4JFEE

Preservation of peptide specificity during tcr-mhc contact dominated affinity enhancement of a melanoma-specific tcr
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
245
structure length
245
Chain Sequence
MSQTIHQWPATLVQPVGSPLSLECTVEGTSNPNLYWYRQAAGRGPQLLFYWGPFGQISSEVPQNLSASRPQDRQFILSSKKLLLSDSGFYLCAWSETGLGMGGWQFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title T-cell receptor specificity maintained by altered thermodynamics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 49
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jfeE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jfeE01
5HYSA 4LSSH 3ME0A 5FYKL 5DI8A 1LNUA 1A6ZA 4XB7A 2X4PB 1J8HB 4LLMA 3TCLB 1YMMA 3KR3H 3VFSB 3UYRL 1W72H 4XNZB 2VXVL 2BCKA 3DMMB 5CP3H 3IJHA 1DZBA 3WS3B 3U1SL 3DVGA 3P9LB 4Z6AT 4QTIH 3W0WE 3HPLA 3G6AA 3H2WA 3DRTA 3WJJA 3SGDI 3RWIA 5FYKD 1A9BA 3VMNA 2YPKA 1C8PA 5F6HI 2XG5A 3VDCA 2YK1L 1JF5A 4RWYH 3X13A 2V2TA 1T5XA 3ULUE 4YXHL 2AEQL 3DI3B 1RJZA 5H94A 3HE6A 1J0HA 4U1MB 1VDGA 5F1OB 1VGEH 5DS8B 2AAVA 4F2MA 3V6OA 5EOTA 2R39A 1OAZH 5HGDB 1U3HA 4S1SH 1A9EA 4IIQB 4PJEB 4JREB 4CJ0A 4AQ1B 1T4KA 1QSFE 4QOKD 4X7CC 4AJ0A 2QEJA 1BMGA 1YEEH 4JN2A 5DMGC 1XR8B 4Z5RB 1I7TA 2D03H 3MV7E 4ALAL 1YEHH 4KMLB 3OGCA 3MGTB 1CFSA 2AV1B 3PP3H 4PJ7F 4CL7A 3VGAB 4YHNA 1CF8H 5ALCL 1NFDB 2DI9A 3EO9L 4J12A 5TE4H 3O6FD 1A3RL 3ARFA 5BW7A 1N8ZB 3QDGE 1C5BH 1B3JA 1QSVA 2EDXA 2UZIL 4PGDA 2P7TA 4IDJH 2AP2A 3WFBL 3P4LA 5BV7B 4AQOA 1UM5L 5DT1H 2XWTA 5HYQA 2ESVB 4JM4L 3MSPA 2XNAA 3CFKA 4TNVK 1MIEH 3MRMB 4P3CH 1KG0A 4YFLI 1V3MA 2O5YH 4GKSA 3DO7B 2LAAA 1EO8H 1N0XH 4X4MA 1KN2H 1HI6A 3C2SA 5L8LB 1N2RB 5IB2B 5BRZE 3QQ3A 5ILTL 2FNBA 1G6RL 1HWHB 3VWKB 1MCOH 4LNRA 2VIRA 2XN9B 3MNWA 4G80B 1AXIB 1CFTB 2OR7A 1MCWW 3VWJB 3GSVB 4BQCA 2DLFL 3PGDB 4PRDB 1T5WB 1CZ8L 5IVXA 3DO3A 4IRJA 3QP3A 1CXHA 3BISA 4PJ8C 2GFBA 5MI0C 3CVHL 2CPCA 4NKMA 1M71B 1YDPB 3BGMA 1U8HB 5J9PB 2X1WL 3CFEA 5IJVA 1ZK9A 4M7JL 1AIFA 3I6KA 3L95B 1J10A 3QXUA 1WEJH 1R3LA 4BQ8A 4DZBA 5MEOA 3PQYD 4HIJA 2HTKC 1F3JB 1IBGL 2MMXA 3B43A 2BNQB 2ZCKL 4U1NB 3RPKA 4H1LB 4KROC 4OGAC 4OSUL 3ULUC 4ZOBA 1NDMA 1I7RA 3QEGH 2A9MH 1ZHNB 2V17H 4LQFL 1NC2A 1UZ6F 3HS0A 4NO3A 2DI7A 4S1RH 4P3DA 4LCWD 3KG5A 1U92B 1PJ9A 2IALA 3GI9L 1G7IA 4GMSH 1XF3A 4QXGH 5CD3B 3BIBX 3P4OB 3G5VB 4M1DH 2GEEA 4DAGL 2ARJB 4XNUH 1WK0A 2EH8L 1KB9K 1ZSDB 3EYUL 2NXYB 3BUYB 5FUZL 1RUAH 1Y18B 1CI5A 2GK0A 2OL3H 5T3ZD 1JNHB 1XIWD 4UI2A 2EYSB 4LCCA 4XP5H 2JJSC 2FHBA 3P0VL 4YHKL 2YA2A 1E4XH 3WJLA 5FO7B 2DICA 5FKAA 1BLNA 4GG6F 3PP4L 4UDTA 4PLJC 2K1MA 2I9LB 2I60H 1EGJL 4JO4H 2C1PA 3ARBC 2WV3A 5E99H 4Z7NF 4PP2B 2VDPH 1T0NB 1HIML 4QHLA 2R4RH 3I02B 4NQTA 1R3KB 3WUZA 1WZMA 2OTUA 3EDFA 2Y07H 4DN4H 3TPUA 4UT9H 2FGWH 1CU4L 5ID0B 4LSQH 1NBYA 5M7QA 4JQVA 4HUXA 4RNRA 5D7KD 2XRAH 1P6FA 4Z8FL 5D1ZD 1DN0B 5TDNA 1U8LB 4KVCH 1JGVH 2R4SH 3HFML 4WUUB 3IB4A 1HXMB 1WFNA 3MRFA 4CMMA 2VLMD 4NWUL 4FTVD 2NQCA 5AZEH 3CSGA 3UDWC 4G8GB 1DUYB 3VXPB 2LABA 3SKJH 4M48H 5DJ0B 3U7YH 1L0YA 4XVSL 1OAQH 4LLDA 3ZDZF 7CGTA 5CWSA 2PXYB 4U0QB 1KJMA 3RGVA 1ZHBA 2D7TH 4LRNL 4PJAE 5HDBE 3H9YA 5FYKH 1V7ML 4JJ5A 1ED3B 2GY7B 1YC8A 2O5XL 3LSOB 3F6LA 3U0WH 3UYRH 1MJJB 4DVRH 2CLZA 2VXVH 3VJ6A 5I74B 5TDPB 3T0EB 4WW2F 1X6NA 4YDVB 3HZMB 2YKLL 3ARZA 3DRQB 4R96A 5CP7A 1S5HB 5CSZB 5LVEA 3QEQB 5FDWB 3QDAA 5B38G 3DETC 5C07E 2XTJD 2AXJA 1JPGA 1S7RA 3FAXA 2P5WD 4F7MA 3MRDA 1YN6A 3D85D 1IM3B 2LVCA 4NJAL 2XZQL 4QRTA 1Q9LB 3QDMB 3QAZB 2P8LA 2YK1H 3W0WA 3T1FB 2GAZA 3MUY1 2R0ZL 1LVEA 1A47A 3QIWC 4XCEB 2AEQH 3X3FL 4JO3H 3VXSD 3VD9A 1B0RA 4CVXB 3ULVF 3TIEA 1UB6A 3EFFB 5I1AA 4OQTA 1TQCB 5B38A 5JW5A 5KSAB 2NY4B 2JJTA 2GTWB 2ATPB 2LVEA 2R1XA 1QACA 5E00A 4OZIB 4D2NA 2X4QA 4Z77A 1BFSA 1DL7L 3QHTC 1JNJA 1E0OB 2BVOA 3VFUB 2EECA 4MAYC 4KTDL 3TZVA 1IGYB 2OQJB 2ED8A 3BN9D 1K6QL 4ALAH 4JDZA 3AY4C 4XCNB 2HVKA 4MX7A 2XY1A 5CJ8A 4PJ9D 3DYMA 1QSFA 5ALCH 1KJ2L 2Z4QB 3SKNB 5EPMA 1MI5D 2BVUA 1TZIB 2UZIH 1EVTC 4MVBC 4PRPD 1XGYL 1PYWA 4Q58C 2WWKO 3WFBH 3C9NB 1KTDA 1KB5B 1OARH 1UM5H 3SDXE 4JFEB 4PRID 4F33B 3OGOE 1AO7B 2ZZUT 3RBGA 5JHDD 4BSWB 5DVNA 4P2YA 3M45A 4MNGE 4U3HA 1TITA 3SPVA 4M61B 4JZJC 5FYLL 5JQ6H 3I2CH 5EIVA 4BK5A 4LPYA 5EBLB 5HYIA 3NPZB 1CLYH 1R3HA 4X6CB 5GHWL 1LE9A 5BVJB 1S9YB 2NY6B 3JWOC 2D4FA 2HMIC 4ZODA 4L8DB 3IJSB 1G6RH 4P49A 1ZHLB 1X7QA 2D31A 2NX5D 4XPBL 3WDHA 4U3CA 5M94B 2X4OA 3GSOB 4KQ3H 1MH5A 4TULL 5CD5D 3KPSA 3B3IA 4H88L 4NUGL 5BRZA 1T7XA 5SWZE 3ZO0A 4HDIA 3FQNA 1OTSD 5GS1B 1CZ8H 5L2JB 3GIVB 3L3KA 1OTUC 5TQ0L 3BDXA 5DJCB 1JTOA 3HCVA 4NKIL 3MV9B 5HDQL 3CVHH 4OUOA 5KS9F 4OZHB 3ZLQC 5E6IB 3SE3A 2QQKL 4NPYA 3B9DA 2R2BA 2PW1A 1G84A 3V5DA 1MWAH 4JM2F 4NWTL 2J4WL 1T22B 3BPNB 4HPYL 2BC4B 1IBGH 3RI5K 2ZCKH 2YRZA 4WDIA 5HGHB 4XNXL 4YK4B 2IANB 4P4KB 4W68A 1CK0L 5TDOB 4LQFH 4Q6IC 5I6XB 3DGGB 4HUKB 5DSCA 2WBJA 3STLA 4L1HA 1AGCB 3GI9H 3ZKMC 3ET9F 1OTTC 5HPOA 2Y5TA 4DEPC 3ZDXE 4LDEB 1ZGLB 3CD4A 3RRQA 1JNLL 4DAGH 5KSVA 3OAUL 3T77A 3B9VA 1IKNC 2FECI 4PTUA 3S5LB 2EH8H 2P47B 5CEXA 3WFHA 3EYUH 1VCAA 4O9HH 3OL2A 3FQRB 3BHBB 4JRYD 4NSKB 5FUZH 5FM5M 4UV7L 3MZTA 5KJRL 3SDDA 3OR6A 3PWLB 4G6FD 4K8RC 4OZGF 3IFPB 3P0VH 4XHQA 4YHKH 3MUJA 3G6JE 4OLEA 3RVTC 3QUKA 4FOMA 1ZWIB 4LSPL 5C0EB 4HUUB 3LQZA 4WTXA 2VAAA 3PP4H 5HPMA 3MR9B 4JVUA 5FYKE 1CR9L 4JQIL 1EGJH 3TBSB 3RWJB 3QUZD 3S35X 3VA2C 4HJJL 4XXDA 4PJGE 3AREA 1AR1C 1HIMH 3PNWA 3KJ6L 5L2KD 2J5LC 3SKMA 4CVZA 4IOFD 4M93C 5F7YC 1IGJB 3A67L 4X80L 2UWEE 1I4FB 1EBAA 1I9EA 3JV4B 4J1UB 5GGRB 5GISL 1T1XB 1Q9WB 1CU4H 4XRCA 5T1LB 3O4OB 4H20H 2FX9L 3DVNB 2EDTA 1E4JA 1QRKA 1ZA3A 3SEPA 4LP5A 4Z8FH 1W72A 3ZYJA 3MNZA 1MFDL 1HSAB 4JFXA 3S98A 2EYRA 5CP3A 4NT6A 4OAWB 3HFMH 1FVEB 3PHQB 4QOKE 3PF2A 4PTTB 2J6EL 4YX2L 4NWUH 2MNUA 3WSQH 4DKAA 1DCLA 2R29H 3QUXC 1QLRA 4ONHB 4X4ZA 3WBDA 2UV3A 4XVSH 3K0WA 1JJUA 3WO3B 3WL9B 2DWDA 1U8IA 4M9PA 4L8SC 1Y0LA 2EDJA 4XI5D 5F9OL 4LRNH 4FG6D 4K3JL 5I18H 1V7MH 1J0ZA 1TJGL 1P4IL 1T7YA 1JZ5A 2O5XH 3QZWB 4Q2ZA 3DV4A 3X14A 1B88A 2WUBL 3MOQA 1LO2L 4NBZB 8CGTA 4UIMB 2IEPA 5FM8A 3HC4H 4PJAA 1WIUA 5HHOE 4OLYL 2YKLH 4WUKH 4LPCA 1QEWB 3K74B 1DE4B 3MYJB 3RDTB 2RQ8A 1K4CB 3QISA 4WI3A 3D39B 4KJYB 4PRHB 2C1OB 4JDVB 4WTZA 3NCEB 1CDCA 4NJAH 2XZQH 3V6FA 3JUZA 3WKML 2DLGA 1B9ZA 1J12A 4XP4L 5FKPB 3SKOB 3BPCA 3VG9C 4CDHA 4LDLB 5C07A 2YC1A 2RIKA 4RMUA 4RGMC 1EXUA 1IL1A 5JDSA 1UWEL 2SEBA 1TCRB 3X3FH 2HJFB 2CR6A 1QTYT 3HAEG 5GGUB 5CEZL 5JPMA 2CXGA 4NIKB 4HGMA 5DJ2A 2X4NA 5SWSD 1QLEL 4R6UA 5JHLL 1FVDA 4WHYG 5BS0D 2YD8A 3GB7B 3GUTB 4ZUVA 3MMEA 4JO1L 4ELMB 2E3VA 1DL7H 3HI1B 1XCTA 3IFNL 4KTDH 5F7KC 1K6QH 4NBXB 1EEYB 1MCPL 3L6FA 1IE5A 1IGML 1H8OA 43CAB 2PNDA 3CDGA 3EO0B 3ES6B 1EH9A 4P4RA 2ZJSH 4ZXBD 1I7ZB 4CJ1A 2EDOA 2K9UA 3S3PA 4K23L 4F8QA 1XGYH 4J7RA 3UZQA 2FL5A 1OWWA 3TH3T 5DHXB 3RIAF 3NIGE 3LDBB 1HINL 4W6WB 1F00I 4R97B 5FYLH 5FUCC 3MC0A 3TA3D 2NY3B 5GHWH 5E5MB 2Y9RT 4XPTL 2YD4A 5A43C 2OJEB 3BDYH 2DKUA 5HHQA 1DR9A 1I9JL 4MNGA 1P7QB 4XPBH 2HP4A 3FQWB 3S4SA 4PJFF 1CQKA 1N6VA 4TULH 3NBNA 2Z93B 1IZJA 5D7SL 4Y5XA 4H88H 3VXQA 4NUGH 3A6CL 5DJAA 1KPUA 4IIQC 5AYQA 1ZLUK 3QDJD 4MCZA 1R5WA 4GSDL 2PYFA 3IDMB 3O11B 5TQ0H 3PGCB 5BMFL 4P5KA 4XVJL 5GSVA 4NKOB 3SKUD 4XPFL 4NKIH 5HDQH 1MAML 5IFHL 4TSCL 5SWZA 2FLBT 2QQKH 5INDA 3SDAB 4X9IA 3TPKA 2YD3A 3ZT7A 1A14L 3T2QA 4CN1A 4PJIF 4GKZA 5GZOD 2ICES 4NWTH 2IH1A 2LE9A 3H3KA 2J4WH 1HZHL 5IB5A 5D7KE 3P4MB 4HPYH 5KG9A 1ZGLP 2OL3A 4YHZL 3QCUL 1A3QA 1AGBA 4HZAA 4XNXH 2YA1A 3O3EA 1UH3A 4XVTL 1A1OB 1CK0H 1SY6H 4NFBA 4FP8L 3CZFB 4FTVE 2B39A 1KJVA 3D0LA 3B2VL 4N8PA 2AK1H 5FA3B 4K7FA 3HR5B 4L3CA 4YZFF 5IMLB 1UKSA 1JNLH 3ZE2E 2ERJB 4JHAH 3QJFA 4AMKH 1BZ7B 3BP4B 1RZ8B 3HZYA 1PDKA 4X4YB 5E8EB 4EIZC 1JBJA 3W81A 2D7PA 5I1JL 4KFZC 3HG1D 5KJRH 1J0KA 5EU6B 3TYGL 1SEBA 2B4CC 4WWKC 1KB9J 3ZKND 3WNMA 3BI9X 2E9WA 2WINB 1A64A 4KKAD 4UMGA 3G04A 4LSPH 5E2TL 3RFZC 4D9QD 1EO7A 5INCA 5BZDA 4OIIH 4Q9CA 3WXVL 4V1DA 2EE6A 1Q9KB 5EC1B 3DYPA 1CR9H 4JQIH 3M17B 2P5WE 4QRRD 5D1XA 4R9HA 1R3IH 3TVMA 2PO6D 4HJJH 3G6JA 4L1DA 2F58L 5F9AC 4HZLA 4U1IA 4XP6H 4GG8A 2ICEA 4EZMA 1XCQB 1T0MA 5ESQB 1XF1A 4HWUA 1DQDH 5GISH 4FFYH 3DX7A 2RFXB 3MXVH 1H5BB 3QI9D 1UXSA 2D2OA 5T1DL 2DRUA 4PJGA 4QGYA 2DF3A 3CH1B 4NO2B 5F3BB 1CT8A 4Y4HB 2B1AL 3PHSA 5C0BA 3THML 1MFDH 5D7JA 2UWEA 5E9DA 1YY9C 4U1KA 2Z0BA 5LGHH 3EW3B 3K7UA 3IKCA 1Z6JT 2AJUH 4YX2H 2BY2A 2ZNXA 4P2OB 5F3HA 4E41B 4NUJB 1CS6A 4NKDB 1AGEB 2VXTL 5KVFH 1M05A 2WAHA 4ZFZB 2W07A 1O7SA 5F1NA 2H3NB 3U0TA 1TZHA 2VL4A 1XMWA 1RQ5A 5GQBA 4BFIA 5ACLA 3S3SA 5F9OH 1MI5E 3K4DA 3KAAA 4PRPE 4K3JH 2I9TB 3QB7C 2HG5B 1TJGH 2JK5A 1P4IH 4I0PD 3RVUD 5K9KB 3RWGB 5GSRB 5D1ZC 5JUEH 2A6JA 1XF5A 2AXFA 2WUBH 3QNYA 4ZUTB 1LO2H 5JHDE 2YXFA 1LEGA 4NQUA 1S9KC 1I8LA 3TYFA 2A0LD 3C60D 4OLYH 2ZKHL 3EIFA 2J8UF 4HIHA 2AKRB 3BSZL 5KSUB 4LQ1A 5J3HD 1OGAE 5A16B 3T3PE 5K9QG 4M8QA 1EV2E 1KT2A 4HBCL 1HHHB 2C3HA 2NX5E 3LZFL 4R7DA 5D2LA 1D5XA 5HHOA 1S7XB 4M5ZL 3WKMH 1A6AB 3VRIA 4XP4H 4WEMB 1KFAL 3I9GL 3BW9B 2YUVA 5FYJD 2BY1A 4NC0B 4U1HA 3BZEB 1RU9L 2YOCA 4MD0B 4N9GA 4MMZC 4AYFA 4YHLL 2DYPB 3EZJB 3BH9B 3QUYA 4CNIB 1YYML 4HS8L 1U95A 1ZLVK 5C6TL 2X1PA 5JHLH 1S7UA 1FNGB 4KUCF 2HVJB 3QCVH 2HAZA 5EUOE 4JO1H 1FYTE 2Z9TA 2ZCLL 2QQNL 4UV4L 4WO4D 5JA8B 3RIFF 2JTDA 2XTJC 3KHQA 1WBXA 5CJOL 4HH8A 1GOGA 3OHXB 3F6IA 3MRPA 4LLVB 4P23D 3MRCA 3RPIB 1G6RA 1MCPH 2EXYD 4TTDD 2KDGA 1P7HL 5I30H 2ITDB 4F7TA 3RZCB 4HWZA 3KWWA 3GSUB 5DTFB 4O51A 5I74C 1YJDC 4F80A 5D2NB 3DUUA 3HZKA 4FQXC 1U8PB 1ZS8A 5FK9A 3TLRA 2NY0B 2CIIB 4LKCB 2FEEI 4U6XA 5F21B 1U3JA 1INEL 3AXLB 2VLRB 5ENWB 1BZ9A 1SM3L 3CVHA 3DVIA 3E3QC 1AKJD 4MSWB 3W11D 5HHMB 1HINH 3ARGA 3CX5K 1RMFL 2E7LC 3RVXD 3BN9C 4RRPG 5C0CD 5EULV 2X41A 1MWAA 4XPTH 3L7FA 4P5MA 3OBAA 1NGYB 4OGYH 3RU8L 3B2UD 3MV8B 4U31A 5E8PA 3RNKB 4EBQL 3SY0B 4X6EB 5ITFB 1I1YB 2VDLL 1WZKA 1YUHA 3LKRB 5J13C 4M7LL 3TV3L 4MJ5A 5IMKA 3TO4D 3FQXA 3MOBL 4GSDH 1N5YL 3X12B 1AGDB 4EUPH 4MD4B 1XIWA 5BMFH 4XVJH 4N9OB 3BEVB 4XPFH 3RVWD 2M2DA 3QO0B 1MAMH 1ZGLM 4MA7L 1UH2A 4L4TD 5IFHH 4TSCH 5L2KE 5I1EL 4LBEA 3O41B 1A14H 1IEBB 3EGSA 4JFOB 3GM0A 3V4UL 5C2BL 5CZVL 2P46B 5FO8A 2Q76A 4M03A 3DROB 1HZHH 1K4DA 1D5IL 3EHBD 3EOYG 5I8EB 5I1LA 4LOUD 4D8PA 5CD5C 4D0CA 4KPHL 2AJSL 3BKCL 3MRLA 4GRLD 4NOBA 5J11B 4GG6B 1TXKA 1OTSC 5ITBH 3L5WB 2NYYD 3TNNB 3QNXA 2FH6A 3LKQB 4FP8H 4MD5A 4CKVX 4X4XB 2AV7A 3IDNB 3T8XB 3U2SA 3JWDL 1EGJA 1JWUB 2IFGA 5CZXD 4PJCE 5CJ5A 3VXME 3QQ9D 2W9EL 5D7LA 4X6FA 1U8QA 3OXSB 3L3DA 2EYTB 4PY8J 1I3RB 3CPLA 2HKFL 4MGXA 4OM0L 3V52L 3OAYK 1U91A 1H0DB 4WHTB 3U46B 1KPVB 5IJKC 5B8CA 4RGNB 4FN0A 2R23B 3BWUC 4O2CA 4IM8A 4X83A 5DHYB 5F93C 3WFCL 2I07A 1LEKB 5I1JH 1JE6A 1R0AL 3C5JB 4A2LA 5ADOL 1Z5LB 5D6DA 3TYGH 5CLTA 5DVOA 1MCKA 1QSEA 2I27N 5E2VL 4JB9L 4ZPTA 3CZJA 5E6IC 3D9AL 1UYWL 3SO3B 1B0GA 3MLTB 1C1EL 4J4PD 1N3NA 2VNCA 2CLVA 3JXAA 1Q8MA 1OAUL 2F53A 3V7AE 5A3ID 4KQ4L 1YNLH 2V7NB 4ONGL 4PR5A 2F58H 2VL5A 5DHVB 3HLAB 4YK4C 4CUCA 1T6WA 3IS1X 2VZUA 5E1AB 4X6DA 4EI5D 3B8SA 5IB3A 5I6XC 5DVLA 2DS4A 4WW2B 5J12B 5T1DH 2PYEE 1FNEA 5ALBL 4LLWB 1KENL 5JO5B 5SWSE 3OG4B 5CJQL 2B1AH 3UC0L 4TRPL 5BS0E 3THMH 4GQ9L 1MHHB 1IVLA 1T04B 3KNBA 3B9KD 5HI4C 3AS2A 2BOCA 2DQDL 1DVFC 3NIDE 4OD2A 1SJHA 1TPXB 1ND0A 5HTSA 1BIIB 2FLRT 4JKPL 3QUZC 4P9HC 1MFCH 4NCC1 2VSDA 4K07A 4JGJA 4ZG1A 4I5BB 1SJVA 3KYMB 1DP0A 1LO0L 1KPRB 3KYAA 3W5NA 1VFOA 5DJZA 1F3RB 2B0SH 1G7QA 4MXWH 4LF3A 4NQDB 4W4NA 3DUSA 3ZYZA 4L29B 5MEPA 1E4WL 3LV3B 5BOPA 3EO1A 4LCIL 4UAOC 4KXZH 5C9KA 2CKBB 4PRPA 3X17A 2ZKHH 5ERWB 4D9LL 5C0DB 4WEUD 3BSZH 5IGXL 5BJTB 3IETA 2VTFA 3TT3L 2GTZB 4G42B 1FL6B 5F97E 5AUMA 1T1YA 3O4OC 1Z9SA 3FO1B 1XGRA 4HBCH 4R90H 2BOBB 5EFIB 3MACH 3LZFH 4M5ZH 6FABL 5IF0B 1OT2A 3W9EA 4RGOL 3LMJL 5F9JA 2OK0L 1OGAA 2VYRE 3ILQD 1JUFB 2E27L 3QDJE 4PY8I 3UTQB 1RU9H 2R0KL 5HVGB 1NJ9B 5L8KB 3U7WL 1I9IL 3RAJL 2NX5A 4QWWD 3ZHLA 5L6YL 3MCG1 1YYMH 3QXAB 5C08B 1PSKL 3SHSA 2OXGA 3UYOD 3PWJB 1FV1B 4OLVL 3MLUL 1YMHB 2QQNH 3R06A 4UV4H 5D70L 1A0QH 4M02A 4KXZI 3ARUA 5CJOH 3V2AR 3VXOA 5HYJE 1QO3A 4E5XB 2V2XA 4U2YA 1CD0A 5F9WB 5I8OH 2FJGB 3CDCA 2D0GA 2I26N 3WUWG 4BH8B 1YEKL 3C6LB 5ISZE 1FYTA 4YBLB 5ESVB 3IDIB 2P44B 1CD1A 4Y4FD 3VW3L 1AFVH 3MJ6A 2MWCA 5E5UB 4G6KH 3MRHA 5CBEA 2MQ0A 4QHKJ 3S35H 5EO9B 1CLOL 4ZUSB 3RDTC 2Z91A 3SGJA 3WHE0 2JIXA 3GJEA 4X5XA 2DKMA 4FQPA 1INEH 3IVKA 1AJ7L 1SM3H 4PV9A 4QHNA 2P24B 5JXEA 4PJ5B 5CCKH 1AHWB 1HKLL 3GBLA 4ZAKA 4NFDA 1RMFH 1G9NL 3ZT5A 3ARDB 5ICZB 2VLKD 4OCMC 5ICXB 3ZMRA 4WFFE 3VGBA 1NDGB 4FQHA 2H6PA 3RU8H 2BSRB 2JB6B 2VXQL 4XCCL 4O2EB 4AK1A 4ZXBC 3F58L 4TUJB 4WNQB 1H3TA 5CZKA 1KIUA 3HR6A 4EBQH 3GMMB 3VFTA 4O58L 3WNKA 2OSLA 1XGUA 1SY6A 5GGTL 4M7LH 3S34L 4DGIL 5IOPA 2VLJB 4D9QE 3F62A 1RJLA 2VZVA 1VEOA 3OR7A 4P2QD 3MOBH 2DLTA 3QFJB 3BXNA 1J0JA 5HI5C 4UTAL 3UJJH 5DUML 1X5LA 3BKJL 2CDGB 4MA7H 1Q9OB 5TE6H 3ALWA 4IRSA 4P46A 5IM7A 4UILL 4L3ED 1KCRL 5I1GL 5C92A 3E2HB 3V4UH 5CZVH 5C2BH 4Z7OF 1JF6A 1MNUL 5I0DA 2XZCH 2NW2A 1F97A 2JB5L 3WS6A 1D5IH 4QXUL 1HDMA 1HYRC 4KPHH 4G9DB 3BKCH 4RZCA 4IHOB 3MLWL 5BQ7B 4LHUA 1F8TL 3N1QC 2Z92B 2V9QA 5K9OA 1ERNA 2QADB 2XWBA 3MRRB 5FYKU 3MRQB 5E94B 3FO2B 1A6TB 2F74B 4ZO9A 3JWDH 2IWGA 4B7LA 4NO0D 5E8OB 5FO9B 3EYVA 1WBZB 4JAMB 3SO5A 4DOHB 5GZOC 4NHUA 1GPOL 4OM0H 3V52H 4W6YB 2VDML 1HHJB 2QR0A 2N56A 4GW4B 3WFCH 3GK8L 3VXMA 3VXNA 1R0AH 2J7LA 5ADOH 5FECA 2Q1EA 2VXUL 1AQDA 3MBEB 4NHCL 2HT2D 5E2VH 3OF6A 4JB9H 4MDIB 5C0IA 1EZVY 4IJ3C 2YHGA 1FG2B 1NCTA 1S7QB 1JGDB 3STZA 2Y72A 4YBQD 3SDAC 3WFZA 4YFDB 2IADA 1C1EH 2YR3A 4NDMB 5DJ6A 1BQHG 2Y36L 3TO2A 5IW1B 1QRND 1UC6A 4QHKI 4XNQA 2D4DA 4NN7C 1WCBA 1WFTA 5AEAA 5I8CB 1ZLUH 1OAUH 3BX7C 4KQ4H 4JRXD 1BVKB 4HUMB 1D7FA 2UYLB 2J8HA 5IVXF 3TN0B 4JFYB 1D9KB 3TNMA 3MV01 3RHWF 4TSAL 5DFTA 5GGSB 2DM4A 2R1WB 4KI1A 3LKOA 4NJ9H 3DGCR 3LKSB 4ZOAA 5C09E 1VSCA 3U83A 4LAQL 4FFZL 4PJ7E 5LBSL 4GBXB 5ALBH 1KENH 4DKFL 3W39B 5CJQH 5F89B 4KKAC 1G6VK 4X8JB 4GQ9H 4EVNA 3KPNA 3OZ9L 1NCBL 4DQOL 4HIIA 4DUXA 2DQDH 2OR8A 2PYEA 1JPTL 4JKPH 1WF5A 2FR4A 4LLQA 2PO6C 5BS0A 3BIAX 5DD6B 4XMPL 3OKMA 2EXWD 5JDJA 4GUPA 4Y4KB 4F7CA 4ODBD 3ECBB 4XP1L 4XMLH 3O3AA 5E8DL 4BUGA 2FHCA 5E2WH 2BSSA 2Z31D 1JRHL 1WZ1L 3WLWD 2OS7A 1E6OL 3M1BB 5H37G 3RY4A 4S0TD 1E4WH 2A6IA 3MYZA 2WUCL 4OM1L 4WI4A 1JPFA 1ZA6B 3RTQA 3T4YB 4LCIH 2PXYD 1S5IH 5TGBA 4P5TD 4ZUWB 4D9LH 1KV3A 2K7PA 5IGXH 5J06A 5C0CE 1OVZA 4OCLC 4H25B 4UT6H 4PG9B 2YSSA 1OQOA 3O3BA 3CUPA 1HHKA 1X5FA 4NQED 4FXGA 1NAMB 1VFBB 2BRRL 1MCHA 2NLJA 2X4TB 2VWEC 4RGOH 5L0QC 2OK0H 2R0WL 4NM4L 3AM8A 1IQWL 3DTXA 4S10A 2R0KH 1T83A 2DAVA 3U7WH 4KKNA 1FZKB 1I9IH 3RAJH 3BWAB 3MA7A 3QFDA 3V8OA 5MHSD 4XCYB 1PLGH 4XPAH 1PSKH 3SE4C 1A21A 4L4TE 1ADQL 3MRNA 4PS4L 5D8JL 5H35A 4OLVH 1U8NA 3MLUH 5D70H 1UZ6E 4Z7QF 3K1KC 5LGJB 2BVEA 3MV11 4GQPH 1DDHB 3X11B 2DM7A 5DEFB 1CBVL 4ZSOE 5KSAD 1FAIL 3PWNB 3MNVB 1SJEA 3R0NA 1JPSL 3RKDC 2ADGA 1YEKH 3QG6A 5E8NB 5BV7H 4U0RB 1KB5L 5FV1L 3VW3H 4FMFA 4X7FC 4OJFL 5HYJA 3NCYP 2FBJL 1HE7A 3DSFH 1XF2A 1X5JA 3IAQA 4NGHL 4Z76B 4PV8B 1T1WA 3BZ4A 3CLFH 4EUPA 3RNQA 5ISZA 4P2RB 5IK3A 1T7VA 1J1OH 4U1LB 3C09B 3J7HA 3UPRB 1HKLH 4QHUA 3DX8A 2FIRT 1G9NH 4M8VA 4P23C 4HKJA 5JLZB 2EXYC 3FT2A 3BPLB 1AO7D 1U93A 4QY8A 3RY6C 1Z9OA 2WM0A 1QOKA 2VXQH 4XCCH 2VABB 5I9QC 3CX5J 4JCMA 4O58H 3IDJB 3UEZA 2YWYA 5I75C 1T3FA 1FE8L 3S34H 5GGTH 3NFPB 5DMKB 1GGCL 2BRQA 3ARWA 3JWNC 1ETZB 3W11C 4UTAH 2ZCHL 4FFWC 1TJHL 1PZ5A 5DUMH 1CICD 3VFNA 3HAEB 5EORL 3B9AA 1BD2D 1EUTA 1BFVL 3RVXC 2VKXA 1ZLVH 3U6RB 3P0YL 2GJJA 3IRPX 4EQ2A 1MNUH 1QQDB 3PUCA 4I48B 1F2QA 3CCHB 2NY0C 2JB5H 1HOCA 1KIQB 1W0VA 5EU7C 2I24N 1AP2B 3OQ3B 1IM9B 4Y19D 1BFOB 1EA9C 1H3PL 2H32B 5KVGL 2FZ3A 2MJWA 3ZHDA 2MCPL 3UJIL 1C12B 1G7PA 1F8TH 2RBLA 3IF1B 4KUZH 3TO4C 5FB8A 4Y1AD 1X3DA 3HC3H 3QJHA 5J4MA 3QI9A 5EC2B 4XTRD 4HK0B 5AD0B 3RVWC 1K2DA 2E7CA 5CGMA 4YDJB 3ZE1E 1ES0B 3AU1B 1DQJB 1JWMB 5F88B 3O3DB 3DV6A 3RWHB 2Q6WB 3NCMA 4HQQL 4HS3A 2BK8A 4HUWB 2HJKA 3VG0L 1DQQA 4LOUC 1J1XL 3QIWA 4GRLC 3LN4A 1NGWA 3WNLA 4BH7B 4NHCH 4KRPB 4FS0A 4ZFGL 2NYYC 3QWOB 4I0PA 3REWB 4G43B 1ULVA 5CZXC 1CGTA 3OJVC 3QQ9C 5D5MA 4Z78B 2ADFL 3CNKA 3C60A 5TF1L 3TBWB 4JFDB 4MQTB 2CIKA 5H2BB 2H9GA 5J11C 4TSAH 1C7TA 4QHMA 5IWLC 4WV1C 4BFEA 1UVQA 4Z18A 2MHAB 1SBBA 3ZKSD 4O2FA 4LAQH 2EEDA 1RY7B 3C5SB 5LBSH 4DK3A 2J8UB 1WGOA 1XGTA 4GXUN 4NYLA 1JHTB 2N7AA 3EYOA 2PKDA 3OZ9H 1NCBH 4DQOH 5IV2B 3BAEH 5C09A 4JKWA 4F7PA 1Q72L 2R56L 5KN5B 1KEGL 1DUZB 3VI3F 5C9JA 3QPQD 5IMOB 4PB9L 2DQUL 4XMPH 4M4RA 1FJ1A 4PJEE 4WO4A 1JTPA 3V6ZA 5ANME 1L0XA 5E8DH 3S88L 3QIUD 3UMTA 5JMOC 4OZFG 3JV6A 4OBRA 4EI5C 3FT3A 4OFKA 1JRHH 1WZ1H 1E6OH 3V5HA 1P9MC 2VB5A 4WRLA 4F7EB 3QDHA 4HX1A 3FZUC 2WUCH 4OM1H 1DJSA 5J1AB 1NFDE 5DDHA 1MCNA 5FHBL 5DVKA 5I71B 5GS2H 2ICCA 3B9KC 4PIRF 3LB6C 5TQ2L 5KVMC 3OKEA 3V4PL 4LARH 4D9RD 2UZYB 5C0GB 2Q3AA 5KZCB 3EBAA 5K59F 3PDGA 2ENYA 4Y5YB 1JK8A 4JLRB 1M7IB 2E9IA 1AKJA 1CXIA 3OKKB 1Q0YH 1OW0A 3MREA 2R9HC 5KS9E 4WW2C 5J12C 1U6AH 3T0VA 2L0DA 2BRRH 3RZWA 2EE3A 4KUCD 3RP1A 3DVFA 3ESVF 4XX1E 5C0CA 2Y06L 4X5LA 4CW1B 2R0WH 1JGEB 3S6CA 4NM4H 1IQWH 2AXGB 3TT1L 4P2QE 2CDEB 5FF6B 3WNOA 1DQML 4Q74A 3PJSB 1LDSA 1TPXC 1JRHI 1CWVA 3GSNB 4K9EH 1ADQH 2BX5A 4JPVL 1JF1B 1BZQK 4PS4H 5D8JH 1F4XL 4DW2L 4L4VD 4L3EE 32C2A 1E27A 3KLAA 5IFAL 3SDCB 3D3VB 2UY6A 3ULVC 3AB0B 4JPWL 4OV5A 4L4TA 1FAIH 5CHNA 3NZ8A 1EFXD 1P4LA 2LTQC 4ODHL 3BQUB 3VCLB 1KB5H 1FGVL 3N1PC 4OJFH 3OAZK 2FBJH 3GSRB 4QWWC 4HT1L 2M1KA 1TZGH 1UJ3B 1GGYA 4NGHH 3ZDYE 1PZUB 4Y16D 3LVEA 4EIGB 3T2NH 5KBNC 2AJ3A 3D69B 3NFNA 4AL8H 4MNQB 4L3AA 4DWHA 2FJFA 3CMOL 4MLSA 1I75A 3O8XD 2C3VA 1MQKL 1A1NA 1U8MA 3H6JA 5EUKA 4XMKH 3L3HA 4X5WB 2A83A 1F42A 3QCTL 4PJAF 5HDBF 3QQNA 5IESH 3EOBA 3ZKXB 2GSIA 1DLHA 4OCSH 1VKXA 1HH6A 1K8DB 3WEXB 4HF5L 5KSBE 2CRIA 2W91A 4QXWA 2BSTA 1FE8H 1CGSH 1L6ZA 2ARWA 3VD4A 1OOAA 4H8WC 5DXWA 4BQBA 3HI5L 3H7LA 4HHAB 4HV8A 8FABA 4QRPD 1TJHH 3FB6B 4JRXE 4NQCD 5F9WC 4L9LB 5EORH 1EEZA 1BFVH 2EDFA 4J4PA 4JVWA 5EA0L 5CMAB 5J7CC 2PW2A 3K4AA 3KXFD 3ZTNL 3VXUA 3P0YH 5HDLA 3NCJL 4G7YH 4A6YH 4FXKA 4XBPB 3OXRA 5EU4B 3U9PL 2DWEA 3BGFB 3G08B 2HJLA 1A2YB 3PL6D 4RFEA 4WI8A 5SWQB 4HKXB 1QHPA 5LG1A 5TE7H 5CIPB 2E8YA 2MCPH 5IBTL 2GCYA 3C5ZA 1PX4A 4Y5VC 5GZND 1AHWC 3VXTA 4JM2C 2C26A 3U48A 1FZOA 3KPMB 3KYOA 2FJHA 3VRJB 2W0LA 3F5WA 1A4KA 3ARDC 3FFCD 5MEQA 1FDLH 4X6BB 3JTSA 4MS8D 2PF6A 4UNUA 1FZJB 3KLDA 4L4JA 1MRDL 1GIGL 3OX8B 1EK3A 4HQQH 4PJBB 2OBGA 2Q86B 3LQAL 3PV6A 1X5YA 5T1KD 5I19L 3GMNA 3UBXG 3KPRB 1HCFX 1YY8A 5E2JA 4AIZA 2E9BA 5IBLD 4ZTPL 2C3WA 4DVBA 4ZFGH 2JKXA 4QRSB 4JFPB 1ROWA 1G7MA 3SDXF 2VAJA 2DMCA 3EJYD 3F12A 3VH8G 4RFNB 3HN3A 1HWGB 3BMWA 1KIRB 4JANA 3VA6A 1IGIH 1CDHA 5EBWA 4OLUL 4AEIL 3FCTB 4KKBC 2ADFH 4EEEA 4HFWB 5TF1H 4HPOL 3HE7C 3FMGL 2HKHL 2WK2A 2X4PA 4EN3D 3IGAA 5B22A 1RZGA 1IQDB 2HH0L 3H9ZA 2ITCB 4ZO7A 3L7EA 3V0VB 1FLTX 3DMMA 5MHSE 5ETUA 1EUUA 2HT2C 3QHZL 2VN7A 2DLIA 3P9LA 3QDME 4K3EL 2KH2B 2YPLB 3CSPA 3O2WL 4YBQC 1CL7L 1OCWH 2FB4L 4PLKD 4XZUB 3SQOH 1BVLB 3U30B 1KF9B 4B5EA 1Q72H 2R56H 1W0WA 2ZUWA 4Y4HD 3MO1B 3B5GA 3WHXB 4PB9H 4FABL 2F54D 2DQUH 4OT1L 4CGTA 5FUOL 1OP5K 2JF1A 4OZIE 5DVMA 5T3XL 1RHHA 4LPUA 3S88H 3ZE0E 3WYRA 3IFOB 4PJDB 4U1MA 4WHDA 2HFGL 2YA0A 5JW4R 2V6HA 3PWVB 2YUZA 5EZIL 5HGDA 4IIQA 5B39B 4PJEA 2R2EB 5FHBH 1FPTL 4M6NL 4PJFE 1XR8A 3E6FB 4Z5RA 4Z0XB 5TQ2H 4LPXA 3V4PH 3MGTA 3ZDXF 3HRZA 4U4BA 1JGLL 1ZE3C 1AO7E 1NFDA 2EXWC 3BPOB 4PB0L 1N8ZA 4LFHD 1EIBA 2FIKB 1TTUA 1A6UL 4GBXC 4WY7L 1FIEA 3WLWC 2Y06H 4YE4H 2EDYA 1F02I 2ESVA 2VC2L 3WXWL 2G2RB 1WSST 3JTTB 1PKQB 1DQTA 3MRMA 1VENA 1Z9MA 1DQMH 3QIBB 3R1GL 4MWFB 1A7BA 4UNTA 4XP9L 3DO7A 3G6JF 5DK0B 3EYFA 5IB1B 4ODUA 4F3FB 1LNUB 4P5TC 5T1MB 3O4LB 1N2RA 5IB2A 4RISH 1BD2E 3MRIB 4JPVH 4QLRA 4LVNB 1F4XH 1U41A 3QR2A 2YN3A 3VWKA 5IFAH 3IJHB 5K33A 4PJGF 5J6HB 3NACH 4JPWH 2XN9A 3MV9E 4G80A 1CFTA 3ARSA 3GBNL 3FB8B 4OZHE 1SYVB 3VWJA 3GSVA 3HPLB 2UWEF 4Y19E 1ITBB 3PGDA 1MQ8A 1L7TL 4WJ5B 5L88H 1FO0B 1I8MA 1T5WA 2AJVL 3LS4L 5C71A 4NN6B 5KANG 1FGVH 5D7IB 3DX9B 1X6LA 3QG7L 5KVDH 4Y1AE 4H1LG 4ONFL 5C0AB 1UH4A 3H3PL 5GGTA 4OI7A 3KJ4B 3PHOB 1YMMD 1PVHA 1M71A 1YDPA 5J9PA 1U8HA 4FQCL 4HXBL 1RJZB 2IANE 3L95A 3T1WA 4LLUB 3FN3A 1T1ZB 3NGBB 3RVVC 5FGCE 1UM4L 3JSSA 1F3JA 1MQKH 1YNTB 2BNQA 1HNGA 4UQ2B 4U1NA 5DD5L 4NO0A 1IARB 2W60B 4H1LA 4HLJA 3FRUB 4U1GB 1ZHNA 2XY2A 2AW2A 3CFBB 4FHBD 3G5YB 3OGCB 4GS7B 2E7HA 1C5DB 4HWBH 4GJTB 4GXUM 4HF5H 4IMKC 4BJLA 5GGVL 5CD3A 1BREA 5IHZA 2LU7A 3P4OA 3HE6D 3G5VA 3HI5H 1Z2KA 1J88A 2EDQA 4C54A 2WIIB 1I8KB 1O0VA 2FGZA 1PBYA 2P7TB 5AWNH 3BP6B 1U3HD 1ZSDA 4F58L 4FFVD 5KSBA 5E4EB 4ORZC 3BUYA 4OF5A 2Y5EA 4MJ2A 1F58L 3ZTNH 2QTEA 1Y18A 1HK6A 4OKVB 1JNHA 4W6XB 3H9SB 3TGXA 2EYSA 4TPRL 5C3TA 4JRXA 4NRYB 1URLA 3FJTA 4I18C 3U9PH 4LGRB 4F57L 4UNVA 2QHRL 5FO7A 3ARFD 4UINL 3L3OB 3BVNB 4ZO6A 5IBTH 2I9LA 2P1YA 3KYNB 2NXZB 2CJUH 2IJ0C 1AXTH 4EKXA 4PP2A 1I1FB 2YZ1A 1T0NA 1CICC 3UJTL 1A6WL 1S9XB 2QSQA 3I02A 1U8KB 5E2UL 4N0YL 4HJ0D 2DL2A 4K55A 2FEDD 2IAMD 1OL0A 5ID0A 1GIGH 2W38A 1RK0A 3V8CA 4JQXC 4APQC 4N68A 1U3ZA 3LQAH 3FB7B 4PJXB 4JRWA 3ARTA 1DN0A 4NZTL 3DX6B 1U8LA 3HNVL 3I6KB 1HXMA 5KOVC 4ZTPH 2VDQL 4P48A 1R3LB 4L8CB 5HBBA 1DUYA 4JN1H 1NBZB 4RA3A 3WDIA 2OJZL 4XTRC 4RIRB 1YYLL 4D9RE 5DJ0A 5E7BA 3UTPD 4RGND 4NQXB 3NIGF 1NDMB 2PXYA 1U2CA 3TWCH 4N8VB 4AEIH 2OP4H 5IKCB 4LRIC 2H8PB 1U8JB 1KTLB 3PV7A 3FMGH 1ED3A 2HKHH 5E24E 2VE6B 3V79C 3LSOA 3OKNB 2HH0H 1MJJA 1JVKA 3D39E 4PRHE 3ZTJG 3T0EA 4YDVA 3HZMA 4KH2A 3DRQA 4RQQB 5F7FA 2A9NL 1S5HA 5CSZA 4K3EH 4ERSL 3QEQA 5FDWA 1XFPA 4MCYB 1NC2D 4KK8D 1R6VA 3V5KB 2Y23A 1UWXK 1IM3A 1Q9LA 3QDMA 2E7LA 2HTLC 1MRFH 1BLNB 4OT1H 5EZLB 4JY5L 5FUOH 3CFCL 4XCEA 1SYSB 4MQSB 1UCBH 5T3XH 2C1PB 2YD9A 4CVXA 3E8UL 3P4NB 2VZ1A 1GAFL 2E6PA 4XNYL 3T0WA 3EFFA 4QHLB 3NA4A 3L9RB 5KSAA 1I85C 4RBPK 2GTWA 2ATPA 1I8IB 5EZIH 2CKBL 3SDYL 5C0ND 3LRSB 4OZIA 1C7SA 4AEFA 5EWIH 3WCYA 3OKLB 4HW6A 1ADQA 1WZLA 3VFUA 4D3CL 1IGYA 3WHE1 1KSRA 2OQJA 4LSTL 4ZS7L 2BY0A 3H42L 4LPWA 5EU5B 5TDNB 3ZE2F 1JGLH 3BP5B 4G7VL 3Q1SL 2Z4QA 3SKNA 3T0XA 3ARYA 1BQHB 1ZANL 4NZUH 4URTB 2VISB 1TZIA 3QIUC 1A6UH 4WY7H 5CGTA 3C9NA 1KB5A 2V5SA 4JFEA 2KKQA 2X9XA 5DJYA 4F33A 2WNGA 1AO7A 5CWSB 1CFQB 3R1GH 1ZHBB 5HY9B 5D1QB 5TH2B 1XR9B 4BSWA 5I2IB 4C56B 4QRPE 2ZUYA 4M61A 4NQCE 5EBLA 4U6HB 4X6CA 1QPXA 2UVFA 5BVJA 1S9YA 4OFPA 4X6DF 5I8KL 4L8DA 3IJSA 3PDDA 3KXFE 5D72L 2XZAL 5EOQH 3R4DA 4BZ1L 2ORBH 1ZHLA 1S78D 3AVEA 3GSOA 4U1SB 2B2XL 4HEPG 5CP7B 5JORB 3GBNH 1BD2A 4FNLH 1YQVL 2PCPA 4PREB 2VR4A 5EIIB 1EMTL 1L7TH 3RGVD 1AD0A 2HFFA 5GS1A 3IXTB 3AUVA 4PJ8B 3LS4H 3GIVA 2AJVH 5L2JA 1FFNB 4YHYB 3MRKB 1ORSB 2I25N 3QG7H 2MTPA 3GHEL 5DJCA 5AZ2L 1H3GA 4G8IB 4ONFH 4QRTB 3MV9A 1LO4L 4OZHA 5KW9H 2M26A 4H26A 3HB3D 3INUL 4N1EA 1ZT1A 1GJIA 4FQCH 4HXBH 1RZIB 1BBJB 4OF8A 3IDGA 1MEXH 5ID1A 1B0RB 2EH7L 2XWJB 1NC4B 2FH8A 1DQLL 1AQKL 1T22A 1UM4H 4R0LA 2BC4A 3S5LG 2R1XB 3LIZL 5T33H 4KROB 5E00B 4JR9L 5DD5H 4Z77B 5HGHA 4OGXL 1EBPA 2IANA 1BF2A 4P4KA 3CDFA 2QSTA 5TDOA 5JPNB 3DGGA 1A7OH 4ORGB 5IB4B 1AGCA 2GJ6B 1UWGL 2HVKB 3VXRD 4AY0A 4Y16C 2Z35B 4G8EA 1TMCB 5HXMA 1ZGLA 4OCYL 1N7MH 1BP3B 2EIEA 3MV7B 4V2CB 3PXHA 4HCRL 4KHTL 1CLZL 1F5WA 1KTDB 3T3PF 3BHBA 1ACZA 1EO5A 1F58H 3QDGB 2VO5A 4TPRH 3U4EB 2X44D 2W92A 3IFPA 4DGYL 3I6LE 4F57H 4EDXB 3UO1L 4QKXB 4Z7WB 2QHRH 5CILL 5C0EA 1ZWIA 2X7LB 4HUUA 4GMTH 1U58A 4KK5D 2H2SD 2UVEA 1NBVL 3ARBB 3MR9A 2BXYA 3P30L 4N0FB 3RWJA 2XQBL 2G9HB 4GAGL 3TJHD 3UJTH 1A6WH 4Q0XL 3GKWL 4N0YH 1IGJA 5E2UH 3NCFB 2JLLA 1I4FA 3L3KB 3E0GA 3JV4A 4J1UA 5GGRA 1T1XA 1Q9WA 3U36B 5T5NG 5T1LA 3HCVB 3GMPB 3ZKXC 4KGJA 3TFKD 5DQJB 2D7OA 2R2BB 1HSAA 3PL6C 4NZTH 3GSWB 1MCFA 2IFFL 4OAWA 2VKWA 1FVEA 2W65B 3PHQA 2VDQH 4PTTA 1U0QA 4L9DA 1IMHC 3KPSD 5GZNC 5BRZD 4PYHA 1OHQA 4KY1L 4OLXL 2OJZH 1YYLH 1NAKL 4LLYB 1BX2B 2A74B 2AJXL 4MS8C 3I6GB 4UTBH 4FQLL 1MJ8L 5DHVH 4J3TA 4WFHD 1RIUH 2WBJB 3MQIA 4X7EC 4RMVA 2G5BB 1LWRA 1AGFA 3IDXL 4G6AD 5DJXB 2R8SH 2H26A 5I1HL 3QZWA 2EEAA 3CC5B 3O45B 4LGSB 4YNYB 4UIMA 3H7BB 5JA9A 1OAKL 1QEWA 2A9NH 3MYJA 3RDTA 4ERSH 3AMLA 1VESA 3EJYC 3P77B 1H3VA 3TN0D 1K4CA 4TNVF 1ITCA 4J3OC 1YNKL 2P43B 1CDYA 3D39A 3LRHA 5JW4N 4K71C 1CE6A 4KJYA 4PRHA 2C1OA 3O3UN 4R4FH 4OCXH 4PJHE 1PAMA 4AZ8A 2HLAB 1F6FB 1NFIA 5FKPA 3SKOA 1G1YA 1RI8A 3WIIL 4KDVA 3DPBA 4JY5H 1S7VB 5HPMB 4EN3C 2HJFA 5GGUA 2GT9B 1RSFA 1ZVHA 3E8UH 4X9HA 2Q8AL 4XNYH 3V95A 3PNWB 3AGVA 2WQRA 5DFVC 2PTUA 3SDDD 4RFNC 3GB7A 1EFXA 1RUPH 3SDYH 3VFVB 3GUTA 4RAUB 4ELMA 4UUJB 2X4UB 3HI1A 3GRWL 3S3JA 4D3CH 1RZJC 5FM5O 3NPSC 5D2NE 2E7MA 1EEYA 4ZS7H 3H42H 1NAML 3MLSL 2CSPA 2DLEA 1RIHL 2VH5L 3MLVL 4H0IA 43CAA 3O9WC 5DK2B 3FO0L 1RK1B 1CXKA 1KN4L 3EO0A 4FMKA 2VLRE 3ES6A 4G7VH 1I7ZA 3Q1SH 3ARED 1ZANH 4HGWB 1HCVA 1P4BL 4MHHG 4JZJB 5FGSA 3MV8E 3EYSL 3U30C 1HHIB 3U4AA 2CRMA 2OTPA 5E5MA 1A8JH 1YEGH 4EOWH 2UUDK 5I8KH 1NGXB 2XZAH 3O0RH 4KKCC 4QRPA 1P7QA 1WICA 3FQWA 4POZD 5FCUL 5EG6C 1T89A 4NQCA 2Z93A 4KMTL 4HWEL 1UXWB 1TJIL 4U6YB 4KKLD 1NPUA 4F9LA 4YGVA 4HXAL 3KXFA 1JL8A 3IDMA 3O11A 1INDL 4RAHA 3PGCA 4HWBA 3GHEH 5AZ2H 1OP5H 2FBOJ 3QWRA 1LO4H 1A3LL 3RL1B 4AT6B 4OZFB 3INUH 5C07B 5AAMA 3WN5C 2VSCA 4FQ2L 3CXDL 3NOIA 2HFTA 2EH7H 2R15A 1GZPB 1C16A 4J3SA 2A77H 2FX8H 1DQLH 1AQKH 1YEDB 3V4VL 4ZD3L 4WU5B 5IVZB 3P4MA 5MEND 3LIZH 3SCMC 1JI1A 5A2FA 4X9BA 4YIQA 3B6SB 5IROC 4OGXH 4Q6IB 5F1SA 3FN0L 1A1OA 1MHEB 3CZFA 1CE1L 4R2GD 1P2CA 1RHFA 4DEPB 1UWGH 4DTGH 4LVNC 5FA3A 1PEWA 3UTPE 3HR5A 4RGNE 2OR9H 5IMLA 1F3DJ 1WFUA 1FHGA 2P8MB 1GC1C 1OSZB 4HCRH 4G5ZL 1CLZH 1BZ7A 2BNUB 3BP4A 3UTOA 1A7PH 1RZ8A 2K3TA 1KC5H 4L5FL 3AAZB 4X4YA 5E8EA 1QFOA 5E7FA 3Q3GB 5EU6A 1MPAL 5JOEA 5C1MB 3MUHL 3KJ4C 3SDXB 4DGYH 2WINA 3UO1H 4XC1L 5CILH 4LSDA 4BQ6A 2AABL 3QH3B 1FLRH 2DMBA 2BMKB 4G8FB 5HHPB 1PW3A 1Q9KA 1NCCL 4LP4A 3M17A 2J88L 3P30H 1PY4A 1MJUL 4GT7A 2J5LB 4HJGA 2QLVB 4M93B 4M7KH 1TENA 3S37X 4GAGH 3V6OC 1OP3K 3W9DB 1U3HC 4OBSA 1NGQL 1P69B 3GSXB 4FFVC 3GKWH 5ESQA 4G9FD 4JHBA 3KS0H 4U1GC 2MKWA 2RFXA 5F1IB 5I15H 1H5BA 1GVIA 3P2TA 1UZ8B 3CH1A 4NO2A 5F3BA 4XAKE 4Y4HA 3UAJD 5DGRA 3QXDB 3WV0A 3IRZA 1T03H 3ARFC 2IFFH 5BW7C 4Q9RL 1BQUA 1S3KL 5TFSL 1WC7B 2NY2D 1RV6X 4P2OA 3QUXB 4E41A 4NUJA 5SX4H 4LIQH 5DD1L 4NKDA 4KY1H 3GI8L 1AGEA 5AYUH 5DURB 4I4WB 5E4EC 1A4JB 1F3DH 4M62L 3OJMB 3IT8D 4ZFZA 3SBWA 1TNMA 2IBGA 2H3NA 5DFWH 4HJ0C 5GS0L 4Z0BL 2FEDC 15C8L 1VEPA 1ZKAA 5SWZD 2I9TA 1T80A 2HG5A 1S7SB 5K9KA 2Y25A 3GIZH 3IDXH 5I1HH 5GSRA 4L3CB 5FOJA 3B5HA 4Z7QE 4ZUTA 3QJFB 5F6IC 5I17B 1RZKL 1W2KT 2AKRA 4TQEH 3BUTA 4QRQB 5KSUA 1ZEAL 3ARQA 4W4OA 4IRJC 5A16A 5BZWB 4XNMB 2QSCL 2IH3A 3MFFB 3S36L 2VZTA 1S7XA 5FDYA 3VG9B 3HKFA 3G04B 1CTNA 5C08E 1HILA 3WIIH 3LY6A 3BW9A 5INCB 5BZDB 4BFGA 3BZEA 4HK3N 2APXA 1H3UA 4MD0A 1VB9A 5F7UA 2DYPA 1A6VL 3BH9A 1SMAA 1MJ7H 4PJHA 4CNIA 1G7LB 2BHZA 1FFRA 1CVRA 3G6JB 3I84A 4CDGC 1B4RA 1IGFH 1FNGA 1PG7W 2HVJA 1OGTB 2EKJA 3HUJB 1J0YA 3UBXB 3MJGX 2O61A 2X1QA 3N85L 1F6LL 2HYMA 3TBYB 1UXSB 3OHXA 4TN9A 1QNZL 3NH7L 4LLVA 1IRAY 2EDHA 1SVZA 1A6PA 2PTTB 3RPIA 1Q94B 4MAUL 3MLSH 4ETQB 1RIHH 2UWEB 4V1DD 3FO0H 4N5EC 1KN4H 2ITDA 3UTZB 5D1XD 4AH2B 3VH8B 3TVMD 3RZCA 5LAXB 2PETA 4IRZL 3GSUA 5DTFA 1CTOA 2GJZB 3FN9A 4NQSB 5D2NA 5FIEA 3EAKA 1U8PA 4Z7UB 3KPQA 2CIIA 3L5JA 3VXRE 4LKCA 2BVPB 1P4BH 2OI9B 3U0TB 4QOKB 3AXLA 3IS0X 2VLRA 3GSNL 5ENWA 3KHOA 1TETL 5C0NC 4ZTOH 2CUMA 4BFIB 3FQTB 2AERT 3H9HB 2FYYB 3MFGB 1SBSH 3EYSH 5C0BD 3H8NA 1BQLH 2JK5B 5D7JD 3WJLC 1C5CL 5E9DD 1KIPB 5ADPL 3TIDB 3LPFA 1FBIL 2APBA 1JZ4A 3O6FB 2VLJE 3QNYB 1NGYA 3W82A 1IC4H 5LQBH 3MV8A 4WW1B 1F4HA 3Q5YA 4QCIB 5FCUH 1X4XA 1MHCB 2FO4B 2ZUXA 4JE4B 4KJWD 5LCVL 3SY0A 3KGRA 2EO1A 5HYEA 4X6EA 5ITFA 1I1YA 2XA8H 1UWXH 1WBYA 4HXAH 3WLBB 3O6MH 4OD1H 1INDH 1AGDA 3X12A 4MD4A 4JQVC 4YBHA 3SDCD 3BEVA 1MLBB 4PPTA 3ROOB 3QO0A 4AENA 1A3LH 1NMAL 4S1QL 1KEML 2L4OA 2BVYA 3O41A 1JNNL 2JJUA 3ESUF 4FQ2H 3CXDH 1CD9B 3BQUD 4N9GB 4G3YL 1IEBA 1E28B 4JFOA 4RBPH 4Z7VB 2BY3A 4YDLB 3IXAB 4LCYB 3V4VH 3DROA 4I8DA 3QEHA 5I8EA 3BT2L 4WU7B 1D6EB 1KLUB 4GG6A 2IAMA 5HHOD 3RGVC 3SGKA 5D1QC 3FN0H 2EDRA 2NY5C 3TNNA 3KPSE 1XZ0B 1CLCA 4ZDHA 1QYGL 1RULL 2QKIB 3GGWB 1OAXL 4OB5L 1BBDL 3IDNA 3T8XA 1SQ2N 1ZVSB 1JWUA 3HAEH 3QUYD 1QFUL 4HWZB 3UP1A 5JW4M 3PQYB 4DFIA 1IJ9A 3OXSA 2EYTA 4WFHE 3IKKA 1I3RA 4WHYH 5FK9B 3H0TB 1FZMA 3O6LH 2D7QA 1NSNL 4U6XB 1H0DA 2NY7L 3BKYL 4L5FH 4ODXB 4WHTA 5EO1B 3U46A 4YFEA 4TUOB 5DHYA 2R23A 3OKDB 1TVHB 4WWKB 4XVUD 1LEKA 2W0FB 3C5JA 4LEXL 4LIQE 4YHYC 1BJ8A 1Z5LA 3RUGB 2H32H 4LCWB 5DGQA 3VI3E 1MRCL 3BDBA 5C6WH 2FRGP 4J6RL 4XC1H 1MWAB 3MLTA 1MFAL 2AJZB 2AABH 3G5ZB 5J0BA 1MFEH 4POYA 4IS6B 1IFHL 3Q6FB 5HD8D 3RX7A 5DO2C 2J88H 4MYWB 1IGTB 3P0GB 2V7NA 2JJTC 5DC9B 5BXFA 2XT1B 4NNXA 5F7LB 5IMKB 5I1KH 5DHVA 3FQXB 3HLAA 1G9ML 1N0LA 3ARGD 3MUGB 1QHOA 4Y2DD 1XIWB 2DQTL 5E1AA 3TZVC 3RWEB 1U2HA 1UCTA 1J11A 5F7MC 2DBLL 2GQHA 4H0HB 4KK9D 4LLWA 5JO5A 1PD6A 4IOIB 5K59E 4UOJA 1MHHA 3IFLL 4ETYA 3WMSA 4Q9RH 1T04A 4KK5C 1S3KH 2H2SC 5TFSH 5TPWH 2BDNL 5EBGA 1BIIA 4MZ2A 2AEPL 4AEEA 3BKML 5I1LB 4HIXL 4JY6A 4PRAB 1QBLL 4D0CB 1OQXA 4GRWB 1QFWM 1G7JA 4I5BA 4LVHB 3KYMA 4UOW0 3KPPA 5GS0H 1KPRA 4OLZL 4MXQD 4LSUL 2YBRB 5GRUH 4N1HB 4NQDA 3D2UD 3SQBA 1Y6KR 4PGEB 5D1ZB 4L29A 2GYSA 1VGKB 3FO9B 2XKUA 3LV3A 5B4MD 2NY1C 1NGZB 3MJ9L 4PY7B 4FTVB 5LWYL 2H45A 4TUKL 4LASL 4TSBL 2CKBA 1RZKH 3VI4E 4Z95L 5ERWA 4FZEL 5C0DA 3RWFA 5BJTA 1ZEAH 4BZ2L 2GTZA 4G42A 1FL6A 2A6DB 3VFWA 2CK0H 3FO1A 4NO5B 2K7QA 2BOBA 5DMIL 5EFIA 5ESAA 5KTEL 1HNFA 3SE3C 1WISA 4KRNA 2BJMH 1OF2B 1JUFA 5D7LD 4HUNB 1NCWL 3UTQA 1FNSL 1NJ9A 4N0RA 1EZVX 2RCSL 1E4XI 1FGNL 3JBG7 3HNSL 3T3MF 3QXAA 4HWNA 5C08A 1RIVL 4XWOD 3U0PB 1IC1A 1V05A 2XTJB 2XOTA 1UEYA 1QSED 1YMHA 4MJ4A 1UKTA 2P5WB 3N85H 2AQ2A 3NN8B 3D85B 2WBJC 3S96B 3NH7H 1OD7A 4M1GL 2HWZL 4E5XA 1FNEB 5F7HA 5F8RC 3ZE1F 3U9UB 5MENE 4MAUH 3GMQB 2GKIA 4BH8A 3C6LA 3Q48A 4P2RE 2F53D 3AMKA 4QF1B 1QR4A 2MSPA 4YDKL 5ESVA 4KTYA 3IDIA 3E6HB 3VXSB 4IRZH 3U1SH 2DQFB 4FQXB 4JFQB 3QYCA 3MXWL 1J87A 3BE1L 4UZGA 4ZUSA 3S37L 1S8DB 5TJWK 3CMGA 2ED9A 3SDDC 3STBA 1WWAX 3GSNH 3LAFA 5CJXA 1GOFA 4PJ5A 1AHWA 1MY5A 2WLYA 4KGLA 1C5CH 1JMZA 4YXHH 3VXRA 5ICZA 1FBIH 4PJ9B 5DZOA 5ICXA 3MROB 1NDGA 1A5FL 1MHPL 2BSRA 2JB6A 1CFNB 1MI5B 4PGBB 4TUJA 4WNQA 1FO0L 3GMMA 5LCVH 5J13B 4PRIB 1MUJB 2ZUSA 5A2IH 2VLJA 4X7TB 1DBAL 5JHDB 4UIKL 3QFJA 4HLZG 4KZDL 3OMZA 4S1DD 4C83B 1I1AD 1WFOA 1HXYB 2CDGA 1QKZL 4S1QH 3K4ZA 3EO9H 1KEMH 1A3RH 1JNNH 3GMRA 4G9FE 4G3YH 4HCRA 3S8WA 3M07A 4ZPVB 4JM4H 4KJPD 3BT2H 1NGPL 2ZSWB 4PJEF 3TBVB 4YHOL 2OZ4L 4G9DA 2NR6D 1H9VA 3LEXA 4IHOA 3SGEH 5BQ7A 4HUVA 4B0MM 3Q6GL 2Z92A 2YD1A 1QO3B 1MREL 1OGAD 3MRRA 3V0AC 3MRQA 1QBML 5E94A 3FO2A 1QYGH 5ILTH 1RULH 5EUOB 4X99A 2EDLA 1A6TA 1BBDH 2F74A 5CEYB 1NFDF 2GITB 3CAFA 5E8OA 5FO9A 1CD1B 2ILLA 1CQYA 1CXLA 1WBZA 2OCFD 4JAMA 2AJYL 3B5TA 2DLFH 4BELD 3CU7A 1YN7B 3ZL4L 5FYLD 3BH8B 5A1AA 2HT3D 2W9DL 1HHJA 1MAKA 3BKYH 2XQYG 4GW4A 4X5XB 4AG4L 1TVBB 2JCCB 4YPGB 4LEXH 1CGYA 4DZ8B 3AS1A 3MBEA 5CIPH 4YR6B 1LP9B 3DXAD 4MDIA 1FYTD 3IU3A 4R2GC 1FG2A 1S7QA 4J6RH 1JGDA 4BM7A 5K9QI 4M7JH 1F6AB 4N5UA 4YXLL 1MFAH 4NDMA 5DQ9B 3MRBB 3SGEI 4ESKA 3FOMA 5IW1A 2G75B 1IFHH 3OSKA 5I8CA 3LHPL 1LQSR 1BHGA 2JIXD 5DMJB 1BVKA 2B20A 1XGUB 4JRYB 4OSUH 3TN0A 5JXED 1D9KA 4CRPA 1G9MH 3BXNB 5DC0A 4ZAKD 4G6FB 5GGSA 1I3GL 2DQTH 2AVGA 2JJVA 1KTKE 5IVNA 3MBXL 4JFHD 3BD3A 2A2QT 3W39A 5F89A 4O02L 4X8JA 1LILA 2BVQB 3KDMB 1DVFB 1X5HA 1G7HB 3K80A 2O5ZL 1VA9A 5DD0L 3QUZB 3MCKB 3ZDYF 2BDNH 5HYFA 1V3JA 5L2KB 1CGXA 3BKMH 4HIXH 5EH1A 3WNPA 1QBLH 1HDMB 5FHAL 1YZZA 5DD6A 4V1DE 4EXPX 3FHAA 2LV4A 4PGCB 4WI9A 2Q7YB 4Y4KA 1B2WL 4WI2A 5IR1B 4OLZH 1NCDL 3ECBA 4LSUH 4IRSD 4P46D 3M1BA 1QG3A 1JYNA 1BOYA 4JZNB 1ODAA 3TC9A 3K3QA 4UAOB 3F7QA 3ROLB 1ZA6A 3T4YA 1XT5A 3OJ2C 5LWYH 1X5IA 4TUKH 4LASH 5IP4A 3NCBB 1P1ZB 4ZUWA 4Y5XC 5C0BE 5KSBF 4Z95H 4FZEH 5E9DE 3I3EA 4LHUD 1H8SA 4O4YL 2BSED 4BZ2H 4PJCB 4H25A 4GAJL 4PG9A 4YH6A 2YD6A 1INQB 3LKNB 5DMIH 5KTEH 1M7XA 4HS6B 1VFBA 5C0IB 3ZYOA 4CU8A 4YHIB 2X4TA 2VZ3A 4XXCA 3D1MC 4XNQB 4ZQKB 1NCWH 4C4KT 3N1MC 1FNSH 1OP3H 1WCBB 1YECL 2RCSH 1FZKA 4AM0B 3BWAA 5A2LH 1FGNH 3HNSH 4XCYA 4ZYKA 1RIVH 2X2YA 3VXMD 1FCGA 1KTRL 4JVPA 3OF6D 5J56B 3CSYB 4K7PY 4BA8A 5E08L 5LGJA 2J12B 1U9KA 1FNLA 1B4JL 4M1GH 3X11A 1NANH 5CS7A 3PWNA 1J05B 1DSFL 3MNVA 1U3YA 5EO0B 3RKPA 5E8NA 4YDKH 5D2LE 4MZ3A 4MNQE 5CUSL 1RAMA 2LU4A 4IBLT 5I16A 3BESR 4ZUUA 5SWSB 1OAYL 5BS0B 4PP1C 4Z76A 3OKOB 4PV8A 5MENA 3S37H 1BAFL 3ETBF 1D6VL 2NY5L 4P2RA 4GUPB 3O6KL 2FO1A 4U1LA 4PGZA 1K5NB 1VFUA 3UPRA 2ZG3A 2A6KA 1JZ2A 4RSVA 4CU7A 3T0DA 2R0ZH 3MLXL 4LMQI 4TNWK 1WCQA 5JLZA 2AQ1A 4ZXBB 5TGBB 3QNZB 1A5FH 2PYED 1MHPH 2VABA 5J6GB 3TVMC 1Y6MR 1FO0H 1EHNA 1NANI 2FWOB 3IDJA 4KK6D 5I76B 3NFPA 5DMKA 3CUPB 1DBAH 2BXZA 4R4ND 1HSBA 4KZDH 4F9PA 5JOFB 1ETZA 3P40A 1X9QA 1NEZG 5CEZD 5L9DL 3EFDL 3HAEA 3TA3B 2NLJB 5D7JC 3RTQD 4ZNCD 3GMLB 1KJ2H 5IHUL 3RX5A 1YA5A 3U6RA 4PJ8D 1MSPA 1G9EA 3ULUL 5EN2B 1RD6A 3UPCA 1QQDA 4I48A 3CCHA 1KIQA 3ZSTA 2EO9A 2OXHA 1AP2A 3MRNB 1IM9A 1NGPH 3QDJB 2OI9C 4YHOH 1BFOA 1GHFL 4OZIF 3PABB 2OZ4H 2WBKA 3OV6A 2H32A 4OGZA 5GRJL 4G9FA 5H35B 1MIML 3QT2A 1N59A 1C12A 3ZE0F 3IF1A 3Q6GH 2HN7B 1LEIB 2ZP0T 3WFEL 2EIZB 4HK0A 4PJBE 3WDJA 3LN9A 4J3WA 4YDJA 4OGAD 3KPRE 1ES0A 3O6FC 4OQ1A 1JWMA 5F88A 3O3DA 6CGTA 4UT7L 2AJYH 4UDUB 2Q6WA 1F4YL 3BZ4B 1UG9A 3TM6A 2EE9A 3ZL4H 4HUWA 2W9DH 5IK3B 1CGVA 4AG4H 3VMOA 2F5BL 1HH9B 4BH7A 4IJ3B 2I5YL 2YRLA 3TH2T 3QWOA 3FT2B 4YXLH 2YMXL 4NN7B 3REWA 4G43A 3HNTL 3WO4C 4AIXA 5HYJD 4GKNB 3X3GL 1PQZB 1YPZE 5IMMB 1G0YR 4YDLC 1UA6L 4D0BB 2DOCA 5ISZD 1Q38A 1MY7A 3TBWA 1GOHA 1JV5B 3MODL 4N0UB 1QPPA 2CGRL 2YPLE 5H2BA 3HG1B 5CFHA 5D7LE 1ZOXA 4U7SA 4XPGL 2FCBA 2MHAA 3VFNB 1IEAB 4OZHF 5GJSL 3MBXH 3C5SA 4Y88A 5CBAB 5IIEB 2J8UA 1WJ3A 3FTGB 3OAUH 2OX5A 1JHTA 4DGVL 4FRWA 1QSEE 2O5ZH 5DLML 2ZSVB 5DD0H 4QRRB 3ULSB 5IV2A 1CD8A 2PO6B 5HD8C 3UTTB 4PJDE 4WFFD 5KN5A 1DUZA 4UV7H 3DOSA 4TVPL 5IMOA 1NLDL 1UQSB 1VEMA 5C0FB 5IUSA 2F53E 3LCYA 2WQ8A 5FB8B 5I66B 3D0VB 4WI6A 3ARGC 1NCDH 1VACB 3QI9B 4HC1L 1FQ9C 3VE0B 4LMQE 4QNPF 2JE8A 2X9YA 1MFBL 4S11A 3HC0B 4F7EA 4KK9C 3Q2CA 4X6DE 3U4BL 2YWZA 2G60L 3UCRA 5J1AA 2DM2A 1S7TB 1JHLL 3KJ6H 3N0PB 4M5YL 1GCFA 3A67H 1QFWL 1GSMA 4X80H 4O4YH 2KQMA 2O93L 4MXVE 35C8L 4HMEA 2FX9H 4Y5YA 4JLRA 4C57C 1M7IA 1PKQE 1NGWB 1XIWC 1M6OB 5EZJB 3OKKA 4GRMB 2PR4L 5D96C 5L0QB 4MXQC 4Q9BA 2CLRB 3DETD 3O4LE 5CKAA 4JGUA 1SJXA 2J6EH 2AXGA 1VFAB 2CDEA 5FF6A 1YECH 2QSVA 4QRUA 4R26L 3PJSA 2ICWB 5JIIA 3C60B 1CG9B 3MLYL 4NKQB 3RL2B 2KL6A 2X10A 3GSNA 1FL5B 3QIWD 3S97C 4X0KB 3C8KB 4LVHC 1F45A 2WSKA 1W8OA 3GJFB 1CFVL 3AROA 4PG2A 5EBMB 2H2PD 3REVB 1FP5A 5E08H 1U8OA 3D3VA 3SDCA 4Y8DC 5D7IE 4OUUB 1NUNB 1JN6B 4NYLB 1DSFH 3VRLE 4D0DA 1MCCA 1HHGB 2ZWLT 4RDQF 5GRXG 3BQUA 3VCLA 4DKDC 2XYCA 4MAYD 3BEWB 1FVCB 3LEYL 4F7PB 4PJ7B 3GSRA 5GIRA 5HSFA 1FC2D 2QHLA 4Y0GA 1QLFB 1B6DA 1UJ3A 2CO6B 5DRNB 1BAFH 1D6VH 2BNRD 2NY5H 3LRGA 3O6KH 4WO4B 3D69A 5D6DC 3JWOL 1A7QL 5F7NC 4MVBD 4MNQA 3TESA 3QXWA 4P23B 5DA0B 2XI9A 1AD9B 5FXCH 3MLXH 2ID5A 3WE6B 3SJVB 1UWEH 5FYLE 3U82B 5CEZH 5I1CL 2ZG1A 5C09D 5I9QB 1YEEL 2X4SB 4NZDA 1QLEH 2LFGA 3OKEB 2D03L 5DYOB 5I75B 4R3SB 3DXAE 3QEUB 2OYPA 3WEXA 2HMID 4KI5E 2FX7L 1S9WB 1JK8B 1KBGL 3IFNH 1AKJB 5GRVK 3BRDA 4HHAA 1F90L 3H9SE 3I75B 4BFBD 3VGFA 5L9DH 2YEZB 1IGMH 5H37H 3FB6A 3RBSA 3EFDH 5C0CB 4L9LA 4MJ6B 4JZOA 5BOZG 5I1DB 1OTUD 5CMAA 4K23H 2VXSL 2HT4D 1HKFA 2VMFA 3ULUH 2V2WA 1N0XL 1KN2L 1TVDA 4XBPA 2P5ED 5EU4A 2VQTA 3G08A 2RJMA 4I77L 4JFHE 1A2YA 3F7VB 1GHFH 5SWQA 3TJEL 3TO4B 4ELMF 1NKRA 1CGWA 4HKXA 3OB8A 2ZUQC 5CIPA 32C2B 4Y2DA 1MCOL 1H3WM 1FL3A 4S1DC 2EE2A 2QV2A 4JEGB 3KPMA 1D5MB 4OV5B 4LCUB 3HZVB 3NZ8B 4PJ9C 3HMXL 4X6BA 1I9JH 2ADJB 5HGBB 2E6QA 3TH4T 4JFFD 4I13B 2VQUA 4UT7H 5D7SH 4NC2B 4WTWA 3OX8A 2CKNA 3A6CH 4PJBA 1F4YH 4K8RL 4CADA 3AFLA 2Q86A 4ZSOB 1N6UA 1OTTD 4KJPC 3QA3B 4GRLB 3KPRA 1F4AA 3QULA 3VGEA 3O2VL 4RRPA 1X5GA 2IBBA 3MRJA 2F5BH 2ATKB 4F37F 3GHBL 4QRSA 5IFJB 2EC9U 4JFPA 1LK2B 3D2UA 1L6XA 3MJ8B 2RAMA 2P42B 3MZGB 1WT5A 2IG2L 5C7XL 2YMXH 1KIRA 4J23A 3G6DL 1IAKB 3HNTH 3FOLB 3X3GH 1UA6H 2GSIB 1MCEA 2IPKB 3FCTA 1MCSA 4YHZH 4XCFL 4HFWA 1HH6B 3QCUH 1GZQB 2DJ4A 3MJ7B 4ODWB 5AAWA 5F6HJ 4QYOB 4WV1B 2CGRH 1SMOA 2HT3C 4XVTH 5IEKB 1YPZA 2AK4D 2VERN 1IQDA 2ITCA 2A73B 3V0VA 2APTA 3B2VH 1AR1D 5ECJE 5GJSH 3MJ9A 4YO0B 2YPLA 3FT4B 4DGVH 4G6ML 1JGUL 5B21A 2PTVA 4FXKB 5B39G 4XP5L 3OXRB 1BVLA 2CH8A 3SGJC 4RFEB 3WHXA 3MO1A 1EHLL 1M4KA 4TVPH 1NLDH 3UTSD 5JXEC 4EI5B 3D25B 4HC1H 3IDUA 3IFOA 2NMSA 2A1WL 2EKSB 4PJDA 1K3IA 5DF0A 1HQRB 5E2TH 2R4RL 3VXUD 3WXVH 4RA0C 5B39A 3U4BH 3B9KB 4UT9L 4JG0L 2R2EA 1MELA 5A2KH 3JV5A 1K8IB 3TEUA 1KCVL 1UB5B 4NRXA 3E6FA 4Z0XA 4M5YH 2VJXA 3EDJA 1QFWH 4MB3A 5KAQF 1I1RA 5HYSG 4JHWL 4I3GA 3C5ZD 5C86A 4KVCL 2YS4A 3UZVB 3T0BA 5IBUG 2E5EA 1E4KA 4HAGA 5AZEL 1BGXL 2PR4H 4C56E 1D5ZB 2FIKA 4LKXB 1S9VB 3U7YL 4P46C 2IQAB 3JTTA 1PKQA 4FQ1L 4D94A 4CVWA 3BO8B 3QIBA 4MWFA 1IT9L 4R26H 2VXTH 4YC2C 5DK0A 5CEZE 3WS6C 1ONQB 3MLYH 5IB1A 4F3FA 5T1MA 3QO1B 3O4LA 4IOFC 5DC4B 3MRIA 3IGAB 1RZGB 2X42A 3U0WL 4U1JB 1CFVH 1KLFA 3PDOB 3L7EB 4DVRL 4GFTB 1I1AA 4H5SA 4GLRH 5ETUB 5IEHB 5J6HA 2R2CA 4JFZL 1QFWI 1A02N 1BM3L 2LTQB 3FB8A 1SYVA 1FFQA 4LAJH 3LKPB 4WJ5A 1FO0A 4WWID 3IYLW 5D7IA 3DX9A 1EJOL 3LEYH 5C0AA 1JMXA 1W0WB 1J8HD 3PHOA 3DIFB 4W81A 3DMMD 2EEBA 4XI5C 3JWOH 4MB4A 1A7QH 1RHHB 4JO3L 3SN6N 4FG6C 4LLUA 3PXJA 1ZT7B 1KFAH 3VGGA 1T1ZA 1KJ2A 3I9GH 4E42B 2ADIB 2GJ6E 3OWEA 4YHLH 1T21B 1YNTA 1NUGA 4UQ2A 4XC3L 5I1CH 1LE5B 2W60A 5ANMB 2IBZX 4Y4FB 1UT9A 4HS8H 4WI7A 3FRUA 5C6TH 3VFPB 3JVGA 4GLRI 4ODTL 1CDUA 4M43L 3CFBA 1FNHA 2OZ4A 3G5YA 5FGBA 2J3SA 3H3BC 3HRZB 1C5DA 2ZCLH 1AY1L 3DBXA 2FX7H 1KBGH 1IKFL 2DI8A 2IGFL 1GXEA 4OZFH 1D3CA 2R2HB 1F90H 2WIIA 3P73B 1I8KA 1V8HA 3BP6A 1KNOB 2CXKA 3DXAA 1XF4B 1OARL 4IDLA 1HN1A 5DWUL 2VLKB 4Z7WE 3PGFL 4OFYA 3T4AB 2VXSH 4FQQB 4PBWD 4OKVA 3MGOB 4PJHF 5KS9B 3H9SA 4HK3J 3EYFB 5JQ6L 4ODUB 3I2CL 4WHCA 4YUEL 4NRYA 4N8CL 4X8XA 1CLYL 4I77H 9CGTA 1XGQB 5IG7B 4DCQB 2X70B 4Y5VB 3TJEH 2AEWA 4KK6C 4P2QB 4JY4B 3L3OA 4JM2B 3BVNA 2EZ0D 4R4NC 1ZT4B 3KYNA 4OI9A 1ORQB 4Q7DA 3WUWA 4KQ3L 2RR3A 2ESVD 4JKLA 1R3JB 4J8RB 1I1FA 5JOPD 2F8VA 1S9XA 3HMXH 1U8KA 4MDJA 3RTQC 1I8MB 2W1NA 1ZHKB 4L3EB 4X98B 2GI7A 2C7UB 1KXVC 2FECL 1N5AB 2B4CL 2VDLH 2RB8A 3Q5OA 4K8RH 3TV3H 2E6JA 4N8VG 5F7EL 3FB7A 2NTFB 4JPIB 4PJXA 4F15C 4UOW1 1N5YH 1T7WA 3VWKD 3DX6A 3O2VH 4XBGB 1MWAL 2XN9D 4M6OL 4UBDD 4RMWA 4L8CA 3VWJD 3GHBH 4KDTA 4TVPE 1YC7A 5I1EH 1KLGB 3TA3C 1NBZA 4FQJL 4RIRA 3AM8C 5C70A 4NO0B 1NMCC 2IG2H 5C7XH 4YXKL 5C0JB 1T83C 3CSBA 4NQXA 3G6DH 1JI2A 4OFDA 4WWKD 4OZGB 5GRZA 3DNKA 2BVTA 2EICA 4KV5E 3HE7B 4N8VA 1QA9B 4I0CC 12E8L 4XCFH 5T3ZL 5IKCA 5GRVL 2GSGB 2AJSH 1JWSA 2H8PA 1U8JA 1KTLA 5SX5K 5IHZB 4M7LT 2VE6A 3OKNA 3LQMA 3G9AB 2W0PA 1KJ3L 2BNQD 5KSBB 4O9HL 4RQQA 4W70A 2W9EH 5JR1L 1QRNB 1H3XA 1J0IA 4MCYA 4G6MH 1JGUH 1NL0L 4U33A 2HKFH 1S7WA 3U79A 1QR1B 3NAAL 2MCG1 4JRXB 1BEYL 3V5KA 2HFEA 4L8BB 1DTUA 1Z0NA 5SV3A 2P48B 1YY9D 1EHLH 1HQ4B 5EZLA 3NTCL 1BWMA 4HIEA 5D5ME 5F71A 1SYSA 4PLNC 2Z8VC 3WIFB 1OWRM 3D9AH 1UYWH 3FFDB 3P4NA 4EI6B 2A1WH 1PEZA 2J6EA 2JELL 2NXYD 4RAVB 1ZTXL 3L9RA 2X89A 5FOBB 3MLRL 2BNRE 1I8IA 3OKYA 1V3KA 3C8HA 3LRSA 4JG0H 5F44A 4ZNEE 4H20L 1BOGB 4ONGH 1RK0B 5HGAB 3OKLA 3VGHA 1KCVH 3CXHK 4JHWH 5EU5A 1JZ7A 4RMRA 4LLAA 3BP5A 1P7KB 1AC6A 3LN5B 3ZKNC 1BQHA 1BGXH 2Z31B 3WSQL 2XTLA 3UC0H 2VISA 4TRPH 1LO5B 2R29L 3VFGL 4ZFOB 1BQSA 4LHJB 3GDBA 4FQ1H 1CFQA 3OG6B 1IT9H 5HY9A 4C59B 4GW1B 4P5TB 5D1QA 1XR9A 5TH2A 3ABZA 4C56A 4CMHC 5I2IA 4ISVB 5I18L 3P11L 4IMLB 4WUUD 4U6HA 1LO0H 2DLHA 1R24A 1I3VA 3DJ9A 4NQEB 2YPVL 4K3DL 4G8GD 3QI9C 3PIQB 3HC4L 4R8WL 3ARVA 2P5EE 1YJDL 3MTRA 4JFZH 4P57B 4U1SA 4WUKL 1CYGA 1BM3H 5JORA 3HPJB 3BZFB 5E1HB 4PREA 5GGSY 5EIIA 1T6VN 2IPUK 5ACZB 4LPTA 3IXTA 3MRGB 4PJ8A 5JNYB 3DECA 1H15B 1FFNA 3MRKA 1ORSA 3WKNA 1EJOH 4G8IA 5ICYB 3TT3H 2VLLB 4QXTA 5L7XL 1DEEB 2DD8L 1RZIA 1BBJA 3T0ED 6FABH 4JFFE 2XWJA 2H2PC 5DEGB 1NC4A 4FQXD 3LMJH 3QEQD 3UBXI 5GS2D 4I0PC 3RVUC 2E27H 1MCIA 2B5IC 4PRBB 2VDOL 2FDBP 2XKNB 4XC3H 5GS3A 2Y4SA 1I7UB 5L6YH 1XGPB 1T20A 3QDMD 2A0LC 3C60C 4ODTH 2GUOA 4HMCA 4PRNB 5JPNA 1EEUA 2VR5A 4M43H 4ORGA 1NBQA 5IB4A 3VFOB 3EDKA 5B3JF 4CN6A 2GJ6A 4WFED 5J3HC 1AY1H 2Z35A 4PLOB 1IKFH 4K3HA 2ZJSL 2IGFH 4PJFB 4MJIB 4GXVL 3MV7A 2NY4D 4NM8L 4UQ3B 2X05A 2VITB 5DWUH 5DJYB 1OD9A 3PGFH 3CGTA 3QDGA 2JJSA 2AK4E 2WBWB 1MOEA 3N06B 1CLOH 4I18B 4JKMA 3EOAA 2MPAL 3U4EA 4YUEH 4N8CH 1PY9A 3AS0A 4EDXA 4Z7WA 1AJ7H 1GGIL 1OLZA 4JHZA 1C08B 3CK0L 2X7LA 4PJIB 4WO4C 3BDYL 1MCRA 5IHLB 1CDBA 3ARBA 1KXQE 3BIKB 2RHEA 3PWPB 3RJQB 2Y6SD 1CICB 2WIMA 4N0FA 4RMQA 4YHPB 2G9HA 4JFED 1CXEA 1PFCA 1BD2B 4LGPB 2CDFB 4TTDC 4U05A 5C3LD 1KELL 2PCPB 4LVOC 3VFMB 4ZS6D 1AD0B 2HFFB 3UTSE 3MOAL 1CIDA 3F58H 5F7DB 2ZUVA 4XH2B 3L5HA 1LDPL 3U36A 4APQB 2AEIT 1KCSL 2HT4C 1OM3L 3GMPA 2B4CH 3LS5L 3T65B 4DGIH 1OB1B 3RWCB 2NY6D 4H26B 5F7EH 5DQJA 4Y19B 1ZT1B 2ZOKB 3VXUE 1O7VA 3DI2B 3GSWA 3IDGB 2APVA 5ID1B 2W65A 3UDWA 1OW0C 4Y1AB 4M6OH 3K46A 3BKJH 4XWGL 4GW5B 4R0LB 4FQJH