB9J 3W0WA 1FZKA 1UKQA 4NQVA 5E2TH 4OQTA 4UAOB 2AXJA 1A1OA 5I74C 1ZHKA 5KAQF 1RURL 5IMKA 4G43B 1U92A 3UJTL 1NQBA 4RDQF 1RVFH 3MNWA 3GMMA 4NQEA 1ADQH 2J8HA 5EC2B 1GC1H 5DZLA 2OMNA 2BMKB 2EDJA 4RX4D 4KDWA 3R06A 4EJ1C 4EN3D 3G04B 3GSUB 2VH5H 4BH7B 4QHMA 4JJHA 4XAWH 5AZ2H 4Z7VB 1ZVSA 4D9QD 5IFHH 3CVHA 3LN5B 2Q20A 4OZFB 1JF1A 4ZO8A 4M5ZH 4B41A 2WANA 3I6KA 2YUXA 3S97C 4QOKD 5JIPA 1T66C 4NNYA 4Y4HA 4OV6F 5CD5C 5FYLE 4U1HA 4X7TA 4N90D 2BFVH 4JFZL 3UYRH 1Q94B 3VFOB 4ZXBC 5K93A 5HYQA 3MBXL 4NKIL 2DMBA 4P23D 5C2UB 3UBXA 3O9WD 4LFHG 5TH2A 1P53A 1U8NA 2CKBB 1HILB 3MSPA 4OBSA 2HMID 3QXDB 1JGLH 4P2YA 1RZ8B 2JELL 3QHZL 5H37G 1XZ0B 3VFSB 2HKHL 4YHPA 1WFOA 1IARB 1V7NL 2HT4D 5EA0H 5I1GH 3OWEA 5EFIA 1MCLA 3VGBA 4KHXL 1IAOB 1D5XA 4O4YL 5AWNH 4I18A 3ZE2E 3FN9A 4S2SB 1SYSB 2VXTH 1S7UB 4ODTL 2N56A 2EDYA 4PJBB 1BWWA 1R3HA 4LSTH 2FBOJ 3MA9L 3GKZA 3RY5A 5HHOB 4YBQC 2WUBH 4RNRA 4XMPH 3SY0B 2AEQL 4PP1C 5KS9E 4M7JL 5EOQH 4H1LA 4YWGL 1UM6L 3MV9E 3ALPA 4HBQA 1RZIA 5IG7A 4NQSA 4M6MH 3LSOA 3PP3H 3RVTD 1HHIA 5EZLB 4PTUB 3N1GC 2BVEA 4HXAL 5I19L 4NPYA 3MLTB 2Z8SA 2JJUA 4JJ5B 3W2DL 3Q6GL 1NBVL 4K8RH 1YMMD 4JO2L 1IBGH 2QSTA 1MAKA 4KJWC 4NN7C 2A9ML 2CDEB 25C8L 2ZOKB 4LHUA 2YZ1A 3DLQR 1T5WA 4I9WD 3SDXB 2OYPA 1QOKA 4NDMB 4LK4A 3ES6B 2XA8L 4M7LL 3QFDA 4MD5A 2IADA 5HHOE 2B1AL 1U91A 1S7RB 3EYVA 2F19H 2E8ZA 4WUUE 3KXFB 1ZLUH 2OQJB 3VU2A 4PG9B 4G9FD 3GM0A 4GRMB 1OWWA 3Q48A 1NCTA 5SV4A 1DE4B 1SJHA 2C3XA 2DQTL 1GCFA 3QNZA 2QHLA 4I0PA 4QXUL 1MNUL 3TZVD 3E6HA 1R3LA 5ECJE 4CJ0A 4M5YL 1C16A 3O4LD 4PRID 4M48H 2YRZA 1UWEH 1EGJL 3OKDA 4P23A 5GGRY 2VL5B 3W11D 2AV1A 1ADQA 2FL5A 3L3DA 3TV3L 5F1NB 3U30B 3QDJA 4P2RB 3U30C 3ARGA 2UY7A 2V2TB 2ZSWB 2Z93A 1JHTB 3WXWL 4ZS6D 4L8DB 4Y4HD 5EOTA 3VXTA 4YPGA 3DVGB 5C09B 3RKDC 4N9GB 2NY0B 2D7TH 5ADPL 4JG1H 5LQBH 4LKXB 4YDKL 2CPCA 2G5BA 1F58H 43CAA 5GGVL 3V5DA 4DVRH 1T83A 4DWHA 4PRPB 3OHXA 4CVZB 2YA0A 2ZKHL 5I0ZA 2JCCF 4M00A 1MLCB 3GHEL 3LZFH 5KTEL 1DQQA 2W0LA 3ARPA 1IQDA 1NDGA 5ESAA 3MCLL 1D6VH 1D7FA 5FHAH 1MCWW 3QDME 3GSRA 4PUBL 4Y19A 1G0YR 3MMEB 5EUOF 4LRIA 5IIEB 4JZJA 3FQNA 4G6JL 1V3LA 1BECA 2YHGA 1QG3A 3F12B 5GGTH 4LARH 2BNRB 3U7WL 4BFEA 1A7RL 5FOBA 1UENA 4FTVD 1OP5K 3ARDC 4Y5YC 3H0TA 4N0UB 4R4NC 1G7LA 5ID1B 4OF7A 1FH5H 4PB0L 3H9HB 2IG2L 4OCRL 4U1GC 1P7HL 1ND0A 4UUJA 2HT2C 4UTAL 4M93C 2FD6L 1ONQB 1RIUL 3HC4L 1P7KA 3ULVH 5HGBA 1JV5B 4P2OC 5GSVB 3WUWA 4DCQB 4WCYL 4QKXB 3NPSC 4I4WA 4JDZA 3KHQA 1RHHA 2ATPB 2KBGA 2DLEA 1H8OA 5KVDH 1OCWL 3HCVA 2XNAA 4UOW1 4MAUL 3J7HA 2FB4L 1CN4A 6FABH 1PY4A 3O2DL 3QDGA 4YBQD 4MXQD 5FO8B 1S7SB 5F9WC 1EO5A 2DTML 1WAAF 4BZYA 4O51B 2QR0A 3WO3B 2FH8A 3Q3GA 4LRNH 1G1YA 5E9DE 2GJ6A 3UTSA 4AM0A 4L5FH 3CXDL 1J0IA 1TCRB 1RUAH 2AJUH 2ZCKL 4DKFH 5D7LA 2J8UB 5EZJB 4BQ6A 3NCJH 3GUTA 3NMEA 1UEMA 3OKKA 3QEHA 5I8EA 4G42B 1J0HA 3RWJA 2NY4B 5E6IC 1IKNA 4GH7B 4ZDHA 4RFNB 1WFNA 2FR4A 4MQTB 1UYWL 2BJMH 2VR4A 2BCKB 2WBJD 3GJFA 1PG7W 3TH4T 4TTDC 5CZXD 2OP4H 2HLAA 4CU6A 3FZUC 4PJ7B 4LQFL 1WJ3A 1U6AH 5IIEA 4NZRH 4U1JB 4M4RA 4YR6B 4ETQB 2W0FA 5CSZB 1YEDA 5EO1A 4XNYH 5FOBB 2R0ZL 3AY4C 1RVFL 4Z8FH 1VPOL 3ZE1F 3TBWA 3PL6A 3EDDA 3KYKL 5JXEC 3TCLB 4I13B 3WUZA 2AVGA 2VC2L 2VYRE 1QNZH 4U6XB 4P2QB 4KV5E 4Y19B 3SJVE 4F37F 2C1PB 3VRJB 4NP4H 5AYQA 1G9NC 2OJEA 3PHOA 4WTZG 5D5MA 1ZLWK 4R97B 2YD2A 3S98A 4P0DA 5CJ8A 4JHWL 2KZWA 3RY6C 4L9LC 4ZOEA 2AXGB 3C8DA 1QACA 5LWYL 2DQUH 4PRAB 4NRXB 5B4MC 2R1YA 4P5TC 5FUZL 3JWDC 3S5LA 4FQHA 3C5ZB 1G7HB 4X6CE 4OFYD 3HLAB 4Q74A 3CVHB 4ZOCA 3MLXL 3PWVA 2UZXB 4MNHB 1QPXA 1XIWA 4V1DA 4KVNH 5C09A 3G04A 1ZT7A 1FFNA 5ITFA 3RWEB 3T1FA 2ZNWA 1YMMB 3CFDA 5EBMA 4CL7A 3R0MA 4N0RA 2ZSWA 3ARGC 5BRZB 1LK3H 3K46A 3QPQC 2O26U 4OZFG 5KSVA 4YFDB 4H0HB 1GZQA 2IH3B 4P23C 3EHBD 1N5AA 2ADGB 5GGUB 4RAHA 4ERSH 4OLVH 3E2HB 5IUSA 3GBML 5F9DC 4LSQL 1HXMA 5IMKB 1XGUB 2D4DA 1T7VA 4MJ4A 1KCRL 1FE8L 5E08L 4KY1H 3UO1L 4IOIA 4OSUH 1A7QL 2H32A 2H2SD 3MBEB 5FF6A 4HWEH 1FSKB 4HLZG 3LEVL 4ALAH 2DOCA 1Q8MA 4HC1A 3DOSA 1IT9H 2EDDA 2JCCB 1X5KA 4JANA 4NKOA 2P24B 5JHLL 4ONOA 3C60D 4ZS7L 5DVNA 3SKUD 3PABB 4NDMA 3MRCA 4KTEH 5DDHA 5E9DD 5EPMA 3BZFA 4P2RD 4JFFD 5D1ZC 1T5WB 2Q8AL 1P7QB 3H8NA 1L7IH 1QEWA 4LLQB 2AJSH 1LILA 3NFSL 5GRYA 2D03L 2MQ0A 3DX6A 5K9KA 3BKJH 4JHAH 1AI1L 3LQZB 2YOCA 3LSOB 3HFML 3LEYL 3CLFL 3SDAA 4Z7OF 2Z35B 1IBGL 2OR7A 1WBZB 3EYFB 4W4OC 2YUZA 1B6UA 4H25A 3F7RA 4LAQL 3ULUE 5BZDA 3V4UL 1OLLA 3P4NB 3FRPA 4ZTPL 3KVQA 1WCBA 4Z18A 1N8ZB 5FYKD 3CCHB 1NGQH 4HGWA 4K3JL 1HYRC 5BXFA 3CZFA 1PBYA 3CJJA 3RTQA 3PIQB 4L8BA 4FQCL 3GK8L 4U05A 4F57L 1M4KA 5JLZA 4PGEB 3QCVL 1HKFA 1NBYA 2VSCA 2E6QA 1RK0A 2YSSA 4JLRA 5J3HC 4JR9L 2PXYB 3QI9D 5EN2A 3RUGE 4OIBA 5T1LA 5TF0A 4LVOC 1NGWA 5T1KA 4X80L 3CMOH 4G8EB 5FO7B 5LAXB 1UWEL 2IH1B 3GMNA 4QO1A 4HMCA 2CD0A 3AMLA 4ODWB 3BZEA 1JHKL 3QUZC 3LH2L 2E6PA 1GZPB 2OXGA 4WWID 3DROA 2AP2A 2F8OA 4JREB 4XXCC 2DQCL 2HFGH 1EAJA 3VXUB 5IVXB 4NC0B 5D9SB 3VMNA 2Y6SD 5FUOL 2ENYA 2UWEB 3PP4L 4E41E 4YHOH 5IBTL 4Y4HC 3WLBB 3DHJA 4EUPA 4XRCB 3BQUB 3OKNA 1B3JA 4M6OH 4JFOA 5EZJA 1NJ9A 5GGVH 3NABL 1B9ZA 5CEYB 2A6IA 2IPTH 4MNGE 3P4MA 2VE6B 1FO0A 5KSVB 5EB9A 3ARBB 1XGTA 2G60L 3L5XH 3MCLH 4DW2H 3BAEL 4PYGA 4OGAC 4JFXA 1A3RL 4X5XA 4ZFZB 4XVUC 1JWUB 2F53D 3S5LB 4NOBA 5HHNB 1DCLA 3QPQD 4KXZI 5F7DB 4HIIB 4JFEA 5KANI 3FB8A 4Z78A 4BZ1L 5KANG 3IDMB 3M17B 4BH8A 5IB2A 3WJJC 4DN3L 4MAYC 2A1WL 4J3SA 3JTSA 2MPAL 2C1PA 2VN4A 4XAKD 4MMZC 5JIHA 1NDMA 3T0EB 3E3QE 2CK0H 2PTTB 2R2BA 3HMXL 2VXSH 5HDQH 1MIMH 2IALB 2XKUA 4P2OD 5D7IA 5KVDL 2F9BT 1XF2A 1IGTB 4ZFOB 1QFWM 1HXMB 4WY7L 1PYWB 1DN2A 3AB0C 5EN2B 4U1JA 1MHPH 3ETBF 2CUHA 2PW1A 3SDCC 4GAGH 4MD4A 3IFNH 4M3KB 4FN0A 4NCC1 4JY5H 5FV2A 5KW9H 4GG6E 4ENED 4HWZB 1V7ML 4X5WB 1MSPA 2DB8A 4MB3A 1D3CA 4Q0XH 3RAJH 4PYHA 4AMKH 1WVZA 2R39A 2XXMB 4G7YL 1CL7L 4QYOB 4FQHB 5D96C 3QYCA 1S7VA 3T4AA 3BWAA 3S88L 4K2UH 5BS0D 3L5WB 2V7NA 2DLHA 3IRPX 2AW2A 4XC3L 1AE6H 1MFCL 2DIBA 2YD9A 5F9OH 3PWPD 5H94A 1YZZA 1I8IA 3CDGB 4W81A 1HXYA 3VXNA 1SMOA 2ZZUT 4HWBA 4KZEH 3C6LD 1Z5LB 4U6XA 5D72L 2MCPH 4JZNA 2PYEA 2AQ2A 2D3VA 3B5GA 4U6VL 5MI0B 4PJ9B 5A16B 4GAYB 1NJ9B 1S7SA 4LQFH 5D7JD 1P84J 2EXWD 3QIBA 3GIZH 4UINH 1A7OH 4LLWB 3EGSA 4FFWD 3C9NB 4WW1B 1QPPA 3L95B 3GMOB 1SY6H 4HFUH 3NIFF 4AH2A 1L7TH 1BD2E 5E99L 2GSIA 5B3JE 2R2HB 2YD3A 2GSGB 3ZE2F 4LVOB 4YGAB 1MRDH 3CFIC 5I30H 1T2XA 3ZKSD 1ITBB 4KDTA 1P4BL 2R0WL 3DO7A 1ZLVK 3H9HA 1J9CT 5HVHB 3EYSL 4XX1G 4AEFA 3OJDB 4EKXA 1WK0A 3LPWA 1G7JA 1QSFA 4NZDA 5JLZB 2RAMA 1FJ1B 2QQQA 1WZMA 2DQUL 2C4FT 4TNWF 1IL1B 3E0GA 1U2CA 5I9QB 1OB1B 3HZKB 3MLXH 3N9GH 2DQGH 2QHRL 2PR4H 4HMEA 3BDYH 3SGJA 2VZSA 2ERJC 3MA7B 2JLLA 4AIOA 1I9IL 2AJ3A 7CGTA 4XH2A 5DSCB 3UJJL 1FPTH 4TQEL 3K2UH 2R69L 3F5WA 5I17B 1UWXH 2N7BA 4KKBC 4WUKL 4YHMH 4MQ7B 5I18H 4LCCC 2Z91A 1KXQE 4RGOH 4OSUL 3KYMA 5CGMA 1XCTB 3CX2A 3KLHD 1MREH 1T0NA 3A6CL 4PV8B 2OR8A 4OV5A 2BVOA 2I9TB 1WT5C 5DK0A 3ARQA 3TNMA 4NQCA 4Z7WB 4U1LA 1NCAL 1MRCH 5I15L 5IHUH 3G5VA 4X6CF 3VGHA 2IPKB 1S7QB 5LCVH 2BVTA 4LEXL 4N5ED 1WLHA 3V6OE 2B7DT 5D70L 4L4TA 4UDUA 2E6JA 3RWFB 1NCBH 3O6KH 5TFSH 1T6VN 1CIDA 5C2BL 1MF2H 5D1QB 3M17A 2G9HB 1CIUA 3L3IA 4Y4HB 3GM8A 4XVJH 5IHZB 2UZYB 5JMRA 1VGEL 3WNOA 2ZG2A 3ARFD 5I1DA 4RWHA 4P9HH 4LLVA 3DSNA 1WTLA 3WL9A 3MYJB 2LVCA 4Z0XB 4GT7A 5HJ3A 5FYKU 3HMXA 1YJDH 3IU4H 4P59L 5EULV 2D9CA 4J3OC 1O0VA 3SN6N 3HAEG 1A6WH 5ILTH 3NFPB 5EUOE 3IF1B 3U1SH 3L3KA 3KR3L 5HYJB 5GZOC 5GRZA 3MNWB 4GKNB 5EU3B 5B38G 3UP1A 3ARBA 4L3EA 4KQ4L 4MSWB 2GTZA 2NQCA 3GRWH 3D0LB 3HI6H 1W0VA 1ZHKB 4CDHA 3QJHB 2JJSA 3WD5H 4X80H 5DI8B 4JFQB 1NBQA 3IU3A 1CLYL 4D9LH 3NZHH 1Z0NA 3RU8L 3OJDA 4PD4J 3T1WA 3OKNB 2QSCL 3ET9F 1A5FL 3C2SA 1MHHB 1QSZA 2AJYL 3EYOA 3BKCH 1HHKA 4WHCA 3QUYB 2CJUL 1LNUB 3WIIL 2HVKB 1FGVH 4MD5B 3QIWA 1C08A 3QULB 2BVYA 4WU5A 4M6OL 4LPVA 4S1SH 1FYTE 4DOHE 3CZFB 4NQTA 4CMMB 5BRZE 2C4XA 3RWGA 4LLWA 3HB3D 5GISH 1U8JA 4PV8A 4F80A 1T1ZA 5CWSA 1FCGA 4AL8L 3LKOA 1L9NA 4Y5VA 1JHLL 1IZJA 5T1MB 1KG0A 3MLWH 1R0AL 1FO0L 3G5XB 1YYLH 5FYJE 1KCUH 4MMXC 2G5BB 4KGLA 3TF7C 3GIVB 2FATH 4QRUA 5K9QG 2HVJB 4TNVF 5JXAH 4K23L 1BZ9B 3JV5A 4XWOD 1H3WM 2VLRB 5C0CB 2F58H 1PW3A 5LGKA 2AJ3B 5C9JB 3OR7B 2ZPKH 1TJIH 1IAOA 5SWQB 1JI2A 3MOBL 3NZ8B 2DJSA 2OZ4L 2JIXB 2X89D 3KPRA 3B83A 2CQVA 3IDGB 3UEZA 3ZHKA 2AJXH 2JJTA 5HJ3B 3QR2A 3STBA 4RMTA 2BSTB 1KNOA 5L2KA 1D5BB 4H20H 3LPGA 4I4WB 3TN0D 3IDNA 5I1AA 3DI2B 1GJIA 2XOTA 2VOTA 5CSGA 1T22A 1KB9K 1PFCA 4LIQL 4Y8AA 4NBZB 3IFOB 5D2LA 3L7EB 4YQXH 2CDGB 2F8XC 2ICWJ 4ONGH 4DGYH 1TZIB 2EEDA 4PBWD 4J6RH 4J8RA 1QVOA 4N8CH 3MV7A 4DN4L 4N0UA 4JRYB 2W59A 1ORSA 1TLKA 4HJGB 2FO4A 2R2HA 4PRHE 2NX5A 4CADA 1S7TA 1MWAH 2FX9L 4XCCL 4P5KB 4G6ML 2DWDA 4XPGL 5DUBB 3H9SE 4NT6B 3ULSB 1AJ7L 1NGPL 2NXZB 3F7VB 1C5CL 5L7XH 5TGBB 3ARFC 5F7YC 1CQKA 4PFEA 2VLKB 4K94C 4G6AD 4XC3H 3BEWB 4Y5XA 4JPKL 1P4LA 4NKMA 4ZD3H 1OW0C 3LMJH 3I02B 2HYMA 4JFDD 1S78C 3V0VB 4MD0A 4U2YA 1NUNB 1IC5H 3LB6C 4MDIA 2MNUA 4M1DH 2XACC 3GMRB 1A64A 4G6FB 2EC9T 1M6OA 3K4AA 1N59A 3RX8A 3H7LA 2J6EH 1S9WA 5I73C 1K6QL 4PJAE 5AAWA 1E4KA 1BAFL 1WBYB 1JCKA 3ALXA 3VH8A 4YIQB 2R1YB 4MWFB 5CZXC 1A7PL 4YHIB 1E6JH 4OCYL 5DRXB 1I3RB 3LIZL 3IDJB 1EBPA 1LO4H 1Q0XL 4K71C 3ZKXC 2R0WH 4LCUA 3O0RL 4NO5B 1A6TB 4XAWL 3O41A 3JUZA 3BD4A 2QADD 2Q7NA 3SDDD 4JQIH 4M7ZB 4RRPA 1RZJH 4MJIE 2SEBA 1YPZF 4IJ3B 4JFFB 3SJVA 5IROC 3CGTA 5KVMC 1XF2B 1MIEH 1TETL 4WHYG 3DVNB 3MROA 2X40A 3QQ3A 3MBXH 1EFXA 3DTXA 1CCZA 1MCHA 3LKSA 5TF1H 1RZKC 3CLEL 1K4CA 2ARJQ 1WCQA 5BOZG 3PHQA 5H2BA 3U4AA 2Z91B 4X0KB 2JELH 1EMTH 3IXTA 4TVPL 4WW1A 3IRZA 5FYJH 3MV9A 3OKKB 5I8EB 1T21A 4JQVC 2NY6C 4ZSOE 3NN8B 3O3EB 1MEXH 3WSQH 5GS2H 3BKYL 1WWAX 3VRLF 4KI5C 5EU6E 1CFBA 1RFDL 2BHYA 2Y5EA 3MV01 5EBGA 4PJCA 4HIJA 4KWUA 3AB0B 1EJOL 3DX6B 4U6HB 4CN6A 2BRRL 2CRMA 4ODTH 5F88A 1C5BL 4PJCE 3QIUA 3TBYB 3MA9H 4PJ5B 2VDRH 4FP8L 4Y4KA 3MV8E 3FOLA 2XFXA 3MRNB 5GS0C 5IHBA 3VFVB 1IKNC 2V2XB 4KMTH 2IJ0C 4Y2DC 1YY8B 2DQHH 1AHWC 5I1LB 5FUCC 5JR1L 3QXUA 1I85A 3O6KL 2XNAB 2EYRA 2ICES 4X4XA 1GHFH 3P73B 3VXUE 2H9GA 4U1IB 1DBBH 5HD8D 3QI9A 5HHPB 3KPSD 1EFQA 4JFDA 1NMCB 4L4TB 3P4OA 5E8PB 4JFYA 4RRPG 2HWZL 5DT1L 3RDTD 1I1FB 2DBLL 4JFDE 1KB5H 4DGIL 4IOIB 3NH7H 4M8QA 4XBEL 2K7PA 4GAJH 1DANT 4LCWE 2FEEL 3HE6C 4H26B 1IGFL 1QFWI 4NWUL 2QQLH 3D39B 4UQ3A 1KIRB 4APQC 1NKOA 3QEQB 1GGBH 5ESQB 1CK0H 3EFFA 1BBDH 1U8KB 2BK8A 4HPYH 1YMMA 3CFDB 2OJZL 3VH8B 5BZWA 5E2VL 3OB8A 1EAPA 4YX2L 4JDTL 2CH8A 1DUYA 3ULVE 4FQPA 4J4PA 3K8MA 1JNLL 5DA0B 5F8RC 5HHVL 3ZHLA 1TQBC 1H5BA 3EOAA 4X6EA 2GTWA 4FQLL 5DQDL 8FABA 1J8HE 2J8UF 1RIHL 2X4RA 3VDBA 1DQJA 2AJYH 3QWOB 3D2UA 2EYTB 3IFLL 1ZTXH 4D0DB 4Y0GA 1I9RH 5EZOH 1X5JA 3PV6B 4Z0BL 1RMFL 1FP5A 5I74B 4GG8A 4MJ6A 3SDDC 1OQXA 2HJFA 3LDBB 4NKMB 1JGUH 2VZ3A 1RSFA 1ZE3C 3DURA 4JVPA 3HE7B 3BMWA 1EHXA 2BOBA 1H3PL 5EIVA 3L7EA 4OF5A 4LCWB 5F3BA 5DMYA 3NPZB 4P5TD 4AL8H 4DEPB 3R4DA 3M07A 2EZ0D 1FRGL 2VZOA 4I77L 1OSPH 4HXBL 1CF8H 3KJ6H 4U7MA 2DRUA 4J3VA 1KNOB 2NXZC 4R7DB 5HGHB 1FFOB 4OLYH 3RTQC 3FQWA 3L7FA 4J4PD 1NUGA 1KTRL 4UI2A 4ZTOL 1N0XH 4XVUD 1MRFL 3A67L 1R3JB 4MAYB 4K3DH 3NIGE 3X11B 1MJUL 1BHGA 3IKCA 4U3HA 3ULVL 3TVMD 4HGWB 5DFVD 5BXFB 2BSRA 3WIHA 1B2WH 2PW2A 1A9EB 5DMGC 4LLYB 3Q5TA 3SE3A 2WWKO 3O8XA 4EN3A 2MHAB 3RY4A 1IQWH 3QUXB 2O5ZH 2FB4H 3THML 3VFNB 5DEFA 2EDHA 4YE4H 4NFBA 4R0LB 4WFHD 2BOCB 5F89A 2X6MA 4ZS6C 3SE4A 4ZUUB 4PB9L 4NWTL 2VZVA 4LRNL 4DGYL 3I2CH 1HZHH 4LMQE 3FMGH 4XP4H 4J6RL 4H8WH 1FBIH 4KUCF 5HBBA 1EEZA 1S8DA 1GIGH 4O9HL 5L8LB 1UCTA 3OAZH 4HWZA 2AXHA 1HE7A 3TEUA 3ZZ1A 3IXAA 5C07E 1MWAL 2FX9H 4XCCH 4QRTA 5JOFB 1Q9OA 1M7IB 2C1OA 2H8PA 5TE6L 1DVFB 1N64L 2RCSL 5CILL 1T0MB 1Q9LA 3H0TB 5L2JA 1V5JA 4Z7UA 4NHUA 5DD5H 1HNGA 4UV7H 4YDLC 1IZKA 1IGTA 4ZFOA 4OUOA 2DBJA 3TZVB 3GBNL 4JG0H 3ZL4H 5T3XD 3BUTA 3TIEB 4NHCL 2Y36H 4LF3B 4DKAA 1TTUA 4NKQB 2EH7H 2OP4L 4E0RA 3VI3E 4BFGA 4TUKL 2YEZB 3LCYA 5F70A 2F15A 1HSAB 2A38A 4A6YH 2X9XA 3REVA 3MGOA 3OAZK 2GK0A 4XCYB 1MVFA 4L8SC 3DRTB 1LMKA 3BGMB 5LBSL 4PY7B 5JPNB 3HNSL 1INEH 3QUYC 3QNXA 5FYJU 1KCSH 2J1KA 1S3KL 1CR9L 3UTTE 1F4XL 3BP4A 2DI7A 1ZSDB 5GGQH 5TE4L 4YFEA 5KJRH 3BEVA 5I76B 2P45B 1LP9E 5D1ZD 3U4BH 3LV3A 3TPUB 2AV1B 2FL5B 2ED9A 3L3DB 3GMMB 4NQEB 3BN9C 2PETA 3ARWA 1U92B 4UDTA 3ESVF 1CBVL 2ORBL 3I85A 4XHJC 2VLKA 5JW5A 4EXPX 1S5IH 3G5YA 5HHMB 4U1NA 1TETH 4UB0H 3NFNB 1VACA 3BN3B 1DLFL 3QDJD 4XXCA 3D1MC 4P57A 1F6LL 1YEFH 1H9VA 4LQ1A 4ZMAT 4TPRH 1UACH 4Z7WE 1B4RA 1CVSC 1OTSD 3FO2B 5DJDB 5M94B 4IIQA 4OF3A 4U6YA 3QA3A 3WN5B 2NY4D 1AC0A 1NLDH 4JRYE 1OOAA 2C26A 5L88L 2X4SB 2BERA 5DJYA 2FJFA 2ARJB 1F97A 3DSFH 5FYJL 1PKOA 4JM2D 1K4DB 3O6FA 1KCRH 3CIQA 3KPMA 4K55A 1A7QH 4C56E 4PG2C 4EIZC 1VDGA 5FGSA 1OSZA 1EO8L 4I3RL 1NCDL 4W68A 3QWOA 3CCHA 4WFHE 4JKPH 2VLME 5MHSE 3KYAA 2CLVA 1NC2B 4XVTL 5FHBL 5LVEA 1MFEL 1BVKA 1UB6B 3ZE0E 4Q6YA 3IFPA 5DJAA 5DYOB 4X6EB 2XTJD 4NIKB 5MENA 4LVHC 2AXGA 5DWUL 1YEKH 1YECH 3QNYA 1XR8B 5MENE 4PJFB 1B6DA 4N9OB 2XZAH 2NPLX 5C6WH 3N50A 2HTLC 2FWOA 4U6TA 3VWKC 1T89C 3MRRB 1EA9C 5EU7E 3SDCD 1UJTA 3HR5B 3PWLA 4P2RA 1JGVH 4EDWL 3D0VA 4HKJA 5HTSA 2HWZH 5CLWA 4XBEH 3DYOA 1VADB 5D7JA 5B8CB 4ZPVA 4L4TE 3TT3L 2PYED 3DO7B 4XP6L 5L2KD 3QUMA 3VFRA 3X13A 5BRZD 3TVMB 2MQ3A 4S1RH 1G7JB 2EO9A 3IS0X 1RZKH 3JSSA 1BBDL 4Z95L 1AD0B 2VXUL 4DZ8A 1T5XB 3DETD 4WWKD 3PNWA 4HEME 4WHYH 2CDFA 3O9WC 2D7OA 2JB6A 4H88L 5JW5B 2QV2A 4MJ6B 4R0LA 3O3DA 4NQEE 2VISA 3JWOH 1YC8A 4CRPA 5FDWB 4OZFA 4RFEB 3VXQB 1YEIH 3TP4A 4FQLH 4L4VD 4DAGL 5GRWA 1PEZA 5D1XD 3VXME 1YN7A 1E28A 4F58H 1FFRA 3BD3A 3VG0L 3QIUD 5IFJB 4YNYB 4KPHL 4LIQE 3C5SB 1S9KC 4UT9H 3PGDA 4Y16D 3QCTH 2V2WB 3EOTH 3CXHJ 1RZ7L 4JCMA 2DQJL 3TFKD 3WFCH 3ALWA 5IHZA 2NW3B 2GFBA 4PP1D 3O3UN 4YDJB 4L4JA 3MGTB 4L3CB 5DZNA 2WNGA 4UNUA 3C60B 1A9BB 1EXUB 4XHJD 2DS4A 3DVGA 4DW2L 3G5ZB 4MDJA 4JY6A 4X7SL 2HJKA 3QPXH 3P0GB 5C08B 3KPMB 5AUMB 3KPPB 1CFVL 1RULL 4G9FB 4ZNEA 2EICA 3VFSA 2WM0A 5KOVC 2AQ1A 1MQKL 1IGMH 1RUPL 4LCCB 3QUML 2H8PB 3IS1X 3WIHH 5ACLA 3F12A 4ZTOH 3RIFF 5F93C 2E9IA 3HPLB 4L8CB 2YXFA 3G5VB 4K3DL 5FM8A 4PJHE 5I1EL 3JV6B 4NQCB 3EFDH 5ESAB 1U95B 3BIKB 1S8DB 2CK0L 4E42A 4FFWC 4OTXL 1KBGL 1FAKT 1QSVA 5IEKB 1OTUD 3TO4A 4F33A 3KPOB 3THMH 4OCXL 2NW2B 5CUSH 1I1CA 2B39A 1J1PH 2WQRA 2ZUYA 1KB5B 4YE4L 4BSJA 4LHQB 4QTIH 3GUTB 4HS8H 4IJ3C 4WI6A 3UAJC 4HC1H 4L29B 4HIHA 4Z7VA 5ACZA 2W92A 5HHQB 1ZSDA 1MCFA 1EAPB 1FNAA 4OUUA 1SBBA 1QFWH 4MA7H 2NTFB 5J1AB 4FXGB 2WP3O 4FQXD 2B2XL 4XH2B 1CFTA 3P30L 4O51A 4JFXB 4WO4D 3DRQA 3OXSB 4BM7A 3S88H 1P1ZA 2XWJA 3VXSB 2GK0B 1OW0A 4PP2A 1UCBH 4PRNA 4RWYH 4I0PB 4PY8J 5FXCH 4OZIB 4W6WB 4DZ8B 2DWDB 3HCVB 5IVOA 2LE9A 2Y4SA 3FQTA 4UILL 4D3CH 5KSUA 1N2RB 1A7NL 5IOPB 1NANH 2MCPL 1DR9A 1R5WB 4XVSH 7FABL 1LEKB 1PKQA 4ODVL 5TDNB 5IVZB 3CMGA 3KYNA 3O9WB 3OKYA 4YK4B 4XXDB 3R8QA 3PWUB 4QWWD 5KVGL 1QSFE 1DVFA 2DLGA 1AFVL 4XPHH 3VGAC 4PS4H 5HPMB 1UXSA 1JYWA 5IMMB 4G5ZH 4H0GA 2VKXA 4JZJC 1GC1L 5E99H 1INEL 4CMHC 3WXVL 1JMXA 4O58L 2LAGB 2JJTC 1KPUA 1CDGA 4M9OA 3EZJB 2Q8BL 5CEZE 3GSNH 4X6DA 3SQOL 4PREB 1CGXA 4M1GL 1CLZL 1VGKB 1V3MA 3AXLA 4PJAA 1XAUA 5AZ2L 5IG7B 3TBTA 3QIUC 2I9LA 5DJZA 4WW2F 2MSPA 3QNYB 2DD8H 3CDYA 3RGVC 2Z92A 1PLGH 4MZ3A 1GL4B 4N0YL 3GZKA 5DYOA 4PGZA 2I07A 3IXTB 5IROA 5SWSE 2BNQD 4V2BA 1OGTB 4ZFFB 2QHRH 2O5YH 1GGTA 2QADC 3KS0H 3ZTNH 4KI1A 3RVTC 3WFEH 1WUNT 4ZYKB 1JPFA 1UC6A 2XT1B 3V6OC 4NKIH 3TO4B 4F33B 4HDIA 5EOCH 3FT2A 2KPNA 3V0VA 1NFDA 4RFOL 1N4XL 4RAUA 4WFEE 3N1QC 3PABA 1A47A 2XIDA 5BQ7A 2FYYA 5CGTA 5A3ID 2VDPL 4MNQB 2ITCA 1KF9B 4K7FA 4KROB 3S35X 4P3WA 4AG4H 4X6FA 3QQNA 3DSFL 4LCWD 2ZCHH 5IM7A 3VWJD 4JAMA 1SJHB 3TO2A 4JM2C 5DHYB 4P5KA 1JYVA 1NAMA 1U2HA 1WZ1L 3FFCB 4UIMB 5AWNL 1EO8H 4HAFA 2BY1A 5GXBB 2P24A 2YR3A 1N26A 2X5PA 1XGRB 1MFEH 1PKQB 1FNEB 1Q9WA 3BYYA 1DL7H 5L0QB 1ZVHA 3QHFL 4QRPD 2DYPA 2EKSB 2ADGA 2I24N 5JDSB 4LKCB 1K8DA 3CSPA 4FXKB 2DJ4A 1GSMA 1E6OL 1W72B 4FQIL 4XCEA 4LSRH 1OT2A 4Y4FA 2ADJA 1CLCA 1URLA 5TFSL 1M6OB 4QF1A 4R2GD 1BQHA 4GQPH 3HUJF 3QG6B 2X70A 1NGXA 3TYFB 1HKLL 1F4YL 2V2WA 3Q6GH 3MR9A 2C4FU 2FSEB 1ZHLA 4NO0B 3RWEA 2EDRA 3KPQA 1L0YA 1HCVA 3NACL 1X5IA 3C6LB 3U0TA 3W39A 4POZC 1G7PA 5ICYB 3DIFB 3FB7B 2X2YA 5GRUH 4QRUB 3HI5H 3WLBA 5D7LD 5B4MD 4KJQD 2ZOLA 2LU4A 4DZBA 2F19L 4KHTL 4I5BB 3B9VA 2YPVL 4BQBA 2NX5B 2OBGA 2PXYC 4CADB 1V05A 2DDQH 4UT7L 4Q2ZB 5EBWA 3QQ3B 1T1ZB 1TZIA 4XNMB 3D39A 4X4MA 5D8JH 3FQUA 2DQTH 1JZ3A 2A9NL 4XI5C 1JF5A 3L3JB 4FFYH 2BNRD 2YC1B 2F74A 4L8CA 1GZPA 1SJEA 5I1KH 2ZUXA 5FFLA 3NCFB 5MP6L 1EGJH 1MFDL 5IB5B 3A6OA 5D6DA 1BQLL 5GSRB 1NMBL 3CFJB 3BP5A 4HWBL 3BGFB 3LD8B 3QDMD 2F53A 2HT2D 32C2A 3WE6B 5ISZE 2QKIB 1BEYL 4WO4B 2NCMA 1NFDB 4XXDA 1YMHA 2HTKC 3MRIA 3MRMA 1OGAA 3HMWH 4XPTH 5DJ0B 1UM4L 1MCDA 1DN0B 3NVQA 4KPHH 2HH0L 1CFQB 3HR5A 5F1SA 1UH2A 3QCTL 1SEQL 5H37H 4J3WA 1JPSL 3BT2H 3TJEL 1FFPB 3CC5A 5J12B 3IVKA 4PJFE 5F8QC 5I2IA 2I07B 1U8PA 1J8HA 5T3ZE 1DLHB 3GSUA 1RK1B 1J7VR 1T3FA 1D5ZA 4OAWB 5FYLL 3S4SA 5HYSA 3OXSA 5F9WB 3M45A 4Z5RB 2A77L 4Z7VE 1TJHL 3HS0B 1P7QA 1TTFA 1RIVH 2FGWH 1H3TA 4LVHB 5IEHA 4LLYA 4K07A 2XZCH 1CG9B 1A7RH 1SM3L 5JZ7C 1IGJA 1OAQH 1P4IL 4HQQL 1KLGA 2FATL 5C70A 1OF2A 2NY6B 2IF7A 3O3DB 5LXGH 3EO1B 1JZ5A 1JMZA 2RHEA 2W65A 4CN4A 1T03L 5IEKA 5IJVB 3TM6A 1EVTC 3RIAF 4WCYH 2OZ4H 1MCOL 3MODH 4D9RE 4OLZL 1BLNA 1KJ2A 3IJYB 1HQRB 4WHTB 5KSBF 3MJ9A 1CXKA 1MWAB 2OL3B 3O11B 3PV6A 1I85C 4X6FB 4N1HB 3T0AA 5JXED 4OZHA 5F96H 2ITCB 2DYPD 3BP6B 3OJMB 1C5DA 3H7BA 1KN2H 4TTGA 5ALBH 4C59B 4BSWA 1I3RA 4G8GB 5DJCA 3EDKA 4QOKB 5JHDA 5TE7H 3V52H 1J1XL 3SKOB 1ZT7B 3Q5YA 3TJHC 1YMME 3U82B 1CE6A 3KLAB 4OM1L 1KV3A 2FNBA 5C8JA 4MQ7A 5ACZB 1AR2A 4L1DA 1B88A 5GRVL 3JUYA 5IESL 1F90L 1IGYB 3BWAB 3VFPA 1Y18B 5EOTB 1KLFA 3BGMA 4OI9A 3VXTB 5L8KB 5T3XL 1UYWH 5C0AE 1DBKL 4JQVA 3ULVD 3BE1H 3EO9H 1N6QH 4M3JA 4WUUD 2QQKL 4MZ2A 4KVCL 3KNBB 1U6AL 5T1DH 1NC4A 4ZUWA 1CVRA 1A3LH 3SDXF 4YAQB 2VDMH 4Z7UE 5F7NC 4XI5D 5JA8B 2IPKA 4M8QB 3C09B 3IJHB 2BNQA 3RWHB 3SDCA 5B21A 3LOWA 4L1HA 2DIAA 4KRLB 3PQYB 4P23B 2A73A 4K7PY 4HUWA 3DHMA 4HCRA 4P4KD 3ZSSA 4W6XB 4O2CA 2GY5A 1RJZB 4NO0D 4E41A 5F7EL 5J1TC 3O0RH 5HGDA 2ICEB 1T6WA 5E7FA 1JK8B 1YYMH 1YY8A 3RKPA 4OB5L 2NY1D 2AEPL 5ALCL 3T0XA 5JORA 4PV9A 4NRYB 4HK3N 1PY9A 1G6RA 3C60C 4ACPA 2F5BH 1JE6A 3FB8B 4M7LT 3DARA 3AROA 4MJ5B 3UMTA 3DXAB 4NPYB 3N85H 4NZTH 3VDAA 2O5YL 4F9LA 4XNQA 3T2PA 4F2MB 5DSCA 1I8KA 3V6ZA 5DEFB 1QHPA 3RDTC 3HHRB 4JGMA 4HUUA 1F6AB 4R90H 1KT2B 1SVZA 3SDYH 3LRSA 1NAMH 1VENA 5ESVB 4IRSC 3UTSE 5A3IC 3UJIH 1RZIB 1KXVC 3MLZH 3MJ7B 5IB3B 4PR5B 3AS1A 4MB5A 2FBJH 2OZ4A 3RJQB 1AHWB 5KAQG 2VAJA 4UBDD 5JDJA 4YZFE 4WV1B 1RHHB 2ATPA 3RWGB 3QQ4A 1X5XA 1SYSA 3IKKA 4AIZA 1DBAH 1VA9A 5GSRA 4N1CA 1JZ2A 4FQQA 1MJ8L 2NX5D 3MRQB 1ZANH 4PJGA 2GY7B 3P11H 2XXCB 3WE6A 2Z31A 4EBQH 1AGFB 3QDGD 3UJTH 3U79A 4LPWA 1M7IA 5HDBF 2GK2A 1TXKA 2APBA 4XMLL 2YUWA 5KSBB 3VFUB 4JPIB 4QRSB 2YD1A 5CZKA 5HVWA 1W72L 2DI9A 2Y6SC 5IMOA 1TPXB 3PGFL 1Y18A 4JREC 3P9LB 4NRZA 4MQXD 3FQUB 4R0LC 3HTLX 4IRZL 2GUOB 3QDMB 3LS5L 4HLJA 5FAAA 5GRUL 5BOPA 5TQ0H 4KV5F 3LY6A 4OZGA 3QQ9C 4ZUSA 1BOYA 3HA0A 3S6CA 4NO2B 4LBEA 4EVNA 4PRPD 2PUQT 5E2VH 3E8UH 3UTTA 2HJLA 3MJ9L 4Q9QH 3BP4B 4BQ8A 3IAGC 5C09E 3DJ9A 1FYHB 1T7ZA 2CO6B 3IKCB 1OARH 1KXTB 5F1OB 4MAYA 1NCNA 4YHZL 4DKDC 3O3BA 3EYUH 4NM4L 1MFDH 1ZHBB 2DYPB 4P5MB 1NMBH 2GT9B 5I1JL 1B0GA 2B5IB 5DQDH 4UIKH 3FQXA 1HH9B 3PHSA 1BEYH 1J10A 2AI0L 4OLXL 2EDOA 1LE9A 4ZUTA 4D8PA 1W0YT 4LLDA 4ZUVB 1HQRA 2Y25A 2X4PA 3AS2A 4OCLC 4JFYB 4ODHL 1QO3A 2EE2A 4H1LG 2VXTL 4QHLA 1UJ3B 3NABH 1JPSH 4RCAA 1UJ3C 3ZE0F 2AJZA 3ROOA 1BFSA 3QH3A 3UTOA 1Q72L 3QDHA 1ZGLP 4Z7UB 1OP9A 4UDTB 4MVBC 1VEPA 3KPSB 1UZ6E 3ZYOA 4M7JH 3PV7A 5EOQL 3LEXB 4HUXA 4M43L 4YWGH 1X5GA 3NZ8A 3VW3H 4G8GD 1JGDB 4X9GA 1BOGB 5EBMB 3BISA 4Y88A 1LQSR 3MRRA 1I1RA 4FHBD 1RK1A 4U33A 5KVFH 3ZKXB 3SKMA 3BIAX 1IM9B 1FVCB 2X1PA 5CBEB 2DQIH 1UEYA 1SM3H 3BPCB 5KSAC 2VQUA 3D9AH 5DFWH 4KK6D 1QRNB 3U0PB 1AR1D 3DRTA 1UT9A 4JM4H 1N0XL 4P5TA 4FFVD 1OTSC 5MENB 4M93B 1TQCB 1CDCA 2XA8H 1KPRA 3WNLA 1TENA 5HPOA 4U1SA 1ED3B 3MRLA 3PHOB 5HGGS 4AQOA 4WO4A 5T1MA 32C2B 5ETUB 1X6NA 2X1XR 1IAII 4NZUH 3ARBC 5BV7L 4NHUB 1UA6H 5DC4B 2NZ9D 1QR1A 2C3GA 1YEDB 1CLOL 2FJFB 3ZKMC 1GH7A 1F11A 1M7DB 3GSWA 3ROLB 3BUYB 4NNXB 3MLVL 5IV2B 3I2CL 1G6RH 2ED8A 1MHHA 4AMKL 3DV4B 2XTJC 1DQDL 2BSSA 4ZOAA 3SDAC 5EIIA 1SJEB 3NIFE 1D5MB 5F6HI 3H3PH 4NUGH 3E6FB 2X4PB 2WP3T 4Z7UF 3RJDA 5BV7C 4K2UL 1BVLB 5JQ6H 4U1NB 4DK3A 4X7TB 2HTLD 3HI1A 5TE6H 5C0RH 1JP5A 2BVPA 4ZAKB 4BH7A 1Q0YH 4X6BB 3RKDD 3DUSB 1TIUA 3BPOC 2NY1B 1RZFL 1SEBA 5HYJA 4JG0L 3ZL4L 3KPNA 4PRNB 2EDEA 4PJ7F 5F88B 2JE8A 4U6VH 1U8QB 2EC9U 2GI7A 2P4AB 2R9HC 2PW2B 4DK6A 2UZIL 5JPMB 2JIXD 5J89A 3MRKA 5C0GA 1A3LL 2WIMA 4GRWB 1QBLL 1OM3L 1H0DA 1FLRH 1FO0B 4YDIL 3GNML 4YXHL 1RPQA 2ILLA 1WT5A 3N1PC 3LKRB 4GBXB 3LEXA 1FZKB 4PRHD 5KZCD 5CP3A 1EV2E 2P46B 3IDYC 2H41A 3KPOA 1F45A 3WDIA 4QGYA 4K8RD 1NL0L 3C8KB 4QWWC 1Z6JT 1HH6A 2V5MA 1NCWH 2VWEC 3ARED 4X5WA 1D9KB 3VD3A 4UTBH 5ID0A 1EFXB 3DTXB 4M4PA 5GS1C 4P2OA 4OB5H 3K4DA 2H32B 3BFOA 3MBEA 5D1QD 2YS4A 2FH6A 5DZOA 1RY7B 1S7WA 2YA1A 4QXGL 3EJYD 1N6VA 5L2JB 1IJ9A 2BFVL 2PR4L 3KPPA 4UB0L 3L3OB 1G7QB 1GZQB 2YD7A 2DTMH 1ZWIA 1MPAL 1MCKA 4YFLI 5CHNA 5FCUL 5ITFB 2R0KL 1DZBA 3SJVD 4X4XB 4LSPH 1NC4D 4PJ8D 2JIXA 4ZO6A 5C6PB 3MREA 4HK0B 3HLAA 3VJ6B 3TYGH 2ZCLH 2HKHH 1IILE 5DS8A 3D25A 2P43B 4DKFL 2KQMA 3SOBL 1NH6A 1TNMA 1WAAE 2VWEE 4PLJD 3CSYA 2RQ8A 2C3VA 2FJGA 3MGTA 3FT4B 3JXAA 4MYWB 4PJ5A 3LQZA 1HINH 1UM5L 3DX9A 1T2QL 1N59B 1R3IH 5ITBL 5IMOB 4DTGH 5MEPA 1RJYB 2OCFD 3ARFB 5F1NA 4XMPL 5DGRA 2VERN 1AP2B 1GGIH 5IBUB 3C5JA 1UXSB 3SDDB 3MRCB 5DDHB 5DQ9B 1T21B 5DLML 3OBAA 2DQDH 3BQUD 2E8YA 5EU4A 1WTGT 2R0ZH 5AYUH 3TT1H 4RFEA 3VXQA 5FCSH 4YBHA 3RWCB 3MRJB 4NQDB 2AK1L 4PIRF 2VC2H 4TSAH 4PRHA 1W72H 4WGVB 4PTTB 1YNTA 4QRPA 2CDFB 1KEMH 4UQ2B 3C87A 1WF5A 4EUPG 1ACZA 1IGCH 5DJ8A 2XTJB 3X3GH 1IEBB 3RWJB 5TDNA 1EX0A 1IM3A 1KIPA 4NUJB 3IU4L 1YJDL 5K9OB 1NSNH 3CPLB 2CDEA 2ZOKA 4N8PA 1HYSC 4KRPD 3VXMA 3W9DA