4JFEE

Preservation of peptide specificity during tcr-mhc contact dominated affinity enhancement of a melanoma-specific tcr
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
245
structure length
245
Chain Sequence
MSQTIHQWPATLVQPVGSPLSLECTVEGTSNPNLYWYRQAAGRGPQLLFYWGPFGQISSEVPQNLSASRPQDRQFILSSKKLLLSDSGFYLCAWSETGLGMGGWQFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title T-cell receptor specificity maintained by altered thermodynamics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 49
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jfeE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jfeE01
4OF3A 4MXVF 4U1GC 3BYTA 1JPGA 2D7QA 2MTPA 1G6RB 2CO6B 4Q2ZB 5F3HB 3H6JA 1GAFH 4GKNB 3VGAC 3FL7A 3LSOB 3N85H 3GI8H 1FYTA 5KVDH 4NT6A 4YFDB 1IBGH 3PHOA 3IJYA 1MJJB 4HK3N 1U91A 4NP4L 2EC8A 1MCOL 1C1EH 4CDGC 2YWZA 4ODSH 2CDFB 3QIBB 4G42B 5DRWA 2BVQB 5JDSA 4JCMA 1CGVA 4P2RE 4UT7H 1CD1A 4PJHA 5A2FA 3LS4H 1QYGL 2AJ3A 2B0SL 1V7ML 1M71B 3PL6C 1AGFB 5C7XH 2NQCA 2VLJE 3LKOA 3W2DH 3GNMH 5ADPL 4UDUA 3VMOA 3G04A 1RUKH 5KSAC 5KVEH 1G9MC 3G5YA 4HXAL 5DD6A 3SJVA 3TO2A 1Q9LB 2DJ4A 4BA8A 2FX9L 4GAJH 4M93B 1BQHA 4WGVB 3FCTB 3RGVD 3QCUL 2EDYA 3QDJD 4HQQH 2O5ZH 1HILB 3OKMB 2LU7A 1ZEAL 2NPLX 1U0QA 2CH8A 1QSVA 1FNFA 1LEKB 4L8SC 5HXMA 3EZ8A 1VFMA 3S3SA 3D39D 3PDDA 5HVGB 4PP1D 3X12A 1H8NA 1I1AD 5HHOA 4IOFD 1Q1JL 4PJHF 5CJ8A 3EOAB 2CO7B 1KJ3L 3L3OB 1EIBA 5I1DA 1A4JA 4G5ZH 2XXMB 3HZVA 4KJYB 4H8WC 5TJWK 5FV1L 1Q0XL 2JJTC 5KS9B 5MI0C 3KPNB 4QT5A 1J8KA 5A43C 1T22B 5DD1H 5C92A 4UU9B 3DXAD 3Q1SL 3DECA 3ABZA 3IYLW 3V6OC 3AMKA 4RZCB 1JP5A 5KTEH 3O8XB 4HWUA 4F7CB 5I1HL 1P7QB 5HYJD 2A38A 4PJ5E 3ZDZF 3QEQE 3U4EA 5EN2A 1IMHC 5HI5D 3KNBB 5J12C 1I7ZB 2JJUA 1Q9WA 2Y5TB 1JTPA 5EUOB 4HZAA 1PKOA 3EDDA 3SDYH 4ZXBD 1TNNA 1F00I 3DX7B 3VWJB 2BSSA 1KULA 3PWJA 2MJWA 4XC3H 3KPRB 2ZUWA 1TZIA 5HVHC 1XF3B 4JANB 1ZK9A 5JHLL 5DRZA 1OAKH 1KCRL 3V5DB 1GPOH 4CVZB 4Z95H 2DS4A 4U1SB 4MJIB 4ZUWB 3QO1A 3DVGB 4JFYB 4NWUL 5BRZE 1YNTA 5DVLA 1GGBH 2YD7A 5D6CA 3VRJA 4M7LT 3I6KA 2SEBA 3CGTA 3PABB 3RBSA 2BDNL 1GGIL 4NC2B 4Z7WA 2AJSH 2UUDK 1KTKE 3HI1A 3QR2A 1NKOA 1GHFH 3VMNA 3LKPA 2FJHB 1BQHG 3MOAL 1OW0A 3OJ2C 4U0RC 4M9PA 4AYFA 4BSVA 5KVDL 1IBGL 2W65A 5BVJA 3PWLA 3U0WL 2DB8A 5FYJE 3DSFH 5EOCH 4QHNB 3QIUD 3EO1B 3GFUA 2R23A 1NCWL 5JXEA 2Z92A 4IJ3B 4NHUB 4QTIH 5E2WL 4NN7B 1GGTA 4H88L 4YHMH 4ONGL 4NCC1 3TVMD 1IQDA 2F54D 2H32B 5E2TH 3UTTB 3ZTJH 5IMOB 2XTJB 1SVZA 4O5LL 3EYVA 3IDYC 3GMLA 4ODBD 2Q7NA 1KPVA 2D7NA 2V2TA 5C7XL 1MHCB 5DI8B 1U6AH 3RDTB 3MJGX 4BQBA 4IRJD 1RUKL 2LAAA 1H8OA 1UCBH 1ZT4B 5HVFB 5CJQH 5FK9B 4Z7VE 3UJIH 1A6AB 1IGJA 1MCEA 32C2A 2Z9TA 2HRPH 5I17A 4CU6A 3MRGA 2V5YA 3QUKA 3MV9E 3FN0H 2HJKA 1QFPA 1JZ5A 3EYSH 3G5ZA 4JFEA 5JMOC 3GHBL 3B3IB 3CPLA 2O5YH 1A3LH 2FJFB 3SCMA 3W9DA 4O4YL 3ULVD 5D5ME 1EERB 3D3VA 1ORQA 4X7DC 3ZKXB 1RVFH 2CKBL 4WWKA 3QWRD 5FOBB 4G6AC 3W0WA 3KJ4C 4NZUH 4NOFA 1YEFH 5CP3H 5J89A 2KL6A 4MYWB 3SE9L 3ALXA 1MPAH 2AXJA 3CDYA 2ZPKH 3QNZB 4O51B 4XXDA 3WCYA 4P59H 3WYRA 1K2DB 4JJ5B 5HGDA 1T7XA 4ZS6D 4NN5B 1U41A 4Y4FC 2F53A 2HTLC 4KGJA 1KIUA 2YC1A 3NCMA 4PG2A 3SDYL 5J11C 3BRGC 4JPIB 4YNYA 1WCBB 1YMME 4JAMA 3UROR 4XNYH 1K9TA 1X5FA 3SDXE 1L0XA 4P46A 4HG4K 5FHAH 2ZUSA 4PJDB 3KPSA 4HC1A 1R3HB 4BM7A 4QRSA 3K3QA 4CL7A 3DX9A 5IBTH 4HLJA 3UTOA 4EUPA 4KQ3H 3EDFA 4L3EE 3HC3H 4UIKL 3VRLF 3U46A 3IFOA 5GZNC 1GGBL 4WI2A 3CFDA 2R0ZH 5DK2A 1Y6KR 2WWMD 2GCYA 4LLQA 4QRUB 2ADGA 1B3JA 1QKZH 1G7HB 3RFZC 4R90H 2XZQL 3KXFE 4KTDH 1QHOA 1U93B 4E41D 3HCVB 3D18B 4URTB 1CBVL 5ISZD 1CGSL 2Z4QB 3N0PB 4A2MA 5CGYD 1Y0LB 5T3XH 1B4JL 5EOCL 3MODH 3KPPA 1UKQA 4TULH 3FB5B 3E3QC 1PKQB 3QIWD 1HWGB 3EJZD 1UB5A 1AXSB 4J4PD 4XGZB 4ZS7H 3MGTB 1QRNB 3VG9C 3M45A 3RTQA 4QRPD 2EYRA 3HG1B 1YEHL 3K1DA 5HYSB 3T2NL 2W9LA 2ADFH 4LVNC 1TQCC 4PRID 4MHHI 2EDJA 4PY8I 1S5HB 2W0KA 1XR9B 1T7WA 2I26N 2VXUL 4E0RA 1H9VA 4POZC 1U6AL 1MCIA 5HDLA 3BUTA 4BFBD 5FO7A 5DA4A 1UCBL 1ZA3B 2XT1B 4TQEL 5GJTH 3KLAB 4MXQD 3WO4C 3UJIL 4AK1A 4QTHA 4LLWA 1U8IA 3P4NB 4OCSH 4NHCH 2HRPL 1BWWA 1FP5A 1N0XH 1UM5H 1DLHA 1DUYA 4MJ6B 3FN0L 2W60B 5F1KC 4M1CD 1V3LA 5JHDD 5DD5H 2P49B 1FIGH 1ZA6B 3CD4A 1JE6A 3Q6FB 5ICXB 1IEBA 3QXUA 1D7FA 3T0WA 1WWWX 4G9FB 1YNKL 1PYWA 4LSVH 4H0HB 1A3LL 4EUPG 2ERJC 4K9EC 1NCTA 4P23B 3MJ8B 2WBJB 1T6WA 4KRPC 3B5HA 4J12A 4QWWD 2VLRB 5BO1H 4K3DH 2L4OA 4IHOA 4NZUL 4JO2H 3GEWB 1YEFL 4YHZH 5T3ZE 4LDLB 3MGOA 2VZOA 1MCRA 3FO2B 5EIIB 5GS2D 3QUYD 1R3KA 2VDPL 3TNNA 3I75A 4Y16D 5H8DA 1QLRB 2X4SB 2ATPA 4U6HA 4OV5B 1P5VA 4P59L 5KVGL 2AQ3A 4BZ1H 2PYEA 2XG5A 4NQCA 2Z8RA 1RHHB 3D25B 3WUWA 1Z0MA 4FG6D 5DJ0B 1T89A 4XNYL 4OF7A 2NXYB 1CDCA 2VC2L 4FN0A 1U8LA 2FATH 2FEEI 3QI9C 3SKOB 2GQHA 1KYOJ 3PJSA 5DJXA 1OB1B 1LO0H 3UP1A 1MF2H 4IOSD 4KKBC 4D0DA 4RAUA 1QLEL 3HC3L 4ZMAT 4JREC 1HQ4A 3D0LA 5E5MB 4TUOB 3U7YH 4Y4HB 4JEGB 2V2XB 4L3AA 4XX1G 2E7CA 3IFPB 1TQBC 3HKFA 5GGVY 4I48A 1WZKA 4I3SL 1QKZL 2XWJA 1JBJA 3WJJC 1MCWW 2NY5H 5ACZB 4J2XA 1UG9A 3O6ML 3BQUD 4FTVA 1YPZE 2J5LC 4KVCH 3D87B 3QXAA 5FDYA 1EX0A 2AJYH 1H0DA 4TRPL 3MBEB 2C1PA 2CLVB 2Q76B 3MRIB 4ALAL 1JYNA 4PJBE 1BIIA 5GJSL 3MODL 1AO7E 4P2RB 2X9YA 3V6FA 2DTMH 1A8JH 3BVNA 3CVHH 5LGJB 3QO0A 2YRLA 4DUWA 4HUXA 4P5TD 2R39A 2VLJB 4HKXA 2GUOB 2DWEA 2H9GA 1KEGL 1YJDH 1P4BL 5E2VL 5F97E 4CVWA 4P5MB 1XIWB 4KKAC 1LDPH 5DVNA 1X5KA 2HLAA 2VABB 1VFUA 3ULSA 1J8HE 2NY2B 3SEPA 5C2UB 5DC9B 2F74B 2W9DH 1U8JA 4QGYA 1VKXB 3QIBC 2EYSA 2JJWA 4EI5D 3EO0A 5I1AB 3KYMA 1T0MB 4X5LA 3CSGA 3ZTNL 4KK5D 1G7PA 4PREA 3RAJL 5CAYB 1GC1H 4NNYA 1U95B 5SX5K 2QHRH 1HQRB 4L5FH 4G80B 1N0XL 5TDOB 1UWEH 2J4WL 3WUWG 4WVRA 2IADA 1SYVB 5D8JH 5CJOH 3OF6D 4M93C 2GSGA 2M26A 4FA8A 1FYTE 5I0ZA 1CXEA 4D0CB 3CSPA 4UDTA 3P30H 5ICYA 4NKMA 2IPKB 1TNMA 1FAKT 1TVBA 5K9QI 5I66A 2MCPH 3BWUC 4JFZH 5E9DD 1S7QB 3ECBA 5EORH 5HI3C 1NEUA 2NW2A 5SV3A 1NDMA 3BD3A 4PJ5B 4ZUVA 3QEQB 2W0FB 4LCWA 4OLWH 2FEEL 4K3DL 3VFOA 4WU7A 5CD3A 4JO2L 4PJHE 1C16A 4ZD3L 5C08D 2PW1A 4V2CB 2H2SC 2MPAL 3L3DA 4OZGF 3N1MC 1OARH 3QUMA 5KBNC 3N1FC 4NO2A 4J3OC 3SKUD 3T8XA 2BSRB 1ZHNB 5IBUB 1E27A 2YS4A 5K33A 5DTFA 3I3DA 5FGRA 3SJVE 4M8QB 3S4SA 1ZE3C 1EAJA 2J8UF 3BP4B 5EC2A 1ZGLP 1D9KB 4YHYC 3ZYJA 3O8XC 3PGDA 4MNGA 5DMYA 4OTXL 4AT6B 4HUVB 1BOGB 5DMIH 5BRZB 4M1GL 1M7IA 2DOCA 2DQTL 3TBWB 4NRYA 2HFFA 5ID0B 3ZDZE 3SKMB 1RZGA 5MEQA 3IXAB 3O2DH 3GSXA 1OF2A 1VPOH 1OAZL 1SJEB 3VWJC 2RIKA 4WI5A 5HHOE 3GGWA 4KK8C 1QFUH 2NTSP 4ZUTB 1IGMH 5IGXH 3BAEH 3CZFA 5HTSA 1NEZG 4LSQH 5ILTH 4JFDD 1D6VH 1G0YR 4E9LA 4HIIA 1INDH 2NY5L 1Z9MA 5E8EA 4Z6AT 3INUH 4HS3B 4ZFOB 1MRCH 5IVZB 3PL6D 3LS5H 4KVCL 5IROC 2AJYL 2HJLA 4JDZB 3O2VH 4D3CH 5M94B 4XNUL 3EIFA 2AEPL 5DXWA 4F80A 5KSAD 1JPFA 3C2AH 1MCWM 3SGKC 3IS1X 5FKAA 2VISB 5EO1A 2ZP0T 3WIIH 4MZ3A 2ZG2A 5E6YA 1N6QL 3F8UB 4N0UE 4NRZA 1YJDL 4R0LB 2EYTA 2IPUK 3X3GL 4N8VA 4H25B 4IJ3C 3BH8A 4NN7C 5E95B 1ETZB 4OQ1A 4Z7VB 4W6XB 1HOCA 3NCYP 2XTJC 2X5PA 3GSQA 3OKKB 3MNZA 2VDQL 1QFWM 1AQKL 1CE6A 1KB5L 3MV9B 4LF3B 4MD4A 5F1NB 4MJ2A 5FA4B 3ARQA 1GC1L 4JZNA 4UNUA 2QHRL 1DBAH 2IMNA 1BIHA 3S36X 5HYQB 3RDTC 4Z7WE 5AEAA 4L5FL 3UYRH 4XPGH 4NYLA 2P8PA 3S4SG 1UWEL 3C5JB 3L3IA 1PJ9A 3IFLH 2MHAA 3IDNB 4I3RL 5CJOL 5D5MB 5D8JL 5L2KD 2Z31A 3OR7A 1IARB 4BFIA 5GGSB 3T4AA 2CDEA 1MJUH 3P30L 3CFKB 5FCUH 2QR0B 2MCPL 4JFZL 5I76A 5EORL 3OB8A 2AEIT 3IDMB 1KIRB 5EU4B 1BAFH 1ORSB 1KB5A 2HG5A 4G6KL 3PWNA 3BN9C 3T1FA 5SWSA 4UAOB 4B7LA 2PW2A 1HXYB 1INQA 3RX8A 3QPQC 3NIDF 1OTUC 4P2QE 5D7KD 4MB4A 1CIDA 3WSQH 4RX4D 1YMMB 3ZKXC 1OARL 5TGBB 5TF0A 1EAPA 1A6TA 3LN4B 3QDJA 4F37F 2G60H 1I3VA 1MCHA 4K3HA 3TCLA 1WV7T 5KANI 4DUXA 4YPGA 1RZJL 5EZOL 4L3EB 3CUPA 1DP0A 1EVUA 1QTYT 3N50A 1OGAE 4IIQA 4PGDB 5I8CA 4ZUUB 5ALCH 5DMIL 2AAVA 4IDJH 4Y8AA 3EFFB 1K4DB 4RMRA 3FKUS 1SYSA 4YAQA 8FABB 4NN5C 3TJEL 3VXRA 1R0AH 5JPNA 3V95A 1JPSH 5JTWA 1EEZB 1TCMA 4Q9QH 3QWOB 4NO5A 4NQEE 1OP9A 1VPOL 4CADB 4OBSA 4JFEE 3KXFB 4N8VG 5F7DB 1IRAY 5DEFB 5DDHA 1FZMA 4QY8B 1IGML 4XNZB 1PFCA 1YN7B 3BAEL 2Q8AL 4NQSA 3D3VE 4LGRB 4NWTH 1IGYB 1JPTH 4OGYH 1INDL 2G2RA 1DN0B 4TSCH 1S7VA 5B38B 1MRCL 4PTTB 3LS5L 3SO5A 3VRLE 3MCG1 1KJVB 4Z0BH 4D3CL 1NFIA 3BD4A 4LU5H 4F9LC 1U8MB 3E0GA 2ZCLH 4FMFA 4Z7NF 1GZPA 1BFVH 2FEDC 4QHMB 1FZOB 1JF5A 1NPUA 4MNHA 2A6IA 5C0DA 1NC4B 12E8H 5KG9A 1XGUB 2Y07H 3HI6H 1SBSH 2C3XA 2F53E 3RI5F 5IOPB 1IAOA 4L8CB 1T1ZA 2B1HL 1RJYB 1WC7A 2E6JA 3KPSE 4OI7A 4F7TA 4OKVA 5K9QG 1EVTC 4CW1B 3R0NA 1UVQA 2J1KA 4UV4H 3BP7A 3I85A 1CGTA 5DA0B 5F9OH 3T0BA 5BZDB 3WD5H 3NA9L 5GZOC 5C6TH 4PRHA 3M17A 1DBAL 2Y9RT 1RZFH 1MOEA 2BY2A 5I1IH 2C3GA 1X5AA 3HB3C 1JGLH 4X5XB 2I9LA 5FF6A 5J1AA 15C8H 1IM9D 1Q94A 3IFLL 3L3KA 4OUUA 5IB4A 3DARA 2APVA 1NUGA 5DJAB 2F54A 2VXSL 1MJUL 4F7MA 1TZHA 4Y4FD 5I8KH 4JGMA 1G1YA 4JDTH 1D5BB 2HTLD 5CSGA 3OHXB 5C8JA 2DMBA 2NZ9C 1QBAA 1NGZB 5E5RB 5GGSY 2NY6B 4LKXB 1SBBA 4ZFZA 3HNSH 5DUML 5TE4L 3RPIB 1FFPA 3FZUC 3SE8L 5ESVB 4HGWA 4WDIB 4XBGA 1A7RH 3WSQL 3CSYA 1MSPA 4P23C 4XMLH 2WBJC 4XX1E 4QHLA 3WEXB 5GZND 4M6NH 5GRJL 2X4RA 1EBPA 1UZ8B 2C26A 2G60L 4JKPH 1S5IH 3NIFE 5DZNA 2YSSB 4JY4B 3HN3A 4NO0A 5DRXB 3SGEH 3MRDB 5ALCL 4UT9H 2BXZA 4LASH 3DROA 3O4OB 4WV1B 2DQUH 2EE2A 3H3BC 1RY7B 1R0AL 3AGVA 4AIXA 4Q9QL 3DURB 4KV5E 2DQGL 5JW5B 1Q72L 2W9EL 1CGXA 4KMLB 2X1OA 3BZFB 4I5BA 3BFOA 4ZO6A 3BESR 3TEUA 1GYAA 4KHXH 2R56H 2NXYC 1YPZB 3O3EB 3MRQB 3CK0H 1KB9K 3T2OA 1JNHB 2WK2A 5FUCE 1ZLSH 5F88B 4PJXF 4KAQH 5D2NA 4NWTL 3UMTA 2EE3A 4PJBB 1JPTL 1AO7B 2NY4B 4U6YA 4PP2A 4Y4HC 2BSED 3I6LD 3GSOB 2H3NA 4Z0BL 2AGJH 1FNSH 4POZD 4LU5L 3BW9B 4XCYA 5FECB 2ZCLL 1YY8A 4OCMC 1LO3H 4M7LL 4OFKA 1WT5C 2NX5A 2R0WH 5C0EB 2V5TA 4WUKH 12E8L 1RJLA 3UPAA 1P1ZA 2ICCA 5DD0H 1J8HB 3B2UC 2IPTH 2B4CC 2Y07L 2XA8L 3Q5OA 5F7UA 2PYEE 4BSWA 1QPPA 5J1SC 3MBEC 3WHE0 3TA3D 4PLJC 2ITCB 4XZUA 3FT3A 1CLCA 3R06A 1VFBB 4NZDA 1A1NA 2VWEC 1TIUA 3P40A 1FNGB 4XXCA 3JTSA 3GMPB 5B4MC 2CJUL 1JPGB 3CXDH 1XIWC 4PJ7A 1Z0NA 1GOHA 4XP6H 3HAEA 3IDXH 5F9OL 4FXGA 2NY2C 4Z78A 1CL7I 4N1HB 3WD5L 4KRPD 1FYTB 3UZVB 1PD6A 5ISZA 3GSNB 3PHOB 3JV6A 5EPMA 2RFXA 4NN6B 1E4KA 4GRMA 4N90D 4S11A 1U91B 4FTVE 4ETQA 5DS8A 2FIRT 2P7TA 2X1WL 4W70A 1JRHH 3QQNA 2A6JB 5DF0A 4HFWB 1NLBH 5HDOA 1JFQH 4QRPA 5JDSB 4Q7DA 1CD1B 1QHPA 1G9NH 2DRUA 4PJHB 2DQDH 3NAAH 2AJ3B 3N06B 1K6QH 5C0CA 4PUBH 4PGCB 3LKOB 3BHBB 4RCAA 4PJGA 4AEHL 3G04B 2EICA 3G5YB 2ZUTA 2C3HA 3HNSL 4D9RD 3SJVB 3TO2B 3G5VA 2HN7A 2JF1A 3QI9D 4YBQC 3T0XA 2VDKH 1J11A 1A7RL 2F8OA 4JFPA 4KKBD 4W6WB 4CU8A 5F72S 4KRNA 3P4LA 1BQHB 1Z2KA 4XMLL 4YGAB 4DQOH 3JZ7A 2EKJA 1A02N 4G6JH 1DANU 3UTPD 4DJMA 3W39A 4R97B 5JHDA 3G5XA 1JV5A 4JM4H 3X12B 4GRWH 4HH9A 4ODHH 1UKTA 5CKGA 5HHOB 3GK8L 2VQ1A 4Q9CA 1FL5A 3OPZH 4OZGE 2RQ8A 2DQUL 5I1DB 1A4JB 1AQDA 1P7HL 1EA9C 1OAXL 1JNNH 5LBSH 1D9KC 3ESUF 1HYSC 4HZLA 4BJLA 4OLVH 4X5WB 4PJGF 3V4VL 3WXVH 4QT5B 5CZXC 1GH7A 5T5FH 2FDBP 4U3HA 4KHXL 2R56L 1J12A 4WI6A 4JZOA 3LPGA 4QXUH 3U0TA 3NFNA 1MLBA 1QG3A 4FQPA 1S7UA 1NCDL 3EYQC 2O93L 2E3VA 3W81A 4TSBH 5JA8B 4KKAD 4HULB 4LOUC 3QUYA 4LARH 4G3YH 2G5RA 2GK2A 4KKNA 3U4EB 4Y16A 5EN2B 1URLA 1JGVL 5DQ9A 2D4FA 3JV0A 1GOGA 1Q9WB 2AGJL 1DBKH 5JIPA 3QIBD 3VU2A 3VDAA 1FNAA 3BJ91 3MRLA 5J57B 3DO7A 4N0UB 2BJMH 4LAQH 1ZWIA 4NJAH 2R0WL 3WIFA 3RKDC 2BVTA 4WI3A 1EHAA 4P9HL 2IPTL 3TYGH 1CL7L 4Z18A 2IG2L 3UYOD 5DRZB 1YYLH 3IT8D 4I3GA 1V3KA 1TZGH 4GQ9H 1YNTB 2EDBA 5D6CB 4GKSA 1M7DB 3I6KB 2SEBB 4N1CA 1IL1A 4P48A 4RWYH 4Z7WB 3CXDL 4TVPD 4R0LC 4FQ2H 2R4RH 3L5XL 2AP2A 4U31A 3HI1B 3VXUA 4XP6L 5HI3D 3LKPB 3BQUA 2COQA 4C4KO 5F70A 2QJDA 5HHME 4JZJA 4JVWA 4R2GB 2W65B 3PWLB 4UNVA 2HP4A 5F1IA 5EU6A 1F13A 4HGKC 5BV7L 1FH5L 2R23B 4ZOCA 2Z92B 4HKZA 5B3NA 4O02H 2FLBT 4HC1H 4KTEL 3ZO0A 1YN6B 2H2SD 3LAFA 3E2HB 2A73A 2EIZA 4P5TA 4K3GA 4HX1A 3SDAA 4H0GA 1A6ZB 1NLBL 4ZYKB 5SWZA 3QQ4A 1JFQL 2HA1A 1T4KA 3EYVB 1PG7H 3FFCA 3GMLB 2DQDL 3NAAL 4P2QB 3O8XD 3VFMA 1K6QL 4ZNCD 1P7QD 5I6XB 1KPVB 4PUBL 5CMAA 2V2TB 3UX9B 1HKLL 2A77L 5TPWH 3KYOA 1F3DJ 5DFWH 3ZT5A 1XF2B 1YEIL 2VL5B 2YPLA 5F71A 2OYPA 2AKRA 5L88H 1MHEA 4KDTA 3AS2A 1NFDA 2X40A 5EBLA 1FCCA 2EDOA 1QD0A 32C2B 4JFOB 3BEWB 1OGAB 5I17B 4KK8D 3TO4D 5IFAL 3KPRD 4RFOH 3B6SA 4G6JL 2O26U 3CDFA 3QUKB 3EYUH 4XMKH 2HJKB 2VSCA 1KCVH 3PWUA 1HHIA 3OF6A 3PF2A 4XAWH 3GUTB 3NIDE 3NGBB 4JFEB 4MJID 3VGGA 4LP4A 3LEXA 5DJYA 5DURB 3OPZL 1IGCH 3DX8B 3CPLB 4PJCA 5GS0H 3MCKA 3SCMB 3W9DB 1JNNL 5I1CH 5IMMA 5LBSL 1Y6MR 4S2SB 3D3VB 2I25N 3UEZA 4OLVL 1ORQB 3WXVL 1A3QA 5TE7H 4WWKB 5T5FL 4JY5H 3TBTB 4EIZC 4YBHA 4NBYB 5MHSD 4JKKA 4R3SA 4X9GA 2BOCA 3EOTL 4NQVA 2W07A 4OAWA 5I1KL 4LLUA 4M00A 1GSMA 5C08A 2P1YA 1HDMA 1NC2A 5GIRA 4TSBL 4LDOB 1QFHA 1HIMH 3T0VA 5F3BB 3MZGB 5SWSE 5HGDB 4KUZL 4XNZC 2F53B 1R3IH 2YC1B 3UTTD 5JW3H 2XTJD 1KTRL 4LSPH 3VXPB 4YNYB 1JCKA 4ZOEA 1WEJL 2BJML 2Y6SD 3RL1B 1HXMA 3V0AC 5IUSA 4NJAL 1AFVH 4P46B 3QDJE 5IB1A 1X5JA 3KPSB 3TYGL 3F7YA 4OD2A 1I8KB 3DX9B 3MRMB 1FVCA 3H8NA 3RDTD 4EUPB 4FP8H 1YYLL 4Y4KA 5D93B 1TZGL 3U46B 4F2MA 3IFOB 4ELMF 2WINA 2C9AA 1UZ6F 3OJDB 4MS8C 4HJGA 4AY0A 5DK2B 3VXRE 4HV8A 2OK0L 2FWOA 2GCYB 4LLQB 4LPYA 1RIUH 4RWYL 5T1LA 1O7VA 4U1JA 4OJFL 3FB6A 5EDXA 3S37H 2AABH 4GRWF 3VXMA 3PL6A 4UTBH 3AMLA 3TIDA 1J9CT 4GBXA 4PJAA 3E6HA 4PJIF 1BEYH 3BN9D 2NY3D 2EO9A 2X1XR 2I07A 4Y2DA 1BM3H 3BIBX 3QPQD 1OTUD 5T1MB 1FFNA 4O02L 4EJ1C 1UB5B 4M61A 4LSDA 2VXVH 2X4OA 3CLFL 1DTUA 4OGAC 1N64H 4P4RA 3RTQB 2EYRB 2ZCHH 4K3EH 5E99H 4H1LA 4JJHA 3CVIH 5E8NA 3PDGA 3I02A 4JFFE 2VLKE 1KLGA 5TPWL 2Z8VC 1RAMA 5GSVA 2EECA 4Y88A 3T3PE 2P5EA 3EYOA 1NCCL 5FO7B 4LHQB 2A9NL 4PJAF 3QDAA 5L88L 1DJSA 4XPBL 4HMCA 5IQ7L 1K85A 4QTHB 2NY6C 4LLWB 1U8IB 1B0GA 3MXVL 4TUJA 3V6OA 1DUYB 5C9KA 2NNAA 2DF3A 3DSNA 3T0AA 3RZCA 4HAFA 1BZQK 1KCVL 4XAWL 4PRHE 1PY9A 1A7BA 1IEBB 3QQ9C 3SBWC 1YNLH 1LVEA 1PYWB 4FZEH 1IGCL 3OGCA 3S35X 2Z8WC 2E9BA 3RY4A 5HHVL 4I13B 5GS0L 4X4XA 1JWUA 5IW6A 3S6CA 2E5EA 3BGMA 2R0KH 2F54E 1O5DT 2BXYA 4NBZB 5BOZG 3O4OC 4WV1C 1MIEH 1AI1H 4M43H 1IAKA 1T0PB 4HWZA 3WV0A 3MGOB 4RX4A 3TNNB 1HIML 3I75B 1MFBH 4U6HB 3RVVD 1M6OA 3H9SA 5KJRL 1LO4H 2PYEB 3PQYE 3JWNC 1QRND 1R3IL 3WUWB 1QUNA 3FN3A 4LSPL 5GGUB 3HG1D 5C09A 3NCCB 1EJOH 4LSRL 4M7ZB 2NY4C 4ZO8A 43C9A 1AFVL 3DUUA 4Q0XL 3STLA 2ZUUA 1A9EA 1U8LB 5GZOD 3ZHDA 2O61A 3PJSB 3HB3D 5DJXB 5FAAA 1WQVT 4O9HL 4D0DB 4RAUB 3T77A 3ZYIA 1HQ4B 3D0LB 4XWGH 5HGHA 5FDWA 4YXKH 1FAIH 1S9XA 1Q0YL 2JELH 3DUSA 4I48B 3JWDC 2XWJB 1O7SA 2X4QA 4ZUSA 2BRRH 4FTVB 5ALBH 1KJ2L 2NZ9D 2AABL 3QXAB 1CS6A 3BRDA 3HS0A 3CU7A 4UTBL 3ULUF 4CGTA 1NUFA 4PV8A 1DVFA 4G9FD 2C1PB 4MD0A 4YXHL 5D2NE 2FD6H 1T1WA 1BIIB 4Z5RA 1X5YA 1ZTXL 4XNXH 5EBGA 3MLYL 1BM3L 1FO0H 1QO3A 3V6FB 4XWOC 1JYWA 2YA2A 3NN8A 5KSVA 3QO0B 4P23D 4HUXB 2VXVL 4LHUA 2WBJD 1IQWH 1K3IA 4HKXB 3L7EB 4W68A 1N64L 4R7DB 2ZCHL 4K3EL 5KSUA 4KUCF 4NN6C 2LU4A 2XQBH 2NX5E 1JNLH 3CVIL 4Q6IA 2FBJL 5C0IB 3OMZA 5JIIA 2EYSB 5K59F 3EO0B 2FHFA 2W0LA 3GRWH 3SN6N 1E6OH 1VGEL 3DGGB 3BH9A 4PREB 3GMMA 2XZCL 4U6TA 2DIJA 4NNYB 1BGXL 3HMXA 3K0WA 4W81A 3VDCA 2YD4A 1GOFA 3QULA 3C8KA 4XVJL 4EEEA 5KW9L 1HSAA 4OZGB 5D7IA 4KI5C 4LSSH 4OZHA 4ZFGL 2IADB 3FQNA 1IM9A 1NCBL 1ZLVH 1G7LA 4IS6B 3UJJL 3D85B 5D9SA 2WAHA 1Q9KA 2AJVH 1E0OB 5D72H 5DSCB 4WI9A 5ICYB 2E8YA 4NKMB 1YNLL 1RFDH 1YYML 3KPMA 4MA3A 4Y4HD 3X3FH 3WNNA 1XGQB 2YD8A 1TVBB 5GGQL 3RNKA 3ETBF 2ARJA 1RV6X 1I9RL 4R97C 4AIOA 3ECBB 4RWHA 4AQ1B 2NW2B 3HMWH 3NCFB 5JR1L 4I4WA 2R0KL 1I1CA 4ZUVB 2XWTA 3WDIA 2CXKA 4P2CG 3GKZA 4UB0H 5IVXF 3B2UD 1P9MA 4WU7B 1MIEL 3FRPA 1U3HA 2PW1B 3MBED 4M43L 5C0CE 4RMUA 1JIBA 4PLJD 5IMKA 3L3DB 5D7IF 4CN1A 3QUMB 4P2RD 4NO2B 3T8XB 5IHZB 3IU4L 4PJGE 2FHCA 3CFJA 4JFQA 1TENA 4XAKE 2VLJD 2ZUYA 3S4SB 5EC2B 2IALA 2ZUQB 4HD9A 4QEGA 3DRTA 4WW2A 5B4MD 4U1NA 3PGDB 1U8KA 1EJOL 3R0MA 3TWCH 2NY2D 5EOQH 5C1MB 4LHUG 4NRYB 2HFFB 5CZKA 4WJ5B 5EB9A 3GSXB 1OF2B 1MFCL 1F42A 3VI3E 1MH5A 1KV3A 2GJ6A 3GGWB 2FSEA 5CZVH 3S8WA 4O58H 2DQIH 4EOWL 3CZFB 2V5MA 3OGOE 4PGJA 5HHMB 4ZO7A 5CLWA 3IF1A 3CFEB 4YR6A 5FA3A 2HMIC 1DL7L 1KC5H 3RIAF 1G9NC 4WW2F 4ODUA 2DQFA 2HJLB 4RRPG 3FQUA 1WFNA 1CFSA 4RFEB 1BF2A 1ZLUH 4DKDC 4Y1AE 4YBQD 3S34L 3SDDA 2X1QA 3JVGA 1WIPA 4MMXC 3E1F1 4X4YA 1JNJA 4M62H 5EO1B 5E8PB 1OW0C 4PJ5D 1IQWL 5JDJA 3QEQD 5BW7A 5MEOA 4R2GC 3X13A 4NRZB 3C9NA 3TA3A 4YBLC 2EYTB 4N8VB 3VE0B 1QVOA 3BH8B 2OL3A 4GKOA 4KZEH 1HOCB 4BFGA 3WKMH 3IFNH 3E2HC 3RWJA 4JFHE 1PSKH 3FOLA 1EZVY 3MNZB 1N3NA 2Y23A 3GRWL 3MA9H 3FRPG 1E6OL 4MD4B 2GJZA 1D9KD 3B8SA 1HYSD 3CLEL 3PIQA 4JZNB 5CZXD 1X5XA 3DO3A 4GQPH 4DEPB 3FMGL 5I6XC 3A67H 4M6MH 1P69B 5BRZD 4LSUL 4YPJA 3I6GA 1IT9H 4JRXA 4DZ8A 4NYLB 2P8PB 1U2HA 4HIJB 4Y19A 4LSSL 3L3IB 1NLDH 4K94H 3LKQA 3VXQA 1MJ7L 3VXUE 4XP5H 2MHAB 4JO3L 3EYQD 5FM8A 2Z31B 3OR7B 3QHZL 4BFIB 3FQTA 3OAUH 4LOUD 2CDEB 2AJVL 4HBCH 5D72L 2OR9H 1UACH 3V5HA 1OY3B 5I8EA 5EU6E 5FHBH 3H9HA 4HJ0C 2R8SL 3FJTA 3MO1B 4Z8FL 4WIQA 4N9OB 5I76B 1OQOA 4HLZH 3WFEL 2YD9A 5FYJD 1CDBA 3HMWL 3MACL 3NGBC 5FYLE 4OCYL 4WRLA 1KB5B 3RKDD 3VWKB 3PWNB 1F02I 1PW3A 3FB7A 1A6UL 4UB0L 5SWSB 5SWZE 3T1FB 1CXHA 5HGBA 4FQXD 4RAVB 3VFRA 3IAPA 2BVYA 3EDEA 3SCMC 3FFCE 4X6BA 3RZWA 2LE9A 5J7CC 1WTLA 1JZ4A 3VXTA 3P4OA 3GMOB 4WWKC 4OZFA 4E5XA 1EAPB 3T0DA 1A6TB 3QDJB 2XY2A 2YPLE 3KDMA 5F8RC 3TIEA 3IKCA 3V5KA 3BOVA 1NDGA 5FM5O 3N9GH 3PP3K 1NFDE 4KJWC 1ZT7A 4YPGB 5AG9A 4OQTL 2D0GA 3QNYA 2E6PA 1T2QH 3CUPB 4B41A 2IFFH 4IIQB 5I8CB 3TWCL 3JWOC 3H0TA 4YAQB 1T3FB 3L5IA 2XV6B 3VXRB 3O9WB 1LDSA 1C5BH 4NO5B 4X9BA 4EI6A 1FHGA 1X4ZA 3ARBD 4LFHG 4U3CA 1NCNA 3MV9D 4UV7H 5DDHB 2XZAL 1G7JB 2PTVA 2LVCA 4P46C 5CZVL 3MTRA 4PJCE 1FZMB 2DQIL 4LPWA 4BK4A 1HSBB 4NQSB 1ED3B 5F6HI 5D93C 1KC5L 2IGFH 2G2RB 3BI9X 3QEGH 1S7VB 1FGNH 5J4MA 4OQTA 1NFIB 4ELME 3GMNB 1UZ6E 1BVZA 1TXKA 4GXUN 1GZPB 1C12B 3LMJH 2H41A 4MNHB 2A6IB 4XBEL 2HKHH 5C0DB 4N5EC 5KG9B 3TH4T 5L2JA 2ESVA 3FT4B 2FYYB 3ARGA 2DL9A 2VLKB 4JFFB 3ULVH 1JJUA 2XXCB 3BO8B 1T1ZB 2XI9A 4OFVA 2BVEA 4U7KA 1DUZB 1KG0A 4PPTA 4YXLH 4MLIA 5D7LA 1E6JH 2ZSVB 1YMMD 4KZEL 3WKML 3IFNL 4F7TB 3MNWA 1PSKL 1MQKL 3S97C 1HCVA 3RTQC 2GEEA 1UVQB 3MA9L 4YDLB 3BP7B 2J6EH 2IF7A 1LEKA 4KVNL 4TPRH 4X6DA 5TH2A 4M48H 1VERA 4R4BB 4WWID 4L3ED 4H20H 4PRHB 4OZFG 3HRZB 3M17B 4M6ML 2GITA 2BOBA 2OLDA 3EOAA 1IT9L 4WTZA 3L3OA 2I9LB 5FF6B 4IM8A 5J1AB 4PJEA 1NLDL 4WFGE 5AD0B 1CFQB 4OUUB 5IB4B 2BC4A 3VXME 4U1IB 2CRIA 3KPNA 3OAUL 4PJAE 2F54B 4PGBA 1RJZA 4HBCL 5C07A 2DM3A 4F7MB 1D5IH 3U48A 4FFYL 4F15B 1S7TA 4X4ZA 1JZ7A 4N0FA 2CUMA 1T20A 5C8JB 2FZ3B 1NCAL 2PCPB 1H8SA 4F7CA 1VCAA 2HKFL 1IFHH 1MFAH 1P7QA 2DJUA 1BECA 2VDMH 4S1RH 4ZFZB 1DQMH 3HAEH 2YPVL 2ZCKH 3PQYB 4ZAKA 3MRHA 4RQQB 5FUCC 3RJQB 1J0HA 2F8XC 4HGWB 4HS6B 4XBGB 4HEPG 1CD8A 3CSYB 3DX7A 1HHJA 3IGAA 3MBXH 1NC4D 4QHLB 4GAYA 5TQ2H 3TO4A 2F5BH 1KLFA 3BZ4A 4MS8D 2P5EE 2X4RB 1TCRB 5C0JA 4BFEA 4NO0B 1UM6H 5FYKE 4K07A 1SQ2N 1T2QL 4U1SA 1HI6A 2IFFL 4MJIA 2PN5A 4ZUWA 4JFYA 4YE4L 1KJMA 1RUQH 4FFVD 1CD0A 1ZANH 4G6MH 1JHLL 1C5BL 1A6PA 3KYKL 4ORGA 1NGYA 4I5BB 1T89C 1W72L 2IAMA 5DJZA 4UV7L 1WZ1H 5CINH 4M7ZC 2GT9A 5DQJA 1HEZA 3ARYA 1PEZA 1DEEB 4OGAD 5AG8A 3VD3A 4YHOH 2X89D 3V0VA 2YUZA 5D2NB 4QHNA 3QUZA 4S10A 1L6ZA 1BBJA 4NHUA 4U6YB 1FG2A 4PP2B 1GGUA 5CP7B 1BQSA 1FGNL 4PRPD 2H3NB 3VI4F 1NAML 4WTZG 4F33A 3LIZH 4XCYB 3EUUA 1YY8B 5FO8A 4OIIH 1IILE 1F11B 1VHPA 2HKHL 2NX5B 2J12B 4HWBA 5T3ZD 4BQ8A 2IQ9L 1P1ZB 3H9SE 3TNMA 4BSWB 4XPFH 3C5SB 3LPFA 2YUVA 2NY6D 3ZE1F 4NZTH 3LV3A 2D2OA 5E6IB 2UVFA 3RDTA 2B20A 5C09E 4F58H 3ULUE 2UZIL 4XZUB 3FT3B 4M7JH 5J13B 3R06B 5H94A 5E03A 1T03H 1A1NB 5FXCH 3W9EA 1MJ8L 4C59B 3QQ9D 3JTSB 5GISH 4GMTH 5GS2H 4FS0A 4HS8H 2CXGA 1YC8A 2J6EL 5D4QA 4FXGB 3DX6B 4TPRL 4Z78B 4M48L 4WUUA 5B21A 5HJ3A 3B3IA 2RFXB 4KHTH 1N59B 4GRMB 5K59E 5HBBA 4ETQB 4JQIL 2N56A 3WFDH 3WN5A 4WU5A 3RIAK 5DS8B 3OKNA 4Q97A 2P7TB 1WUNT 3RWGA 4OCXL 5CEZL 4QRTA 3V0WH 4Y5YA 1D5IL 3WIHA 5DHVH 5DFTA 3MFGB 5JW4M 2DKSA 5C0CB 2JKXA 2DLTA 5I18H 1IFHL 2NY1B 1MFAL 1AO7D 3MUGA 3RHWF 2NY4D 3LH2H 4PJGB 1YECH 1L0YA 3ALWA 1U8NA 1DQML 3I2CH 3KLSA 2ZCKL 4M7KH 2BMKB 2HN7B 3G5VB 5HGAA 3OG6B 1G7QA 3WFCL 4JFPB 1ZXQA 2M2DA 3MBXL 1AGDA 1QP1A 2YMXH 3RWIA 1J8HD 1EHLH 4RFNB 2VITA 1F4YH 3BISA 4PJ9A 3CU1A 3LKNA 5JHDB 4HKJA 3QPXH 1UM6L 3O6LL 1IGIL 2CLRA 4KRLB 4HH9B 2C4FT 3PE9A 2VQ1B 5HY9A 4KY1H 3UTSE 1FFRA 1FL5B 4JM2A 1F3DH 5D7IE 2VKWA 4PJFA 3AVEA 4TUKH 1DBBH 1AQDB 1RUQL 4N0CC 1BWMA 4G6ML 5F6IB 2ZUQC 2YRPA 3WDJA 4QRUA 1G7HA 3FHQA 1MI5A 2IQAB 3PDOA 1KT2A 4D8PB 4XWOD 1OM3H 5F1SA 1U93A 4TNWF 3U0TB 2X09A 3HCVA 3NFNB 1FYTD 3HFML 3IDUA 1MLBB 1U2CA 1X5GA 1TTUA 4AL8L 1BZ9B 5HYEA 1LP9F 1OT1A 3QUYB 4JGUA 2YD3A 5ADOH 1A5FH 2YEZB 5DQ9B 1CLYH 4XGZA 4DVBA 2I24N 3BZEA 2C7UA 3K2MC 3WXWL 4JHZA 1BJMA 3MRLB 3DO7B 4JM2F 2AI0H 4OIIL 5I1LA 1ZWIB 3WIFB 4LQFH 3GSWB 2FR4A 4D94A 1KFAH 4XTRC 1CDGA 4F7PA 3BKCH 4MMZC 2XOTA 4MAUL 4M7JL 3SJVD 4XPTH 1ZA3A 4KK6D 4GKSB 3I84A 4YO0A 2Q8BL 1ZGLM 1IL1B 2XNAA 4GMTL 1NL0H 3QYCA 2Y36H 4X8XA 25C8H 2GJ6E 4MJ6A 4X9FA 3VXUB 1KXTB 2VZUA 1DANT 3TPUA 3QJFA 4S0SD 1ZA6A 1DN2A 1LO2L 4RIRA 5CD5C 4JZJB 1G7MA 3WS3A 3PHSA 1XEDA 5F1IB 5EU6B 4HKZB 1ZLVK 3WFDL 3BKMH 3TN0A 1CGWA 4DEPC 5HDBE 1LNUB 2A73B 2EIZB 2VKXA 3MJ8A 2ADJA 4HX1B 1OOAA 3SDAB 1OSPH 3EHBD 3BDBA 5SWZB 3QQ4B 1NMCB 1ZLWH 1JYVA 1T4KB 4K71B 3FFCB 3T1WA 1YQ2A 3VFMB 1G6VK 2D7PA 2Z31C 2ZZUT 4RMTA 1QBLH 2DLFH 5CMAB 5I18L 3FO2A 4S0TD 4OFIA 1YMHA 5E2UL 1OAQH 5CKAA 4OGXH 5E6ZA 1LK2B 1YECL 2YPLB 5DRNA 3WHXB 4N5UA 3I2CL 2AKRB 4M7KL 3VFWA 3D25A 3MGAA 1NFDB 5EBLB 1UH3A 1BQUA 1MWAH 5DJ0A 1CLZL 2FGZA 1AD0A 2H6PA 1F6AA 2Q3AA 4U6VL 2YMXL 3VWKC 4PD4K 4I0KA 1IC4L 1G9MH 2BNQA 3B6SB 4LAJH 1F4YL 1ZS8A 2MQ3A 1EMTH 3S36H 4NZJA 3PWUB 1HHIB 4JLRA 2HMID 4XP9L 1OTSD 4M6OL 4APQA 2L0DA 4JRXE 4KY1L 5DJYB 4Y4HA 1FC1A 4PJCB 4TUKL 4Y19E 4H1LH 2Y1VA 3MCKB 5DUBA 1BP3B 3JBG7 2VDNL 4MQ7A 1K5NA 5SX4H 4IIQC 1IC5H 4R3SB 2BOCB 4NQVB 3O6KH 2X05A 2JJSA 4H8WH 4KKLC 4OAWB 4LLUB 4ELMB 3O9WC 3BT2H 4WEUD 3GSVA 4R2GD 1HDMB 1HWHB 1NC2B 2AVGA 2YKLL 5GIRB 3OAYH 1FV1A 4P2RA 5ADOL 1A5FL 3K81A 2D7OA 2DDQH 4NUGL 3K8LA 5CGMA 1CLYL 1ND0A 1D3CA 4FQLL 4TVSa 1TJIH 4HFUH 5CCKL 4HPYL 1X5IA 4M5YH 4J6RL 2JLLA 1HXMB 2P5WA 2WMPA 1UENA 4CKVX 4P2QD 5IB1B 1YZZA 3F7YB 3Q6GH 5K9KA 4OD2B 5JOFA 1KFAL 2D9CA 4NRXB 1J88A 1FVCB 3IS0X 4Y4KB 1YEGH 4ZODA 5DHXB 2XN9E 3LZFH 4HCRA 1I9IH 4F2MB 1V8HA 4XPTL 2WINB 2D31A 4HJGB 4NFDA 3MLWH 3ARUA 4HV8B 2FWOB 1OGAD 2K3TA 5T1LB 6CGTA 4U1JB 4HDIA 4HJ0D 3FB6B 25C8L 2HT3C 4JE4B 3WFHA 2H8PB 2PF6A 3V6ZA 4NQED 3VXMB 3CFCH 4JFED 1DQDH 4GBXB 4PJAB 4D0CA 3U4BL 2X4TA 5DURD 1RSFA 2I07B 4Y2DB 1S9YA 4YDLC 3P0VH 3SCMD 1A7NL 1ZHLB 3BGAA 1FFNB 3BKML 2X4OB 1YEDA 3L7FA 2E27H 1RIHH 1J0YA 4WWKD 1BREA 5F9JB 5TDNA 3ZKMC 4GMSH 4B0MM 1H3PH 4X6CA 4JY6A 4KJWD 4X80H 5E8NB 2ESVE 4WFHE 1MAKA 3V52H 1BX2A 1OAYL 2DLFL 3I02B 1KLGB 4CAGA 4Q9BA 4MQSB 3WE6A 2BSRA 4OGXL 1KN2L 4FFWC 2P5EB 3EYOB 4F15C 2EZ0C 2F53D 3BP4A 5JW4Q 5D7LE 3BKYL 1MWAL 2AJUH 1AY1H 5CWSB 1B0GB 1J5OH 4DN3L 3FT2B 4P46D 4JHAL 1G9ML 2J2ZA 4TUJB 3KPSD 4NKDA 2NNAB 3MLRH 5EIVA 3RZCB 3IXAA 1EMTL 3GO1H 4X6DE 4ODVH 2VL4A 1N7MH 2D0HA 2EDDA 4YDKH 2HFGH 3IJHA 2WBKA 4X6CF 3OGCB 2WP3O 1KPUA 3WLBB 3MPCA 3GKWH 5DC4B 4PJEE 4JDVA 4NZRH 4X4XB 4X7EC 1JWUB 2R1YB 4PRNA 5IW6B 2HT4C 3UBXI 3GB7B 3BGMB 5KOMC 1JUFA 4N5ED 4UQ2A 5C07E 5D7SH 4HS3A 4KKCC 1WBXA 4YHLH 1IC5L 2V9RA 4FQXA 5B8CB 4JDZA 1CF8L 1IAKB 4HWZB 3HMXH 4OF5A 1OPGH 3MV11 4G9DB 5J6GB 5D7JA 1V3JA 2D9QB 3RHWK 1AXTL 1M6OB 3H9SB 2DDQL 1S9WB 4KDWA 3OAZK 4HGMA 3RTQD 4HFUL 5D2NC 5C09B 2F58H 4M5YL 3X14A 4QHKJ 2GK0A 43C9B 2KQNA 3DUUB 3STLB 1A9EB 4JR9H 4Z7VA 3TC9A 4HKBA 3Q6GL 4XVTH 5F89A 1DFBH 1GCFA 2NY7L 3QAZC 1FZKB 3T77B 3VI4E 3ARBA 3MV9A 1I9IL 3CC5B 4LF3A 2BK8A 1HHHA 2Q86A 1Q38A 4TSAH 3P73B 3G9VA 3SGJA 2PO6B 5FDWB 5HGHB 5D1ZB 1S9XB 2WNGA 5E6IC 3DUSB 4LIQL 1L9MA 3QP3A 4NKOB 2X4QB 5J13C 4ZUSB 3ZYZA 3MLZH 4CJ0A 3O45A 1SY6H 2NMSA 2HT2D 5AYUL 1G0XA 3HS0B 3PHQA 1A3RL 5GGSA 4DOHE 4DAGH 1J05A 1DQDL 4XXCC 4AEFA 4PV8B 1DVFB 2ZNWA 4MD0B 1ODAA 1AJ7H 1T1WB 4LK4A 4Z5RB 3STZA 2L7JA 1TVHA 2QR0A 1QO3B 1N4XL 3OL2A 3IRPX 1OGTB 2VZ3A 4WY7H 3NN8B 5KSVB 2CRMA 2XY1A 3ZDYF 4H5SA 1PLGL 2LV4A 4LHUB 1RIHL 1MFNA 2AS5M 1Q9OA 4XH2A 5KSUB 5DFVC 3UJTH 4GMSL 1T7VA 1MQ8A 3MJ9L 1F8TH 3ORJA 3FO1A 4Q6IB 4JG0L 5L8JB 2EKSA 3EJZC 1VEMA 4X7CC 4HPOH 2WV3A 2J88H 4J3XA 3SDXA 1TJHL 1JTTA 2PYED 1KJ2B 1XCTB 4NQUA 3VGFA 3TBVA 3BH9B 1YUHB 1F2QA 3GMMB 2VQUA 1I1YA 2NY1C 4B50A 1MELA 1AY1L 3K8KA 5ITFB 3QULB 3F5WA 3GBNL 1UXSA 3UTSB 3A6CL 3C8KB 1HSAB 2R0LL 5D7IB 2R29L 8FABA 4HWEH 3FQNB 1IM9B 2YD1A 2PTTA 3GO1L 1G7LB 4H26A 4WUUE 2R4SH 1Q9KB 2ZJSH 4QNPE 5CBEA 2Z8SA 3P11H 2OMNA 3U9PL 5DEFA 3KPMB 4MA3B 2HFGL 1WK0A 4RFNC 4MQXC 2P24B 4GS7B 4RGNE 3EFDH 4QY8A 4ZTPL 3SKJL 1G1CA 4M1CC 3S9DB 4P99A 5EWIL 1PZ5A 1IGYA 4S1QH 5D1QA 5E8DH 4GH7B 2XWTB 4FTVD 5D7SL 3Q48A 5B38A 1GJIA 3ARZA 4GW4B 3QCVL 1UJ3A 4K9EH 3ROLA 1U3HB 5F6IC 2I60H 5IMKB 1FZOA 1S78C 3NH7H 4JPWL 3BWAB 1I7RA 5A2KH 4BH7A 4XBPA 3CFJB 4L4VE 1IGTA 1OSZB 1GXEA 2IALB 4OM1H 5IOPA 4WW2B 3DRTB 4LHJB 1MCBA 1U8KB 2F58L 3UAJC 5H37G 4FQHA 3QUYC 1L7TH 4PB9H 5GRUH 3L6FA 1V05A 1FDLL 2P4AB 5BVPH 2JB5H 1I8MA 3HNVH 4XVTL 5MP6L 1EFQA 1QFOA 1WWCA 2A6KB 5CEZE 1MH5B 4OD1L 4LP5A 2GJ6B 3LEVH 5E5UB 3GJFH 2FSEB 1J0ZA 1DDHA 1CD9B 4FQIH 2UWEA 2BY3A 4PJFE 1MCFA 4F7EA 2F9BT 3G6JF 3VFVA 2GFBA 3IF1B 1J0KA 4MDJA 4DUVA 4XCNA 4X5XA 5FA3B 1EZVX 1MI5E 4B5EA 1OD9A 4FFZH 5DD3H 1P4LB 2I5YL 3PV7A 1SY6L 2CRYA 1ZSDA 3JV5A 4ODUB 1AP2B 2DQFB 3G6DH 5EZIH 2EIEA 3D85D 4PRPA 3TH3T 3FQUB 4R8WH 4JPKH 5DGQA 1CFSB 1RUMH 2RJMA 3O11A 3SDDB 2NCMA 4GXVH 1KGCE 3BN3B 2ICWA 2BY1A 4XCCL 1MCPH 3H7BA 4JZJC 5MEOB 1G6RH 3VMPA 2W91A 3C9NB 3TA3B 3UJTL 4P9HC 3TESA 1BFOA 1F8TL 3OXRB 2OL3B 3DETC 5CFHA 5DK3A 7FABH 4LCUA 5KSBF 5DHYA 3RWJB 5ITBH 3SDAC 2J88L 3FOLB 3ZLQC 3D0VA 3NA4A 1NMCC 2KDGA 4K71C 1N3NB 3UBXG 5DZOA 1QA9B 2GJZB 4JY4A 3PIQB 4PY7A 1BMGA 3O81A 1DBJL 1TMCB 3I6GB 4JRXB 1F6LL 3DUHA 5D6DA 4Y19B 1AE6L 4ONFL 3L1OH 3VGDA 5I2IA 1EEUA 4KDTC 3DURA 3J7HA 3BZFA 2R4SL 5JOPE 3ZHKA 3V5HB 3P11L 4KI1A 5H35A 5I8EB 4R4NC 3O3EA 3H9HB 3EFDL 1BVKA 4RISH 4IMLA 3SOBL 5HHMD 1BD2A 1RMFH 1QSEE 5F88A 1F2XK 4XB7A 2BSTA 4S1QL 4X8JB 3FB7B 2VDLL 5HGBB 4TVPH 1QOKA 1T83A 4A6YL 5IHUL 3VFRB 3B9DA 4K9EL 4X98A 5TE6L 2I60L 3VXTB 1RUAH 3P4OB 5AZ2L 1N2RA 4DTGH 5ESQB 4OZFB 4E5XB 3NH7L 5C0EA 3KDMB 1J8HA 1QLFA 3U1SH 3TIEB 3IKCB 4L8DA 3RY5A 4NJ9H 5CJXA 4YZFF 1P84K 1B6UA 1JTOA 1ZT7B 3NFPA 3H42L 3R1GL 3EOBB 4MD5B 2XN9B 2EDKA 1L7TL 5GRUL 2RAMA 3OJMB 4LLAA 4YHPA 2BNQE 3UC0H 1JL8A 4U1HA 5KZCB 4KTYA 5CD5D 1X44A 3HNVL 4LLVA 3VXSD 4EI6B 3GMPA 2QQKH 1SMOA 3K2UH 4LMQE 5I8OL 3LEVL 2VUOA 4FQIL 4G7YL 3RWDA 4I77H 3NCJH 2QADB 5T33H 2XFXA 3FTGB 3GSNA 4Y4KC 4WHDA 4FFZL 5KAQF 3MV7D 4G7VH 1S7SB 2Z31D 3G6DL 5EZIL 4DVRH 3O41A 2W38A 4NM8H 4YHIA 4R8WL 2A6JA 4OKDA 4HFWA 2FHBA 3H3PL 3HPJA 1RUML 4NFCA 1KELH 2N1KA 4DKEL 3FQWA 5L2JB 2OZ4L 2ESVB 4GXVL 4XNMA 3AY4A 3ARGB 4OLXH 4XHJC 1MCPL 4GBXC 4PGCA 1VENA 3VWKD 3BHBA 5SWSD 1G6RL 4OLYH 5LCVL 1ZLWK 1G9EA 1S9VB 2GTWA 5ANMA 2P5WE 4Y2DC 1KG0B 4A2LA 5D7LB 4WHYH 2ADIA 1EO8L 1WZLA 3MNWB 4WFFE 2VOTA 5LJYH 3LQZA 1TVDA 5DVOA 2VYRE 4K55A 2V17H 4YC2B 3U7WL 4H0IA 5C3TA 4X6DB 5TH2B 2ILLA 2H32H 4JGJA 1A1OA 4TTGA 2Z91A 3THMH 1K8IB 2GITB 5E00A 4AMKH 2BOBB 1CE1L 2G75A 1ZKAA 5KAQG 5ELIA 3C6LD 4KKLD 3VXRD 4IRZL 4PJEB 3ZMRA 2HWZH 3O9WD 3I3BA 3HHRB 2ZUVA 4OCWH 2BC4B 1N5YH 4EBQH 4X5WA 4CRPA 1CGYA 2DWDA 5L9DL 4PGBB 2B1AH 3QXDA 1RJZB 5C07B 2DBLH 2FO1A 3IDJA 3QFJA 4POYA 5ENWA 4WTXA 1VACB 1S7TB 2GY5A 4U2YA 3VG0H 3WUZA 4N0FB 2DQCH 4RISL 3RZCC 1T20B 1RMFL 4M03A 1INEH 2V9TA 3UYPA 4TVPL 3I9GL 1H3UA 4YFEA 4ZAKB 4Z7QF 3MRHB 4P2YA 2F5AH 4X6CE 5IB5A 3WS6A 5E94A 4DFIA 4MXWL 4N0UA 1HHJB 3IGAB 4UOJA 3WO3B 1RUAL 4GAYB 1J1XH 4MGXA 3TO4B 3BZ4B 4LCCA 4JG1H 4JFFD 2VLKD 4NJ9L 5C0JB 2MWCA 3I50H 2QTEA 1J10A 4FQ1L 1X5ZA 1HI6B 1F4WH 2HVJA 2HT3D 1N26A 4RMQA 3HC4H 3WBDA 3UC0L 4OSUH 1EGJH 1KJMB 4K8RC 1M7DA 1KENH 1ZV5A 3ARFA 4ORGB 1NGYB 1SEQH 1NMBH 3S35H 3K4DA 3ULUC 3DVNA 4ELKA 4FZ8H 2IAMB 5DJZB 5GGTH 1BVLA 1F3JB 1GAFL 2QQNH 2GT9B 5JW4N 5DQJB 3AROA 1HEZB 3N85L 4PRHD 3GI8L 3NCJL 3TBYA 4DOHB 5E08H 2C3VA 4JQXA 4N9GA 4N8PA 4YDVB 3JSSA 5T33L 3AB0B 3FHAA 2FCBA 3V0VB 3ZKMD 2GKIA 4HK3J 1NANH 3QUZB 4U1LB 4ZOAA 2WWKT 1BBJB 3QA3A 4G7VL 1FG2B 5IQ9A 2PO6C 2UYLA 1CK0H 1YN6A 5D1ZC 1C1EL 3ARVA 5GGVH 4DVRL 4ODSL 4F33B 1A6ZA 4P2OB 4ZYKA 3QG7H 4FFWD 1VADA 3AS3A 5GRWA 5FO8B 2EZ0D 5BCAA 4UT7L 1KELL 5D1XA 1A6WH 4G6FB 3STBA 2YHGA 3LS4L 4P2QA 3TNMB 1CT8A 4NNXA 1IEHA 3LV3B 1DVFC 3W2DL 1W72B 3GNML 4OLYL 1XF2A 3OKEA 1T1XB 1DLFH 2VL5A 4GW1A 5KVEL 1NANI 3PQYD 4L8BB 5H94B 3GBMH 4AM0A 3MV8A 2E9JA 2X7LA 4GAJL 3TGXA 4PS4H 3W9EB 4AJ0A 1S7RA 3UPRA 4JFOA 4OCRH 3BEWA 1OGAA 3T08A 3ZDYE 5IVOA 4HQQL 2O5ZL 4FRWA 2XYCA 1A7QH 5KS9F 1FGVH 2V17L 1R5IA 4BQ9A 3G08B 2HT4D 4Q6IC 1IGFH 4NO0D 4NQEA 4WUUB 3GUTA 3THML 2IANA 3OKDB 1NKRA 1U3ZA 1R5WB 4KKCD 2NY3B 5HJ3B 4RGNB 2UY6A 3DX8A 5A2IH 3DV4B 4YLQT 4BELD 3CX2A 4G5ZL 2HWZL 5D2LA 1Z9OA 4GSDH 4OCWL 3WN5B 4S2SA 4WU5B 5DMGC 2F19H 3OKNB 2YD2A 3RWGB 1S7XB 2B1AL 5DD1L 3RX5A 4QRTB 3BUYB 4Y5YB 3TBTA 5BMFH 2YXMA 1XGTA 1W0VB 1T80A 5EIQA 5KTEL 4NFBA 3F7VA 5EBMA 4J7RA 4PBXA 1INEL 3MUGB 5F3BA 2XTLA 2C1OA 3QZWA 3GHEH 2FJGB 5JW4R 1U8NB 4L4VB 1EXUB 5K93A 3OWEA 5HGAB 1G7QB 3VXPA 2ZG3A 4LIQE 4DN4H 1H15A 1AGDB 3RL1A 2NX5D 5CUSH 3MQIA 3RWIB 5D2LF 1BPVA 4XC3L 2VITB 4JN2B 1P9MC 4FXLA 2NR6C 4PJ9B 4JG1L 3HPLB 1I8KA 5E6ID 3LKNB 5GSRA 1U3HC 3MRMA 3MR9A 2CKBA 1OAKL 4HKJB 4I9WE 3RVUC 1GPOL 4Z95L 2CLRB 3SE3A 2DI9A 5JZ7C 2EC9U 3RU8H 4GO6B 5HY9B 3LN5B 3HC4L 4JM2B 3LKSB 3OJDA 4PJFB 1IAMA 2GAZB 2QL1A 1EGJL 4OSUL 1C08B 4Z0XA 4MNQA 4U0QB 4WW2C 1UWGH 3LKRA 3RVXD 2JJVA 2OTPA 4LPCA 1OT2A 4QYOA 2AJSL 1MI5B 3PDOB 1KT2B 2XKNB 5GGTL 1A4KA 1GHFL 5FB8A 3UDWA 3VGBA 2C3WA 4WO4A 5E08L 3VFGH 2V7NA 4WEMB 5DFVD 2PKDA 3DSFL 1PY4A 4XNQB 5SWQA 5JPMA 5C2BH 1A47A 3HRPA 4QTIL 5T1MA 5DWUH 7CGTA 1UWXH 3LN9A 4YHML 2FLRT 4DVBB 1CK0L 4AQOA 3BZEB 5GGVL 2YRZA 3NPSB 5E2TL 2C7UB 4P3DA 1KEMH 1FSKB 2IPUG 4QRRA 2DIBA 5I1LB 5HYIA 4AZ8A 1A6WL 4KDVA 5C0CD 1ONQA 2FR4B 2NY1D 5AUMA 5INCA 4Q6YA 1UEMA 4F7PB 4WHTB 3MRPB 1DLFL 1PDKA 4XAKD 3T2QA 2B4CH 3JVGC 3SDDC 3E8UH 2CLZA 5CJQL 4YO0B 5FEBA 2QSQA 1DQQB 1LO5A 1J1PH 1Z3GH 4PS4L 3QZWG 1JWSB 4OCRL 2XNAB 5BW7C 4MQXD 1I8IA 3TA3C 5IG7A 1P7KA 4JB9H 4OFDA 2M8XA 4F3FA 3TPUB 2UWEE 4Y89A 3QJFB 1IGFL 2YZ8A 1IE5A 2MQ0A 3EYSL 4RIRB 2B5IB 3VH8A 4P0DA 4UIMA 2BX5A 5KSBE 1G7MB 2YZ1A 3SDCA 3WS3B 4FABH 2OS7A 4P57A 2O5YL 3QCTH 3BDXA 2PYFA 1PX3A 4GSDL 1QSEB 3EO9H 3TN0B 1KPRA 1WF5A 2F19L 4BK5A 4PRPE 1S78D 2ADJB 3TPKA 3V7AG 1RVFL 1JF6A 1T21B 5CHNA 4PR5B 5BQ7A 2R69H 1NMAH 4X6FB 1ZGLA 3UAJD 4J3VA 1MPAL 1YMHB 3ZE2F 1MNUH 4PJDF 2ZPKL 4Y1AD 3VXOA 5IV2A 5L6YH 3CFIC 5DRNB 4RAHA 3DHMA 3VFWB 2R2CA 3KPTA 5GGUA 5EOTA 4UQ3A 1KTDA 1HINH 5TQ0H 1AD0B 3U30B 2CK2A 1F6AB 2H6PB 5CUSL 2BNQB 4K2UH 5FHAL 2E7BA 5HI4D 1ZS8B 4JN1H 4JFHD 5IBTL 5IW3A 4KQ3L 3BE1H 4JLRB 4EN3A 2YD5A 4HUWA 5CGTA 1JK8A 1B4RA 3RU8L 4APQB 2IBBA 4HXBH 2OTWA 1AR1C 5CP3A 5E56A 1DQJA 1TTGA 1P6AB 2R0ZL 4OLUH 3DYPA 3VCLA 2VUYA 4WEBH 5DUBB 3ZT6A 1MIMH 1KCUH 4YZFE 4MQ7B 2UV3A 1K5NB 4R90L 4ZPTA 3GJFK 3VXUD 4KTDL 2VAJA 1L0QA 1UFUA 1BD2E 4ETYA 3GSVB 1U8PA 5EU6D 5T3XL 1FV1B 1HNFA 1ZT1A 2ICEB 3MLTA 5MENA 4DGYH 4TULL 5C2BL 4MXVE 5E4EB 3DETD 5DWUL 3ZTJG 3VH8G 2YA1A 1ND0B 4X7TA 4BYHA 4ZS7L 5CBAA 2QADC 5EO0A 5FYLD 3SDAD 3L7EA 3RPKA 3EZJB 5SWZD 4R7DA 4CUCA 4UINH 4MQTB 1CN4A 5LGHH 2P5WB 5I1JH 1WCQA 2ADFL 3FFCD 5IVNA 1A7OH 2AV7A 3ALPA 5C6PB 2OMBA 5IESH 1FORH 2NYYC 5K9KB 4F57H 5K9JH 5JOFB 5C0IA 1IKFH 1NEZA 2EO1A 5FYJH 4Z7UA 2YPLD 1QQDA 3DGGA 4P4KB 4RBPH 4I0PA 3E8UL 2D31B 5GJTL 3ARGC 3PXHA 5E7BA 4ZPVB 1KACB 4L4TA 4OCSL 4NHCL 5F7WC 4R4ND 4HDIB 4OZGA 2DQEH 1UM5L 4X4MA 3WFHB 3Q3GA 4Y8DC 3V6ZB 5DD5L 4IS6A 1FIGL 2J8UA 3D85A 5DSCA 2X4TB 4LSVL 4FABL 1XGQA 1S9YB 3QCTL 1SEBA 4U4BA 2HAZA 1F4HA 4Z7UF 3MRKA 1CQKA 1YEDB 1RZKH 3L7FB 5T1KA 5BXFB 5TDNB 5BO1L 4BQCA 1DSFH 3LDBB 5TFSH 4YHZL 1J18A 4X6CB 2A1WH 1NC2D 1NMAL 4JY6B 1BX2B 2Y72A 2C4XA 1EFXA 3WE6B 5IHZA 4HJJH 1NBQA 1I85A 1L4IA 4GG6F 1PQZA 5ANME 4BZ1L 2YPKB 2VN4A 4U1GB 2WM0A 5D71H 1OVZA 4MCYA 1HINL 1HHGA 2R15A 5EU5A 5JORA 1I9EA 2LFGA 4K2UL 2FATL 1J1OH 2K9UA 4JO1H 4NKDB 4ZAKC 1FPTH 4WJ5A 4Y4KD 2RB8A 1GZQB 1LO0L 1MF2L 1JHTA 3FOMA 4Y5VB 2ZOLA 5F7HA 3MRBA 3IJHB 4HXBL 3TO4C 3U7YL 2VMFA 5DEGB 1RU9H 1KPUB 4JDVB 1UB6A 4PRNB 4WEBL 4HH8A 3CFEA 1QBMH 5T1LD 3VFTA 4C83A 1A7PH 1MIML 1JYXA 3AM8A 2OJEA 4MHHG 1KCUL 5F7FA 3SQOH 5JO5A 2WW8A 1JUFB 1UM4H 2BHZA 4UQ2B 3DLQR 4WFGD 4G43A 3QFJE 1WBXB 2GJJA 5IKCA 4I8DA 3VXMD 4NCDA 3CJJA 1T5XA 4FQXB 4XHJD 4YHNA 4GBXD 4KQ4H 3MLSH 3C5ZA 1CLOH 1L6XA 4RFEA 4Y2DD 4EQ3A 1Y6NR 2IAMC 3N1GC 5D7JB 5I0DA 4DGYL 5MEPA 1CTOA 2GSIA 4PBWD 3RA7H 4EZMA 2DTML 1ZHKA 3CVHL 5E8PA 3EDJA 4HBQA 5IW1B 3AB0C 1WZMA 4J8RA 2QQLH 2D3VA 4UINL 3X14B 3QUZC 1LDPL 2GK0B 1VB9A 1X4YA 2FX7H 3TH2T 3VE0A 5I1JL 2MNUA 1A7OL 4KWUA 3NBNA 1TTFA 4HKBB 1FORL 5C0BE 1AIFA 4Q9RH 2W9DL 4F57L 4OF8A 1IKFL 3VXSA 5F89B 4P2OC 5FYJL 5LXGH 2P5ED 3DRQA 3ARBB 4HK0B 2VB5A 1FN4A 43CAA 5JUEH 5IWLA 2Y6SC 1HHHB 2Q86B 5GXBB 4ZFOL 2NXZB 5FYKD 5CLTA 5AZEH 1HH9A 4M02A 3LD8B 1UT9A 4HIJA 5FO9B 3RY6C 3KPLB 3RZCD 3O45B 3MV7A 3TT3H 4GAGH 3TP4A 3PHQB 5DJDA 3AREA 3RWHA 1J05B 5I71B 3NZ8A 3Q5TA 4LPTA 4K23H 3STZB 5AWNH 3TM6A 1TVHB 4MX7A 3MO1A 4PJ8A 5GPRA 2G9HB 1XGPA 2GW5A 3BXNB 4H5SB 5E4IA 4L9LA 5DYOA 3VWKA 3VD7A 1Q9OB 2NY3C 1CDIA 4XH2B 5ERWB 4RGNC 4LDEB 4OLWL 4RAVA 4WCYH 4B7IA 5TFSL 3FO1B 2A1WL 3WN5C 2EKSB 4HAGA 3W11C 2UVEA 1FVEA 3GMQA 3GMOA 3SDXB 3H9SD 4Y5YC 1JZ6A 2XQYK 5J3HC 4K8RD 1Z6JT 1NSNH 3L3JA 4L29A 3TBVB 3C08H 3MV8E 5C09D 4NUJA 3ULUD 1I1YB 4OZ4A 4FQJH 2LQRA 4J3UA 4M9OA 3P9WB 3F5WB 1UXSB 2FRGP 5F44A 3G6AB 1T3FA 3C6LA 5T3ZH 4UNTA 4JO1L 4MDIB 3O9WA 2PTTB 4MA7H 3O2DL 1S3KH 4H26B 2D7TH 5EU3A 4LPVA 5CILH 2L7UA 2IANE 5CBEB 4QLRA 4HSQA 1G7JA 1QFUL 2PO6D 5D1ZD 1RU9L 5IGXL 4PJ9C 2BFVH 5D2LE 5B22A 2P43B 4LSQL 2VXTH 3C60A 5ILTL 1HSBA 4MA8H 3NFSH 1D6VL 1ED3A 2AK4D 1PZ5B 3P2TA 1MREH 4MLSA 1H3VA 5D1QB 3KVQA 1ITBB 3INUL 1OHQA 4JM2C 4LLDB 1IEAB 3O2VL 1UJ3B 3UBXB 2CQVA 4I18A 4PB0H 1DVFD 3ROLB 1N5AB 3GMNA 3MSPA 4KQ4L 3MLSL 1CLOL 4YX2H 3VXNB 2R2BA 5LG1A 1C12A 3C2AL 3LQAH 1I7RB 3RA7L 2V5SA 4BH7B 4XBPB 1R6VA 3U9UA 1JGEA 5FGBC 3FT4A 1IGTB 2FYYA 4LHUD 3S3PA 4JFFA 2VLKA 3DV6A 3WIIL 4V2BA 4OUOA 2QQLL 2AW2A 3B5GA 3BO8A 4FQHB 5F93C 3MREA 3OKLB 4NOBA 4V1DD 2FX7L 2X9XA 3L6FB 5IJVB 3RIFF 1DUZA 1ADQH 2X70B 3RVVC 1XZ0A 2UZYB 3FQXA 2ZSVA 1I8MB 1JHKH 3NPSC 1EO7A 1FSKC 2CR6A 2WSKA 5LXGL 5DJ8A 5D5MF 5JUEL 4P5KB 1DDHB 2IBGA 3V7AE 4L9DA 2UWEB 1CFTB 5DMGD 3VJ6A 1CVRA 4R4BA 1EHNA 3OBAA 4YQXH 4FQQA 5ACLA 3QHFH 4MNQE 3JXAA 4F7EB 3HRZA 3VFVB 2GFBB 4MDJB 3UTSD 5KSBB 4XCNB 2P44B 3UYRL 4XPGL 1CXIA 4XPHH 1NGXB 2DQJH 5I1EH 5AD0A 1U42A 1CFQA 1ZSDB 3TT3L 4GAGL 4U1IA 4PRPB 1PAMA 4JKMA 3JWDH 4BQ6A 2B2XH 1EEQA 4K23L 5AWNL 3ZT7A 5FCUL 4S1SH 3DTXA 2BNUA 3O11B 2Z35A 3O4LE 3UXFA 2FZ3A 2PCPA 3NCYS 2ICWB 2B5IC 3H7BB 4DKFH 2EIBA 1BAFL 3GIVB 1A64A 4QRRE 4KXZH 3MLXH 2NR6D 5E7FA 4WCYL 3PQYA 1BFOB 1U3HD 4RQQA 4HS6A 4LCUB 3RVUD 3TN0C 5DHYB 5JZ7D 4GXUM 4Z9KB 3GSNH 1I3GH 3O3UN 4PJXA 4D0BA 3D0VB 4AEIH 1L7IH 3H3KA 1CZ8H 2WIIA 1TCRA 3BPNB 3ARRA 4WGWB 3WHE1 3P9LA 2CK0H 4PY7B 5EG6C 4AEEA 4P3CH 3Q5YA 4IDJL 4KK9C 2KUTA 3ZE2E 3AAZB 2XPGA 3D6GA 4X7SH 5I2IB 4CU7A 1AKJD 1JPSL 2AEWA 3VFUA 4MA7L 1FNHA 2GJ6D 3U30C 2XA3A 1WWAX 4Q58C 5EZLB 4O2FA 3QBTB 2WUBH 5H35B 2PUQT 4U49A 3NOIA 2APBA 4KMQA 1BVKB 4PLOB 4IMLB 1HHKA 1DEEA 2BFVL 1BD2B 4BZYA 4JVUA 2VXTL 4MA8L 1AH1A 1NBYB 4U3XA 2VZTA 2BSTB 4OGYL 4APQC 3SGEI 4TSCL 4NP4H 4ZSOA 5CP7A 4K7PY 5IB3B 3ARTA 4PB0L 4X98B 1CWVA 3OZ9H 2DYPA 4AENA 1AXIB 1BFVL 4DWHA 1F11A 1N2RB 3SDDD 4X7FC 1QYGH 2B0SH 1QLFB 3HI6L 4U6XA 1SBSL 4L8DB 4NSKA 2JJSC 3C5SA 5E6IA 3NFPB 5ADPH 3T65A 2HYMA 2C4FU 4LFHD 4HXAH 4ACPA 1BLNA 1UA6H 3GBLA 5E4EC 4YHPB 1ADQL 1YEEH 4U1HB 2V7HA 1HCFX 1JHKL 4LLVB 3V4PH 3RX7A 4XCEA 5HHPA 2CD0A 4HIEB 3VW3H 4UV4L 2RBLA 4ISVA 4LEOA 3DX6A 2OSLA 3LOWA 3RWDB 5M95B 1X6LA 4G8GA 3QHFL 1ES0A 1CQYA 1KCKA 5C6TL 5J1TC 5FUOH 2XFXB 1RZFL 4JRXD 5I1IL 1KJ3H 1JGLL 4Y19D 1CU4H 3WFZA 1N59A 3K4AA 3HE7A 15C8L 4P4KC 5I1EL 4G8EA 2NLJA 3O41B 2EDWA 1WSST 5E1HB 4YHIB 4JFXB 1BF8A 1S8DB 4Y7MA 3MLUH 3Q1SH 1VGKA 4J3TA 4WI7A 3O3DA 5KANG 3HPJB 4W6YB 5I8KL 4S1SL 5MENE 2N7AA 4JDTL 1SHMA 3FQWB 3MRNA 4XNMB 2AJZA 1FLRH 5I1HH 4N0YH 1ACYH 3OKOA 5KVMC 1FNEA 2GTWB 4HMDA 5ANMB 2ENYA 2LAGB 5L8LB 2BMKA 3S96A 2EH7H 2ADIB 1XF5A 4RDQF 1JRHI 2BVOA 2MFNA 3SE4C 3HLAB 3ARWA 5GS3A 4CNIB 1AR1D 3R8QA 4Z7UE 3QSKB 4M6NL 3LQZB 4UZGA 1S7WA 3LDBC 4G8FA 5IJKA 4JKPL 1S5IL 3BPLB 1VDGA 1O0VA 1YA5A 1KCRH 1A1OB 2Z91B 2XN9D 4HHAA 5T3XE 5E00B 2VR5A 4L4TE 4UTAH 2G75B 3O6FA 3U36A 4UT9L 4LASL 3VFPA 5KZCD 3L3GA 2X42A 4P3WA 4PJBF 4X4ME 3BPOB 4X7SL 4GG6E 4QOKA 2MCG1 3ZKNC 4JRYD 2J8OA 2DWDB 2J8UE 4LKCA 3RQ3A 2IQAA 3QXDB 4D8PA 3IDJB 1DR9A 3QFJB 5ENWB 2WUBL 5DJ2A 3CK0L 3MOAH 2QADD 1BZ7A 1ZLSL 2HVKA 5IM7A 1BZ9A 3E6FA 4KAQL 3U0WH 1CDUA 3MLVH 1NCWH 4Y5VC 5E2WH 2YEZA 4Y1AA 4HIXH 3F7PC 1FZJB 4H88H 3DGCR 2NYYD 4ONGH 1PGRB 2Q7YA 1D5MA 4GFTB 4M3KB 1FNSL 5IB5B 5E94B 1I4FA 2ORBH 3MRRA 3OZ9L 4O5LH 4RDQG 1H3TA 2Y25A 1LO3L 3IVKA 3MCLH 4WUKL 3BX7C 5EBWB 1H3GA 3CIQA 2VWEE 2ESVD 3GSWA 4LCCB 4WFHD 5DD0L 3ARGD 4FQXC 2DMCA 5J06A 5C0BB 1XF4A 1LGVA 2WIMA 4YH6A 1ACZA 2HVJB 5D7JC 1UA6L 4F9PA 4CN6A 5D7LD 1QR1A 1YEEL 3BMVA 3ARFB 3F58H 3V4PL 1RK0A 3KHQA 3DVNB 4ELKB 4PTUA 3JWOH 3VW3L 2X9WA 4RBPK 1BVLB 4WI8A 3IDXL 4I2XA 2OBGA 4FXKA 2Z93A 3HC0A 3TBYB 4RNRA 2C3VB 5I74B 4N9GB 5FUOL 1RZKC 2VE6B 3GHBH 1T7YA 3REWB 5E0QA 3VFSA 3TZVA 1CU4L 3ARBC 2YWYA 1VEOA 1SJXA 3QA3B 1VESA 4O4YH 2NXZC 4OB5H 3SGJC 5IQ9B 1UH2A 1N6UA 2UYLB 3JTTA 1LNUA 4EUPH 1H5BB 4KI5F 1JRHL 2CKBH 5C07D 4JQVC 3WL9A 4D9QE 3MLUL 4M3JA 1FBIH 3LD8C 1QBBA 1VADB 4YEEA 1VFOA 5D1XB 1G9NL 3MYJA 3SE9H 4GAFB 4YHYB 1WAAA 3ILPA 1CT8B 1FLRL 3MJ6A 4NNXB 3DMMD 4N0YL 1ACYL 3H7LA 5TF1H 5I71C 1RQ5A 3LEYH 4LQ1A 3OKEB 5DMJB 1LK2A 4GW1B 3WDHA 3B9EA 3FO9A 3WHXA 4ZAKD 4AM0B 4KJQC 3MV8B 3CFBA 2X7LB 1QSFA 1RI8A 2EH7L 2V6HA 2VDKL 3RIFK 1S7RB 5GGRA 3UPRB 3VXSE 4DQOL 3K4ZA 3BIKA 3FONA 1I3RB 4UAOC 1WJ3A 3LPWA 4QRQB 1R5IB 4U05A 5J9PA 3FRUA 4NQEB 4LCYB 2IANB 4UIKH 4JM4L 3D5OF 4ODHL 4UTAL 2VIRA 9CGTA 1WAAF 3MLPA 2WQ8A 5D2LB 3MV7E 1DE4A 3IXTA 2PXYA 2XZQH 2IAMD 3VD4A 1RK1A 2YN5A 1KNOA 3CMGA 1HZHH 1MCJA 3QEHA 1W8OA 4QXUL 4JHWH 1XGTB 3QJHA 4ELMA 3ILQC 1CBVH 3QXWA 1CGSH 4PRAA 3F7VB 4QHUA 5EBMB 1B4JH 3MLVL 3QUZD 3RNQB 4DCQA 2C1OB 4LARL 4G3YL 3QZWB 4HIXL 3P0GB 4NQDA 2R1XB 4BUHA 1DBKL 4P2OD 2ORBL 1H15B 1YEHH 3T2NH 2JB6B 4PJIA 5D1QC 4LAQL 4G6FD 3MCLL 1CICA 1W0WA 5C0FA 5IHLB 4Z7WF 2VXUH 1UJ3C 5GSRB 2XICA 1Z5LA 4NRXA 3MR9B 5IIEA 2CKBB 1REIA 1YEKH 5ICZB 5IFHH 1EPFA 4GQ9L 4Z7NE 5ACMA 1UKSA 4TQEH 4Z0XB 2DKMA 5J8OA 4MNQB 4IRSA 3F58L 3V4UH 3LKRB 4QYOB 3BPCB 2QKIA 4FQ2L 3OJVC 2R4RL 3V9FA 1A4KB 3JWOL 5FB8B 2CMRH 2H8PA 4WUUD 4FFVC 4WO4B 1GVIA 2V7NB 3IDIB 3B9AA 1YNKH 4PGEA 1T0NA 4RGND 4CBPA 5SWQB 5JPMB 2BNRE 4MJ4A 5EU7E 3O4LB 2R2EB 1ZHLA 4OB5L 4J1UA 4HC1L 2LTQB 3W11D 2ZSWB 5J56B 4EDXA 3HE6A 3ZKQD 4P3DB 1NGQH 5C70A 5F9JA 5J3HD 3KAAA 4QRRB 1FBIL 5C0RH 1PG7L 1ONQB 5HHQB 5AUMB 3KPQA 4NDMA 5A16B 5INCB 2VDPH 1OTTD 5TF1L 5I1GH 3J8F7 3VD5A 1FVDA 3LQMA 2ARWA 3LEYL 3CZJA 5KVGH 3EJYD 4L4VD 1AR2A 3ARDD 3PV6A 2CLZB 1LO5B 2PR4H 4GOSA 4HW6A 5CWSA 5FOJA 3FT2A 3FAXA 3RVWC 3IAQA 4RFOL 1I8IB 2VC2H 5IG7B 5A3ID 1P7KB 5IBLC 4PJ9D 3EYUL 2NTFB 4F3FB 2Q6WA 3NIGF 3U2SB 4LRNH 4XMKL 5CEZD 1MLCA 3D2UD 2XWBA 3VH8B 4LNRB 3UZEA 1QLEH 3REVA 5C9JA 4UIMB 3KYNA 4JM2D 3SDCB 3RWEA 5L7XH 4R4FH 2EC9T 4P57B 3GMRA 5DJCA 3WLBA 3V8CA 2PYFB 3BPNC 2YBRA 5I1CL 1CGUA 2R1YA 5EZJA 1KPRB 4I3SH 4LEXH 3GB7A 1MI5D 1YDPA 5TE7L 4ZFFB 3O6MH 3LQAC 3MZTA 3SY0A 4JY5L 1TJGH 1HZHL 2GY7B 5CHNB 5D6DC 4R7NA 1T04A 5BQ7B 3VA6A 4TRPH 5B8CA 3I3EA 2YXFA 4JHWL 2AV1A 3T09A 1ZGLB 4ALAH 5GJSH 2QHLA 2DL2A 4G9DA 3BKJH 1I9JH 5J6GA 3K80A 4ERSH 3VXOB 5IV2B 4MB3A 2OTUA 3T0EA 1Y18A 5LKNA 1JZ3A 1KGCD 2YA0A 5CIPA 1S9WA 3GSRA 1CDYA 5JW3L 1KEGH 5EOTB 4UQ3B 1KTDB 1P4BH 5E2VH 2VNCA 3DHJA 1ZHBA 4PJXE 5ECJE 1T83C 3EOYG 4C54A 4C58B 5AYQA 4FP8L 1MFEH 4EN3B 1QEWB 1YEKL 3DYMA 2ED7A 4HUWB 1JK8B 1FZKA 5IFHL 2YK1H 5FKPB 5LWYH 3CC5A 3ZTNH 2OTWB 3P73A 3RAJH 3L95A 2PO6A 3MA7A 5D1ZA 1DQJB 3EBAA 1T6VN 5CJXC 2CIIA 3VCLB 3TFKC 3EDKA 3V4UL 1RIUL 1RUPH 3QUMH 1ZOXA 4NKOA 4ZPTB 2AK4A 3F6LA 2J4WH 2BCKA 3K1KC 4C56A 2CMRL 3S37L 4NIKB 4DK6A 3KJ6H 3CXHK 3VFNA 5JOPD 4KZDH 4K7FA 3QQ3A 3OSKA 1BEYL 1XCQA 1MVUA 1U8PB 3IJSA 1ZT1B 2CRZA 3MLTB 3O2WH 2CUHA 4XC1H 1IAIH 5MENB 4KMTH 4YK4B 1XT5A 1OGTA 4ZSOE 2R1WA 3VGEA 4EDWH 1QSED 3WLWC 3TN0D 1U3JA 4X7TB 4QCIA 5CBAB 5EO0B 1NGQL 3ZSTA 3NIFF 5C0AE 4M1DH 3V2AR 5C0RL 4V1DA 5E99L 4ENEC 4ZD3H 2AV7B 4MAYA 4RGMB 2MPAH 5LGKA 5EUKA 3LB6C 1NEZB 5I1GL 2N4IA 4KC3B 4KK9D 4Z7UB 3LY6A 1Z9SA 1QQDB 1KJ2A 4KV5F 3V6BR 1IAII 1XCTA 1P6FA 4ONHA 3VGHA 1FC2D 5IVXA 1YUHA 3LRHA 4I0PB 5DR5H 3AY4C 3QISA 4OTXH 2PR4L 4RRPA 2A2QT 5ITFA 4L4TB 2BNQD 3UTSA 2O5XH 4M1GH 2OI9B 2DQTH 2IMMA 5F1OB 5FYJU 5JIKA 3P77A 2J3SA 1TFHA 3Q3GB 1WBZA 4GG6B 4KK6C 4LRNL 1OAZH 4G8GE 4U7SA 2J8UB 1T1YB 1K3ZA