4JFED

Preservation of peptide specificity during tcr-mhc contact dominated affinity enhancement of a melanoma-specific tcr
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
197
structure length
197
Chain Sequence
QKEVEQNSGPLSVPEGAIASLNCTYSFLGSQSFFWYRQYSGKSPELIMFTYREGDKEDGRFTAQLNKASQHVSLLIRDSQPSDSATYLCAVNDGGRLTFGDGTTLTVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title T-cell receptor specificity maintained by altered thermodynamics.
pubmed doi rcsb
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2013-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jfeD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jfeD02
35C8H 1HSAB 5IBUB 1KIRB 3FT3B 4ZO6A 4Y4HD 1J0HA 2AK4E 3IJHA 4LHJB 5E70A 1PX3A 2CJUL 4FABL 4YWGH 3LZFH 3SKNA 4NP4L 4OSUH 4UOW0 5E00B 4Q9CA 1BFSA 1QNZH 1ZLVK 1RIUH 1P84J 2BNRE 4WHTB 3QUML 1NEUA 3MYJB 1UQSA 5GGSA 1PEZA 2OR8A 5KW9H 3NTCH 3GJFK 4HFWB 1CD9B 4S0TD 2BVPB 2DLIA 1M6OB 4QY8A 3U0TB 4X6FB 1T20A 1FZMB 5IF0B 4OGYL 2ICEA 3RY4A 4LEOA 5E6ZA 2PF6A 3HHRB 3A67L 4W6YB 4YO0B 4XH2A 3VA2C 1B4JH 1F2QA 1OD7A 5GRVK 1OCWH 1EGJL 5L8KB 1CTOA 5ANMA 4NNPL 4S1QL 3ARDA 5HYSB 1NGPL 3GJFB 3MBED 3AREB 4GS7C 2FGWH 4PG9A 3R0NA 4P59L 3E6HA 4MNQD 2ADFH 4OZHE 2JCCB 3VXMB 4LPTA 4QT5A 1X3DA 5GS2H 4KJYB 1MJ7L 1CE6A 4TVSa 2MCPH 2BFVH 2HFEA 2VE6A 4XNYH 1IMHC 2P5WB 5FCSH 1UJ3C 3VI4E 4YK4B 1MCLA 2VDKH 5JOPE 1BD2E 1UKSA 4XZUA 1TJGL 5H35B 4AMKL 3WV0A 3OKYA 5DDHB 3PF2A 2ZUTA 1G7HA 5HSFA 5BRZE 3RUGE 3U4AA 4XC1L 4GSDH 3SKUD 5I8KL 3BGFC 2ITDB 4OV5A 1B4RA 5A16B 4HQQL 3JV6B 5E6YA 3T4AB 5DC9B 4ZDHB 5C9JA 3KXFB 4Y16A 1CDUA 2ENYA 4YE4H 5J13C 3ULSA 1V7MH 5GHWH 1A1MB 1Q9LB 1U8IA 5GS2D 4JQIH 3PDOB 4TOYL 4R4NC 1ZHKA 4MDIB 5ALCL 2OXGA 2HVJB 4PLKD 5ADPH 4MWFA 2R9HC 3TYFB 2IAMD 3DROA 2GT9A 4GAGH 2NY1D 1PY9A 4K94H 1KCSL 3HZVA 4QXUH 3W9DB 4NHUA 1VEMA 1DTUA 1GXEA 1TPXC 1JRHL 5DYOA 4PJ5A 5H2BA 3TJHD 4PJHE 3IKKA 1IAIH 4PGCB 1TZHB 4PJGF 3EFFB 3BO8A 3GO1L 1YEDA 3HE6C 1C1EH 4EI5D 1QR4A 2DLTA 4AL8H 4GKZA 2C1PA 4ZAKA 2MWCA 3QEQA 4J3SA 3B83A 3Q0HA 5D72H 4DFIA 1P9MC 1YUHB 3O6FB 2D31B 1P7KB 1T7YA 1UVQA 2G75A 1UB6B 3BH9B 3KLHD 5FF6B 4P3DA 5DVLA 1CFVL 2GFBA 4JO2L 1GOGA 1QFUL 4KAQL 4ZFOA 4F9PC 5C0JB 3ULVD 4JLRB 5C0DA 1RZ7H 3Q6FA 2B4CH 1OF2B 1B88A 4LLMA 3P73B 5E2UH 1JIBA 3P4OB 5D6DA 3VFOB 2OP4L 2OBGA 2X70A 1RJLB 5L6YH 3QIUC 1CXIA 2OQJB 4QTHA 1GGCH 4DVRL 2OJEB 3P9MA 4N0UE 5I75C 5BS0D 1OTSD 4F7PA 1BM3H 1FFOA 1IGIH 4WDIB 2GHWB 4UT6L 4GMTL 5ICXB 2AJUH 1CTNA 2XG5A 4EN3D 2WLZA 4P57B 2R0WL 4X98A 3R1GL 1RSFA 4OTXL 3A0OA 3QIBA 3WXWH 3OR7A 4H1LB 1YPZB 3NIFE 3QNZB 4M6MH 4X5XB 4F37K 1S5IL 1JNHA 5KJRH 3O6LL 2AK4B 5LGKA 1F4WH 3VD5A 5MERB 4UB0L 3RA7H 3SDCB 3PWPB 1NFIB 1W72B 3HAEG 4MD5A 2UZXB 2NX5A 3TO2B 2J6EL 3PNWA 4LHUA 4HULB 1NAMH 2LU3A 2XZAH 5D7LE 3WFBH 1E28B 4XVUD 4G6JH 4K3DH 1QRKA 1ORSA 3REWA 5KVFH 1FL3A 2GSGA 5IBTH 4HK0B 1J05A 4ZUTA 1A7NL 4BUHA 4BZYA 2DS4A 2GK2A 3QZWA 3SPVB 1XCTB 1I7TB 1MJJB 2QQLH 3U7AA 3D3VA 1YECL 1A6ZA 3KWWB 3EO0A 2ARJQ 3VG9C 3J8F7 1AFVL 1HDMB 2P8PB 4M61B 2APBA 3GSXB 4X7SH 3MRGA 3HMXH 4KTEL 2J8UA 3F7QA 3RWCA 4HXBH 1BOGA 1MFCL 3TN0A 1NAKH 5JZ7D 3X12A 2XZCH 1OSPH 1EEZA 4I2XA 3D18B 3K8KA 5EO1B 3MA7A 4HC1H 4GLRI 3JVGA 2N4IA 4G8GA 1G84A 1QPXA 4R7DA 3VFGH 1JGLL 3VFPA 2Z92A 3DHMA 1LILA 1Z5LA 4U05A 5K9KA 4I1NB 3FQUB 4IIQB 1Q72L 3F5WA 3EJYC 4JZJC 3VD9A 1E6OL 5EPMA 3ZKSD 1DBJH 1BD2B 2P4AB 4MQSB 4TSBL 4N9GB 4QRSA 2HYMA 3MRDA 4L9LC 1U58A 5DJYA 4WFEE 4XNXL 3F58L 3SEPA 4F8QA 1AGDA 3RUGB 4ETQB 4PJ7F 3VWKC 3ARGD 1IC4H 4HZLA 5JXEC 3CFEA 5T3ZL 5JPMB 3S98A 1BZ9A 3K74B 1FRGL 5T1KB 1ZLUH 1U8KB 4JR9L 4G9FA 4PJ9D 5D1ZA 4UIMA 2OK0H 3QUZB 2O93L 3QPXL 2Y5TA 4QHNA 3QHZL 4U1SA 1AR2A 4H0HB 1IT9H 5BO1H 4KQ3L 1YNLH 4KGLA 4LCYA 4JY6B 4XPFH 1QSED 3GMMA 5CJBA 3WO4B 4YXHH 5C09D 1RVFH 1IKFL 3LCYA 1N6QL 2FGZA 1PBYA 3I2CL 5E2TL 2XYCA 2AAVA 4ODUA 4Z7QF 3PE9A 1MWAB 1CICD 4U0RC 4MQXD 3P4NB 3BUYB 4L5FL 3NIGF 5CUSL 4F3FB 4P23B 1FAKT 4D0DA 2VYRE 5DK0B 1U91B 2WWMD 2ITCA 4HWBH 5ITFB 5GGUA 5IHUL 1A6VL 1EJ6A 2VITB 2ORBH 4HIEA 1RIVH 2B0SH 1ONQB 4P5TC 1GGUA 4K7PL 5B8CB 5FGCE 3DBXA 4DN3L 3S37L 4I8DA 2Y1VA 4OF7A 1FG2A 1AC6A 1ZOXA 3GSOA 3IDMA 3SDDD 2D3VA 4LKXA 5AYQA 1LE5B 4ZNEE 1KPRB 4OGXL 1AY1H 3SDAC 3EZJB 4EIZC 1U3HA 3BT2H 5DWUL 1IKNC 2AEPH 5J3HD 2J8HA 4ENEC 4KTDL 4YFLI 1NUFA 1AD0B 2Q76B 5INCB 3GI8H 1X5AA 4RGNE 1D5BB 1MCRA 5FO9B 1FDLL 1QUNA 1FV1A 2VQ1A 2ZOKB 2EDWA 3K46A 4RAUB 3WLBA 4HEPG 1V5JA 2IMMA 1OAYL 3S7GA 4XPGL 2E9IA 3V4UH 4HH9B 3MGAA 4OD1L 2YA1A 3CFJA 1NCCL 4GQPH 4E0RA 3CNKA 4JPVL 4CRPA 2H32B 2NTSP 4LBEA 4P2RD 3TH2T 2QSCL 1CXFA 3PGFL 4LL9A 4MHHI 1HI6B 4OLVL 1UZ8A 5DC0A 5KS9A 3RY6A 3CMOH 2HKFH 4HUVA 1D5XB 1N8ZB 4I48B 2NNAA 5TFSL 4PFEA 2I9TB 1LP9A 2WAHA 4P5KA 5KAQG 1JRHI 5TF1L 4OZGB 3ZO0A 2IPUK 3P11H 2Z9TA 3QFDB 4F7EA 4PJEF 3T1FA 4JY5L 5HHOE 5D7LB 1OARL 4N0RA 5IHZA 5B39A 2JIXD 1X5GA 2XPGB 4KI1A 4O51B 1IQDB 4HUWB 1NCAL 3MRCA 2YPLB 5JPNB 1CGUA 1ZLWK 2F8XC 1OLZA 3EYVB 5MEOB 5SWQA 2C3WA 4QRQA 1KJ3H 5AEAA 4MB3A 2VMFA 3OKMA 3ARBA 2MHAA 3AM8C 1C7SA 1ERNA 1XCQA 1T3FA 3ROOA 4JPKH 1JMZA 3LZFL 4PJXB 4XMKH 4OSUL 2DI9A 2NW2A 4BQCA 4K3GA 3TVMC 2XKUA 4S10A 1RIUL 3KPSD 4HWEH 1J18A 5T3XH 3SGDI 3FB5A 1PZ5B 3P77A 3NTCL 1GIGH 1FC2D 3PQYE 4OCRH 1BHGA 1MFAL 2V2WB 2DQGH 4HKZB 1VADA 4X5WA 4DK6A 3FRPA 4IRSC 1WCQA 1U8PA 3MRFB 4BKLB 5C08A 1D6EB 4YHOH 3L5WA 5B4MC 1QSFE 4Y5XA 4U1LB 1MHCA 4M4RA 4JRYE 3BDBA 1OCWL 4JDVA 4YBLB 2HLAA 1QSZA 2P44B 4DAGH 3FQTA 5I1KL 5IMMB 4YDJA 3VXOB 5J11B 1AO7A 1Y6KR 3L9RA 3O2VL 2CKBH 2E7BA 1H8SA 2L7UA 2FGWL 4ORGB 3PABA 4NGHH 2ADFL 4W6WB 4QOKA 5HGBB 1BFVL 1EO8H 1KBGL 4LU5L 4FTVD 4BH8B 1D9KA 5FYLH 2EYSA 2MCPL 2KQNA 2BFVL 5T3XD 1RK0B 4XNYL 3V7MA 3KPTA 1N5YH 3U4EB 2XZQH 3KPMB 3RBGA 4WEBH 4AM0B 2KDGA 3QDJE 3HZYA 4L1DA 1HOCB 4ESKA 2Z93A 5ACZA 1XGTB 3QO0B 2VTFA 2APXA 4FQHA 4XMLH 43CAA 3ULVF 3S8WA 5CJQL 5F97E 1MIEL 5KTEH 2Y25A 1DCLA 1S7TA 5EBMB 4NZTL 3SCMA 3TNNB 1N4XH 1G7JB 2H6PA 2JKXA 3M17A 4YDLB 3O8XD 4K9EH 5K9JH 1MCQA 4PJFE 5E24E 2FEDD 3E8UH 3IDIB 3B3IA 5HYQB 3S3PA 4YE4L 1YEHH 5KSBE 3D39B 3CDCA 4U1MB 5LJYH 5H8DA 1DUZB 1V7ML 1J87A 2ZWLT 3WFDH 5J4MA 5GHWL 1SHMA 3UAJC 3T04D 2NQCA 1AP2A 3UC0L 2DQEH 4PJ8C 4Z7UB 5ADPL 3H7BB 5JTWA 3MPCA 4CADB 1FLTX 4Z5RA 1TCMA 3H9HA 4O2CB 4ZXBA 2HTLD 4QXUL 2BC4B 4Y8DC 5HDBF 4RBPK 5JNYA 3DWTA 4OJFH 5IT2H 1RPQA 4XX1E 1MH5B 3ULVL 3MZGB 1NC2A 4RRPG 4WHYH 3ULUE 3G5ZA 4WCYL 1L7IL 1X7QB 4RGNB 5DJXB 5K93A 1CGWA 3MJ8B 1I7UB 2YKLL 2BNQA 5DJDB 1NCNA 3N1GC 4P4KB 2EDJA 2EC9T 4Y4KD 5DGQA 1C1EL 2IPKA 1JWMA 3KPRD 5SX5K 4AL8L 5TF0A 3VFSB 2JELH 4B7LA 1ULVA 4U6YA 5FM5M 3T2OA 1R3HA 3PWNA 5EFIB 3WNNA 1RZFL 2XQYK 1AGFA 2ZZUT 3TIEA 2ZOLB 1SM3L 4MJ6A 5D8JH 4OFPA 4HW6A 5A43C 1FNFA 1U8OB 3MLTB 5K33A 4GXUN 2BSRB 3ZKNC 2B4CL 4U1IB 1TVDA 4MQ7A 5D1QA 4P2QD 2IG2L 1QP1A 4G43A 5E2UL 1UZ6E 3LB6D 3VH8G 4PRPB 4TYUA 2DQFA 1TLKA 5L6YL 1UWGH 2H26A 1ND0A 4MNGB 3TT1L 5EUOE 4ETYA 4CMHB 4WHYG 1IRAY 2NY3D 3GJEB 4RA0C 2FCBA 3H3PH 5DD6B 5C07E 1MRDH 5E1AA 3OJVC 1WWWX 2ZSWA 1UACH 2AJUL 2P24A 5I1EH 4FXGA 3E2HC 3T0ED 1FN4B 3MMEB 5I73B 4L8SC 3C6LC 2P46B 4M6ML 2ESVD 3AAZA 5KJRL 1GGIH 3FQXB 3OKKB 3OAZH 2ARWA 1F4WL 3RA7L 3PL6D 3W9EB 4F2MA 1CFSB 1NFDB 4YGVA 1IBGH 2GIYA 4N68A 4TQEH 4JFYB 4CN1A 3OL2A 3WFBL 4G6JL 4K3DL 1Q9WA 3S4SB 3U9UB 5BZDB 3EYSH 4QHUB 1FFRA 4H26B 4X6CA 4NSKB 2VZTA 1K3IA 3MREA 3V8OA 5C0CA 4HF5L 2FJFB 5D1XB 2WLYA 1R24A 5LAXA 1FPTH 4NQEA 1PKQE 2FWOB 1EHLH 3RGVB 1XH3A 1S9WA 4YHZH 4X7SL 1DVFA 2NXZC 4QNPF 3HMXL 1HHJB 3UBXA 1ZHNA 2CPCA 4HXBL 1A1OB 1NAKL 1U8NA 3CXHJ 5CIPB 1HQ4B 2EDDA 2OTWB 4RGMC 3B9KB 5AG9A 5EU6A 3MLPA 1I8MA 1OSPL 2WWKO 2DL2A 1MLCB 5GZOC 1KIQA 4HC1L 3TGXA 3IDGB 1HWHB 1XR8B 2IQ9L 1HWGB 1MVUA 1VDGA 2D9CA 2RBLA 3HG1E 4HWNA 5F7NC 43C9B 5C0BA 3VFGL 4K3EH 4LLAA 5I6XC 4JRXB 4MS8D 3TJEH 5GGQL 4NDMA 5GSVB 3T2QA 3RAJH 4A6YA 1HHHA 1B0RA 4MA8H 3WL9A 3QDJB 3V0WH 1BIHA 1U8QB 3QEGL 4UQ2B 3FCTA 2QHRL 3ARDD 2CKNA 4KKBD 1I1FB 5KSVB 1KPVB 3Q3GA 2EDNA 3VFTA 1RZ8B 1E4WH 3AC0A 3I6KB 4LSSH 3RKDC 3QDME 2GUOB 4XMPH 2E7HA 2VISA 1DANT 3S3JA 4LMQE 2O61A 4PJFB 2HT2C 2FECL 5ID0A 4IOIA 5SX4H 1XIWC 2PNDA 4HJJL 1S7QB 2PW1A 2OK0L 3EDDA 3JUYA 5IFJA 1UH3A 1IT9L 4BFIB 1AHWC 5BO1L 4TVPE 4L3CA 4QRRA 4YXHL 2V2TB 3PDDA 3MRPB 5D5ME 3LSOB 4JE4B 1L0YA 1OP5H 4HD9A 1ZA6A 1ZHBA 4MD0B 2AXFA 4HUXA 4CVXA 3GEWB 5HGDB 3PIQA 3MTRA 1RZKH 4Y16D 1EERB 3RKPA 3VXUA 2VDMH 5ACMA 4R4BA 3SGKA 1U3ZA 5J1TC 2J1KA 4WI3A 1MLBA 1KGCD 4KRNA 4KRPD 5INDB 3V79C 2E27H 3X3FH 1RIVL 2B0SL 3O4LA 4JZNA 5BXFB 1DUYB 1A2YB 3NOIA 1PGRB 2EIZB 4PR5A 3L3DB 1PKOA 1U6AH 3FOLA 2M2DA 1UJ3A 3NAAH 4OZFH 1AY1L 3AY4C 2W9DH 3IF1A 2L7JA 5FA3B 3T77A 3W5NA 4MJIB 3UYRH 2GCYA 4PJ5D 2DLFH 4LPUA 2HFFA 3F12B 2LAAA 4PUBL 3GI8L 4TUOB 2DQDH 1OY3B 4HIJB 4KVCL 1PYWA 4YHNB 4G8EA 2EDRA 1MCOH 4ZAKD 3QEQD 2BOBB 2W65B 1BECA 3HR5A 5LGJB 5D70H 2YXFA 3BZDA 4FXKA 3IXAA 4HAGA 2BNRA 1DR9A 1M4KA 1OAKH 4LDEB 1ZT4A 4NYLB 3QFJB 2BMKA 1FBIH 3BWAA 2YS4A 5J7CC 2BY3A 3V4UL 1FFNA 1FIEA 1MCBA 5IOPB 5I18H 3FB6B 3GZKA 1ZGLP 5CEZH 4K07A 3BUTA 3CMOL 2HKFL 2IALA 2X40A 1HDMA 4EQ2A 4JFDB 4NO3A 5DVNA 4QHLA 4OLZH 3VXSD 3JWDC 4LF3B 5JXAH 4F8TA 4D8PA 3P11L 4PLJC 1K4CA 1REIA 1K2DB 3HE6A 1YN6A 4OZHA 4P4RA 4YHLH 1IAII 2AJ3A 2PO6B 3QULA 1DQJA 3VFWB 4F33A 1VFUA 3MUY1 3V6FB 3MUGA 5MENB 4PJIE 3QEUA 4HFUL 1PZUB 2YMXH 3BH8A 4Z7WA 4LIQE 1P9MA 5FKPB 3EYOB 3WIHL 5J9PA 1RMFH 1JYWA 3KYMA 1P6FA 3QIBD 4KJPC 4POYA 3BEVB 1X6NA 1EX0A 2NXYD 3OAUH 5CEZD 4Y19E 1PKQB 5BRZA 2QBWA 1QQDA 3AGVA 5F88A 4HH8A 3ZT5A 2NX5D 3DVGA 3GSWB 4LHUD 4JPKL 4XMKL 4IRZH 1P7QB 1QFOA 2DBJA 3QIUA 4GW5A 4HWEL 3LD8C 2WINA 5T3XL 3ET9F 5EOTA 2DLHA 4LHUG 5CD5D 3D3VD 4MDJB 1EO5A 1GIGL 4M1DH 2DQGL 1TTFA 3O11A 3NA9L 3UTTE 2X4TA 3U48A 2ZUXA 3GSRA 4X6BA 3KJ6L 3KLAA 4M62L 1N2RA 3PWJA 3QZWG 5HHVH 3RTQC 2A6JA 1JHLH 1BQHB 2V6HA 4WV1C 4YHOL 4GXVL 3IDYB 4U1JB 4P0DA 2GKIA 4PJHA 3U46A 3QDMB 1I3RA 1T0MB 4Y2DA 2CKBL 2IADB 4ELMF 1LEKA 4G8GD 4NGHL 3SDXF 3HB3C 5D96C 3ARWA 5F9WB 4LPYA 3L3KA 2BNUA 3P30H 4MXVF 3BWUC 4L29B 5IJVA 2Z0BA 1OM3H 5F1SA 1RULH 4RFEB 5IWLC 2GAZB 4XCCH 3HI5H 1N5YL 5J1SC 1DBKL 2XZQL 3VRIB 4LVEA 5EUKA 2GTZA 4ZNCD 4WEBL 5BJTA 1GOHA 2K9UA 3CUPB 1OPGH 5D5MB 3AVEA 4KJQD 3VWJC 3QP3A 1FCCA 4NQCD 4QYOA 5FDWB 3MGTB 5EN2A 1QYGH 2J4WH 5I8EB 1C08B 2P49B 1N4XL 1D5BA 1ADQH 4G9FD 3ZTNH 1SVCP 2DJ4A 3LHPH 5D1ZD 2DIBA 2JJWA 1AKJA 3I3DA 4N5UA 5C0FA 5K9JL 1JGDB 2Q6WB 3QWOB 3K2UH 3LRSA 1HILA 1YEHL 4XBPA 2XKNA 4RAUA 3WFDL 3WHXB 5GGRB 1YC7A 1JPGA 4N0UA 1QBLL 4UAOB 3B9DA 2IEPA 2NY2B 3G6AA 4FN0A 4J8RB 1CYGA 5TGBA 4GH7B 4JZJA 2B5IB 5F3HB 2X4PB 2IQAA 2FHBA 2J88H 3D87B 3OWEA 2VAAB 4PJGE 3FB8B 4OJFL 5I74B 3UTQA 3M1BB 2VLKB 2FJHA 5DVMA 3SKOB 2ATKB 3VWKA 1X5JA 4E41A 4OLWH 4YJZL 1P4BH 3T8XA 5JXEA 1R5VB 5CEXA 4ZG1A 1TFHA 3JTTA 3PGDB 1S3KH 3BYTA 2A6IA 5F71A 2V5RA 1RZJH 2LVEA 5H37H 2WP3T 1PX4A 1T0NA 2JELL 4LLDB 4QRPE 4YDVB 2JJTC 3KPOB 4NN5B 1R3IH 4JRWA 1OT2A 5I1JH 3LVEA 5D8JL 1KV3A 3I85A 4X80H 3ARXA 1HYSC 2F5AL 1E4KC 2KH2B 3SDYH 1UWGL 3WNMA 1BLNB 2EC9U 4TULH 1H3GA 3RWHB 4P5TA 5BZWB 3TO4B 4KK8D 4OGAD 5CEYA 3NN8A 3VRJA 4PJIB 5IJKC 1A64A 3MZTA 1NCWL 3P9LB 1MRDL 3GMRA 2FX8L 4CVZA 5CBEB 1UACL 4XTRC 2OM5A 3SDAA 5I1EL 2WZPD 4P2OD 1NGXB 4DGVH 4X6EB 3RZCB 5BCAA 1N64H 3N1FC 4PRIA 3UTSB 2JJUA 4CUCA 2XFXB 5DRNA 3BX7C 5ETUB 3KPLA 5IK3B 5HDQH 5FAAA 2ID5A 2W9EH 4O58H 2VABB 3OXSB 1GGIL 4UINH 4KUCD 4POZD 2SEBA 5CWSA 4Z76B 2HG5A 1HN1A 1IBGL 1QRNA 4U31A 4LPXA 4IHOB 3NCEB 1EUUA 3OHXB 1T21B 3EYSL 3O4OC 4KK6C 5B39G 5DMIH 5IEKA 3B6SB 5F7MC 2C4FT 2XIDA 2CRIA 3QUKB 2I26N 3RVXD 1LK2B 3JV0A 2H3NA 1JYVA 4U1HA 1FPTL 2DQJL 1EHLL 3OPZH 5I9QB 3WNOA 4RFNC 1ACYL 2PYED 4G9DA 3CH8A 5CJXC 3GIZH 3MV9A 1G6RA 4GRWF 3TA3A 3F7YB 1V05A 2X6MA 1YYLH 1CF8L 3BYYA 2LVCA 1HSBA 4B5EA 5ISZA 2XRAL 1J7VR 2HMID 1RK1B 4PP2A 4KHXL 1BBDL 3CH1A 2EKSB 3L3GA 5HI4D 4UTAH 2C26A 2FIRT 5C08D 2K3TA 2UV3A 3EHBC 3TJEL 3WN5B 1BVKB 4PJ7E 5HPOA 4ZNEA 1I9IH 1F90H 4R3SA 4PP1C 4JAMA 4O2FA 4MA8L 2IANE 3V0WL 3AU1B 3BHBB 3M45A 1TDQA 3FRPG 3NCYP 1WISA 5HD8C 1AO7D 4FZ8L 4XXDA 1VACB 1L6XA 2WIIA 3HPLA 4MNHB 1BZQK 4QOKD 1E4WL 1OGAE 3AM8A 1XGQB 1T66D 4XMPL 4OCNC 1JPFA 1D9KD 4TTDC 4Y5VB 5AD0A 3W82A 3GSUB 3VGHA 1DQQA 4Y4FB 3WYRA 2P5EE 3TVMA 2GK0B 1TZIA 1ZVSB 3PV7A 1ED3A 4HUUB 5DI8B 4WWKC 3TBWA 2KKQA 4Z7QE 5JDSA 5C6PB 2OL3A 2RB8A 2VDNL 5FUCE 2A1WL 3NIGE 1RURH 4IRSA 3ZKMD 1WZ1H 3SCMD 4UUJB 3RZWA 2W60A 1CFTA 2IMNA 2CUMA 1MI5E 4PJGB 1HHKB 1RZKL 2Q1EA 5DJ2A 3OGOE 2F53D 2VDML 1BF8A 1DANU 4AH2B 2ICWB 3VXTB 1ZS8A 1IEHA 4CVWA 4WFGD 3LEVH 3HI1A 2BSSA 3LMJL 3B4NA 4HUMB 3X3FL 3SQOH 4UOJA 4Y7MA 4JO1L 2LAGB 4ZXBD 3I3EA 3QT2A 2V7NB 5HHOA 1YJDL 3NAAL 1TJHH 2APVA 3FFDB 2W9DL 1NH6A 1RHHA 4ZFOL 4H8WH 4ZMAT 4H20H 1U95A 1ZSDB 3KPQB 1NC2D 3O9WC 1T1XB 2VDPL 1NFKA 4IRJB 3QR2A 4JFOB 3G5XB 3PGCA 2A83A 2BNQD 5DJ8B 1Z9SA 2DQDL 1K8IA 4WU5B 3E3QE 3UCRA 3BKJH 2VWEE 3FN9A 3CX5J 1IZKA 4JY4B 5CGTA 3TCXA 1XGPA 4I9WD 4NQTA 4TUKL 3ZDYF 5D7SH 3QDGB 5DEGB 3BZFA 5CLWA 5E9DE 4PJ8A 3DGCR 3PQYA 2QADC 5EZLA 3H9YA 5I16B 5T1LB 2J8UF 2A9MH 3VXRB 5B8CC 4FQIL 5CEZL 5D1QD 1QSFA 4PJEE 1IAOB 1HZHH 4TSCH 4JRYA 3V5HA 1PQZB 4OLZL 2E9BA 5JXAL 3SGJC 1S7UA 2NY5H 4KVNH 4W6XB 5IVXF 5C70A 5K9OB 3QCUH 5BMFH 1BREA 1U8MB 4PY7B 1YY8A 4NKDB 4G8FB 4CDHA 5CKAA 3JBG7 4RMSA 3A6CH 3DUUA 4GAJH 3GMPB 1T04B 4YAQB 3JWOC 3QUXB 3UMTA 3SJVB 4DUXA 1QVOB 3AUVA 3IFOB 2AJZB 1HK6A 4LRNL 1JVKA 4NJAL 2IBBA 1X5KA 1T22A 3CFCL 3FFCE 1CK0L 4XP5H 5GS0H 1EMTL 2R56L 5F9JB 2AXGA 1W8NA 3MRKB 4PGDB 4X7FC 1WBXB 3UEZA 2VWEC 4NRXB 3BP7A 5LGHH 1EEYB 3INUH 1JHTA 3ZT7A 3DXAB 2BSTB 3NFPB 1CLYH 4UT9H 1ZE3C 2P5WD 4K7PX 5FK9A 5KSBA 5KN5A 4Z7VA 4AEIH 3QNYA 1NL0H 5I30H 4RMTA 5DMGD 3NFNA 5EU4B 3FAWA 3QCTH 5C0CD 5E4EB 4RX4A 1KCUL 4XAWL 4M1DL 4WI6A 1U8LB 1XF5A 4G6KH 4NQED 5DA4A 1DQMH 4PD4J 4UILL 5CHNB 4M9PA 1U2HA 5HHVL 1Y18A 1JHLL 1FCGA 1DVFD 1WGOA 5IG7A 4D0BB 2EEDA 4Z6AT 5AUMA 1R3JB 5GS0D 2I24N 5FO7A 4YHMH 3DX7B 4L8SA 2OR9H 1PD6A 5EU6D 2PXYA 1G0YR 4K23H 5EBWA 3C6LA 4X99A 5D6CA 1QEWB 5ESAA 4HJGA 3OBAA 4KROC 1OAXL 2D7MA 4UQ3A 3W0WA 5C0BD 3EOBA 3KPNA 4L8DA 3UBXG 3P30L 4OF5A 3ZL4H 5L7XL 1F3RB 4JEGB 1OM3L 2EXWC 3DSNA 2P5EB 1RULL 4JZOA 5DS8B 1IM3A 4RWHA 4ODSH 3FQNA 2Y06H 3NZHH 3BRGC 4XCCL 3HI5L 4PTTB 2M1KA 4YHIB 3EO1A 5KSUB 3L3OA 5DQJA 3C9NB 3BOVA 1GSMA 3WEXA 1OPGL 5C0IB 3BZEA 3RDTB 3TEUA 5SWSB 1MCHA 2EH7H 4P9HC 3IKCB 1MI5B 1QYGL 4JREB 4OCYH 5DQDH 3AB0B 3ZTNL 4XCFH 2ENSA 1ZT1B 3TBVA 3MOAH 4FQLH 4AENB 4FFZH 2FHCA 1GZQA 2YSSB 3K2UL 4UBDC 2Q8BH 1G7LB 3A6BH 3PP3H 1E4XH 5HDBE 5EUOA 4HHAB 1ES0A 5KS9F 1CN4A 1HHIB 5C07A 5E8NA 4Y4HB 3FRUA 1J86A 1LO4L 2PN5A 4H1LH 4ZODA 2J88L 2LV4A 3VXUD 3MLYH 5E6IC 1W72H 1GHFH 4X6DE 4OQTA 1A7QL 2A77H 3V6OE 3EOAA 3CZJA 4OLWL 3O4LD 3P4LA 1P4BL 5IMLA 2AEWA 4JFXA 4V1DE 1C5CH 1KNOB 1MCEA 3HR6A 2NY6C 1DDHA 1XIWA 3BPCA 3U6RA 1RZJL 2P43B 3LEXA 5DFWH 1JGUH 3GI9H 3CPLB 3NACL 4EDXB 5SX4I 1D5MA 1KT2A 1AHWA 4ZD3H 1YZZA 3DJ9A 3MBEB 1F4HA 2NLJB 2O5ZH 3ESUF 1IC5L 4YIQB 1R3IL 1NPUA 1B0GB 3VFVA 1OAUH 3EYQC 2EDOA 2BOCA 5I1JL 3BVNA 1VSCA 4PJEB 5MEQB 3D25A 4X80L 1SJXA 4PG2C 3SQBA 4H1LG 2BNRD 4QTIL 4X7EC 5LXGH 1UADC 3SDYL 1YN7B 4J7RA 1SEBB 1F6LL 4TULL 2R9HD 5EULV 4U1KA 2Q3ZA 2C7UB 1EA9C 3FKUS 3HG1A 1DLFH 5LWYH 1U93A 2QLVB 5TE6H 1G7MA 1F4YL 3QJFA 4U1NB 1TNMA 3N9GH 4HX1A 1M7XA 4XBGB 3AY4A 5E5RB 1JK8B 5EU3A 2VXSH 3LQAL 5D9SB 4DGVL 3T3PF 1MUJB 3TP4A 4LSRL 1QO3B 3BGMA 1F2XK 3FFCB 3HI6H 3LIZH 3DNKA 5HDQL 1S9YB 4JGMA 3LKRA 2IAMB 4UINL 4X9HA 2YWYA 2NY1B 4HAFA 1W0WB 1FORL 2NTFB 1FNGB 3BXNA 3G5YB 3OAYH 5JOPD 2I9LA 1IILE 1FO0A 1N5AB 4JFHE 1MWAH 4U3XA 4YH6A 5DMIL 1FFPB 1X4YA 5CZKA 1F58H 4KMTL 1JV5A 4YHKL 5BRZD 3CVHB 1A14H 3ARFC 2B1HH 3CSGA 1E6JH 4GQ9H 2UY7A 3OPZL 4EI5B 4I0PC 2DQCL 1B3JA 4DCQA 4HLZH 5JO5A 4UT7L 1OSZB 3FJTA 4XNMA 3GIZL 4U3CA 2DQIH 4IJ3B 3WDHA 4PJBE 2WUBH 2H45A 5DLMH 4IMLB 3IFLL 2C3VB 1M71B 5TH2B 5EZIL 1ORQA 4CBPA 2RFXB 1I4FB 2CR3A 1WIPA 1ETZB 4UTAL 3QA3A 3I02A 2XA3A 1S7SB 5ERWB 1I9IL 1F90L 3O6MH 3LKQA 4ODXB 4NQXB 1QZ1A 2YPKB 2CIIA 3H3BC 2R4SH 5I76A 2JJSC 1IAIM 2BVEA 3MBXL 1IEBA 2ZG2A 2BHUA 4O2EA 4Y2DD 3F6IA 3DRQB 5C3LD 4JANB 1JN6A 5BS0B 4TUJA 1WK0A 3L5XL 2CIKB 4LLWB 5J12C 3LKOA 3MLSH 3E1F1 5D1XC 4JM2F 3E6FA 1ZA3B 3OXRA 1VGKA 3FT2B 1I7ZA 3HAEB 4EN3B 2H32H 1H8NA 4YBQC 2HTKC 5TE4L 4Q9RH 3C09C 2GI7A 1XGRA 5E5MA 1WZ1L 3NZ8A 3QUYC 3F7VB 3LY6A 3RTQA 2K7PA 4WV1A 1BVLA 1AKJD 5CP7B 5HHNB 1JF1A 1A22B 5BQ7B 3WJLC 5IW1B 3VFRB 4AIOA 2E6PA 4PY8J 3FONA 4J3TA 5F6IC 3LEVL 4NQSB 2XTJE 3FQRB 1P5UA 1YY9C 3DYPA 2V5SA 4WTZG 3BESR 3U9PL 4R7NB 4MA3A 3JV4B 4FFVC 5IWLA 2UYLB 4GFTB 3WSQH 4JN2A 2OSLB 4ZSOA 1XF4A 4GW1B 2R1XB 1A3QA 2CDEB 4H8WL 2ZJSH 4H20L 2EO1A 2I27N 2KBGA 5DEFA 3VWKD 1T7VA 5I66A 2EDYA 5HGHB 4R0LB 4ZUUB 3VWJA 3GB7A 3KPSE 4E41D 2ED9A 2R39A 4K7PY 4LP4A 4M7JH 5JXED 3QO1A 4YDKH 3QRFM 4GKNA 5ICYA 4Y19A 3V4PL 1BQSA 9CGTA 1U8JB 5I8OH 2FB4L 1CFNA 4G5ZH 4OLUL 3MJ9A 3AXLB 3MO1A 4IBLT 4CMMA 1FVDB 1LO5B 3OQ3B 2X7LA 2BERA 5AZEH 1MSPA 5D7SL 4X6CF 2YD2A 3U30B 5A1AA 1MCWW 3RPKA 5IM7A 2GTWA 3ARGB 4NZRH 4D9LH 2VXVL 3RY5A 3UTTA 4U6TA 5MEPA 1IL1A 1S9XA 4UU9B 4XCNA 2A74A 5F7DB 3GKWL 1FGNH 2R0KH 4PJ9B 3R0MA 5JA9A 4KI5C 4LSQH 1HZHL 2OS7A 3RPIA 4C56E 3FB7B 5ADOH 3TFKD 4G7VH 1RFDH 3UYOD 4P5TD 4KPHH 4XP4H 4K8RC 1J12A 4TNVF 1ZGLB 3J7HA 1QSEB 2XTJC 1P69B 3MACH 3PHOB 3G5VB 4KVNL 1ZLUK 5C09B 4LLUB 5BMFL 2EE3A 2Q86A 5JHDE 4NBYB 1CICB 5DO2C 5LCVL 4LCUA 2Y5EA 4YNYA 2CMRL 4FZEL 3A6CL 4OD3L 3SDAD 4GAJL 2ICWJ 4PRID 5IB5A 1IFHH 2X1OA 3WIFB 2JJTA 3O41A 1NLBL 4ENED 2DMBA 4GBXC 3T4YB 5F9DC 4YX2H 4U1GC 1JZ3A 4Y5YC 4XP5L 4DOHE 4M5YH 2R1WB 4HWUA 5GS0L 4ONHA 1QRND 1A3RH 1G9ML 3SDDB 3R8QA 5EO0B 4PGBA 1JWUB 3INUL 4R96A 1NDMA 3DRTB 3V7AE 1CLYL 3RL2B 1KB5B 4UT9L 2IFFH 5I30L 5CD3B 3MNZB 2V9TA 3REVA 4S1RH 2LQRA 4S1DC 3BJLA 3QCTL 3DLQR 4UIKL 2J7LA 5IJKA 2DM4A 4DKFL 1FNSH 1YNKH 1CG9A 4B7IA 1IGCH 1MY5A 4O5LH 5DD1H 3SDXE 3MV9D 3DTXA 5F9OH 4M7LH 4MAYC 3TA3D 2EYTA 4MXVE 5HPMB 5FYKD 5F89B 3JTSA 4K23L 4FQ1H 2FZ3A 2YD7A 4LSDA 4AH2A 3QQ4B 3L7FA 5IMKB 3X11A 1I1YA 1R6VA 5E8PB 2E3VA 3GMLA 4P2RB 5SWZE 5HGAA 3WUWA 3ZL4L 4M8QA 12E8H 5IB3A 4AY0A 5I1HH 1TETH 2PW2A 3NZHL 4QRPA 3KNBB 2FEEI 1JZ7A 5DT1L 4ZO8A 4Z77A 4TRPH 4N0CD 3IETA 4OIBA 4DZBA 2EH7L 3FO9B 3KR3L 4OCYL 1JNNH 4QXGH 2JIXB 3HMWH 4XCFL 1C8PA 2QQNH 2ZUWA 1AGCB 3MOAL 5CJXA 4FQCL 3TVMD 1CDBA 2I60H 4FFZL 3HCVA 2NY4C 2CLRA 1CFBA 1OB1B 4LLYA 1FFQA 3IXTA 2D2OA 3C2AH 2Q8BL 1RJZA 3ROLA 3OZ9H 4BSWB 2KZWA 4XNZB 4NNYA 1E4XL 5LKNA 1HCVA 5L2JB 3WD5L 4C4KO 5MI0B 4IRSD 3L7EB 3G6JA 1T1ZB 1KN2L 3L3HB 4K71C 3KS0J 3OX8B 2VXUH 5T1MB 5B4MD 4HKJA 3S36L 5JOEA 1KTRL 5DQ9A 2Z91B 2GY7B 2VIRA 3MLYL 2PTTB 2FO4A 3DX6A 3KPSB 1AE6H 4OZHF 3NCCB 4ONFH 5J1AB 2AI0L 1JHKL 5KOMC 1A4JA 2A77L 2WNGA 1P4IH 3ARVA 4MCYA 5KSAB 3UPCA 4Z7WF 3C8DA 2DD8H 2MNUA 2XT1B 5HHOD 3HZKB 1SJHB 1X6LA 4C59B 1VKXB 1X5HA 1YQ2A 1JGUL 3GI9L 1WZMA 2O26U 4WWKA 2JK5B 3MCKB 2DWDB 4W68A 1JWSA 1A4KB 3TCLA 1EZVY 4ZD3L 4Z0XA 2FHFA 5FECA 3ZKXC 2O5ZL 3IFOA 1MOEA 3ZYJA 1B90A 3WS3A 4J6RH 2HJKA 3ZSTA 5ENWA 1OAUL 5BVPH 4YPGA 4FTVB 4APQC 5CIPH 1A6TA 4PBXA 1N6UA 1O7SA 2A38A 3CSYA 4QRUA 3UJIH 4ZPVB 1Z9OA 4CU7A 3UAJD 5LXGL 2AJVL 3IGAA 4FA8A 4PJ8D 1IGYA 5ANME 1LGVA 2BDNH 3PQYD 1EJOH 4PJAA 1DLFL 5EC1A 1J1PL 3SGEI 1KG0A 4V2CB 2B7DT 2BVQA 1CD1B 1MQ8A 1INQA 2R4RH 5EU7E 2QKIA 2VQTA 3O8XB 3S4SG 4PJ7A 4XHJC 1QSFD 4BQ9A 2PCPB 4PJHF 3GSNA 2IANA 1DN0B 4JRYD 4BH7B 5I1AB 3LS5H 4UV4H 4M03A 3O9WA 3KDMB 2FYYB 4X8JA 3HI6L 4ZPTB 3B9KD 5IESH 2X44D 1HKFA 5GRUH 3MGOB 2NPLX 1OGAA 5KG9A 1NCDL 3I6LE 4ODWB 4Q74A 3QIWB 1LO0L 2X41A 4GUPA 2ATPA 2BVTA 1K5NB 4UV7H 4QO1A 2I25N 3ZTJH 1TTGA 1KLGA 2PETA 1JPSL 1MCFA 1EAJA 4PRNA 3PWVB 3SKJH 1F58L 1K3ZA 1QLRB 4M93B 1A14L 3ULUH 1G7IB 2B1HL 4GRWE 5JR1L 3WHE1 1E6JL 4GQ9L 3ZKND 1IJ9A 2C4XA 4Y4KB 1SMAA 4ELMB 3PXHA 4X4MA 1Z0NA 3KPRB 3IFPA 1OWWA 3GMOB 4NQUA 4GOSA 4HIHA 2DQIL 3D0LB 4LQFH 3TZVC 5DLML 3SGJA 4PJ5E 4LSTL 1BZ7B 2G2RA 1Q0YL 4RX4D 3C08H 3PJSA 2FH6A 5B3NA 3RRQA 1MHEB 1R3KA 3BPLB 3BZ4B 5T5NG 3U36A 5CJOL 3LKSB 3KHQA 4E5XB 3QEQE 5DMKA 5GJTL 3IB4A 2PXYD 3CFKB 3QXAA 3PWUB 3ULUD 3C6LD 4NKMB 3S3SA 3B9VA 4JGJA 5HYEA 4PJDB 1CFQB 2ZG1A 3L95B 3TPUA 2YK1H 3W0WD 1TCRA 4LGPB 2NY3B 5M94B 4XXCC 1UB5A 3VFMA 4XX1G 3MV7E 1UEMA 3I84A 1PG7H 1C16B 4XPAL 3ES6A 3MLSL 4JQXC 2CO7B 2R0ZL 5C0AA 4PS4H 3OKEA 1J0ZA 3CVIH 3T0EB 3D0VB 2IH1A 4JFPA 5DHVA 2UWEF 5BV7B 3QPQC 1TENA 2VZ3A 4D0CA 2GJJA 5E9DA 2GJ6E 4WIQA 4Q9RL 4BQBA 3RIAK 1H15A 4NN6C 1H5BB 4OQTH 1HHGB 2WANA 3PL6B 2OZ4A 3I6GB 4NWTH 3IVKA 3IDJB 2NXZD 4NQVB 3BIAX 3MRHB 2R0LH 4LHQB 1UWXH 1SYSB 1A6UH 1OL0A 2DTSA 1CZ8H 5GZOD 2AEQH 3WE6A 1EHXA 2N1KA 3RI5F 1VFBA 1I7RA 3OAZK 5CZVH 1INEH 3MUHL 5DJ0A 1KB9K 3WFEH 5CINH 4F7CA 5C07D 1UG9A 3IJHB 2FR4A 4ODTH 25C8L 1SY6A 3RVVC 4OKDA 2X4RA 3SKNB 4GXUM 1GZPA 3N0PB 4OZ4A 2VLME 2C1OA 1UQSB 5GGSB 4Q0XL 1MAML 5GJSH 4M7JL 4LPCA 2HT2D 3D3VE 4QY8B 1T20B 2NY0C 1XIWD 2PO6D 1OQXA 5TDPA 2ICEB 4LEOB 3LEYH 5L88L 3QAZB 4XH2B 4F58H 4X7CC 4OCWH 5DJCA 2G5BA 1UENA 3KYKL 2ZSVA 5ANMB 2J8UE 3ARDB 2FO1A 1SVZA 4XGZA 4RISH 4NKIH 3MLWL 1U8HA 4PG9B 3E6HB 2YRZA 4NZRL 3U7WH 3NCYS 4DGIH 4KXZH 3BE1H 4QT5B 3IU3A 1DBAH 1P84K 6FABH 4MB5A 4WW2C 5IQ7L 1CE6B 1KENH 2HFEB 2VE6B 4P3CH 2R0KL 2CUHA 1LVEA 2VH5H 5GS1C 5IVXE 4HJ0C 5E6IA 5EZOH 3V0VA 4CJ1A 4XZUB 3ILPA 4UTBH 4G7VL 4I18C 2X10A 2D7OA 4WW1A 1RFDL 2ZUQC 2YN5A 3MRIA 3KYNA 4PGZA 4KPHL 4XP4L 3HG1D 4IMLA 1X5FA 3MACL 4AK1A 1BQUA 1DE4A 1MFBH 3VG0H 1A7RH 2Q3AA 4M6OL 4OV5B 4RNRA 4BYHA 3BP4A 1I9JH 2FIKA 3RWIA 5C9JB 4Y16B 2CXGA 5KZCD 1JCKA 3ULSB 1IFHL 4M8VA 1U8IB 1ZHKB 4KRPB 4YC2C 1U42A 1VENA 2YUWA 1OP5K 5LVEA 2FH8A 2P7TA 3HNTH 4MWFB 1G6RL 3QDMD 2BY1A 4DZ8A 3DROB 2GT9B 4M5YL 4ELKA 2ADJA 2VAJA 5FYKL 1ZT7A 3QH3A 5E7BA 1A3RL 3HZVB 2DQUH 3WKMH 4PREA 2M26A 4NHUB 4P3WA 4PG2A 1KTDA 4U6HA 4WEMB 1KTKE 2IFFL 5H2BB 5DYOB 4PJ5B 3VXPA 4S1RL 4TVPD 2QHLA 4JJ5A 4L8CA 3B9EA 3BO8B 2Z31C 1T4KA 1YEDB 3S5LA 1WZLA 1NJ9A 3JUZA 4J3OC 1WAAA 4U33A 2DM2A 1AC0A 3FTGA 5FHAH 4GKZB 2C1PB 4ZAKB 3QEQB 4J1UA 2HN7A 4NM8H 2IBGA 5DD1L 5F9OL 4M7LL 4F57H 1QA9A 4X6DA 1UVQB 2G75B 2HLFC 4PLJD 4P3DB 1FL5A 3C87A 3OR6A 4XAKE 1Y6MR 4JKMA 2OL3L 1T2XA 4V1DA 4ZFOB 2YUZA 1Q9KA 5DEZA 1T5WA 3MRMA 5GISH 5C0DB 3Q6FB 12E8L 2NY2D 1FVEA 1PLGH 3T2PA 1HE7A 4LLMB 4R6UA 4F9LC 5HHMD 2CJUH 2P48B 4FABH 2X70B 4NP4H 2AJYH 3BN9C 4QTHB 1FZJA 3U82B 2AQ1A 1XR9A 2BP3A 3VGGA 2EE2A 3LRGA 4DEPC 1JTPA 3CDYA 3HLAA 3P9MB 4JM4H 5HVFB 3QEHA 1S78C 1WWAX 5C1MB 3ARFA 1NEZA 4F7PB 1N0XH 4KTYA 4P9ML 3B5GA 1FFOB 4FG6D 4NNXA 1OGTA 1LNUB 1JNNL 4I0PA 4LDOB 3HMWL 2XICA 5F8RC 5KS9E 3WIIL 4X98B 4JVWA 5FHBH 3K3QA 3C2AL 1F45A 1KELH 3MXWL 5BVJA 3QIBB 3OZ9L 1ZVYA 3OR7B 4LIQH 1EGJH 4PRHA 4S1QH 5FIEA 4KKCC 1KYOJ 1JNHB 4PRBA 2NXYB 3JV5A 2GITA 4P59H 5EORL 3IDXL 3RTQD 4MD5B 2NX5B 4B0MM 3C8KA 1WFTA 3PNWB 1F3JA 3NABL 5SV3A 4LHUB 1MJ7H 1OP3H 2B2XH 5GIRA 3CFBA 2VKXA 1ORSB 3REWB 1FL3B 2GSGB 1FSKC 3CFDA 1J05B 3EUUA 4LVHB 4ZUTB 2FBJH 2JJSA 3QZWB 4ONFL 2CDFA 4JGUA 3D3VB 3HB3D 1YMHA 1P4IL 1A6ZB 3TO4D 5F3BA 2HT3C 3EO0B 4NO2A 4JG0H 2DD8L 1J8HA 2J5LC 2X4NA 4XBEH 2OI9B 4KV5E 2EECA 3MRGB 1HINH 1T7WA 2J8UB 5ALBH 3X13A 1EEQA 4HQQH 2CRMA 3RWCB 1BOGB 3TN0B 2DKSA 3X12B 5HVHC 1EEZB 4I2XB 3VWJD 4XB8A 3MA7B 2HWZH 4N1EA 3HZMA 4Y19D 4TOYH 4G8GB 4HPYL 4R7DB 5CGYC 3QUYA 3VFPB 2Z92B 3IYLW 1Z5LB 4MX7A 4Z7VF 3OJMB 3F5WB 4L3EE 5EPMB 3WJLA 3WFHA 4OF8A 2FNBA 4QRSB 3MRDB 5T5NF 1U58B 4PJBA 5DJYB 3ALWA 2VNCA 3Q5TA 1AGDB 4I3SH 5CS7A 4AT6A 2Y36L 4YFEA 4WNQA 4HZLB 1K8DA 1AO7E 3UTTD 5C0NC 3K2MC 3CFEB 1TZGL 4NC1C 4R4FH 2A9NL 1BZ9B 2VN4A 4LSPL 1KACB 4G9FB 1BJ1J 4JFFA 5D1ZB 3BEWA 4UIMB 1NGQL 1XGUA 2Y5TB 4QHNB 4Z78A 4U1SB 1ZTXH 4LCYB 5IESL 2CK0L 3DI3B 3GMMB 1OT1A 5GRUL 5IFAL 2WBKA 3MBEC 1CBVH 4ODUB 1QFUH 1JNJA 4KAQH 1KLFA 3UJJL 4OCLC 2UY6A 2XWTA 4KUZH 2AXHA 4WVRA 4UV7L 4D0DB 1MRFH 1BVZA 3ZYZA 3ARPA 1DBBL 2ITCB 5IKCA 5GGUB 1T83C 2VN7A 4HIEB 2K7QA 5JDJA 3SKJL 4DVRH 3DBXB 5JW4Q 3ULUL 3KLDA 4KK5C 4AEHH 1FG2B 1F02I 3GSOB 3IDMB 2XKSA 3U4BH 4LKXB 3HNSL 2X1XR 4OCXL 5M95B 2X9WA 3BQUC 1U3HB 5EA0L 5DMYA 2VO5A 3M8OL 4R97C 4LQFL 4NN7C 1QPPA 1UH4A 3R1GH 3V6ZA 3S96A 5L0QC 1S5IH 3O6LH 3MJ6A 3IDNA 3MCLL 4LRIC 1FV1B 3BI9X 2VQ1B 4XTRD 1IQWL 1YMME 3WLBB 1P1ZA 5FYJE 2VOTA 5JW4R 5DVOA 4EQ3A 4GBXA 4HIXH 3GSVA 5JORA 3UZEA 5E8OA 2GW5A 3EOYG 4I77L 2HJLA 5HI5C 4Y5YA 5JW4N 3BDXA 3CFJB 4E0RB 3UTPE 2XZZA 3LDBB 3LN4A 4LBEB 3K7UA 4EI6A 1YECH 2AERT 1PG7L 1UZ8B 1OW0C 5KS9B 4HUVB 1EEUA 4PS4L 3STLA 2HJFA 1BIIA 1ODAA 2NNAB 3HNVL 4QRPD 4KK6D 1RZGA 4ZUVA 1FZOA 3WUWG 2R23A 1LP9B 4P5KB 2XA8L 4Q7DA 3RWGA 4IJ3C 4F7EB 5I1GH 1DFBL 3FT4A 3T1FB 5C92A 4OQTL 3R8BB 4K94C 3MSPA 5IHZB 5B39B 1RJCA 4NWTL 1VCAA 1AXIB 2ZKHL 2ADGA 1ITCA 3C2SA 2Q87A 2ZPKH 2R0LL 3MRCB 1Q72H 1XZ0A 4MAYA 4P46C 5DTFA 4C56A 3Q6GL 2YXMA 1CZ8L 2QR0A 5JMRA 5DVKA 5SWQB 1JGEA 2AEQL 3OGCA 4OF3A 5A2KH 4QRQB 4R2GD 1NMCC 2H8PA 4I3GA 3OKMB 3CC5A 1INEL 4PRAA 3ARBB 4EUPA 3WFEL 2MHAB 4JDZA 2WIMA 5CINL 1AD9A 2F54E 4LCWE 3EHBD 4UOW1 1MFNA 1XCQB 4ODTL 1T3FB 5JHDA 3ROOB 5T1LD 1BEYH 4PP1D 1FRGH 3TBTA 2NW2B 1RJYA 1F00I 4J2XA 5F96H 5HD8D 2AGJL 2PCPA 4CNIA 3DO3A 3FB5B 2W1NA 3NH7H 5CMAA 3P77B 4XPHL 5KVEH 1DSFH 4ZUWA 2DTMH 3KS0H 4ERSL 1VADB 1GAFH 4X5WB 4MXWH 5K59E 4X6CE 5EWIH 4MQTB 1U8PB 4L3EB 2ERJB 2QSTA 3QWRA 5C08B 5J06A 1N6QH 3L5WB 2A2QT 2X4OA 4FMFA 4Y5XB 1AGBA 1MHCB 4WWKD 3G9AB 4JDVB 3ZE0F 2HLAB 5DJZA 3FQTB 3QI9C 4BFEA 4YDJB 1AO7B 3L9RB 3D2UB 5IHUH 3GIVA 3PABB 3R4DA 1X4ZA 3U7WL 4QOKB 1A5FH 4YHYC 4JDTL 3BRDA 3BE1L 1T5XA 2R8SL 1D9KB 1X5YA 1KENL 2EYSB 2AW2A 4DN3H 3S37H 2F58L 1N7ML 2WBWB 1GJIA 3S35L 3SDXA 2VH5L 3BJ91 3UDWC 4OUUA 1P7HL 3HZYB 4UTBL 3UPRA 3G6DH 4WUUE 3EJZD 2EDXA 3WXVH 2Z93B 5ACZB 4FQHB 43CAB 4KTDH 5JZ7C 3H9ZA 1S7TB 3ABZA 3SCMB 5SWZA 1MFBL 3VG0L 2H6PB 1A7RL 3M17B 4G3YL 5D2LF 3DUSA 4TVPL 2A6DA 3RNQA 1U3YA 1QG3A 1I9JL 5DSCA 3B3IB 2IAND 1GC1H 1KUMA 1N3NA 5F44A 3O9WD 1WLHA 5MP6H 1CXEA 1F11A 3DECA 1AP2B 3D48R 2OMBA 1NGWA 1TQBB 1OGAD 1P53A 4PRDA 4Z5RB 3H9HB 3JWDL 4APQA 4ZXBB 2LABA 4QRRE 3CX2A 3ISWA 1T2QH 4GKSA 2ZUVA 2DQUL 1HQRA 5CP3A 3LPFA 4QF1A 1NGZA 5JNYB 2D7NA 1D6VL 1JMXA 1NC2B 4DN4H 4LLQA 3G5ZB 1ZWIA 2QADD 4HV8A 5F1OB 4NBXB 1HXYA 2BNQB 5A2IH 5A2JH 3LKNA 3PV6A 1UXWA 4H0GA 4KKNA 5EU5A 2IPKB 4M9OA 1JWMB 5IVZA 4RAVA 5JW5A 4N1HB 1OARH 5FHAL 4MJ5A 3TT3H 2LE9A 2NYYC 2W0KA 4I3RH 4F57L 5D7JC 3MRRA 4AQ1B 4U6YB 2VLJE 1R3HB 2AV7A 3PWNB 2WWMC 4M1CD 3I75A 4CU8A 1QLEL 1AGFB 2YC1A 1Z3GH 3LPGA 4NT6A 3TIEB 5IFHH 4N90D 4MJ6B 1YA5A 1BJMA 5GISL 4GMSL 3MRNA 4LCCC 1PLGL 4MQ7B 5D1QB 4YEFA 4G43B 1E27A 1TNNA 3FN0H 2OZ4H 3QUMA 5F7WC 2AJYL 2DQFB 1BBJA 2H26B 1ND0B 2P42B 3TV3H 3MX0A 5E95B 4LGRB 3TWCH 1ZHLA 2VKWA 3PP4L 5E8EA 4JM4L 2YEZA 1F6FB 3LN5A 1N0XL 1MFAH 5CZXC 5E1AB 4RSVA 1KC5H 4KJWC 1LEIA 5IB2A 2ZSWB 1T89A 4MXQC 2P24B 5C0AD 1J5OH 4BQ6A 2HT4D 4FXGB 4XP1H 1SY6H 1DQTA 3TBSA 1A1NA 3TZVA 4ODVH 5FHBL 5E9DD 1KELL 4LKCA 4LIQL 2YR3A 5I1KH 3D69A 3AAZB 2VDLH 4GW4A 1A7PL 3O2VH 3CDGA 4F2MB 3G08A 4PV8A 4YGVB 4GRMA 1BFVH 5LQBH 1KBGH 1NGYA 4LU5H 4P9HH 1IGTA 4M6NH 2B2XL 3F6LA 5CLTA 4N8VA 1Q9WB 3H42H 4Z7WE 3H8NA 2OYPA 2FBJL 4RMQA 4KROD 1LMKA 4X6CB 8CGTA 2W0FA 3WMSA 3MREB 4XXCA 5C0CB 3WFZA 5GQBA 3T0AA 1R24B 5LAXB 4QLRA 4JG0L 4NQEB 5CJQH 3TH3T 4K3HA 1MIEH 4XBEL 1XH3B 4JQXA 1S9WB 3EYFA 4NZTH 3X17A 4FNLH 1DVFB 1HINL 5ALBL 3UBXB 4JPWH 5DRWA 1ZHNB 3CVHH 1URLA 3QQ3A 1U8NB 1WBYA 2YBRA 2X89A 4N9OB 5EU6B 1I8MB 5I1CL 1KIQB 2HWZL 3FFCD 1MVUB 5GRVL 3UC0H 1D3CA 5C0BB 1DP0A 3DO7A 4NDMB 3DETC 4L4VE 1PDKA 1UM5H 1MY7A 3WNLA 3H9SA 4A6YB 4G7YL 1HHHB 2D9QB 1B0RB 3WL9B 4M7ZC 4UBDD 3FCTB 2FD6L 4MCZA 2W38A 3MLUL 1JTOA 5D2NE 3ULVH 4ONGH 4I3SL 1JZ2A 2HRPH 3Q3GB 2VR5A 3L5IA 3VFTB 3P0YH 1L7IH 4WCYH 3ZT6A 2VISB 2O61B 1QFWH 2YKLH 4R4FL 3CXHK 1FG9C 5ID0B 4IOIB 3W2DL 4JG1H 4MJ2A 1XF3A 2PW1B 4PJCA 5FM8A 5E6ID 5IFJB 3SY0A 4KY1H 3ZE1F 1A21A 5FB8A 2BVOA 1ZTXL 4XCEA 4AG4H 4L3CB 2KQMA 4QRRB 3MROA 3OKOA 4JFEA 2XOTA 5ID1A 1CT8A 3BP6A 3MV7A 1RU9L 1ZA6B 3HAEH 1RZFH 1ZHBB 2NY6D 1CBVL 2AXFB 4HUXB 1HNFA 4CVXB 3T08A 3PIQB 3TLRA 1SM3H 4IS6A 4KUZL 4AYFA 3DV6A 1F42A 5C71A 1MRFL 3L3JB 3VXUB 1K6QH 4R4BB 3PP3K 5F7HA 2WV3A 2IG2H 5A2FA 1MLBB 2BZDA 4GS7B 1ZANH 2GJ6A 3O4LB 4JZNB 4I4WA 3TT1H 5AAMA 4WW2A 4PR5B 4WJ5A 4AEHL 4KXZI 1A6WH 2D0GA 3U4BL 3FOLB 4JHZA 4GG8A 1UJ3B 1ITBB 4IOSD 1LNUA 1MCJA 3IF1B 3T77B 5GS1A 2LFGA 2GCYB 1F4AA 4IOFC 1JBJA 1J1OL 4I18A 3G6JF 4XVTH 5IVOA 2HFFB 2FEDC 4DUWA 1YPZF 2I07A 1NC4A 5D2NC 2ICCA 5M7QA 5HJ3A 2E5EA 4E41E 2RHEA 2J6EA 1PYWB 1JFQL 3BGFB 4G8EB 4HIIA 4POUB 4OI9A 1RQ5A 2YWZA 5I8CA 4OKVA 5AG8A 5C2UB 1X5IA 1O0VA 4WTWA 5J13B 3HR5B 3PHQA 5SV4A 4FXKB 3IXAB 3S5LG 5AWNL 2BNRB 2HTLC 4HCRA 5K9QI 4HIXL 4LOUC 1ZT4B 2W0PA 4F37F 2BMKB 3O3AA 1SEQL 2DAVA 3BWAB 3GMNA 1T03H 3QRGH 1FFNB 5ITBL 1AQKH 4V1DD 2UWEE 4EEEA 4HF5H 4K9EC 2HKHL 4HGMA 3GGWA 2R29H 1CGSL 2IGFL 3MLXL 1XGYL 5FO8A 2IALB 1TPXB 1KLUA 4QGTA 3TIDA 4NO3B 2YD1A 4QHLB 2Y6SC 2YD6A 3EIFA 4D8PB 4R90L 1K4CB 2BHZA 2Z31A 3DARA 5DHYA 3ARFD 3HE6B 1YN6B 4OZHB 4P4RB 5I1GL 1CXHA 2AJ3B 1R5IA 1DQJB 3MLZH 3QULB 3RU8L 4F33B 1LQSR 2IQ9H 4NCDA 3MUGB 1WSST 1FYTA 4I0PD 5E99H 1JF6A 3QEUB 5I0DA 3BH8B 4Z7WB 2ZPKL 5GGQH 5IVXA 1Z9LA 4RMRA 1NEZG 2XQYG 2UZIH 4Y1AA 5J9PB 3VFUA 3KYMB 1I8IA 4PJAF 3QEGH 4PRIE 2VSDA 4CW1A 2QHRH 4PRHD 3LB6C 5C2BL 3KVQA 1I8KA 1T6WA 5BRZB 1QQDB 5F88B 3BGAA 3DVGB 2DI7A 1B2WL 1EVTC 1BEYL 2NY3C 3OJ2C 3OAYK 4C54A 4F9LA 4PTUA 1QRNE 4YUEL 4ZOEA 4I5BA 4HJJH 3ECBA 3EDFA 3QIUB 5F96L 4KZDL 4OV6F 3GSQA 2CXKA 4GW5B 3ZDXF 2WINB 5EOTB 2AS5M 5IMOA 4CU6A 1WBZA 2AVGA 3ORJA 3NH7L 4H5SA 5I75B 5KVEL 1DSFL 2DTML 1GAFL 3O11B 4MXWL 1A7OH 3RWEA 1KB5H 2X4TB 1J8HD 3GSRB 4X6BB 5EWIL 1M05A 1JUFA 3KLAB 4RMVA 1N2RB 3PWJB 2A6JB 4HSQA 1NUNB 5EC2A 4FP8H 3ILQD 3RJDA 1VFAA 1X5XA 1XMWA 2G9HA 4YBQD 1I1CA 1G6VK 4JFHD 1G7QA 3OKDA 3MV9E 2PKDA 5I17A 2WBJC 3RGHA 4XWOC 4PJHB 3U46B 1I3RB 2ZCLH 1C5BL 3GSNL 4Y2DB 1LK3H 1LEKB 5FYKE 5ISZE 1OAZL 1A5FL 4MB4A 1FH5L 3L3KB 2AKRA 2BNUB 5IJVB 2VERN 3I50H 4H0IA 3WUZA 2MKWA 4OGZA 3GK8L 5ILTH 5EOCJ 3RVWC 3QG6A 5EUKB 2GTZB 5BJTB 3LS4H 1CDYA 2XWBA 1PFCA 3G6DL 3KPPA 5ICZA 4S0SD 4F15C 3WXVL 5EBGA 1YY9D 4QYOB 4JPIA 4PUBH 2R1YA 5EN2B 5MHSE 3ME0A 4HK3J 3VG9B 2LTQB 4KVCH 5I1LA 2KZ1B 3BP5A 4HBCH 1AKJB 5C0FB 1FJ1A 1GC1L 3LRSB 3T2NL 1HILB 3R06A 4XBPB 2XKNB 4PY8I 5FXCH 1VB9A 2VQUA 3V2AR 3QAZC 4X4YA 5MP6L 7FABL 1JPGB 3CZFA 3FZUC 4N0UB 4E9LA 2JTDA 1BJ1H 2Y7QA 3DVNA 1IZJA 1NBYA 3RNKA 5CAYB 3G6AB 5J89A 4BFGA 1T2QL 5TGBB 1TVHA 1UYWL 4JZJB 2C5DC 2IQAB 5CJ8A 3T0WA 3UTQB 2RIKA 2FJHB 2E6JA 3UZQA 4DN4L 1EFXA 1HH6A 2EDBA 3VWKB 2VXQL 3NIDE 4JKPH 4E41B 1RAMA 4TSAL 3T8XB 5CEXB 5KOVC 3JTTB 5F6HJ 2A6IB 3EGSA 3W11D 1O5DT 1W8OA 4KI5D 3STBA 4ZUSA 2ADIA 2B1AL 4HFUH 3O45A 1T0NB 3TT3L 5IQ9A 4I3RL 3VGEA 3WIHH 1CQKA 1I85C 4K8RD 5LBSH 3RP1A 1A0QH 2XTJD 1FLRL 2NR6C 4OF6A 4OIIL 1KOAA 1Z3GL 3C5JA 5DO2D 5IFHL 4BQ8A 4I13B 3D85A 4MNQA 3LQZA 4PJXF 3O3DA 4MA7H 2X09A 1GGYA 3FN0L 2OZ4L 1T83A 1Q38A 2AQ3A 3STZA 3TV3L 3B2UD 4M02A 2FSEA 2DRUA 15C8H 3P9WB 4KWUA 3TWCL 4P5TB 5CEYB 3NN8B 3VRJB 4YR6A 1KCRL 1J1XL 3GMRB 5KSAD 5IVNA 4CVZB 3RIFK 4G8IA 3NA9H 1KC5L 1RZKC 3KJ6H 1NMAL 4M62H 3SDAB 1J5OL 2D0HA 4L3EA 2ICWI 3BQUA 4GG6E 4GXVH 1K9TA 4PRIB 4XP1L 5GZND 1SY6L 4Y0GA 4GRLC 4X4XA 4Z0BH 4ZAKC 3DURA 4ODVL 5HHXH 5DRNB 5I2IA 5LG1A 3KPLB 2AJXL 2PUQT 2Q7YA 4RQQA 1Z9MA 3OG4B 2VDLL 4MVBC 4E42A 2SEBB 3D2UA 5CWSB 3AS1A 2HG5B 1QRNB 1D5IL 5LQBL 4NC0B 4P9HL 2X5PA 3O2DA 5FM4A 2JE8A 5DZOA 4M6NL 4MAYD 5IB1A 3O3EA 4C56D 3H42L 1A7BA 1NDGA 1DBKH 2VUYA 5L9DH 5HHPA 3CIQA 3GNML 5IEKB 5C0EA 1M7IA 3FO1A 3KYAA 2H3NB 2VZVA 3ARUA 4WU7A 4LVOC 2EYRA 4U1HB 1ZMYA 5JHDD 1OW0A 4OI7A 3CFIC 3QDAA 4Z9KB 4NFBA 4FNLL 4G9DB 3MV9B 4GJTB 4JPWL 1G6RB 3CVHL 1W0VA 3TA3B 1PSKH 4XNQA 4HKBA 2MQCA 1HSBB 4Z7VE 4JHWL 5ISZB 3H3KA 4PP2B 1U36A 5FGCB 2ZCHL 5DURD 3CH1B 3L3GB 5I1IL 3BD5A 3QWRD 1QBLH 5ABDE 1YEKH 2NXYC 1FNEA 3ARTA 2FX9H 1UM5L 3QIWD 1XF1A 4Q6IC 3IAQA 4R3SB 2NY4D 4JAMB 4O2FB 2QV2A 4P46A 4QGYA 3D6GA 1DEDA 4M7LT 1OD9A 4ONGL 4XXDB 1WAAF 2HRPL 1SBBA 2WIIB 3HPLB 1K4DA 3P0YL 3V7AG 1CR9L 1F4XH 1JPFB 1QFWL 5AD0B 3W0WE 1V3KA 4W70A 1FIGH 4JG1L 4X6DF 1YMMA 1DQQB 3BD3A 3VCLA 1SMOA 3TVMB 2GSIA 1TZIB 2OI9C 4KRLB 1ED3B 4KY1L 1I1AC 3TBWB 5JDSB 2OL3B 2R2CA 2CH8A 1WWBX 4AG4L 1G0XA 4JM2A 2ED8A 4IRSB 3SE9H 4RZCA 5SWZD 2W60B 5BV7H 3JVGC 4DVBA 1CFTB 4D9QE 5KANI 3CGTA 5B22A 1BFTA 3U7YL 5DJ2B 4KDWA 1K6QL 2F5AH 1GL4B 5D71H 3QI9A 4HGWA 2Z35A 5GSRA 1ZS8B 5D7IA 3HI1B 2BSSB 2X4QA 4ZFGH 1ZANL 3MRJA 1P2CA 4APQD 4JFQA 3U0WH 5HHOB 1CDGA 1I3UA 3BRFA 4GAYA 2DWEA 1A6WL 1NCWH 2FX8H 3UDWA 4XI5C 1KN4H 1RHHB 1S9KC 1U95B 3W39A 5IEHA 3GMQA 4XVTL 3CD4A 4DWHA 2ZNXA 1UWEH 3DMMC 4XWGL 4Y88A 4OLXL 2J8OA 1BX2A 3PGCB 5JIPA 2A83B 1NBZA 1K8IB 4XPTH 5HI3C 3OKLA 1NFDF 4FFWC 2F54A 4LCWA 3C5ZC 1NAMA 4U4BA 4XHJD 5F7EH 3QNXA 4OM1H 3CSPA 4WI4A 4DJMA 2NW3A 2LU4A 1XGPB 3RHWK 3GM0A 3BZFB 2OJZH 3L6FA 4ZFZA 1S7VA 5EZJA 2F19H 1DN2A 4Y8AA 4PJ8B 1JZ6A 3PQYB 3BN3B 4XRCA 1T03L 2AJSH 5CBAA 5EZLB 3QRGL 1T1YA 1SJVA 1AQKL 5T33H 4WHDA 1S7WA 5JLZA 1R5WA 5BOPA 3VFNA 3HMXA 2DQJH 5KVGL 2PTUA 2R29L 1QSFB 4DKEH 1T1WA 4K7FA 1ACYH 1JNLH 4JRYB 4G42A 5F1KC 3V5HB 3BISA 4HG4J 1T6VN 1Q94A 3CX5K 5IBLC 5JIKA 1H8OA 1CF8H 1S7UB 3RWJA 4V2BA 2XRAH 2XG4A 1TQCC 1AGEA 3MLZL 1VA9A 2MCG1 1YY8B 2UUDH 5E99L 4KHXH 1BBDH 4PJBF 3DUUB 2YRLA 5D4QA 3SKMA 1S7XA 4HS8L 5D7JA 2UZIL 4DUVA 1S5HA 3SO3C 3O3BA 4QXTA 1WFUA 4WUUA 2EZ0D 2R15A 1A3LL 1EAPA 1T22B 4NPYA 1K85A 4FZ8H 4NC2B 3MFFA 3PXJA 2AXGB 4KK9D 1YC8A 3WLWC 5C0RH 4LCCA 2IF7A 3BP7B 2ILLA 2IPTH 1JHTB 5L2KE 4I0KA 4XB7A 4GRWH 2OX5A 5FK9B 5KN5B 5KSBB 4Z7VB 3QNYB 2VXTH 2Z8RA 1IEAA 4P2OC 3NFNB 2A0LD 2ARJA 2VDNH 3CLEL 1F13A 4N8VG 5E03A 1UC6A 2A1WH 5F7FA 1YNTA 1A7OL 1XF5B 1KB5L 3I6LD 3ZE0E 2F8VA 3EOTL 4LNRA 1Y18B 1P4LA 5IG7B 3KJ4C 4FP8L 3E2HB 4HWBA 3QPQD 5AUMB 2EDQA 1JGVL 5FO7B 3ZHLA 5FGBC 2X89D 4L8SB 2PXYB 1UKTA 3L3JA 5E94A 4HKXA 5EBWB 3C6LB 4X99B 5D6CB 2ZCLL 5ESAB 4HJGB 1CDJA 1RUQL 4UQ3B 1LK3L 4OT1H 4J23A 4MLSA 3W0WB 3WKNA 1WEJH 3EOBB 3KPNB 3LMJH 4L8DB 4UNTA 4KI5F 1Z0MA 2MJWA 3UP1A 3I50L 3D1MC 4JO1H 4L4TA 4M3KB 4OZIA 8FABA 4JB9H 4JZOB 4MHHG 1IM3B 2DLEA 3FQNB 1YJDH 5ILTL 4HPOL 2F15A 3ARYA 3EO1B 3L3OB 3HE7C 3LS4L 5DQJB 5HHME 5I0ZA 3GHEH 1PG7X 1A9EA 2VLJA 5D2LE 4DW2H 3WEXB 3C5SA 1FYHB 3BZEB 1J0KA 3K1DA 2VDPH 1CD8A 3C60C 3T09A 3NPSC 1TIUA 3RVUC 3S88L 2HMIC 4HS6A 4HBCL 2WQRA 2NXZB 3TBVB 4ZFFA 5J8OA 1GZQB 4KH2A 4WO4C 4KKAD 4RGMB 4TUKH 4YQXH 3H2WA 2EH8H 3U2SA 1Q9OA 3AS0A 5EUOB 3MC0A 4TNWK 1A9BA 2WWKT 1ES0B 3M07A 4JFED 2BVUA 2Z4QA 2NY0D 3MV7D 5FA4A 5DA0B 5I6XB 5C07B 5E8NB 3GDBA 1OTUC 3FRUB 2H9GA 3CJJA 4K8RL 2COQA 4HXAH 1UWXK 5FKAA 1UCTA 4FQIH 5IV2A 2PR4L 5HYIA 4JKPL 2GJ6D 3EOAB 4MA1C 4KMQA 2FL5A 5C0GA 2R2BA 5IMLB 4JFXB 4OD2A 4M6AA 3EDEA 1DDHB 1XIWB 3BPCB 5I15L 3U6RB 1QFWI 1Z2KA 4KU1A 4BUGA 3ZKMC 3LEXB 4HJ0D 1QBAA 1ACZA 1DJSA 2X9XA 1D5MB 4ZSOE 1KT2B 3RX8A 2P8LA 1AHWB 1NC4D 4HMEA 5LBSL 1A0QL 4LRNH 1HXMA 3VFVB 1MHHA 4NJAH 4QRTA 2BOCB 3VJ6A 3CFCH 3OKNA 1CK0H 3QXDA 5E56A 3BVNB 5C6TL 1EMTH 2R56H 3C6SA 3D25B 1VFMA 4F9PA 2FLRT 5EIVA 4FQXC 5DK2A 3ZYIA 4ZXBC 4MA7L 1INDH 2EDKA 5D93C 5B38A 3QXTA 3UZVB 2HP4A 3ARRA 2VLMD 3ETBF 2A73A 15C8L 1M7DA 4U1KB 4XP6L 4Q58C 5DMJB 4YHPA 2DICA 3HG1B 1U93B 2V7HA 1G7MB 1KCUH 4XAWH 3QJFB 3V5DA 4HX1B 4L4VA 5ESVA 4UILH 3VXME 4HLJA 5EU3B 3VGDA 1YYMH 5KZCB 4JKWA 1PVHA 3TNMA 4Z0BL 3BGMB 3G9VA 5HHXL 2CKBA 5DJ6A 3TN0D 5D2NA 1PY4A 2Z31D 4U6XA 4D9RE 3LKRB 3QG7H 2OCFD 5TDNA 1OAXH 1FYTD 3BPNC 5L2KB 2HRLA 4M7KH 2IH3A 4WGVB 4OBRA 3LQMA 5L7XH 3MR9A 3IU4H 4EXPX 3BXNB 4H8WC 2I9LB 4UNVA 1FO0B 2HLFD 1LWRA 1QKZH 5L9DL 5IR1A 3QXUA 1WUNT 3KXFE 3RVTC 1JV5B 5HYJA 2BRRH 1IVLA 3FMGH 4CDGC 1CLOL 5HHQA 4NOBA 4DCQB 5I19H 4X9BA 5JO5B 3QJHA 1C5DA 2E8ZA 4XNMB 5FUZH 3MUJA 4EBQH 1IC1A 1PSKL 4EVNA 2CLVA 2HA1A 1ORQB 5DFVD 5E5UB 1MRCL 1OP9A 1MQKL 1GYAA 3QA3B 1J0IA 3I02B 1CXKA 1G9NC 5HY9A 3VH8A 1KEMH 1YEKL 4QEGA 2FX9L 3AREC 5H94A 3RL1A 5FUOH 3LKQB 4S2SA 5HHMB 1LO4H 4LAQL 1MF2L 2CIIB 3SE8H 1KXVC 4P2QA 5I76B 4WY7H 1AXSA 4L9LA 1IEBB 4O2EB 4XCYA 4KKCD 5TPWH 4MLIA 3EFDH 5FFLA 4OAWA 2NY5C 1BFOA 4OI8A 1A7QH 1WIUA 4YK4C 1JN6B 3EDKA 1F4XL 3ZE1E 2V9RA 4TUJB 5DMGC 4Z95H 3LKOB 1FIGL 4N0FA 2EDHA 1TXKA 2OTUA 3WFCH 4NZJA 3IJSA 2UVFA 5BOZG 1OOAA 3E6FB 3OXRB 1VGKB 2FECI 4NZUL 1I7ZB 1QBMH 4XP9L 3LD8B 3NACH 4HK3N 3RFZC 1DVFC 1U3HD 3HN3A 2A6KA 2D7QA 2E7MA 4XAKD 2Z8WC 3WNKA 2RGSA 1XGRB 5CSZA 1I3GL 5E5MB 3SE9L 4IM8A 1IC5H 4OLYH 3NZ8B 2UWEA 5EOCH 3RTQB 5BV7L 2ESVA 4QHKJ 4WV1B 1BVLB 1JF1B 3GRWA 4ACPA 1KIPA 3OJDA 3LV3A 2WK2A 2CD0A 1HH9A 4LDLB 5D71L 3FONB 2WBJA 4QTIH 4MYWB 1NLDH 4ZFGL 5D96B 5CGYD 5FOJA 1AR1C 3U0WL 1OP3K 3G6JE 4ZTPL 4MA3B 1UXSA 2D7TL 1YPZE 1F4YH 4JN2B 4ZSOB 1XF4B 3FQWA 3PWPE 1KN4L 3GHBL 2QJDA 3LRHA 4YZFF 1HKLH 5E08H 4OBSA 3LQAH 5DEFB 1EFXD 5KVMC 3DIFA 5I66B 1F6AA 1TITA 1IKNA 1UWEL 4JVPA 5TQ0L 3VWJB 3GB7B 4LSRH 3WO3B 1B6DA 3QO1B 1AIFA 5C0ND 4GKNB 5ICYB 4Y19B 2R2HA 1LEGA 1IM9A 4P48A 4YEEA 3TPKA 1CE1L 1CFNB 4XPTL 3MO1B 4QCIA 3O6FC 4YFLF 4CMMB 5IUSA 4RCAA 4EXKA 5F7EL 5TDOA 4OM1L 2X7LB 1IGJA 3DV4A 4OM0H 1FORH 3UTOA 2MMXA 2OJZL 4NKOA 1I9EA 2F19L 4AJ0A 4QWWC 5IM7B 2GTWB 2NZ9D 3SGKC 5JHLL 2AJSL 5T33L 3UTTB 3VRLF 4IDJL 4KMTH 5MEPB 1IL1B 1S9XB 3ARBD 3D85D 4YHKH 2D4DA 5EBLA 4XCNB 2A74B 1FP5A 3VA6A 3JZ7A 4UZGA 4DKEL 5CJ5A 4Q2ZA 2DQCH 4C83A 3RPIB 1JNLL 4UT7H 2FLBT 3LKPA 3O2DH 2F74A 4B50A 4EOWH 5IIEA 1RZIA 1BJ8A 4JCLA 3IFLH 4KK5D 5EZIH 1KJ2A 2VLLA 1TVBA 1U92A 4L8BA 2Q86B 4PJAE 4LCUB 4YNYB 5E8DL 1RY7B 4L3ED 5HDOA 3BQUD 5DUMH 2NCMA 5IB5B 4ZYKA 3SDCC 3O41B 1I85A 4ISVA 1I75A 4F7MA 1S8DA 3BIKA 4TPRH 4N0YH 5DD5H 1DLHA 3MBXH 3MRBA 5C86A 3D2UD 4PJCF 4ONHB 4MZ2A 2EXYC 1S9VA 3ZDXE 5I1DA 5C0RL 3S9DB 1WTLA 3L5XH 1ZK9A 2IPTL 4PGBB 5AZ2H 1HEZA 3ZSSA 4R96B 1NKRA 1NDMB 4P5MA 5I71B 4C57C 1RIHH 2VXTL 1NCBH 3VXQA 3T0XA 5HI5D 3REVB 1NQBA 4HS3A 4PLOB 4EKXA 5HVWA 4JO4H 5TE4H 2V2XA 3MRLA 3WS6C 1CQYA 4OFIA 1OAQL 1BWWA 2Y07H 1CG9B 2YHGA 3MNVA 4B41A 2QSQA 4X4ME 3DTXB 1JPTL 3DX9A 4GRLA 2EYTB 2BSED 1EO7A 3JTSB 4WW2F 2YUXA 4IIQC 2FZ3B 3IS0X 4M43H 2B39A 5FYJH 3L7FB 5EOQL 4OT1L 3X11B 1I1YB 1WEJL 4JFZH 3GMLB 4FQJL 1QR1A 1G7PA 3G04A 5HGAB 4G6MH 4HDIA 3WUWB 3N1MC 4M8QB 1Y0LA 5F21B 4OZFA 3QDHA 4JB9L 4N90E 3U9PH 5IB3B 1ZAGA 3HUJA 2PW2B 2FJGA 4P46D 5BW7C 2JB6A 4QRPB 3O4OB 5EO9A 2CLZA 1WCBA 3GHEL 1MAJA 4DW2L 4Z77B 1W2KT 1KJVA 1MFEH 3IETB 1MJ8H 3D9AL 3QUZC 1Q0XH 4DZBB 5GRZA 3PHSA 3U1SH 3VXSA 4OF0A 1SYVA 2B20A 4MD4A 4OFVA 3ARZA 3V4PH 1TTUA 1KCVH 1NBVH 2FB4H 4RFNB 4OLUH 2YD9A 1YMMD 1KTLA 3WO4C 5FYJD 3HCVB 4PIRF 1B6UA 3OV6A 2CLRB 5C0AE 4LLYB 3IXTB 1RJZB 3ROLB 3S34H 2X4UA 2EH8L 4YQXL 1A02N 4NNYB 1EXUA 2VZOA 4JM2D 4R2GB 4P23C 3UTPD 1TMCB 5F1NA 3G6JB 4XNUL 1V8HA 4Z7OF 4Y2DC 1D5ZA 3VI3F 2VXVH 2O5YL 4OZGE 4HXAL 3L1OH 5J0BA 4Q6IA 4HKJB 1XAUA 3GKWH 5DQ9B 4GG6A 2ZUYA 2VIRB 3QI9D 2FO4B 3DX6B 3K4DA 4NO5A 1A4JB 2YPLE 1YQVL 3OF6A 4HCRL 4MCYB 5JW4M 2R2EA 4KKLC 5GGRY 5CKGA 4NRYA 1ZVHA 4O00A 1KULA 5LCVH 4HBQA 2LTQC 3QBTB 2CMRH 2DKMA 2XWJA 4FZEH 4OD3H 4WWKB 1I1AA 5EIIB 4UDUA 1JWSB 3TCLB 4Z0XB 4PJXE 5FECB 1NLBH 2VJXA 3TBYA 3P2TA 1ZLSH 3WS3B 2HJKB 3HRZA 5ENWB 2F54D 4LCWD 3DGGA 2DF3A 4YPGB 2DQTH 1YDPA 4NCC1 1A6TB 3MRQA 3N1QC 4BM7A 3CSYB 4QRUB 1KPUA 1G9MH 2RCSH 3TH4T 1EBPA 3EO9L 1INDL 4P2CG 32C2A 3IGAB 1IGYB 3FO2A 3S37X 1GOFA 3LPWA 2DYPA 4A6YH 3HPJA 4X5LA 2E8YA 4PJAB 4R8WH 5EC1B 1KG0B 2BVQB 4UIKH 4DFHA 1INQB 1MCKA 4NQCA 1H3TA 2QKIB 4DKFH 2PYFA 4PJ7B 2Q8AL 1F97A 3HS0A 3GSNB 2IANB 1YYML 3O9WB 1YEJL 3GUTA 3DMMA 4X8JB 1NMBH 3L3IA 1H3XA 5C8JA 1V7NL 3HC0A 1OGAB 3QG7L 5J6HA 5KG9B 2BCKA 3F65A 3C5ZA 4CJ0A 4LVNB 3ARQA 4M7KL 4GUPB 2ATPB 1C12A 3IU4L 2NYYD 1KLGB 5D7JD 5IW6A 2B8OT 3DX8A 4RIRA 4RFOH 4WUUD 2V5MA 1QKZL 1J0YA 4PRNB 2QADB 1VGEH 3TFKC 5T5FL 5FV2A 5DT1H 3D39E 1WZKA 2BRRL 4YDIL 1XF2A 3U0PA 1ADQA 4OB5H 3T0BA 3FMGL 1UCBH 4M5ZH 4AIZA 3VE0A 4Z7UE 3IFPB 3KR3H 5J6GA 5I19L 3FO0H 3U83A 4NRZA 2CSPA 3AFLA 1LE9A 4HIHB 5FUZL 4FQCH 2H2PC 4EBQL 4PV9A 2F9BT 4QHMA 4FRWA 2G2RB 3WNPA 3PJSB 5CZXD 1CU4H 3WD5H 4QRRD 3MNWA 4JVUA 2GEEA 4KJWD 4YBLC 2BJMH 1KN2H 3IJYA 3O2WH 4MXQD 5J11C 1KEML 1WAAE 3ALPA 1R3KB 1TJIH 5FUOL 2EDLA 3U36B 2PTVA 5DMKB 2XI9A 3S36H 3QQ9C 3NPZB 3SE8L 3QXAB 2VB5A 2RJMA 3RWFA 4WY7L 4HWZA 4PPTA 5ACLA 5TPWL 3EFDL 3TPUB 4JO3L 2AI0H 1JHKH 1EVUA 3MV11 1TCRB 1UB5B 3VFMB 2MSPA 2QTEA 3LH2L 4L4TD 5FOBA 3VD7A 4Z95L 2C3GA 4X8XA 3ES6B 3WFCL 3VMOA 3BDYL 3JXAA 5C0AB 3OKEB 1ZEAH 5DHXB 4WUKH 5DJAA 2DDQH 2IH1B 4JFPB 4MGXA 1QBML 5DHVB 3RX5A 5ESQA 4X0KA 5F1IA 4D0CB 2VLJD 4YDLC 3K8LA 5E9DB 4P2OA 4L9DA 3TA3C 1H15B 4KV5F 4PRPE 2GJZA 1DQDH 3T65A 2MFNA 3KG5A 3K4AA 4OLYL 5DUBA 5EOCL 4MNGE 1HNGA 3QCVH 4M1GL 3IVKB 3S97C 3D5OF 4X7TA 4FQQA 5E2WH 3CCHA 5FGBA 2G60H 3KHOA 1Q8MA 3WE6B 1VFBB 1I7RB 4KROB 1NLDL 4R4ND 2AJVH 5DJ0B 3BAEH 4PRHE 4F7CB 1E4JA 4LLVA 2FR4B 35C8L 3DETD 3QSKB 2X4SA 1KJMA 1J1PH 4N0CC 5FM5O 4BSVA 4RGNC 3BW9A 2X4RB 1FL6A 3Q1SH 4MSWA 1GZPB 3K0WA 4YWGL 1KFAH 1IGFH 3HE7A 1NFDE 4ZQKA 1N59A 2BY0A 1HKLL 2PYEA 4OZ4B 4P4KC 5E08L 1ZKAA 2C1OB 4LARH 1QNZL 5DD0H 4D2NA 4ZS6C 3C60A 1ZXQA 2VL5A 5KW9L 3AMKA 1Q1JH 4NO0A 3HE6D 1R3LA 4RGOH 2APFA 3VXNA 1SJEA 1NCDH