4JFEE

Preservation of peptide specificity during tcr-mhc contact dominated affinity enhancement of a melanoma-specific tcr
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
245
structure length
245
Chain Sequence
b'MSQTIHQWPATLVQPVGSPLSLECTVEGTSNPNLYWYRQAAGRGPQLLFYWGPFGQISSEVPQNLSASRPQDRQFILSSKKLLLSDSGFYLCAWSETGLGMGGWQFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title T-cell receptor specificity maintained by altered thermodynamics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 49
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jfeE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jfeE01
5ETUA 1OF2A 1GSMA 2BDNH 4JZJA 5B3JF 4JKMA 5F9WC 2D31B 5D7LB 1WC7A 3WUZA 1FG9C 3DXAD 5HYSB 1FGVH 2Z31C 1U6AH 3RUGF 3NFNA 1QEWB 1I7UB 3RY6A 3ZYZA 1IC5H 1C5BH 2HRPH 5JW4Q 5TGBA 5DLMH 3NZHL 3LQZA 4KTDL 5EZIH 3QIWB 1DR9A 4HG4K 4OLZL 3ET9F 3G04A 4XPGH 1PG7L 5EBWA 5A16B 1U3HC 5DK3A 2EKSB 4F37F 1FZKA 3ARGB 43C9B 2DKSA 3ULUC 4KI5C 2BVOB 4K94C 4X0KB 1Y0LB 4MJIB 3WN5B 1FAIL 1PAMA 3BIKB 2VDOH 4WVRA 1U8LA 2XTJC 1UCBL 3SDAC 5FYKU 2HA1A 3KS0H 3VXTA 5KVFL 3PL6D 3HLAA 3MV7A 4KKNA 2NCMA 5FKPB 4OZGB 3KPPA 3VFOB 3G6JB 2YBRA 3OB0K 3GHBL 5CJQH 2P4AB 5GRUH 4X83A 4GRLC 1AO7B 3FONB 4OKVA 2ED8A 2R0WH 2YD7A 4JFFD 2IH1A 4JDTL 3RWFA 3BPOB 3IRPX 1ITBB 3MRBA 5IW1B 4WFGE 4XRCA 4BQ8A 4ETYA 2NY2C 3TYGH 3VGAC 2CJUL 2HLAA 4M7JH 3SKOA 3IDMB 3MRLB 2V5TA 3X12A 2QQKL 3J7HA 1B0GB 2PXYD 1H0DB 2AQ1A 2RAMA 5SWSA 4UDUA 3EAKA 1CK0L 3Q3GA 2IFGA 4G9DA 4LVNB 4NO0B 3RKDD 4YHYC 4XI5D 1C08B 4GW5B 1RZFH 1IEAB 1AFVL 2ADFH 4B41A 2FGWL 2N4IA 3V52H 1A7BA 3FB6B 1G9EA 4I77H 1D5IL 4JFFB 3S3PA 1AKJD 1L7IL 1IFHL 3SDDC 3VRIB 3UJTL 2DQJL 1X5ZA 1AHWC 4MDJB 1VPOL 4LSPH 5GRVK 1WWWX 1JNLH 4Y2DA 5KANI 1DBBL 3QUZB 1KJVB 4I48A 5ICZB 1I1FB 1T22A 1P4BH 4YPGA 2R2EA 4HK3J 1N6QL 4UTAH 4UNTA 3ALPA 3D87B 3EYSL 5BOZG 2FD6H 3TWCH 3DMMA 2EYSA 4XX1E 4TUJA 4U1HB 4RNRB 4JLRB 4JO4H 4KK6D 4GBXA 2VDPL 1OGAB 1ZVSA 1NGPL 5ADOL 3FT4A 2Q8BL 2DI7A 1Y6NR 2VLKA 3QEGH 2Z8WC 3GMQB 3D69B 4S1QL 5EULV 4M6OH 4L9LC 4JN2B 2OK0H 5JDSA 5F7MC 1LQSR 1QLEL 2FJGA 4KQ3H 3V5HB 3WKMH 2ENYA 1ZE3C 1NGYB 3T4YA 3N85L 1LO0L 5LBSL 1XF3B 4XTRC 5ETUB 1U8NB 3K46A 2DQUH 3MV7D 1NCBL 1EJOL 3ULVE 5CEZH 3QRFM 3BKCL 3GBLA 4N0UB 3MLPA 2ADGA 4AG4L 4U1KB 3Q5TA 4S1DD 4EI5C 4P46B 2J1KA 2Q86A 5TGBB 1EEQA 4RBPK 3OHXB 1P9MA 1XR8A 1IBGL 5DD5L 4BK5A 4TSAH 3HPJB 4RAUA 3G04B 3L5XL 3D85A 1G0XA 4X7DC 5J6HB 4HAFA 3WO3B 3SQOL 4BFEA 1FZKB 3RZCA 2F53E 3F8UB 4EDXA 5DUPL 4D8PA 3CUPB 4OFVA 5SWSD 1U8OA 4WI5A 1CGSH 3HLAB 1I1AA 2GY5A 1LK3L 2E7BA 3KPPB 3CU1A 5LG1A 5KN5B 5MEQA 3I6KA 4HK3N 2DDQH 1QNZH 4N1EA 5C0FB 3PWJB 2ICES 4CW1A 5DC0A 2XRAH 3U30C 2BJMH 4DUXA 3MRBB 5D2NE 4MMZC 3AMKA 1WZ1L 3DURA 1LO4L 2F54E 4Y2DD 1FL5B 3HZVB 3EO1A 3RL2A 1YC8A 3FHAA 1MRDL 4XGZA 1G1CA 4LSVH 4JDVB 3RWEB 1OAXL 3BRGC 4QRSB 3DMMD 3Q3GB 3VXSE 3DETD 1X5JA 5ALCL 3GO1L 4OIIH 5KVMC 4GBXD 1P69B 4M7LH 2ICWI 5DQDL 3VRLF 3NIFE 3Q5OA 4PJBF 4PJGE 1RURL 1ERNA 2VLKD 3TBTA 4AT6B 4PJFB 3O4LB 4GAYB 1CFQA 3EJJX 5C0BB 2AABL 4XCNA 1BZ7A 4LSQH 3D0VB 1TJIL 5EN2A 1H5BB 1BP3B 4Y2DB 1NPUA 4FQXA 3CZFA 1MPAH 3HC4H 3S36H 2V9QA 1BWWA 4EDWH 4HMCA 4YPGB 2R2EB 5C08A 3U0WL 1MRFL 2CUMA 3ARWA 1YYML 5J11C 5IEKA 1WJ3A 3NN8B 4CL7A 4JG1H 5JA9A 3DMMB 2EYSB 4MVBD 4MNHB 4CMHB 4MYWB 3DVFA 4K94H 5EU6A 1OQXA 1UWGL 4RWYL 3ULVL 4HKJB 1GJIA 1B2WL 5B4MC 2DM7A 2W1NA 1FFQA 2HFGL 1NUNB 2VDQL 5F1NA 2OTPA 5IMLA 5I1JL 1JUFA 3BD5A 4P3DB 3D85D 4YEEA 2W9EL 5K9QG 1LO3L 1PZUB 2G9HA 1BQUA 5IF0A 2OL3A 1YN7A 1FL3B 3RZCD 1VACA 4OBRA 4NBXB 1GZPA 5D2NA 3LD8B 3V4PL 4H1LB 1I1AD 3TT3L 2UV3A 5FHBL 5H37G 3MV11 2VE6A 5ID1B 4H5SB 2Y7QB 4CJ1A 2F54A 5E8NB 5TH2A 2MNUA 5EO1A 4H25B 2IQ9L 4D9RD 1BVKB 1EH9A 4WGWB 3R0NA 3HZMB 3AS0A 3FQTB 2Q6WB 1MWAB 3N50A 4ZS6C 2OL3L 5D7IE 3B6SA 4JHWL 2V9TA 5C07B 2FBJH 4OTXL 3VXSA 3TM6A 3VGDA 3WHE0 4UILL 3T2OA 4G7VL 2AGJL 4G80A 1TNNA 4HIHA 3GDBA 3MRIB 4PJGA 2NY0D 3GSQA 5DUMH 4XVSL 4BM7A 2QQLH 1TCRA 5FFLA 5GISH 1U8OB 5E6IC 1QSEE 3U4BL 1EEYA 3OKNB 1HH6A 5FM4A 1I1AB 1OTSD 4UV4L 2JKXA 3C5SB 5F7DA 3DPBA 5TQ2L 1F4AA 1TQBB 2OQJA 3TNNB 1IGML 1T0MA 4CN4A 4IDJH 2WIMA 1J0JA 1NCAH 3C09B 4Y4FB 5E00B 5DMKB 4RCAA 3ULVD 2KDGA 4CW1B 4NWUL 3U7WL 1NDGA 2E7CA 1G7IB 5A2FA 1PKQE 4OV6F 1VFBB 4I3SH 4G6MH 2DM2A 4JM4L 4WJ5B 2OR7A 3U9UB 3EO1B 4FQXD 4NZUH 5AZ2L 1CD1B 3B83A 3FRUB 5C08D 4ZODA 4NYLA 4TRPL 1F3DJ 1JPST 3WDJA 3GGWA 2AJYH 2YXFA 5T3ZE 4QCIB 2CK0L 3I6LD 5E8EA 1GXEA 1D5XA 4M00A 4ZUWB 5EU6D 3KJ6H 1D3CA 2YRPA 1JIBA 2GJ6E 3HHRB 5SX5H 3F7QA 4X7EC 2O26U 4OB5L 4P2RB 4Z78A 1CF8L 3TBTB 3GMNA 4MQSB 1WV7T 5ESAA 3PWLB 2YK1L 2AXGA 3RAJH 5JR1L 3WBDA 2X70B 3QULA 3FT3A 4LCWB 2F5BL 4XCNB 1DQML 4A2LA 2VN7A 1NAMA 5CBEB 4AEFA 2DQGH 5F70A 3ZDXF 3GNML 4FQXB 3MV8B 4F7PA 4FQJL 5I1EH 3KXFA 3MBXL 1YQ2A 4Y8DC 3V0AC 3BVNB 4HUNB 3DGCR 1QQDB 1SMOA 3DX6A 2F54D 1IE5A 4TSBH 1HCVA 3TC9A 1NANH 1BD2E 1CLOL 2X4QB 4ZUUB 4WHYG 5EZOL 1MCPL 4LLQA 1OARH 1QSEA 4MXWH 2R1WA 1UM5H 2NY6D 3VXSD 1NAML 4PP1D 5DEGB 4CUCA 4RFNB 3DVGA 3DBXA 4YHPB 3MRRB 2XQYK 4RFEA 4JKPL 1F45A 4MWFA 4KKBC 1VACB 4LDLB 5JPMA 3P9MA 2WLYA 2ZUTA 3K4DA 4WU7A 5JOPE 3QWRA 4N8VA 1PKQA 4LIQE 2VE6B 4PV8B 4Z77A 1OTTC 1UGNA 2DLFH 2DMBA 3GRWH 5IHUL 3CXDH 3GSUB 4G8IA 3ETBF 1Q8MA 4JO2H 1I4FA 4UBDD 2DICA 4KQ4H 1XGRA 1A5FH 1FNSL 3FB8A 3RWIA 4X4ZA 3H3KA 1V7MH 3EJYC 2FEEL 1IM9A 2ZG2A 1J1OL 3HR5A 3MLRH 2A6IA 1WCBA 3T8XB 4H26B 1MCOH 3LQAL 5DVOA 1Q94B 3V4VL 4DW2L 1TCRB 1NH6A 2UWEA 3PWNA 3DHMA 2YMXH 1H3GA 4L4TE 1UVQB 2J88L 3UJJL 3MLUH 3MV9E 5CCKH 1HH6B 4EOWH 4LLMA 1HQ4A 2EKJA 5J06A 3QH3A 1QPXA 2VXQL 3FFCE 5T3ZL 1F4XL 1JHLH 3TCLA 2CDFB 3BGAA 1V5JA 1M1SA 3C2AH 4BKLA 4OZFG 5CSZA 1U3YA 2HWZL 2DJUA 3BPNC 1CTOA 2DN7A 1NDGB 4JAMB 2AJZA 3ZKQD 4MQTB 3MROB 3QAZB 4MAYA 4GRWB 1PX3A 3P9WB 5D2LA 1T5XA 3WUWA 5HHOA 3KXFD 4M1DL 1YUHB 2KZWA 1J12A 1RZGB 4Y5VA 3E8UL 3CH1B 3TT1L 3OSKA 1IKFH 5IMKB 1I8LA 4K23H 4OLEA 5E8EB 5JUEH 4U3CA 3KDMB 3ULSA 2NYYD 3KPQB 3MFFA 1OAYH 2XQBH 1QSED 3RVXD 4C58B 3EGSB 1JGUH 2Z0BA 4U1IB 2EYTA 3BWAA 5F6HI 3C5ZC 2VL5B 5L6YL 2VZVA 2YR3A 3QDJE 1K8DA 5C6WH 1QZ1A 4M48L 4UOW0 3QNXB 1PY4A 4M1GL 3E0GA 5FOBA 2HTLC 1DN0B 3KXFB 1GGYA 4KJWD 4LEXL 4NJ9H 4HFWA 1U93A 3QWRD 4NJAH 4X80L 4R4FH 4DN3H 3DX7A 3VI3E 2BVUA 3KYOB 3O45A 1F11A 3NACH 5I1AA 3KLAB 4MCYB 1JCKA 5HI4D 1KCRH 4HUKB 4ONFL 5CD3A 3D25A 1SJEB 3CC5B 4ZTPH 4BA8A 4R3SA 5I1IH 5JIPA 2H9GA 3LN9A 4L4TA 5T3ZD 3MV9A 5B39A 4GXUN 2W07A 5KVDH 5B3NA 5BW7C 3DVGB 2H2SC 4LF3A 1IM9D 4RFEB 2VR5A 1CTNA 1N2RB 15C8H 4JPWL 3IFPB 4MWFB 1G9MH 1OAKH 3V6FA 2Z35A 5I66A 4LQFL 3VXQA 4GMTH 3FT2B 1MCDA 3GKWH 4JRXA 1B6DA 5IQ9A 4S11A 4XBPA 5E95B 1DUYA 5SWZE 2RCSH 3GFUA 2VNCA 2XXCB 4YDJA 4GAJL 5EB9A 2XOTA 3WMSA 5FYLE 1HHGA 1NCWH 3MZTA 4O9HL 1IAOA 1VHPA 3LKOA 4MAYD 4FFYL 5DO2D 3HNVH 4D94A 1YEFH 1DCLA 2A6IB 2DQFB 5HHOD 3VFUA 3BI9X 2QHRH 4MMXC 4NP4L 5DFWH 4OD1L 4PP2A 5DRWA 1F02I 2ZOLA 1IGFL 4AY0A 4Z6AT 3PWNB 1MJ8L 1A6UL 4CU6A 5C09E 4NHCH 4QRQA 2EDNA 1QRNB 5IJVB 4NHUA 1DL7L 4JRWA 3ZT5A 3QH3B 1U92B 2VIRA 5D6CB 3HRPA 1ZGLP 3OJ2C 1YEGL 4NBZB 3F7YB 5J3HD 5IVZA 3ULVF 4JFEE 3FO1B 1HINL 1KV3A 2AV1A 4YZFF 5CSZB 2AJXH 2WSKA 3L3DA 4JQIH 4JFDA 2ZCKH 1RZ7L 4MA7L 1L0XA 4I0PA 1UB5A 2AJZB 1A1MB 2CO6B 1KGCE 1VGEH 5DFVD 3PF2A 4A6YA 2Y36L 2EZ0C 5F3BB 2R39A 4RMSA 5D2LB 3MMEB 4P59L 2F74A 3HNTL 5D7JA 5HGGS 4G6JH 2VXUH 4WIQA 1QOKA 2O5YH 1F58L 1Q72H 4QHUA 1YY8A 2GTZB 1IGIL 4JPIB 4DVRL 3TN0A 4PBXA 5CSGA 3IU3A 3NGBB 3T0BA 4URTB 4FQQB 2P44B 2VDKH 1QUNA 4NQXB 1YDPA 5EG6C 3BN3B 3AU1B 3F5WA 3E6HB 5MENB 3ULSB 3T2NL 1T04A 5HGHA 4PRPE 4L4TD 1CFVH 3MV9D 1UKSA 2DJSA 4JFQA 2NW3B 4PJEE 4A6YL 4QYOA 2OTUA 3QIUB 4GAGL 5ECJE 1YNLH 3RWHB 3F12A 4G7YH 4GO6B 5SWZA 4I18B 5I73C 3G6DH 2DKMA 4D0BB 3AM8A 5LGJB 3IGAA 1L6ZA 4ELKB 4KKLD 4JRXD 4HBCL 3ARVA 5JHDB 4RZCA 1T2XA 2A73B 1JZ5A 3WNMA 2CGRL 4MAUH 3O3BB 1I1YB 4IDLA 1YC7A 5DK0A 3Q6GL 1A9EA 3BUYA 3HG1B 2DM3A 2XWBA 4FQ1L 1A6ZA 5FO7B 3D25B 2C3XA 4RGMC 5F7KC 2ESVE 3HE7B 5JQ6H 4Q6IA 1T83C 3TPUA 4FFZH 3SGKA 2HJFA 5GGVH 4PJGF 1RUMH 1A14H 2NW2B 3S6CA 3WN5C 1LP9E 5FYLL 4XXCC 4RAVA 1W8OA 1FO0A 3NCBB 3VXPB 4JFEA 3V6FB 2G60H 3HFML 5DD6A 2VH5L 5DC4B 1URLA 4JRXB 1SBSL 4PJXA 5IQ9B 5JXEC 5F88A 2G75B 2MWCA 1WK0A 3QRGL 3VGFA 1UM4H 2MCPH 1KIPB 4CADA 4TSCH 5TF1L 1BFOA 1M6OA 3RRQA 1HZHH 1SMAA 5F1IA 3BPOC 4XWGL 4H0IA 2R2CA 2N7BA 4HGMA 3WFBH 5GZND 4JFDD 1HHGB 4I0PD 5E7FA 1IAOB 3LKOB 4ETQA 4JCMA 3IJSA 2ZPKH 1ZAGA 5D7JD 4WUUB 4JN1H 5DRWB 4PP2B 1NMBH 1QR1A 3K81A 3TN0D 5F9OH 4P3WA 3STLA 43CAA 2R0ZH 2HKHL 4QRQB 3ZT7A 3FQNB 4X6DE 4FTVE 4NHUB 4KVNH 3OR7B 1CDCA 2CKBL 1LMKA 1T7ZA 1CDHA 3RA7L 4UT9H 3D6GA 5EFIB 4CVZA 1NUDA 5IVZB 3QUXA 3S34L 4LPYA 4X6CE 2I60H 2AV1B 3UTOA 3LHPH 1CLYL 5E5MB 3UDWC 1T2JA 4XP1H 4JFDB 3IKKA 1JWUB 4NZDA 1NFDB 4KZDH 1YNKH 5SWZD 1RFDH 5E8PB 4YXHL 4L3CA 1T89C 3DWTA 5ITFB 2O61A 5D7IF 1N4XL 2RHEA 3L3GA 4L29A 5FYLD 2N1KA 5BV7L 1I9IH 5EOCL 1JGEA 4ERSH 3W2DL 5EU4A 4I2XA 3UJIH 1IARB 2I07B 3IU3B 3UP1A 1DVFA 4QXWA 1G6RH 4HCRA 1A1OA 3MV01 5DJ6A 3ILPA 1FRGL 4P49A 3F5WB 2BOCA 2DQCH 4XMLH 3ZDYE 5HI3D 1AGEA 1T04B 3UPCA 4OGYL 4S2SA 4TNVK 2Z8SA 4KK5C 1JFQH 4JFQB 1T1XA 5C2BH 2Z92B 5F96L 3VFGH 5IGXH 2D9QB 5TE4L 2XYCA 4U1NB 1KPUA 4X4YB 5KJRH 4JFED 2IAMB 4LCCA 1FL6A 3P4OB 3GSNA 2V5MA 4LASL 1K8IB 3N1QC 5GIRA 4E42A 4HCRL 4YUEH 3AGVA 1OW0A 5CINL 4YPJA 4RZCB 4HKBA 4Y2OA 3WXWH 1RUQL 3HAEA 3HMXA 4DZ8B 1XIWC 4P46C 5SV4A 4XPHL 1TDQA 1RD6A 3BUYB 25C8H 1V3JA 1P2CA 3A67L 4X5WB 3BH8A 4PPTA 2GYSA 1DLFH 1AQDA 4JY4A 4EEEA 1I8KA 1G7MB 4NO2B 3VWJB 2H6PA 4IRJA 4DN4H 4X6DA 2XPGB 1T7YA 1AI1H 3GMRB 1JTPA 2NY5C 4MNGA 4P3CH 3GI9L 4KDTA 4IRZL 4RAVB 1K4CA 4LSSH 4Y7MA 1FO0B 1DDHB 1B88A 2UWEF 2X40A 3CSBA 4I5BA 3HMXL 5D70H 2B1AL 2FB4H 4OCXH 4XP6L 4DKFL 1CBVL 3GJFA 2ADJA 3O8XB 3KVQA 5F7HA 1R5IA 1CICB 4UUJB 2X4PA 1BFOB 1JPTH 1M6OB 3QUXD 4UDTA 3WHE1 1QSVA 2O5ZL 2FO1A 1MHHA 4ZFGL 2V6HA 1EERB 1NGXA 2BCKA 3NABH 1XCTA 4WWKB 2C1PA 2DQDH 1DBAL 3QDMA 1YN6A 2VXSH 4PGEB 4ZYKA 4R4ND 1J8HE 4NT6A 2EO1A 4X99B 3BW9A 1EFQA 3EO0B 5DURD 4W81A 1LE5B 1OGTB 4FXGB 3MLSL 3O2DA 3B3IA 3A6CL 1DVFD 3BN9C 5DK2A 2WW8A 2HMIC 3WFZA 4LLWB 3FTGB 3PP4L 4K3JH 4MGXA 5FGBA 4KROC 1WTLA 2YXMA 4XCCH 4X9BA 3WSQL 4CVZB 4JFZH 3QUXB 4KXZI 4NQDA 4GOSA 1J8KA 1YECL 1B90A 4GQPH 3QCVH 4RGND 1RHFA 3RBSA 2A2QT 2Y1VA 1H5BC 1AQKH 3JV4A 1F3RB 4NC1E 4M4RA 4YLQT 3BZDA 5DQ9A 1HYRC 4G9FA 4WHTB 3O2DL 1MJUH 3AUVA 1CGUA 4R26L 5DI8A 2VDLH 5IT2H 5BQ7B 3BKYH 4OLVH 4XNXH 3HE6B 5EU4B 1A7OH 3D48R 4I2XB 3TO4B 1ZGLM 4DGYH 1DVFB 4S1SH 5GRVL 5HY9A 4U2YA 4CMMB 5HTSA 4FQLL 1BECA 2GUOA 1VKXA 1YEIH 4GT7A 3RNQA 3WXVL 1JTTA 5EIVA 1A22B 4R2GC 5IFJA 5DGQA 1UEMA 1AGEB 5HHXH 2F5AH 1MREL 1YY9D 5I8CA 1EVTC 3OJDA 4IRJD 1T7VA 5FKAA 1MI5E 1SEBA 5C0JB 3KLHC 2FDBP 4FTVD 2HT3D 4RGNB 2BRQA 4D3CL 1CE6B 1WGOA 5DA4A 1T1YA 4OQTA 1KPUB 2VAAB 2JJUA 4RIRA 1QRKA 4PJ8C 1FL6B 5JNYA 3CX2A 3GSNB 1I9JL 4WI4A 5AUMB 5T3XD 3BT2H 5BVPL 3NOIA 5SX5K 4ZDHB 1VA9A 5A43C 1TMCB 1RIHL 1ZWIB 1IKNA 4QXGL 3HUJB 3DROB 5DDHB 2R2HA 4RQQA 5MHSE 3BH8B 5CMAA 1DJSA 5CHNB 4AEHH 2H6PB 5E99L 2V2XB 4OQTL 4YDLB 1K9TA 2PUQT 3AFLA 4QHNA 1A3QA 4Q9BA 2IJ0C 1PD6A 5EORL 4JFOB 1FDLL 4XX1G 3QDMD 2P8MA 4JKWA 4KV5E 5GJTL 2GI7A 1WFUA 4H8WC 3QHFH 2BVQA 4RA3A 4HXAH 4MHHG 1P7KA 2DQHH 3D5OF 1R5IB 4Z0BH 3DRTA 2HT4C 4LBEB 3Q0HA 4XC1L 1DBJL 2X4PB 4JKKA 3C09C 4Y4FC 4EN3B 5KS9E 4HT1H 4UDTB 3OXSB 5LVEA 4NQDD 3TVMA 3UTZA 4BH7A 3ECBB 3UPAA 3VI3F 3WEXA 1C8PA 2DWEB 2EH7H 2VLRE 1RHHA 3NH7L 5A1AA 2BCKB 2WNGA 3RVUC 5J9PA 4X4XA 3LOWA 4OLUH 5HD8D 4G9FD 5B8CA 3QDMB 2FJHB 2SEBB 1YN6B 1JGLH 1A3RL 1BAFL 4I3GA 3IT8D 2OP4H 3BW9B 1HK6A 3RKPA 3JVGC 1VESA 1VFOA 4KK8D 1QLFB 1F4YL 1QLRB 1KIRB 3RU8H 5HVWA 3B3IB 4P23C 2WIIA 2VLLA 5J1AA 5H94A 5DK2B 3BYYA 5DHYB 3C60A 2XI9A 1T0PB 3QO0B 4Y8AA 4TTDD 1NLBL 1ZT1B 1XGQA 5E08L 3ALXA 1YJDL 3TO2A 2H41A 3GMMB 1MIML 5AD0A 2Q8AL 6FABL 4LPCA 5IESH 4JJ5A 3BMWA 4IIQC 3FRPA 3SE8L 2ZCHH 2A9NL 5SV3A 3TP4A 3O3DB 5IFHL 5JZ7D 2CRYA 2C7UA 2YPLA 5F89A 5DQ9B 3V7AE 3OJVC 1DQJA 1KCKA 2QKIB 2G5BB 2HFFA 1KN2L 4M6ML 1FPTL 2YD6A 1C7TA 3PDDA 4R0LB 5IIEA 3KYKL 3MLWL 4OZHB 3IDJB 1XGPA 4PY8I 2VLJE 3V2AR 2IANA 1HHKA 3CCHB 2NY5H 1S3KH 5HVHB 4L4VB 4XZUB 4DOHE 5GS1B 3BP6B 1ZA6B 3ABZA 3EOBB 4YX2H 4UOW1 1BQSA 1OHQA 3F6LA 2FX9H 3WFDL 1Q0YL 5FKAB 1SEBB 3BWUC 3BEVA 1NC2A 4CVUA 3N1PC 4FRWA 3IDUA 3OKKA 2G5RA 5JW3L 5DD3L 5DWUL 4QT5B 4ZFZA 2UZYB 3KR3H 4RIRB 5JNYB 4JFXA 5ANMB 1KN4L 1BVZA 1G7PB 3BGMB 4GKSA 4PJXF 3V79C 2FL5A 3MJ7A 4KRPD 1S7TA 1A4KB 5BO1H 5IJKA 3MRQA 4MJ6A 1OSPH 4M5ZL 1F6FB 3DRQB 1UM6L 1I3UA 5DJ8A 5I30H 5CEXA 1NBZA 2R2HB 3TVMD 1MIEH 3SE9L 3BDYH 5KAQF 3QEQE 4TVPE 4HFUL 5CJ8A 5GS0L 4UV7L 4KZEH 2X4UA 4KRNA 2VAJA 1NFIA 2P8MB 1ACYH 5IB1A 3NA9L 1N0XL 4DKEL 3Q1SL 4O58H 2BVQB 2DLTA 5HDBE 4HC1L 5K9OA 4HJJH 4ZO9A 4LRIA 3S4SB 1BPVA 1NDMB 3MRJB 3C60D 1HXYA 3CSPA 5KANG 1AD9A 5JIIA 1LDSA 3BQUC 4AEEA 1FGNH 5C3LD 3QQ9C 3TVMB 1V7NL 2J8UB 3UTZB 1K4DB 1WZKA 2WP3T 5CEYA 3WEXB 4G42A 1FJ1A 2VLJA 4QTHA 3EOYG 3QAZC 3G5XB 3BMVA 1RZJL 3H9SA 3D9AL 1NKOA 2AV7B 2YPLD 1J88A 3DVIA 4NSKA 4XBGB 1Q9LB 1BQHG 3H6JA 4FQ2H 3VDAA 1GGCL 1UJTA 1NEZG 3RGVA 4GH7B 5KVEL 1BFVL 2IF7A 5JMOC 4ODWB 1W0VB 2ADIB 1FVDA 1HHIA 1KPRA 3IFLL 5MP6L 2IAND 4DAGL 1CIDA 1HHJB 2X7LA 5H94B 4IMLA 3EFDL 5FECA 3SGEH 1ZGLA 4J3OC 2OZ4A 5HYJB 3WNPA 4H1LH 3VXUA 2R56H 5CZVH 3HC0A 3HI5H 3TO2B 3L7EA 5AD0B 4HIJB 3MRHA 2APTA 1NC2D 5CIPA 3T4AA 2BSRB 1Z9SA 3RL1B 4IOIA 2NY1D 4ZPVB 3O6LH 1MWAH 2C7UB 1RK1B 5GS0D 5L8JB 4HUXB 4O00A 3RPIB 5D5MA 4LOUC 1KCVH 2HFFB 4XB8A 1KB9J 4YBQC 1VSCA 5FM5O 4ODUA 3OGCA 2OZ4L 1QBMH 1OCWH 2VITA 5GRYA 1EAPA 1HHKB 5T1DH 3MLYL 4GLRH 4N8VG 1R5WA 1U0QA 2R0LH 1JF1A 1TFHA 5IVXE 1YPZE 1G7JA 3FOMA 5EIIB 3OAUH 3H8NA 4X6DF 3OKEA 1YZZA 1JNJA 4NNPH 1EFXA 2JIXD 2B2XH 1KIUA 5LCVH 2Z93B 1WFNA 4MX7B 3OTTA 3OKKB 2NY1B 3QISA 1NCCH 1TJHL 2NY3B 4X6CF 3K7UA 4ZFZB 3CLEL 3AROA 3TYFB 4CVXB 2BY0A 5AAMA 1DZBA 3QO1A 4XH2A 5TFSH 3MJ7B 2E6QA 1Y18B 2YEZB 3SJVA 1MCHA 4L8SA 2LFGA 5DJ8B 2ORBL 2QTEA 5CEXB 4YDVA 2BMKB 1TIUA 4ZFOA 5F3HA 2D7TL 3EJZD 2ZUQB 1T66C 2AXHA 4JM2B 1GGUA 2H2PD 3MJ9H 2VLJD 1EGJH 4LVEA 3H9SD 5JW5B 4QLRA 2HT2D 1S5IL 4FA8A 1Z0MA 2HTKD 1WEJL 3VD5A 7CGTA 4I13B 5IB1B 3O4OB 4P5TA 1U2CA 4JGUA 1ORQA 3STZB 3RGVD 2FJFA 1FP5A 1IGJB 4LLYA 5IMOB 3SDYL 3WUWG 1JZ7A 4JPVH 5FCUH 5CGMA 3MRNA 3HB3C 4QWWD 3SKJH 5EUOE 2BOBB 4PLOB 2W38A 4LLDB 3U83A 4OLXH 4P4KA 1DFBL 3ARFC 3X17A 2ZSWB 1T20B 2VWEE 3VXUD 5D1XC 1S8DB 4PG9A 1M71A 3BRDA 4XP5H 3R06B 2P8LA 5E2TH 1F2QA 4QRRA 4ZPTB 4XVTL 1GL4B 1G9NL 3HMWH 4O2CB 1J05B 1II4E 3OZ9H 2QQNH 5HI5C 4TYUA 4BQBA 3O6KH 1AH1A 2WBJA 1M7IA 1INEH 3MGTA 3QJHA 4LAQL 4KFZC 4RA0C 5KSVA 1BM3H 2B39A 1YPZA 1AE6H 4HEME 1N59B 4V1DA 4NUJA 3MR9A 1UA6L 3ES6B 1CL7H 1XH3A 1HHIB 1RUAL 3T3PE 2YSSB 3MXVH 3TJEH 5CKGA 2X7LB 3K3QA 4IMLB 1E4WH 5KZCB 2QHLA 5BZWB 2XKNA 4H20H 3ROLB 1V05A 3VXUB 4DGIH 4Y1AA 4LNRB 4F9PC 3MA7A 2APBA 1EFXD 3QIUC 5CIPB 4PJIE 4P9ML 5D6DA 5B39G 4I18C 3LY6A 4MQXC 3MUGA 1G7HA 3JWOC 3NCCB 5I75B 1CDGA 2AJUH 1MEXL 5I9QC 2R4RL 1A3LL 5TDNA 1MY7A 5ACLA 3BIBX 5IHZA 3SJVD 3IS1X 3OGCB 3WE6A 4J4PA 1LO5B 5CILH 1EXUA 2DM4A 1ETZB 2KKQA 4LP4A 2W60B 4GRMA 2WQ8A 1IILE 4B7IA 2F53B 5KSBA 4ZS7H 4YAQB 5FO8A 3VFVB 4JO1H 4PTTA 3PIQA 5EO9A 3ROOB 2J8HA 4LLAA 1OY3B 4J6RH 4K9EC 4F33A 1RPQA 5L88L 4OGAD 4U1JA 5DHVH 5DJYA 1QA9A 5AWNH 3U9PL 1ZLWK 1JPSH 3I50L 4P5TD 3TNMA 2PCPA 4RAHA 3ZYIA 1W0WA 4XH2B 2KBGA 2JJSC 4DZBA 5D72L 5DVKA 4GRWH 3X14B 4HJ0D 5EC2B 3V6ZB 4P4KD 2JB6A 3OAZK 3CDCA 5HXMA 3FFDA 4ZFOB 5E8DL 2FIRT 5F3HB 1F2XK 1GIGH 4QRRD 3V5DA 4R9HA 1EHLL 3PJSA 5C0EA 1ES0A 3HI6H 3IJYA 1KTDB 5I1GH 1IAKA 1QKZH 2WBJD 4HPOL 5IBLC 4F57H 1FYTE 4BQCA 4JFPA 2XKSA 1HQRA 4O2EB 1ORQB 2FHBA 5K9KA 1ORSA 2FJFB 1JGDA 5CLTA 1U95B 4LLYB 3LKSA 4B0MM 4I9WE 8FABB 2NLJA 2I9LB 2A1WL 2PETA 2QADD 1NCTA 4AMKL 4CAGA 4EIZC 3N9GL 3ZKXC 1EHAA 1F4HA 4Y16C 3CX5J 4S0SD 4Y1AD 4PG9B 1M71B 4MXVE 2XZZA 2P8LB 3CAFA 2Q3ZA 1FGVL 1U6AL 3SY0A 2Z91A 5INCA 4PRBA 1IC5L 1RZ8A 5IG7A 1C5BL 4NQCA 5CBAB 2WBJB 4WU5B 1T03H 1NCDH 3DV4B 5EZIL 5JOFA 2XIDA 4ALAH 4V1DB 4XPGL 3P40A 1U3ZA 3D18B 1YNTA 4J4PD 3TBYB 5J1TC 5ISZE 3U7YH 4HJGB 2R69H 5IB4A 3RWDA 2MKWA 4CN1A 3WV0A 5CEZE 2VDOL 3QA3B 4OI9A 4MJ2A 3QUYA 5LXGH 12E8H 1QFWH 4NGHH 4W4OA 3MA7B 3T0VA 4Z7NE 5E6ZA 1MELA 3MUHL 5GRUL 3B4NA 3PHQA 3PWPE 1Q9KA 5E2UH 2R0WL 1S9WA 3H2WA 2HG5A 3C6LA 1GZQA 4PJ9B 1RZIB 3ZKMC 1NEZB 1P4IL 3VWKA 3OKOB 4K7PY 1YEDA 2P49B 3SPVB 5IHZB 4Y4KC 3TYGL 2CRZA 3L3IA 3WE6B 2OI9B 4EVNA 3S88H 1KEGH 4M7JL 3V6OE 1A02N 1EXUB 1FLTX 3ESVF 1C12B 1BIIA 2FR4B 4OZIA 3INUH 3VWJC 4Z76A 3E2HC 4UMGA 5H37H 4XPBH 1KOAA 2H32B 4PTTB 2F9BT 2BSSB 3CVHL 4Z7UA 3P2TA 5H2BB 1VFAA 1RZFL 2ADFL 4JHAH 2C3VA 3OL2A 3KPLA 4R8WH 3T0DA 1GGIH 3SBWC 1QA9B 3V52L 3LKRB 2CXGA 3Q5YA 1IC4H 3O8XC 2E5EA 2QEJA 3P73A 1CICC 3LS4L 4Y5YA 3RVVD 1QFUH 3H7BA 2NTFA 4LSPL 1JN6B 1JNLL 3S3SA 4HGWA 1K3ZA 2JB6B 4N9GA 4FG6C 5ICYA 5CKAA 3FFDB 1TQCB 4P2OA 2DOCA 1MHCA 2OX5A 3MRDB 4HV8A 4UTAL 1M05B 2XFXA 4K8RH 4L8CB 4F7CB 2FD6L 1SY6H 1KB9K 2Y6SD 4JO4L 2ZKHH 3PWUB 4KKAC 1XF4A 1IAKB 1WIUA 3E3QC 4NQCD 4YXKH 4KRLB 2F8VA 2VDNH 5E4EC 1E27A 3BZFB 3QEGL 5K9KB 5D1ZA 5F7LB 4ENED 5CD5D 4M03A 2W65A 5IWLA 3GM8A 2VN4A 1CDYA 2OMBA 3T77A 3H0TA 4PR5B 3G5ZB 4G6AC 1SM3H 4M6OL 3L5JA 2OK0L 3CFKA 1J5OH 1CQKA 3JWOH 1D5ZA 4KQ3L 1SYVA 4NNYA 4YHZH 3WKML 1G7LA 3TBWB 1U58A 4MZ2A 1ONQB 2W0KA 1PQZB 2UZXB 3QUYD 5H8DA 4L3EE 1EDQA 1A7RL 2A6DB 2DQUL 2EE2A 4J8RA 1CDUA 5CEZL 1T5WA 1CQYA 3QFJE 4YGVA 1ZHLB 3EW3B 1NBQA 3SCMB 5IB2B 1D9KC 5INCB 4DCQA 4PRBB 5FUCE 5HGAA 5IG7B 3WHXB 3C6LD 5D5MF 1ZV5A 4TOYH 3U7AA 1R5VA 1A7QH 3VWKD 4MCZA 3H9HA 4TSAL 2MMXA 4HUVA 5GRXG 4HUUA 1Z2KA 3DJ9A 4K9EH 1YNTB 2JCCA 3IKCA 2F15A 3MZGB 3K1KC 2AXFB 3HAEG 3FL7A 2Y5EA 4J3UA 4GS7B 5ICXB 1CGSL 3H3BC 1GRWA 3DSFH 2PNDA 3ZSTA 2JK5A 4N0CD 1TZGL 3DI3B 3BDXA 1R3LA 2UZIH 3NTCH 2VSDA 5I1HL 1NLDH 2CK2A 1R24B 4OUUB 2DDQL 2NY4B 3OR6B 1QNZL 1N8ZA 3FB5B 1S5HB 1S9WB 3C6LB 4NQEB 1GZQB 3VXRE 3VWKB 2H8PA 2XRAL 2BJML 1U41A 2D7NA 2P5WA 1X7QA 4ELME 2P5EA 4N0FB 1OB1A 1UXSB 4K3HA 4X98B 2Z31A 4P2OD 4LSVL 1I85C 1RI8A 4M61B 4Z76B 4DVBA 3JWNC 5IB5A 2YN3A 2J3SA 4OIIL 4JKLA 4PLJD 5HYFA 4M7LL 1FZOB 3WLWC 4G43A 5CEZD 3MJ6A 2C3VB 4ODVH 2FHCA 3KPLB 1U3HA 3OQ3B 1NGQL 1MAML 4L3EA 5ID0A 2HVKB 5D1ZD 3FFCB 4C56E 2BVYA 1TVBB 1U91B 4NZRH 5E2VH 4YIQB 3SDAA 3LKQB 4FFWD 3HKFA 5TE6H 4PTUA 4CBPA 4LSQL 2AI0H 3MYJB 3L1OH 3VFWA 2NTFB 1KXQE 3B9AA 5H35B 2Z9TA 1MPAL 3HC4L 1HYSD 4DWHA 4HV8B 4NNXA 4GSDL 2XFXB 4K2UH 3O2WL 1EEZB 3IXTA 4JG1L 1WF5A 3P30H 5CJXC 4HS6A 5TDPA 3BEWB 2NR6C 2CSPA 4K94L 3JTTB 1A64A 1RY7B 1YPZF 1AD0A 2FRGP 4G8EA 5GGRY 4OZFH 1N6VA 3GI8H 1JYWA 5C0CE 5D1ZB 1QBBA 3ZO0A 1MHEA 2IQAA 2FH6A 3K2UH 4MA3B 1IAIH 2YZ1A 3HC3H 4OD2A 4NQVA 4Z7QE 1NGWB 2WZPD 4OV5B 3WO4B 4HK0A 3PL6C 4LPWA 3QDJB 1D5ZB 1ITCA 4Q9QH 3GSRA 1U58B 2X05A 1A6WH 4B7LA 4MLSA 2E9BA 1A4JB 1OP5K 4LHUA 4BSVA 5FXCH 4LARL 2X4RA 3KYNA 1U2HA 4YGVB 3T0EE 2UVEA 1A2YA 1JMXA 2EC8A 3SDDA 1UZ6F 4K71C 1AHWA 3X3GH 2H26B 4XCFH 1DLHB 3KWWA 32C2B 1R5VB 1YMHA 4XAKE 3MNWA 3H9HB 2GEEA 2P5WD 5DJ2B 3KYMA 3OG6B 5JHLH 4HUVB 5JORB 1J0HA 2P5ED 4U1SA 2ZUSA 5GS1C 5B22A 2Z31D 3RKDC 3MRKA 5DUML 1NAKH 4XI5C 4ZOAA 2QQLL 5KSBF 1KTLA 3SGJA 5FYJU 2A74A 4J1UB 3IB4A 4PGDA 5C0RH 2JJTA 3TBVA 2HJLB 4PUBH 4GG6E 3IETB 2E8YA 1U3HD 4L9LA 1PFCA 4N68A 4IDJL 1NCAL 4L3ED 4F15C 1EO7A 3H7LA 3OAYK 4OFDA 2H8PB 3CX5K 2XTJD 3VCLB 5DRZB 3SDAD 4KJPC 2P5WB 4E5XB 1W0YT 4NOFA 1FG2A 1JHKH 3CZJA 2E27H 3EDEA 4G6ML 4I3SL 2HVJB 1UZ8B 4WRLA 2EDKA 4OAWA 1U42A 2ICWJ 5C6TH 1L6XA 1GVIA 1LO2H 4YHMH 4EI5A 3P9LB 4NKQB 1VADA 1A6VH 4P2YA 1LK2B 4POUB 2AJYL 5E2JA 4XWOC 4D9QE 5E9DE 3KJ6L 1E28B 4ZOCA 2XT1B 2NY2D 5C09B 3DX8B 1EO8H 1U3HB 5I17A 2EYRA 3MYZA 5ID0B 4IOSD 3X13A 3CFJB 3MLTA 4JY6B 1PDKA 4PJ7E 3RAJL 4L8BB 2R1YB 3MRMB 1GPOH 1KLUA 4PTUB 5B38A 3THMH 5FA3B 4QGYA 3FO2A 2DQGL 3QJFB 4LPXA 4M6NH 4BH8A 5I1EL 3KAAA 1IM3A 4LHUD 3EDKA 1JRHH 4GRLB 4KK9C 4KTYA 4NNXB 1WQVT 1XAUA 5EC1B 5FB8A 3VFMA 3VGGA 3SDDD 3I75B 4PJAA 4TSBL 4Z95L 4NBYB 2ZSVA 3HNSH 1TZHB 2QSCH 1LEKA 4G8EB 5DTFB 3QUMH 1OARL 3NCYP 3QG7L 4FNLH 1UM5L 5J0BA 3GRWA 4P2QA 1UKTA 4GG6A 4QHMA 4QXUH 4PRPB 4OD2B 5A40E 5L2KA 3VXNA 1KELH 4QF1B 3CGTA 4DGVH 4BFGA 4O4YL 4PJEB 4NFBA 1X5XA 5DRNA 4YHYB 3DTXB 2EDXA 2HFEB 2GAZA 2AQ3A 5F7EH 1MCNA 1JL8A 2X4RB 3DI2B 3JWDC 4OFKA 4F8TA 1BOGA 1RJLB 1J18A 1A2YB 1V3KA 2DLFL 4ZSOE 1UG9A 3CXDL 1AHWB 2XG5A 1EZVY 4PRHA 3BP4A 1AY1H 2CLZA 5C0AA 1I7RA 1S7QB 3MNWB 4KQ4L 3UPRB 1A5FL 1VEPA 4WO4B 3I84A 4WDIB 4XTRD 1INQB 1MSPA 3L3OB 5E9DA 3QUKA 1XF5A 3V0WH 4DFHA 2IBBA 3MLRL 3GSXA 4M1CC 4S1RH 4OZIF 4PRIE 3MRKB 3P4NA 1ZLVH 4XMPL 1S7RB 1R3HB 4Z7WE 4EI5D 4X5LA 1LP9B 4OZ4A 5HDOA 3TIEB 2V2WB 5C8JA 2YMXL 3LEXA 2A74B 2DBJA 1WWAX 4Z7UF 2R9HC 3O0RH 4LRNL 5KW9H 4EOWL 5DD0L 3LEVH 3BHBB 1B0RB 5GRJH 1DEEA 1JHLL 4KY1H 3QNZB 3UYRH 5J1SC 4FABH 3P0GB 3C2AL 2VUYA 3IU4H 3VH8B 1L7TH 4WNQB 5HYEA 1JPFA 1JHTA 1TTFA 1UYWH 4U6TA 2M26A 4M9OA 4BK4A 1E0OB 3QI9B 4MVBC 3DV6A 4OCSH 1ZMYA 2PW2A 1CFSA 2EXYC 2ZUQC 3BXNB 2WANA 3F6IA 5DRXB 1N6UA 3V7AG 3T65A 1JWMA 5I6XB 1MRCL 3I9GH 1IKFL 4TULH 3ARTA 4PFEA 5DZLA 4K23L 3O11A 4HWZB 3O3EB 4WENB 5JUEL 1H3WM 2BNRE 2DQEH 3LMJH 4PB0H 4X4ME 2H3NB 4IOFC 3VXOA 3O4OC 3TH2T 3D0LA 1YYLL 1OAYL 5I17B 5JIHA 2XQBL 1FFNB 4O2FB 3RZCC 1JGUL 3X13B 4P2QD 4M43H 1KC5H 4MS8C 4NKMA 5L2KD 3ALWA 2ARJB 1BF8A 4M93B 3CFEB 5E6IA 4P99A 4ZSOA 1UQSA 4Z0XA 3MLZH 2AQ2A 3PABA 2BY2A 5FYKE 2FIKA 3VI4E 4NJ9L 3EYVA 3MRCB 4NJAL 5L9DH 1IT9H 3LSOA 4R4FL 3JBG7 4HBQA 4KUZH 3U30B 3V5KB 5B3JE 4HWBH 5TDOA 5DJDA 1KCRL 3V95A 1HIMH 4Z7WA 7FABH 1R3IL 1A7PH 1K2DA 1LEKB 5D7KE 4ZTPL 4PRHD 4LMQI 3RUGE 5I1IL 5C0AD 5GGQH 4BSWA 2NZ9C 5FUZH 1AR1C 2NY0C 3RNKA 3UAJC 4E9LA 5KVDL 4XMKH 2BHYA 3EFFA 4RMVA 5E9DD 1GOGA 2JCCF 1PG7W 2YOCA 5CSBA 5L2KB 3VXNB 4KJYA 4TNVF 4PJCB 1T0NB 4XP4H 5EPMB 4WV1B 1D5BA 3QDGE 2FSEA 1G9ML 5CUSH 1OAKL 5DQJB 4HS8H 3SDCB 5B4MD 4GMTL 3GKWL 1DQQA 4PRDA 5EO0B 2IG2H 4G6FD 4PRNA 4CKVX 3CFBA 2V7HA 3ULVC 1RUPH 3KNBA 3PGDA 1WVZA 5BZDA 4JANB 1UCBH 1Q38A 1RIVH 2RCSL 3S5LA 1ZANH 3O6FB 4BYHA 1NFKA 4PRHB 3DUUB 5E4IA 1CFTB 1I7RB 2LTQC 5I1DA 1NCWL 3W9DA 2BNRA 5DMYA 4Y89A 5J11B 4X4MA 3KPRE 4JPKH 2ATKB 1EX0A 1FZJB 1ND0B 5DEFA 3WFEH 1YEFL 4HPYH 4QRTA 5F72S 2K7PA 1S9VA 2CUHA 1GAFH 2QHRL 4OZ4B 4RFOL 5C8JB 4R7NA 2CJUH 1I75A 3QQNA 1TLKA 2EDBA 4NHCL 4D9LH 4G6FB 5LQBH 3AREB 3RVWC 1A6TB 4TUOB 2QQKH 1ZTXH 1CK0H 1FSKC 3W0WE 4ZUSB 4FP8H 2MKLC 5HHPA 5E6YA 3B2VH 2CIKB 5EOCJ 2AJXL 2VUOA 1RU9H 1MVFA 4JQIL 4J3VA 5E6ID 2FGWH 3W11C 4X5XA 3TH3T 1A6AB 2A77H 1RAMA 4K07A 4CJ0A 4KKCD 5IMMA 3DIFA 1IFHH 3MTRA 4G6JL 2VXUL 4GKNA 3ZLQC 1Q72L 4ZUTB 4GJTB 1JWMB 3PV6A 2VB5A 5F9JA 3RX7A 4NN6C 3O11B 1DBBH 5F6HJ 4QY8B 5FYKL 2E6PA 1WZLA 4ZAKC 5GZOD 3QDGA 5JMRA 1N6QH 2ERJB 3B9DA 1CFVL 2VYRE 2GK0B 1AJ7H 1U8KA 4DTGH 3L6FB 5IB3A 3JWDH 2V2TA 1YNLL 5DC9B 5E94A 5B21A 1XGUB 3DUSA 4G7YL 2PO6B 1UQSB 4Z0XB 3FO9B 2R1XA 1S7SA 2EIZA 2MJWA 3HZYA 1UCTA 4NO5B 4HHAB 4APQB 3MUY1 5ESVA 2FIKB 1IEBA 3FZUC 5AZEH 1ODAA 1L4IA 4MAUL 1LEIA 5DJZA 4DFIA 3O41B 3PP3K 1C5DA 3B8SA 1QFPA 5DJDB 4RGOL 4O51B 3BKCH 2OLDA 5JQ6L 5BS0E 3UTSB 1MAKA 4AG4H 3JXAA 4YFLI 4BSWB 1FBIH 4L4JA 2OJEA 4W68A 4M7KL 3BZ4B 3PHOA 4FFZL 5GGTH 2BNRD 5GGVL 1FV1B 3IDIB 4OFPA 1A14L 3VFNB 1MI5B 2AJ3B 5DYOA 1B6UA 2FSEB 4HEPG 1P4LB 2G60L 4U3XA 4UOJA 4CGTA 1S78C 1VB9A 4P4RA 4EUPG 4NM8H 3G5YA 5ITBH 4KAQL 3TF7C 4G8FA 1MUJA 3MNZB 3BISA 3DYPA 4C83B 3CPLA 2AAVA 4FQHB 3C5ZA 1FNEA 1UEYA 3GEWB 2R2BB 3ARDC 2MCPL 4BFBD 3SKMB 2FLBT 3N1GC 3F58H 1KJ3L 4C4KO 1CFNB 1S7VB 4ZNEE 4LMQE 3MRPB 2I26N 5GPRA 3VE0A 1HZHL 3PV7A 4KI1A 5K9JH 3NCJH 4X6FA 3WFBL 1T1ZA 3IAQA 4JY5H 5ESQB 1KT2A 2DI8A 5HHVH 4HZLA 1FHGA 3D39E 3MGOA 3ZSSA 4KPHH 5MEPA 5D7KD 3VXME 2ZPKL 5HPMA 4EXPX 4WFFD 5DGRA 4JN1L 5IR1A 2C3GA 4AIZA 1GHFH 1NMBL 3V0VB 5HDQH 2FYYB 5F9OL 2Y07H 2AEWA 4KTEH 3TIDA 1MRDH 4X6BA 2Q7YA 4K55A 4KVNL 3QDGD 5BW7A 3HR6A 1OAXH 2V5RA 4OIBA 4UT9L 3QPQD 4YNYB 4YXLH 5DZNA 1G6RA 5KS9B 3N1FC 2I60L 3U36B 3VRLE 4PJBE 5DQDH 5D8JH 4XP1L 1I3RA 4JHZA 1TPXB 2ZNXA 4KZDL 3QHZL 4X5XB 1MJJA 3M17A 3LQAC 2VLRB 3MBEB 1QHPA 5JLZA 3DIFB 4GKNB 2AABH 2UUDH 1QP1A 2VLME 5FAAA 1I9IL 4Z5RB 5F9JB 1TJIH 1KJMA 3RTQD 4ERSL 2X6MA 3I2CH 2XZCH 4PJAF 3UJIL 5D7SL 4FZ8H 2PTUA 4N8PA 2Q76A 1G6RL 4LSDA 1HN1A 3UTTB 2DQCL 3IVKB 4XMLL 2EIDA 5CP7B 2OTWA 3CSYA 2ILLA 1WFOA 3EDJA 5M94B 3MA9H 5HHMB 4GG6F 3LVEA 3U4EA 1JFQL 5MERA 4LLVB 4HGKC 5C2BL 1B2WH 1W72L 3GUTA 3B9KB 3VFGL 4ZNEA 5KJRL 3HRZA 4UT6L 1IGCL 5EUKA 4MJIE 2W9EH 1HSBA 4YHIA 3PGFH 4PJ5A 5ESVB 4YUEL 3R1GH 3HPLB 3GHEH 2QSTA 1F90L 4YH6A 3BGFB 4PJHB 3WXWL 3C5ZD 3BESR 3K80A 3D39A 5DJZB 2FECI 4KHXH 3BPNB 4G8GB 2FGZA 1IQWH 1FORH 3VXMA 5LWYH 1M7DA 4MAYC 2IADA 5L7XH 1DLFL 1NC4A 4DN4L 4V2CB 2LE9A 4Y5VC 1BBJB 2IQ9H 1GYAA 3WIFA 2PW1A 1UWEH 5MEOB 4P3CL 3P77A 4LSSL 4IM8A 3D3VB 2K1MA 1AXSB 4GS7C 5D70L 1UWXK 5DD1L 2FB4L 4OCXL 4UINH 4UQ3B 5EU7C 1U9KA 2GITB 2WM0A 4ZXBC 2OJZH 3PNWA 2YD9A 3TJHC 3C5ZB 1FNEB 4W70A 4RMUA 4AENB 1SEQL 2H2SD 2NY4C 2BC4A 3C08L 1I3GH 3QG6B 3NZ8A 3U4BH 1JPTL 1S7XA 4U0RC 3MOQA 1CDBA 1CXIA 1REIA 4X6FB 1T1ZB 4JFFE 2D31A 2AERT 2XZQL 4Y5XC 5D7LA 4TPRL 1KT2B 2EDRA 3IFOA 2MQ0A 4HZLB 2DQDL 3VFTB 3OF6A 2P46B 2VXSL 4WW1A 4NN7B 1I7UA 3UYOD 2BSTB 5IR1B 2COQA 4XNQA 3QIWA 4XT1C 2LVCA 4X9IA 5HSFA 4GXUM 3SGEI 4X6BB 5C86A 5AZ2H 3LRSA 5A16A 1T83A 5DF0A 2QLVB 4ZTOH 2WQRA 4K3JL 5D1QC 43C9A 2K9UA 3SKNA 4XCCL 1Y0LA 3L95B 4MJIA 1AIFB 3MCKA 3MLVH 3WN5A 2CLVB 3BIKA 4XXCA 5MI0B 1G6RB 3DO7A 5DMIH 1V3MA 4OM0H 1U8IB 5ILTL 1JNHB 2RIKA 3QCVL 1I3RB 1IGYB 2LU7A 5FKPA 4OZGA 4B5EA 3M17B 3G6JA 2A83B 4MB3A 5JXEA 1TTGA 4ACPA 1FH5H 1MJUL 4HKXB 2GFBA 1AO7A 2VDLL 3FONA 4PJ5D 4UIKH 2KZ1B 4PJDB 5IT2L 4UU9B 4AIOA 4L8DB 4GLRI 4OLVL 3ZDXE 4XNXL 3D39D 2B0SH 3ZTNL 5IW1A 4DGYL 5FYJH 3VXMD 4S1SL 2Q76B 3MBXH 4Z7WF 1YEIL 5DT1H 3IDMA 3MRLA 5HHXL 5JXAH 1NC4D 2EZ0D 2F5AL 1H0DA 4LPTA 3F7VA 1J11A 4HWEH 1A9BB 1DBML 4MA8H 5DHXB 1XMWA 1DUZA 3G6AA 4LVHC 4J3WA 1MCPH 3GUTB 3K1DA 2E7LC 1C08A 1Q9OB 2PKDA 1AGDB 1IEAA 3IF1B 1HSBB 5DJCA 3FB6A 4JKPH 3BT2L 4MQ7B 4KMQA 3PE9A 4HH8A 2IALB 1D5MB 1MFCH 3MV7E 3UDWA 4AYFA 4JG0H 2KQMA 3QUZA 4Y4HD 1T7XA 1KJVA 2EIEA 2H32H 1I1FA 5ICZA 1T89A 1NC4B 3BSZL 4OCYH 4AEHL 5D7JC 2YA2A 1FE8H 5D7LD 1T6WA 4ONOA 2AK4B 3MQIA 3TN0C 3WIFB 4NWTH 4U1HA 4G6KH 2NTSP 3OF6D 4IEFB 4WI6A 4JLRA 3QQ4B 5SWQB 3P77B 3SO3B 2L4OA 3S35H 3QHFL 1OGAA 1CGYA 1H3XA 1FNSH 1M4KA 1TCMA 5IK3B 2NX5A 1HI6A 4HXAL 3QIWD 3QXAB 2FX8H 1U36A 4TNWF 2Y5TB 4YHOH 5E1AB 3GMQA 2DQHL 3PNWB 3CFCH 4Z0BL 5I8OH 3TBSB 2DLGA 4JN2A 2BC4B 1EAJA 4MJID 4HT1L 2J88H 3UJJH 1S7XB 1RVFL 3STBA 1NGYA 2QBWA 3KHQA 2R8SL 5IOPA 1XF3A 1CZ8H 1U8NA 2EH7L 3VD7A 4PJFE 3RPKA 3M07A 3IFOB 3CMGA 4N0UA 4OLUL 4U1KA 5JXED 1RK0B 2AKRA 1JGLL 3U0TA 4WW1B 1AO7D 4P46A 1A47A 1CL7I 2R29L 5D71H 4XNQB 1SJVA 3OHXA 4RGMB 4WCYH 3RU8L 5HI3C 1DSFH 1XGTB 3HPJA 4P57B 3LRSB 5J6HA 3SGKC 1PLGH 5EUOB 3SKNB 2P43B 3MCKB 3UBXA 4U0QB 1LWRA 1ZLSH 3CUPA 1X6LA 3DO7B 3IDNA 2VLKE 5IESL 5KTEH 3SGDH 3VD9A 4NO0D 3RWCB 4ODSH 5ERWB 2BRRH 5KN5A 3GJFK 1TJGH 4RWHA 2GFBB 1IL1B 4Q2ZB 5C0FA 3PWJA 1G6VK 1NBVL 4M48H 4KMTH 1ZLUK 1Z3GH 1VGKB 2L7UA 5FIEA 3UO1H 2DF3A 3JZ7A 4LHUG 2YD3A 1S3KL 2W9DL 4N5EC 3QUZD 1FL5A 3HZVA 2Z8RA 4PGCB 3P11H 4YX2L 1HHHA 2FX9L 4JDVA 1QHOA 3RWEA 3F7VB 2P42B 4QRSA 4LIQH 4ONGH 1DUZB 3G6AB 4TTGA 3I6GB 4FXLA 1C16B 1SHMA 4LEOB 1OGAD 4N5UA 3KR3L 4GFTB 2NX5D 3MOBH 5DJCB 3NBNA 3PWVB 1WBXA 4AT6A 3B43A 4PJFA 1KG0B 5BO1L 3O4LA 1OSPL 4JPWH 4GAYA 1D6EA 4KK5D 5C0BA 5I30L 5E7BA 3D0VA 4JR9L 3WDIA 1H5BA 2FECL 4WI2A 4LAJH 2FWOA 1Q9WB 1MIEL 4WO4C 4D9RE 4NRZB 5AEAA 3LQMA 3BUTA 1UH3A 3BPCB 1CG9A 4P2CG 2PYEB 3NN8A 3UTPD 1EEUA 4KZEL 4MNHA 3C87A 1U8MB 1BLNA 1ACYL 2VISB 1PEZA 4HKJA 4IMKA 4P46D 5I18H 3LN5A 5T1LB 2NX5B 1HI6B 4O9HH 4X6EA 2OSLB 4HJJL 1JBJA 1FVEB 3EYUL 4P3DA 3T3ME 5EU3B 4JZNA 1S7WB 1NGZB 4YJZL 3AY4A 4OD1H 1GOFA 2VQ1B 1FL3A 5EZLB 5AG9A 3V4UH 1A6UH 1FGNL 4OD3H 1I8IB 5DVNA 5IOPB 2X4OA 3SDXA 4H1LA 4XCYA 4MJ4A 5ID1A 5AG8A 4H5SA 2Y7QA 3QI9C 1KJ2B 4YZFE 3UCRA 1HINH 4LCWE 2F58H 3C8HA 3V8CA 1P7HL 5E8NA 2AKRB 3U0TB 4H25A 5B38G 3WIIH 1BVKA 1XIWB 4UIMA 5I6XC 5K33A 3SN6N 1CR9H 1MCSA 3HZMA 3FQTA 2Q6WA 3ARUA 3MREA 1MWAA 5T5NG 2FEEI 5C08E 5C07A 4JZOB 5IQ7L 1U8PB 4P59H 3HNTH 4IRJC 4XPTH 1MQ8A 3I6LE 3GMLA 3MRIA 5EU6E 2Q7NA 3UBXB 4XXDB 2R56L 5CZVL 4KDTC 3K8KA 4YC2B 3HI5L 4F9LC 2XNAB 1QFWM 4M93C 3IDNB 3OKNA 3RY5A 1P7QA 4PY8J 5M7QA 1QACA 1N5YH 5J6GB 1NMAH 3C5SA 3O6LL 1MWAL 2HMID 3TNNA 3UROR 1MFEH 1CXFA 3N1MC 4AZ8A 2B1HH 1H3PL 4KROD 1KCVL 4Y4FA 5E00A 2P45B 5JDJA 5DMKA 2MFNA 2B4CL 4N1HB 3O4LD 1QBML 1OCWL 5T1DL 4J23A 5C0BD 1G7IA 1B4RA 1OP3K 5F8QC 1VFBA 1TVDA 2YPKB 4WJ5A 5A2IH 2EH8H 4AM0B 3U9UA 1KPVA 4G5ZL 5IP4A 4PG2A 5GQBA 1HHHB 2CGRH 3OAUL 1CD1A 3FRUA 5HGBB 3CXHK 1EJ6A 4Q74A 3JVGA 4QCIA 4WV1C 1FFPA 5LCVL 1SYSA 5E56A 4ZUWA 3MJ9A 5E5RB 5C0NC 1NCCL 1EGJA 3SDCC 4U4BA 3KPMA 1NBYB 3PWPB 4P2RA 4FQPA 3P3YA 4H0GA 5TFSL 4KROB 1WBXB 3LH2L 1KB5B 2CH8A 3PWLA 4YK4B 2IFFH 2X70A 1D6EB 4HSQA 3KLHD 1FNAA 4LCWA 4FOMA 3O6FC 5LGHH 2ITCB 1BJ1H 5CBEA 3P0VH 1C1EH 4FFVD 1BBDH 5KVGH 3MV8A 2FWOB 5C7XH 3MJ9L 2E6JA 3GSVB 3BVNA 1EGJL 4NFCA 1CG9B 1ZVHA 2VSCA 4EXKA 1QQDA 5TF1H 3HZKB 4KK8C 4UQ2B 2X1PA 5EWIH 3LIZH 3ULUH 3AC0A 1KULA 1BLNB 4NRXB 5C6PB 4DUWA 2ZWLT 3BPLC 4HX1A 3RVTC 4ZO8A 4ZUUA 2CMRH 2X4QA 3K4ZA 3LN5B 2IWGA 4GRWE 3VGBA 5IW6B 3GKZA 3QZWG 4R2GB 4JPVL 4X6EB 5FCUL 3AREC 5FF6A 5C07D 3SKJL 5DEGA 1JK8B 4R7DB 4JZNB 4YHPA 3MRRA 2XZAH 2HN7A 4OLXL 1AGCB 3GJEA 4QNPF 4XP5L 2HKHH 5E2TL 3A6BH 4PJ8B 4OZGF 2CKBH 5CP3H 2X4OB 3HMWL 4RMQA 4Y88A 3SDXB 3OZ9L 4Q7DA 4XCYB 3G6JF 2HH0H 3KLDA 3LPFA 2QQNL 3QWOB 1P7QD 4QXTA 4XPFH 4PV8A 4Q97A 3O6KL 1INEL 2HT4D 3HTLX 3J8F7 3VRJB 1BM3L 2LU4A 1AE6L 3KS0J 3GSUA 4PD4J 4UIMB 3WFCH 4Y4FD 4HH9B 3UTQB 3MREB 1CL7L 3KXFE 4J3XA 5DS8B 4YXHH 1TVHB 3MXVL 4X7TA 1E4WL 3RVUD 2ERJC 4XPAH 3GMLB 3O9WB 4H20L 3T8XA 4H26A 3OKLB 1YQVH 1Q94A 2AK1L 4HLZG 4OQ1A 4YBHA 3M8OH 3I02B 4I4WB 1UVQA 2W59A 4KVCH 6CGTA 1X9QA 2PO6C 2OCFD 1P7QB 4X7FC 4YFLF 4N0RA 4NC1C 4Y19B 2AJUL 4APQC 1BREA 4P2RD 3OKDB 1KUMA 2CDFA 3CFDA 3EKCA 5DHVA 1X5YA 4PY7B 2AEPH 3BQUA 3E6FA 4FHBD 5TE4H 3QCUH 1DQTA 5CZKA 5CILL 2BY1A 1L9MA 4LCWD 4OGZA 4JAMA 3VD4A 4MNQB 3MROA 2WINA 1KPVB 1A1NB 5FGCB 4WHCA 3MV8D 1YUHA 1RZGA 3S5LG 4ZS7L 1BFSA 4M62H 4YFDB 3CH1A 4HLJA 4JO1L 2VZSA 3EYFA 5IMKA 3KPOA 2J6EH 3FOLB 4J6RL 3A67H 3WJJC 1FFPB 1SYSB 2WK2A 5AWNL 3CSGA 5KSAC 1JPSL 3P0YH 4P23B 3TA3C 3KDMA 5CJOH 3KPQA 3C60C 3KPMB 3VMPA 1F6AA 3EGSA 4U1IA 4EKXA 3CH8A 5FK9B 2VL5A 4POYA 2UWEE 4IRZH 5C9JB 3EYOB 4HS3B 4HWUA 1I7TB 1QRNE 3VW3L 4ELMB 3QNXA 4K3DL 4IIQB 5KG9A 3D1MC 2V7NB 5IBUG 5I1LB 3MNVB 4HW6A 1GIGL 1DN0A 5DMJB 1ZVYA 3GSOB 4Z9KB 3HI6L 4HF5H 2C3WA 1QKZL 5A3ID 3KYOA 2O5ZH 4F57L 4PB9L 1MLCB 3KLAA 4MCYA 1IAII 4HX1B 1LNUB 2DQTH 1SJEA 3CC5A 5D2LE 5TPWH 5HHOE 1IZJA 1NMCB 4NZTH 3OB0H 5L2JB 1IAIM 5FF6B 4C56B 3B5HA 3ZE0F 2XTLA 2HN7B 5DJ0B 1OM3H 3GJEB 1N2RA 4ZD3H 2CR3A 2IGFH 3IFPA 3ZDZE 5MENE 1T2QH 2GHWB 2CO7B 3ARBB 4WI7A 1TPXC 3FT2A 1KXVC 4OLYH 2NXZC 4LVOC 2WBWB 3MBEC 1SVCP 4K7PH 4QXTB 5GXBB 2LAGB 1T03L 1JJUA 1NCDL 4EQ2A 1CFBA 3KPTA 3IXAB 3I3BA 4NZJA 4PLKC 4GW4B 1H9VA 1H8NA 3BQUD 3KPSA 2YUZA 4FQIL 1AGBB 3ELAT 1R3KB 3BKMH 3ZE2F 1HSAB 4R90H 4X7TB 3U7YL 1KIQB 2R69L 2W0FA 5FGSA 3OXRB 2DLIA 1ED3B 2DQFA 5LXGL 5E2WH 12E8L 3S98A 1N7MH 1WBZA 3FN0H 1U8QB 3B9KC 1IQDB 2MHAA 3GSWA 3QQ3B 5FDYA 1QRNA 5IJVA 3W39B 2YHGA 1BJ8A 3T0EB 5E2UL 5I1CL 1U92A 5D6CA 3F7YA 4PJFF 3CFDB 3FO1A 1MNUH 5DHVB 1AP2B 3BGFC 1QR4A 3FB7B 5D1XA 2X10A 3BQUB 4CNIB 3E6FB 2V5SA 1ZT7A 1X6NA 5E8OB 5F1OB 1JV5A 4JRXE 3S88L 1KEGL 1PBYA 1A1MA 1EMTH 1YEEL 2WINB 4R96B 1MH5A 5F3BA 3INUL 4C54A 3MMEA 2HTKC 1FIGH 3WIHH 4XPBL 3EOTL 2X41A 2GTZA 1T3FA 4JPIA 4LOUD 5ACZB 3MXWL 3FAXA 1IC1A 3EYFB 3KYAA 4KJQC 3QIBB 3KPOB 4YBQD 3WLBA 4KHTH 3NFSH 4R8WL 4FQQA 1GGIL 1O0VA 4NQXA 3FQXB 1DQLH 1SY6A 1IC4L 3AU1A 2VZ3A 3E6HA 5MENA 3LZFH 1F6AB 4WUUE 5EORH 4PV9B 1T80A 3LPGA 3S3JA 2FZ3B 2UVFA 1OT1A 2NW3A 1QFUL 4F9PA 4HXBH 3LN4A 5HJ3B 3QIUA 4Q9CA 4QRPB 5TQ0L 1RIUH 4RBPH 3RWHA 2HJKB 1JRHI 5KG9B 4I18A 1VFUA 1IGTA 1H8SA 3RI5F 4D0BA 5LGJA 1XR9B 4K8RL 3SDXF 4ELKA 3DECA 1J0KA 1SY6L 5JHDA 2A73A 1FC1A 2OMNA 3QFDA 3O3BA 1I1YA 4JFDE 4NN7C 1TZIA 4EZMA 2VDNL 4ZFFB 4U6XB 3HG1A 4UZGA 4ZG1A 1UH2A 5FO7A 4Z8FL 4NKDB 3HE7A 3W82A 3KPSD 4P5KA 1SM3L 4I0CC 1T66D 3MODH 4MLIA 4L5FH 1J5OL 4PJ7B 5I8KL 3JWOL 4UT7H 2UYLB 3RY4A 2OBGA 4YHZL 2NW2A 5MI0C 3VXPA 5HGDB 5HDLA 3L7FB 3LB6C 1IRAY 5J7CC 1QRND 2JTDA 4AQOA 2BNQA 3HB3D 2JJSA 5I71C 3NCYS 2G75A 1DP0A 4L8SC 1KIPA 4TOYL 1MIMH 1A7QL 3LKPA 3VA2C 4HIIB 5C0IB 3ZL4H 3W81A 4D0CB 5D1XD 1OSZB 2W91A 3KPSB 3K4AA 4K9EL 3GIZL 1BVLB 2FATH 2IPTH 2A9MH 2W0FB 5HI5D 1UJ3B 4E41A 3FMGH 3MLWH 4OGAC 4NC0B 4WUUA 1G9NC 3T3MF 4TUKH 3DSFL 1WBZB 2I25N 5D4QA 5AAWA 3L5WB 5BRZA 2AXJA 1ZHBA 4K8RD 2MHAB 3GSWB 3FQNA 1NLDL 3OR7A 4RISH 3ZHDA 5DR5H 5MEND 5EFIA 2CRMA 2ZCLH 2AEQH 3ARFB 5ENWB 5SX4I 1H8OA 1QO3B 5D1XB 1FVCB 4QHKI 3U2SB 5E5MA 1ZT7B 1AC6A 3BDBA 1JV5B 2IC2A 1KBGH 3QIUD 1JWUA 1NFDA 4PJXE 1KN4H 5E8PA 1MH5B 4MQXD 1JP5A 1HOCB 3NAAH 5ITFA 5DSCA 1BGXL 4PRIB 4PD4K 3BKJH 3VFPB 1H3TA 2AS5M 1T3FB 3TV3H 5DVMA 5JHDD 4U3HA 2P24B 1J0ZA 3IAPA 3WLBB 4WFED 3SO3C 3SOBH 2I07A 5CFHA 4XAWH 4ODVL 4HIEB 1FNGB 5DFTA 5IW3A 1YEKH 3HG1D 2BERA 5HYSG 2QADC 3IYLW 4HFUH 3HE7D 4NZRL 5E2VL 2GTWB 4MD0A 4NPYB 3RBGA 5TE6L 4OZFA 3KPNB 4XNZB 3DNKA 1Q0XH 3UX9B 2AI0L 2OR9H 2M2DA 3L1OL 4CU8A 3Q1SH 3LN4B 5IBTH 2Z92A 1CDIA 4HC1H 4LCYA 1O7VA 2LQRA 4U1NA 4X4YA 4Z7VA 2IAMA 3ARXA 1IGTB 3P4OA 2CUIA 4K2UL 1K8IA 5I9QB 3P30L 5K59F 3IDGA 1OLLA 4NRYB 4NCC1 2BNQD 3FQRB 3QFDB 3U4AA 2DWDB 4DZ8A 3MX0A 1TZIB 3EUUA 4WGVB 2DQIH 3GI8L 4QGTA 4X5WA 3ILQC 4JFHD 1XGYH 3D9AH 3NFPA 4P5KB 1KLFA 1HDMA 1IAIL 3HC3L 1G7MA 4NO2A 3VWJA 2ZNWA 3S37H 4P48A 2CR6A 4K3EH 1GGCH 2XPGA 4OT1H 1OAUH 1CGWA 4I2XE 4Q9QL 5I16A 3IDXH 1D6VH 4E41D 3GMRA 1A6WL 5BVJB 5IBLD 4WUUD 1DDHA 2XN9A 2VWEC 3SBWA 3EZ8A 3ARSA 1VERA 3U82B 3D2UA 2JELH 3O8XA 5BRZD 1JVKA 3AB0C 2BNQB 1CICA 4UUJA 3X3GL 4XCFL 4RGNE 1E4KC 4PGBA 5CJBA 3LKPB 2H1PL 4LHJB 5E5UB 4GXVH 5JHLL 5FUOH 3RUGB 4HKZA 1FO0L 3FN9A 2H45A 4LLUB 4GRWF 4WWKA 3JTSA 4LCUB 2ID5A 4UI2A 4E41B 4PGEA 5C0DB 3RHWF 4MJ5A 3PXJA 4X99A 5C0RL 4ZNCD 5CZXC 3MLYH 5C0GB 3EO0A 1LE5A 3O6MH 4PUBL 1OGTA 2E9JA 4FXGA 5LKNA 5DA0B 5BRZB 3MJ8B 1ZHBB 1QBLH 3L5IA 3RVVC 4F8QA 2M1KA 4LLWA 3FTGA 5E70A 4MNGE 3GIVB 3ZKXB 4Y16B 1WT5C 3T09A 4WW2C 4TVPH 5T3XE 2E27L 2IMMA 4JJHA 3CLEH 5C6TL 2NXYB 5D93B 4UAOC 5I2IB 2IAMD 4YHML 4WHTA 1IZKA 5DSCB 1A6VL 3EDDA 4MB5A 3VD3A 3ZKMD 5ELIA 3B9EA 4ESKA 5BQ7A 3ZKSD 3O3AB 5GSVA 4LCIH 4ENEC 4B53A 3HE6A 4ISVB 3K8LA 5EH1A 4FMKA 3TO4A 2DKUA 1MCEA 2C4FT 1EO8L 4XCEB 4CMMA 4X8JB 4XC3H 3QDME 4OCWH 1GPOL 1KNOB 4MD0B 4IRSB 3VWJD 2MPAH 3QUYC 4C57C 1WEJH 3QUMA 3BE1H 4OZFB 4C59B 5C0JA 3THML 4W4OC 1J1XH 1LE9B 2MSPA 3ZKNC 5KOVC 3FQUB 5T33L 5DJAB 1CE6A 4M6NL 35C8L 4LCYB 3CMOH 3NCEB 2VAAA 4Z7VB 1HILB 2XN9D 2VOTA 1U8JB 3O3UN 4HUWB 1JRHL 3DGGA 4HIXH 5AUMA 3WJLC 3D2UD 5IV2A 2EE3A 2DYPB 3O8XD 4NQDE 3IDGB 3MFGB 2VZOA 4QOKA 1CICD 1BX2B 4ZDHA 1ZSDB 3HNSL 4Y4KB 5F7NC 3UZEA 2QSCL 5JW4N 4U33A 1ZWIA 3QUML 1NUGA 4FG6D 3BOVA 3HUJA 3DROA 5DDHA 3WL9B 2HLFC 4G9FE 4YHNB 3QXDB 4OM1H 1KCUH 1I85A 1F97A 3NFPB 4QXUL 5IFAL 1HDMB 3AMLA 1KENH 5CHNA 1MQKH 1XZ0B 2V2XA 3E2HB 3WNKA 4DGVL 4OLWH 3G5VA 1E4XH 4AEIL 3GSNL 2WUCH 4JFOA 4WWKD 5I16B 4KKAD 4YC2C 5IKCA 3H9YA 3X3FH 4POZC 2IBZY 2XN9B 2NQCA 1S9YB 3C5JB 5F7EL 2BP3A 3L9RB 3RDTC 3CK0H 1CWVA 3MOAH 5D96B 4N8CH 3D2UB 3O81A 4G6AD 5F6IC 4JQXC 2Z8VC 2EDTA 4LBEA 4Y0GA 4EN3A 4PGBB 1UADC 1AY1L 3OXSA 4P2OC 4ZOEA 4L1DA 1RJZA 4OF0A 3ECBA 3CD4A 2DWEA 5ANME 4HKZB 2YC1B 2DBLL 1N3NA 4S1RL 1WISA 1BF2A 5CJXA 3REWB 5D2LF 3JTSB 4PLJC 5T3XL 2FJHA 2SEBA 3FJTA 1CGXA 4MJ5B 5E4EB 3O0RL 3JV6B 1G0YR 5KW9L 1J87A 1QLFA 1QLRA 1KIRA 3HE6D 5IWLC 2RFXB 3REVB 2DLEA 4MD4A 1EUTA 3TO4D 1KEML 1NL0H 4DQOH 2XWJB 2XWTB 3ZDZF 4KY1L 5DHYA 4FABL 4JRYB 3QO0A 5I15L 1ZT1A 2VMFA 1L7TL 4FZEH 4LKCB 4C4KT 4YK4C 1QVOB 5KBNC 1X5HA 3GMMA 3U9PH 5FA4B 2BK8A 1UYWL 5FOJA 2Y72A 5D9SA 1RULH 2D0FA 1UB6A 4OCSL 3O3DA 3V6OC 4EUPH 4R97C 1D9KB 4PS4L 4TN9A 4TULL 1RJYA 2QKIA 2G5BA 2Z4QB 4LU5L 3MC0A 2J8UE 5GSVB 2DQEL 4R0LA 5DVLA 4OZHA 3IDJA 3HI1B 5EIQA 4QOKD 4PB0L 5E8DH 4HUMB 1R0AH 4BUGA 1JTOA 2A6KB 4QO1A 3CCHA 1X5KA 4L4VA 4XZUA 5GS1A 1N26A 1ZXQA 3WS6C 3QNYB 3BP6A 1SJHB 1ZA6A 3EOBA 4GG8A 4KWUA 4HWBA 2VJXA 3PQYB 5I8EA 4M43L 4HDIB 1OL0A 1KC5L 4ORGB 4CVWA 3H9ZA 3QUMB 2D0HA 4PJBB 3HS0B 3MLZL 4JO3H 5JOEA 3WLWD 1JNNL 4QT5A 3U0PB 4X9HA 4M5YH 5HYJE 5ALBH 3DGGB 2YPVL 5ANMA 1G7PA 3BGMA 5IV2B 4V2BA 3LKNB 4KUZL 1A4KA 5EDXA 2NNAA 4YWGH 4N1CA 3DRQA 4HWBL 4QOKB 1Z9MA 1HIML 1OT2A 7FABL 4I3RL 1A7PL 1HWGB 4CU7A 4EN3D 1PEWA 3KLSA 5GGQL 2DD8H 1CLZH 2YPLE 5FUZL 3GMPA 2J5LC 4XMKL 1MJ7L 3CLFH 1EV2E 4XP4L 3G5VB 1XF2A 3ZTJG 2NR6D 3O9WC 1YMMA 5CUSL 5BOPA 2IANE 3S35X 3CDGA 4HS8L 1K6QH 5IKCB 5FCSH 3QXTA 5T1KB 2CDGB 4RMTA 2IG2L 4D0DB 1B3JA 3C9NA 3PGCB 3X11B 5INDB 1RUPL 1U3JA 2PR4H 3QPXH 3JV5A 1RIVL 3S4SA 3M1BA 1NDMA 3T0AA 1ZANL 2VRAA 3MRJA 5FUCC 3R0MA 5A2LH 2CDEB 4BZ2H 3DXAB 5L0QC 3U1SL 2X4TB 2BVPA 3VFRB 4F3FA 4M8VA 2J8UA 1RJZB 1K4DA 2OS7A 2E9IA 1NFDF 1DQDH 2ZG1A 1N3NB 4JPKL 2EDEA 3G5XA 3RX8A 3WFEL 4HPYL 1P4IH 1E4JA 2AV7A 1I7ZA 1GAFL 1VCAA 2FX7H 2P8PA 4XBGA 1Q9LA 4XNYH 1HXMA 1F13A 1I3VA 1AGFB 1KTRL 4OCMC 4ODWA 1W0VA 2ADIA 4D9LL 5LQBL 1QYGH 4F58H 4MD4B 4X7CC 1R6VA 2RBLA 1HHJA 1QSFA 1ZTXL 4NKIH 4L4VD 5CAYB 3F65A 5I19L 3PL6B 4FP8L 3QEUB 3OMZA 5HYJA 3CVHH 2J4WH 3B2VL 1RU9L 1EPFA 2AJSH 1KJ2H 4HIJA 1WUNT 2EXWD 2A77L 1K3IA 2BSRA 5D9SB 3RL1A 5FO9B 4Z7VF 4WY7L 1UB6B 4ZPVA 3CU7A 1RK1A 3LS4H 4K71B 1F3DH 4HUXA 3RPIA 5HYIA 3NPSB 1RJYB 3U6RA 1PSKH 1X5AA 4KJPD 4XBEH 2PXYB 1XT5A 3GK8L 4GW1B 2X09A 3H9SE 4MB4A 4ODTH 1LGVA 4DTGL 1AJ7L 1NMCC 3BD4A 4GG8B 5IEHB 5I8EB 3JWDL 1MCCA 1Z5LB 5EIIA 3SGJC 4EQ3A 2N7AA 3SE3C 1B4JH 4XNUH 1FN4B 1A0QH 1T4KB 2JJTC 4BZ1H 4XWOD 1YMMD 2Z93A 5GGTA 4MX7A 1AKJB 5F1KC 4YQXL 2R4SH 5AZEL 5GS3A 3ARBC 2HRLA 3TYFA 3L3KA 2X4NB 4CVXA 4F15B 2ATPA 3VXUE 3MACH 1VENA 3O2VH 4R6UA 5HPOA 2JLLA 2QR0A 5AYUH 1Y18A 2YEZA 2NNAB 1KXTB 1OF2B 1A7RH 4ODHH 4JZJB 4XNMA 3LPWA 4OSUH 1WC7B 1HEZA 4EI6A 2BMKA 1FBIL 3GMPB 3NFNB 4JM2A 5GGTL 5D5ME 1S9KC 4KK9D 1IVLA 3LQZB 4D2NA 1GH7A 3LS5H 5JW5A 1XF2B 3QB7C 3TCXA 4IBLT 1YMMB 3CDGB 3VFSA 3ISWA 4P5MA 4WEBH 5EBWB 2ED9A 4NM8L 5ITBL 1KB5H 3STZA 1YEHH 4XVUC 5EZJA 4XHJC 3TFKC 1IGJA 5IMOA 1E6JL 4A2MA 3C9NB 4S0TD 1GGTA 3T0EC 1U8LB 1QSFD 2VC2H 4GQ9H 3M1BB 3F58L 2BOBA 3GM0A 4LLDA 2D7MA 3VXTB 3F62A 5J13B 3MV7B 2JJWA 2O93L 2XA8H 2ZSWA 5HYJD 1T20A 5K9JL 1S8DA 2BVPB 1TZGH 2YBRB 3NCJL 4F3FB 1M7XA 3R06A 4JY5L 3TH4T 3VG0H 5I1HH 5F8RC 1F6LL 4ZPTA 5HHVL 4OKVB 4O2CA 1J05A 2IH1B 4KPHL 3SJVE 3T1FA 3RWFB 1OAQL 1I7ZB 2VXTH 1GHFL 2P8PB 4XRCB 5HDQL 1ZEAH 4AK1A 1HXMB 2Y07L 2HLAB 1N59A 3QIBC 4KTEL 1P6AB 3EO9H 3SKOB 3ES6A 3IRZA 2VABA 1DBKH 3X12B 4BJLA 2YSSA 3B2UC 5SWSB 1QSFB 4UDUB 4M1CD 4YXLL 5BZWA 4G9DB 2ZUYA 3ROLA 3SGDI 4LHQB 4LNRA 5D8JL 4BZYA 2RR3A 5EBLA 1NGQH 1KFAH 2R9HD 2CKNA 1MAMH 1TITA 4U6HA 2EEBA 4BUHA 2O5XL 1TETH 2C4FU 2NY3D 1TTUA 2EE9A 3LRHA 3OV6A 3U6RB 1JMZA 2VZ1A 1KCSL 2GJZA 2XZCL 3I2CL 1OD7A 4YHLH 4I48B 4QRRE 4FZ8L 1T22B 1LO5A 4GSDH 3EHBC 4WFGD 3HUJF 1ETZA 3O2WH 4H8WH 2W60A 4XVJL 4TUJB 3MA9L 1WAAE 2EXYD 2PTTA 2F53A 4JM2D 4GBXB 4ZMAT 4YAQA 3VFVA 4V1DE 1ZVSB 3FT4B 3ROOA 1JF5A 2VLKB 3QXVA 3IAGC 4YHKH 2IPUG 2FEDD 4IOFD 3PGFL 4TNWK 1DE4A 5FYJE 5JDSB 3IDYC 3R1GL 3L3KB 3GHEL 3NVQA 4AL8H 2ATPB 2FJGB 4Y1AE 2D4FA 2QR0B 4KHXL 4MS8D 2LV4A 3S7GA 1IQWL 1FORL 3T4YB 3X14A 5L8KB 3CVIH 2LABA 5LWYL 5EC2A 1WWCA 4LPUA 3V6ZA 4XNMB 1HEZB 4LARH 4EI6B 5L7XL 1H3UA 2HP4A 2ADGB 3S36X 2EIBA 1UZ6E 1MCLA 5GHWH 1BEYH 3BAEH 4U2ZA 2Q86B 1UWEL 4ODBD 1UJ3C 3TLRA 1KTDA 1XR8B 2WBKA 2APVA 4ZAKA 1MFBL 4RAUB 3VFSB 3D85B 4KC3B 4P5MB 4UINL 4O2EA 5EZJB 4CDHA 2OJZL 1U95A 3RZCB 2NZ9D 1AR1D 3UAJD 4EDXB 8FABA 5KSBE 4D8PB 2I9LA 4ZFOL 4LDOB 1GCFA 4U31A 1I3GL 1HE7A 5KZCD 5KSUA 4J7RA 3DOSA 2Y23A 3OKYA 5HHNA 4KKCC 5MEQB 3I6KB 3RIFF 1LDPL 2OXGA 1G9MC 1EBPA 5FDWA 3T1FB 5CBAA 4P9HC 4WU5A 5EOQH 5GZOC 2ZUVA 3BJ91 1WAAA 3Q48A 2EDDA 3DV4A 3DURB 4U49A 5IROC 3RL2B 4OZHF 4XGZB 2VABB 2PN5A 2NY0B 3D18A 3TBYA 2VQTA 4ZTOL 4MXQC 4HJGA 2HYMA 3UZQA 3MLVL 3QA3A 1E6OH 2L7JA 5DMIL 4OM0L 2F53D 4XNZC 2VL4A 4FQCH 5EBLB 5C2UB 4U6VL 1X5FA 3GBMH 3RVWD 4U6HB 3RX5A 3MLXH 1FH5L 4MA1C 1JWSA 3ARDA 4UIKL 5HBBA 1CFQB 1BQHA 1MFDL 1BZ7B 1NCUA 4PJ9A 3VDCA 4DK3A 1RZIA 1NEZA 5EN2B 3OKOA 5F93C 2GJZB 2B0SL 3SPVA 3CZFB 5FYJL 2LTQB 5FV1L 1CI5A 5D7IA 3UZVB 5C08B 3W11D 2MTPA 5DT1L 5IEKB 4K3GA 5JXAL 5ADPH 5C71A 1C12A 4H88H 4NQCE 2FR4A 2X89A 4HWEL 4O02L 5EU6B 2PTTB 4Z95H 4MA8L 2EEDA 2H32A 3JUZA 2BNUA 2IBGA 2BSSA 5F1NB 1IAMA 2GW5A 5H2BA 3H3PH 3QG7H 2AVGA 2QJDA 5J12C 4ZAKD 4RMWA 5IMLB 1JUFB 1MFAH 3TZVC 3EYQC 3LKRA 1DE4B 2G9HB 1BJMA 5BMFH 5IF0B 1FSKB 3NIDE 2OL3B 4O4YH 1YN7B 2KPNA 1KCLA 1MFCL 4I0KA 4UTBL 3QHTC 4QEGA 1N64H 5EU7E 4JG0L 4LQ1A 1JN6A 2ED7A 1GZPB 5D2NB 2JB5H 4OCYL 2J8U<