4JFEE

Preservation of peptide specificity during tcr-mhc contact dominated affinity enhancement of a melanoma-specific tcr
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
245
structure length
245
Chain Sequence
MSQTIHQWPATLVQPVGSPLSLECTVEGTSNPNLYWYRQAAGRGPQLLFYWGPFGQISSEVPQNLSASRPQDRQFILSSKKLLLSDSGFYLCAWSETGLGMGGWQFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title T-cell receptor specificity maintained by altered thermodynamics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
total genus 49
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jfeE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jfeE01
3NAAH 1UVQB 4OLVL 3K0WA 4UOW0 4OB5H 4BH8B 5HPOA 2VDLL 1VFUA 1A3LH 1PFCA 5IW1A 4KKLD 4NCC2 3PG2A 3DXAD 2EDFA 2NY3D 3OSKA 5JW5A 4DUVA 4UV7L 2IQAB 4QTIL 2H9GB 4X6FB 3GGWB 3PGDA 3T0EA 5A2JH 4R90L 2ZOLA 1AHWC 1IC7H 1QFUH 2F54B 3RTQD 2X40A 4DZBB 1TQBC 3DNKA 1CDYA 2X41A 5HYEA 4NWUL 4U6YB 2DD8L 5GGQH 4F15B 1CS6A 4QRUA 3VFNA 2DQJL 4KUZH 5CJBA 1SJEB 3F65A 2Q6WA 1QLEH 3B2VL 4NRYA 3QIWB 4JKWA 1F11B 4JFED 4JDZB 3VFVA 4NKDA 3U6RB 5D2NB 1WAAE 2KDGA 2W65A 3ARZA 3TT3H 5BZDB 1NAMH 4KQ3L 5A3ID 5D9SB 4AJ0A 1P53A 2AEIT 3LRHA 1Y0LB 4P5KA 3AC0A 4LIQL 3MUJA 1HHJB 5T33H 3ZKQD 2IALB 4LNVA 4PJAB 1ZKAA 3KLSA 1FGNH 1H3PH 1YEFL 4FQIL 1C16A 4CGTA 2VLLA 2J8OA 1FLRL 3BQUA 5FM8A 4YHYB 2XTJD 4G8EB 3WV0A 4YDIL 4DKFH 3OTTA 3TIEA 3GJEA 1FNGA 3U7YH 1YN6A 2YRZA 2OQJA 1MCWW 5E8DL 1EFXB 4JE4B 2FL5A 5B22A 4RGMB 5M94B 3BP6B 4LRIA 3QQ3A 5D1QB 3NZ8B 4NNYB 5MEPA 3TO2A 5A2IH 1U2HA 4KI5F 5C0CE 2A6IA 3RUGE 3RVUC 2ZUQB 5L7XH 3HI5L 5DQJA 1J8HA 3D69A 4Y7MA 3GJFA 4HZLB 3QCUH 5E9DB 4MXQD 1K5NB 1I7UB 2W0PA 3VI4F 1DBJH 1J88A 4Q2ZA 2ZUYA 2MCG1 1QYGL 4OM0L 3GMPB 1JFQL 1I9RH 4RX4D 4FQQB 4H0GA 5T5FH 5IG7A 3TA3C 1Q8MA 5F1IA 5I18H 3ZE1E 2G60L 1NLBH 2FBJH 2A73B 5DRWA 1QLFA 3N9GH 5D5MB 2EKSB 1EH9A 5IROC 4JZNA 5DJDA 4MXWH 4LAJH 3ARUA 1Q0XL 2UUDK 3DMMC 4PJ9A 2I9TB 4NZJA 2WQRA 2ORBL 5LCVL 2ZOLB 1QLRA 1OD7A 2YPVH 5KVFH 1AQDA 3CH8A 4U6VL 5DVNA 4NSKB 1RUKL 2RCSH 4HLZH 3VI3F 3TZVA 1FJ1A 2DBJA 2PNDA 4H5SB 1BD2B 2P48B 2DM2A 5GRUH 5DHVA 3WHXB 3DV4B 1MVFA 1QD0A 3LQAH 3I2CL 3UMTA 1TNMA 2NY5C 3HI1A 4FFYH 2H26B 3PHQB 4MJ2A 4S2SB 1JP5A 3AAZA 2CUMA 4JFEA 4RMQA 1FE8H 4NZRH 4CADB 3WHE1 5DDHB 4KDWA 3ZO0A 1D6EA 3LKOB 1FFRA 5K93A 3UXFA 2YZ1A 3KWWB 3QI9B 3E3QC 4LAQL 2AEQH 2YD4A 3FT3A 3K4AA 1RZIA 5F8RC 5LQBL 4GRMA 2F58H 5HYIA 1RJZA 1KCSH 4JFDA 2QQKL 1I3UA 3TNNA 3EDFA 3EYQC 4WU7A 3R06A 2B2XH 1QLRB 2VDLH 2ZCHL 3F58L 2YXMA 4G6KH 1T1YB 5C0RL 5DMKA 3ZDXE 3ZMRA 2A1WL 3P4NA 5GRYA 3JWDH 5ANME 4P46D 3QDMD 5I8EA 4QOKD 5IJKC 3KPNB 3JTTB 4P57B 1CIDA 1CD8A 3I6GB 4BFEA 2NLJB 3DYOA 1KBGL 3B3IB 4KKAC 1FSKB 4BSWB 3DSNA 3CDGA 4QY8A 3JWOC 5BOPA 4GG8B 1S8DA 1MCPL 5T1KB 2BDNH 2DOCA 2ATPB 2BRQA 1WCBB 5LAXB 5HYJE 3MRJA 4V2CB 1O7VA 3LPGA 1XR8B 3NABL 4WEBL 1FLTX 4QXTA 4X6EA 2QSVA 3LPWA 5FOBA 4QRQA 5EU7E 3QDJD 4PJ5A 5CEXA 5CIPH 3ARVA 5EOQL 1G7HB 2KBGA 2CKBL 4OZHF 4PB0H 1S7RB 3VWJD 5JNYB 5A3IC 1T89C 4I3RH 4M1CD 1VHPA 2VOTA 1KLUB 1A14H 4DVRH 2FATH 3SGEI 1ACYH 3LOWA 1GZPA 3LHPL 1RUKH 1NGWB 3WNKA 1WFOA 4WIQA 4S1SL 4UTBL 2BSSB 2NXYB 2BCKA 2AABL 2FDBP 5HJ3B 2DS4A 1BJ8A 3K3QA 3PWJB 5JW5B 3LN9A 4OLUL 3KYAA 5EO0B 2A38A 3OAUH 2YPKA 4URTB 5I1LB 3E2HB 2R2HA 2DI7A 1XGTB 1MI5A 3FT2A 4KK6C 2JCCA 4FQXC 2CDEA 2WZPD 4ODVL 4PRDB 4PTTB 4OI7A 3BP5B 4XPBL 5D7IB 3U48A 3UJTL 4LCYB 4O51B 5HHOD 4IOSD 1NEZA 1YPZA 4DGYH 4DTGH 4DVBB 2A0LC 3HR5B 4NO2A 5I1DA 4OGAD 1IAII 1KTDB 1JF1A 2CGRL 3WD5L 4Z7WB 1S7XA 1SM3H 5E6IC 2IPUG 4LPWA 2VO5A 4HIEA 2GT9B 5D71L 4WW1A 4WNQB 2FWOA 4R3SB 2MQCA 1J1PH 3QIBA 4OLEA 1H3GA 4O58H 4XPAL 1QHPA 3FOMB 4MDJB 3PL6C 3QA3A 5JPMA 2LTQC 5DJ8A 4N8VA 1P2CA 4NC1C 1OTTC 3NFPA 2VDPH 4GW4A 1AGDA 3BKML 4PJIE 3OX8B 4N68A 4UDTB 5IB3B 3IDXL 3FMGH 4GMTL 1GZQA 4MWFB 4H0IA 5F7FA 4YXLH 2X4NB 4KKCD 4PV8B 1BHGA 3S37X 3K46A 3MA7A 1G7PB 2P5WE 2Q76B 5CJ8A 4JKKA 3GMLA 5T33L 1I3RB 5GSVA 3MRBA 5FKPA 5EIIA 1P1ZA 5D96C 2ADGB 4F8QA 4FFZH 3G5XB 3DIFA 5T1KD 5FO8B 2JCCF 1G9MH 4JZOB 3QG6A 4KTDL 5HYSA 4UINH 5GS3A 4NN6C 4XCNA 5D7JD 4OKVB 1MCOL 2NX5E 5MHSE 4XNUH 2NY3B 1D9KC 4HC1A 2QJDA 3UTTB 1XF4A 3QDJB 4NUJA 4FS0A 2EXWC 2X4UA 4WFFE 3PE9A 5DUMH 5DJ0B 3CSYB 3OZ9H 4HXAH 5IB2A 3HNSH 1WWCA 1UC6A 2R0LL 3OGOE 3FB7A 4HZAA 4WTWA 5GQBA 1TTGA 5HJ3A 3B9KA 2ZPKH 1S7TB 1IEHA 5ITFA 4HUVA 5FA3A 5DR5H 1YMMB 1MFCH 1BZ7B 4H1LB 3QPXH 3QRFM 4QCIB 3HLAA 4A6YB 4UIMA 1ZHNA 4JFZH 3OJVC 2ZCKL 3KVQA 3O3DA 5CIPA 5IWLA 1PLGL 6FABH 5CKAA 3PV6B 2I9LB 5KVMC 4GKNA 5LWYL 1XR9B 4H1LH 3QFDA 2ARJQ 3W5MA 25C8H 1Q9WA 2NY5L 2LQRA 1FL5A 1PGRB 3G6DH 5K59F 3ZYIA 1RZKL 1FNAA 3LH2L 4PV9B 5F89A 2LVEA 1W0VA 4FXLA 5I1LA 3DX8B 2YN5A 4LHUD 1HK6A 3TNMB 5F7LB 3QULA 4P0DA 1MQKL 3T0XA 2DM3A 4O02L 2J6EA 1KJ2L 5AZ2H 4NKQB 4HC1H 4U1SB 4BZYA 1S7VB 1P6FA 1FVCA 2G5BB 4LGSB 2F58L 3V5KB 1PX3A 2DMCA 3MRIB 4MZ3A 3MV8D 5CJOL 1A7QH 2HFTA 2VXVL 5KANG 4V1DE 3T09A 2HLFC 1J1XL 1KCRH 4YXKL 3Q1SL 1XF5B 1ULVA 2BVTA 1WZKA 2E6PA 2GJJA 1NGZB 1BM3H 4PP2A 5CJXA 4O2FA 1AJ7H 4S1QL 1K3IA 2IFGA 4C56E 1KOAA 3MV9E 3FO0H 2H6PB 4NQVA 4NUGH 1N2RA 2J12B 4OLYL 1RULH 3NMEA 3PP4L 2PYFA 1HINH 5JO5A 5TJWK 1ZMYA 5IGXH 1N59B 3PWLA 4JEGB 4PGCB 1OAXH 1JGUH 1RZIB 3ESUF 4M03A 3UYRL 5EC1B 3HZVB 4JRXE 5DFWH 3OXSB 4YHML 1T3FB 2EH8L 3C6LA 5DJ0A 1JZ7A 4ZTPL 1U91B 3TV3H 1RURH 2J6EH 1CU4H 1T1XA 5EU5A 1OB1B 5EC2B 1QSED 1DUZB 3G5YB 5JHDE 3GSUB 4M1GL 3FB5A 1T1YA 2GTZA 4Y4HC 2PO6B 3U46A 2VZVA 4OFDA 3DGGB 1NGWA 5BS0D 4H5SA 1J0KA 2BNUB 4HKBA 1KEMH 3ARTA 1I3RA 2HTKC 2X4TA 1AE6L 2JJSA 4MA1B 1PEWA 4XPFH 4LRIC 2DQIH 1JWSB 4XP1L 5SWSB 5DD0H 4KHXH 2MOVA 5CZXD 4C58B 4RWYH 1ZV5A 5FF6B 2ARWA 2ED7A 3GRWL 4DOHE 2AJUL 4KJQD 3N1QC 3GJFK 5JW3H 4YDLB 1F3JA 4HUWA 4MQXD 4M62H 3P4OA 4PIRF 4NJAL 3RVVC 4DQOH 2NY7L 3GBLA 2V7HA 2J1KA 1AY1H 2OMNA 3TESA 3VD4A 1CL7H 4ZSOE 2FX9H 5FYKD 1C5CL 3THMH 1K4DA 4PGBB 1XH3B 5D1XB 5T5FL 5KS9E 4DKDC 4F9LA 4MNQE 3MRCB 4P4KC 4YFEA 2XWBB 4X4XB 43CAB 2V2WB 3OR7A 1NEZG 1U3ZA 2ARJB 3GSXA 4FOMA 4XZUA 1I8MB 5DD6B 4OIIH 2HKFH 1NANI 1GGBL 4M93B 1AE6H 1AP2B 1N64H 5DT1H 4ELME 3PWPA 4NO5A 4U2YA 3P30H 3DVNB 3TZVD 5L2KB 5AWNH 3F7RA 4Y16C 4JRYB 2YHGA 5LVEA 1T5XB 3QFJE 5D93C 1R0AL 2WUBH 1RU9H 2R1XA 5L8LB 1OAZL 1A4KB 1R3LA 4NSKA 2BHUA 3HUJA 3RIFK 1DANU 4ZUSB 3ULVD 1X5JA 2HH0L 3O2VH 1IFHL 2F8OA 4I2XB 1ZOXA 5FYJH 3TO4A 2P5ED 4H88H 4LPYA 5I71B 2Z92A 3IFOA 4PJ8B 1CE6B 1TJGL 1T7WA 4HX1A 2JB5H 1LDPH 2XFXA 4XNYL 4M6NL 5C0FB 1ORSB 2VIRB 3EYVB 3O2VL 3U7WL 4A2LA 4KWUA 1BFOB 2VZOA 4U1KB 1CLCA 5GZOD 4PGEB 4P5MA 1ETZA 2CKBH 4PB0L 2PCPA 4HIHA 5DJCB 4YBQC 3RWCB 5ISZD 3UTSA 3JV6A 4EOWL 4S1DC 1CK0L 2G9HB 1MVUA 5EU6A 4M7LL 4OF0A 4HF5L 3MRFB 1UA6H 4GLRI 3V7AG 2DQTL 4L8SC 2ZZUT 1NGQH 3VRIA 1I1AB 1LMKA 3EJJX 3QUMB 3KJ4C 3MYJB 5F93C 1JI1A 4X6DF 5EZLA 2VDOH 2W0KA 5FYLL 3T65A 5C0AB 3FZUD 1MCDA 2F9BT 2Y1VA 4RGNC 2QQLH 2LU3A 1IQWL 3QH3B 3PV7A 4X5WB 3GMQA 3CSBA 5KSAA 2XPGB 1MCJA 3STLB 1SYVA 5E2UL 2VDKL 3QZWB 2ICWI 3HPJA 1LO5A 2APTA 3T4YA 3WFCH 2ICES 5IBTH 2NY1D 3OJDA 3GJFH 3PXHA 1UFUA 1XGRA 3HKFA 3ARDA 3O6MH 2V17H 1H15B 4KJPC 3ZKSD 3FOLB 1FO0L 1ZAGA 3EO0B 4K23H 4LVOC 2DJUA 2GCYB 5J0BA 2P42B 2AJUH 1MH5A 4WWKA 4WY7L 3MRDA 3IJSB 1I8KA 3L3HA 3QEUB 1OM3L 5ID1A 4MMZC 2EXWD 4JO1H 1G7QA 2BSRA 3B43A 4MNHA 5D70L 1AKJD 1OD9A 4TPRH 4PJXA 1MCFA 3NTCL 5EORH 3V6ZA 5T1LB 1HHIB 1WC7A 1JZ6A 3TZVB 5I8KH 5L2KD 5T3ZD 1Y0LA 4RWHA 1T21B 1A21A 4F3FB 3STZB 1EVTC 2WP3T 1PZUB 1U8QA 5E2JA 2APWA 5GJSL 1XH3A 4N90D 4OGYH 4KKLC 3QCVL 1R24A 2BVQA 5HPMB 1QSEE 1T2XA 5I1IL 2Q86B 4MGXA 1ROWA 1H3UA 5ACMA 3CFIC 3MO1B 3G04A 5E7FA 3O9WD 2YKLH 4OZGA 1X5YA 3QDGD 4YNYA 1OP9A 4BQ9A 4PJ8D 1JK8B 4JY4A 5DO2D 3BJLA 2WSKA 3DRTB 3PV6A 3UBXB 3VRLE 1OQXA 4EI5A 4YUEH 2OL3A 5M95B 5CGYC 5FFLA 5DTFB 2EE6A 4JKPH 4DTGL 4A6YA 1AJ7L 5FYKL 4N0CC 5B38G 3JXAA 4FQ2L 3KJ6H 4P2OC 4R2GD 4P2RA 5DI8A 2VDNL 3PWVA 3VGAB 1NGYA 3CXHJ 5FYLH 5FHAH 4X9GA 5C6WH 2CKBB 2X4QB 1A0QL 1UH3A 2OTUA 2NYYD 3MCG1 4NNXB 4X7SL 4C55A 5D7LB 3QUXA 3O45A 4XPAH 1CE6A 3OKNA 1KIQB 2XTJC 5BCAA 2NY4C 4GRLC 3BE1H 1AIFB 1QLFB 2EDRA 1TVBA 5DVKA 5J6HA 4WO4B 4P2YA 3QUMH 1TETH 4GSDL 5DYOA 4IIQC 5GGVY 1ZA6B 2R2BA 3U9UA 3WE6A 1IE5A 2HT4D 3ULSB 1FO0A 2NXZD 2XN9E 4YIQA 3O9WC 2B5IB 3SE8H 4PJ8C 1Q72L 1KJ3H 1IAMA 1OAUH 1MRFL 1Y6KR 3OMZA 4U1MA 1I7RB 4PJ5E 1K8IB 4JO3L 2BHYA 4N0YH 1BVLB 3CFDA 4DWHA 1LO4L 4R4FL 4FTVA 4ODWB 2WWKO 1DQLL 4LLWB 2CXKA 4XCEB 35C8H 1RK0B 1E4WH 1UH4A 4CVZB 5TF1H 3MGAA 1CU4L 4Q6YA 1JPSL 2CRMA 3ARGD 3LV3A 4JM2C 2CUIA 2OP4L 2WV3A 5IWLC 1F97A 3OAYH 2V5YA 3G6JE 1JNNH 3LEXB 1X5AA 5IMOB 3GMMA 3PL6A 5CZVH 5EUKA 3IJSA 3SOBL 4HK3N 1NMAL 1I3GH 4GXUN 2GY7B 3QT2A 4HKJB 1I9IL 2DQCH 12E8L 3NCJL 5J13C 1WCQA 2IALA 3MROB 1OAZH 2ILLA 4JFXA 1KPVA 5F9OH 4FQXD 4KFZC 2DJ4A 4MA7L 5BS0B 2Z4QA 3HR6A 3RP1A 5GZNC 5FK9A 3JV4B 3AY4A 1R3JA 4PRDA 4WW1B 4ZUUA 1CGSL 1YNKH 1BQSA 3RFZC 3HE7B 2EDQA 1NKOA 1JRHH 2NW2A 1ZLSH 3WN5A 4WHTA 3KPRE 5FHAL 1UENA 4F7PA 1DQMH 3NCYS 5IBUG 1WWBX 3GO1H 3RA7H 3RZCB 5CFHA 5LXGH 3QXAA 4PJXF 4YBHA 4H8WL 3TO4D 2DICA 2E7BA 1RK1A 4M61A 1NDMA 3CNKA 5D2LF 3FFCA 2XZZA 3ARFB 1DCLA 1NC4D 1I3VA 4X5XA 4ZUTB 4K3HA 4K8RL 3NIFE 4NC1E 4HGWA 3FRUA 5ICYA 4ZFFB 1BQHB 4LAQH 4L4TB 4WWID 4DKEL 3BZEA 1MIMH 2DQGL 2CUHA 4OV5A 5I17A 1SMAA 2X4NA 4QNPF 1R3JB 3V0VB 3WN5C 3GSQB 1HH9B 3C08H 4PV8A 3MV01 4I0KA 2FH6A 1ZTXL 5C0JA 3FT4A 1J0JA 1EO8L 4RNRA 1E6OH 3F7VA 4Z7WE 5HI3C 3MCKA 4JRYD 1OY3B 2O5XL 3GDBA 1QRNE 3SKUD 3DV6B 4PJEE 3HPLB 2UY7A 4WJ5B 3ILQC 4MD0A 1R3IH 4X6DA 4O2CB 4EJ1C 4Z7OF 5T3ZL 4H26B 3DHMA 4QF1B 4K3EH 3C2AL 4LARL 3J7HA 3U4AA 4BKLB 4DUWA 2R23B 1UACL 2EIZA 3RZWA 5D1ZD 4B7IA 4F33A 4ZQKA 3WSQH 1Q0YL 4X8JA 3DX7B 3RGVC 5SWZD 3V6OA 5KW9H 2GT9A 3BKMH 2H8PA 3V0AC 1QFWH 2FWOB 2FX9L 3H9SA 3K4DA 1HI6B 1IGMH 4X4MA 4JR9H 1R3KA 5ENWB 1DBAH 1MLBB 3KPRA 3EUUA 4U1LA 2CRYA 4EDXA 1KIPA 1BVLA 3RWHB 1A7PL 3RVVD 3TCLB 3HUJE 1P7QA 3IXTA 3UO1L 1WBYA 3EGSB 1Q9OB 1C5DA 2PW2A 4KDVA 1MH5B 2HVKB 3MLWL 2WBJC 1J05A 2VDPL 2Y7QA 3EHBD 4WFHD 5HDOA 4E0RA 4P23B 1KTRL 3EOTL 2NXZC 4M6OL 3RWEA 3MCLL 1IGCH 5C0AD 4UMGA 4M7LH 3MRHB 1QRNA 4TTDC 2CLVA 4WV1B 4NCDA 2VIRA 3BRDA 5HHNA 3V7MA 3CZJA 5C0AA 1DZBA 1NCBL 1NAMB 1WT5A 2GAZB 2X70A 3MPCA 2BVPA 4DFIA 1N3NA 1YECL 5DHVB 3HE7A 4R7NA 2Z4QB 2A74A 1VFOA 1AXSA 4HK0A 3KYNB 3LS5L 1JNNL 4P2QB 4GFTB 3S34L 3A6BL 1PSKH 1P7KB 4NM4H 4EZMA 3SQOL 2O93L 2CDEB 5HYSG 2ZP0T 1S7UA 4X7TB 4R97B 4X7EC 5I9QC 3S36H 4J3UA 2IH3B 5DRZA 2OXHA 5DS8A 1MHEB 1T1ZA 2QSQA 4P2RD 3B9AA 1BOYA 3PQYE 1DBKH 5DUBB 5E8EA 5ELIA 4YJZL 1RU9L 4EI6B 3MRMB 4HK3J 4F3FA 1MFCL 4HIEB 1YJDC 5BO1H 3MCLH 1QFUL 5DMGC 1MLCB 4KZDL 1HHIA 5JDJA 5HYQA 5HPMA 2AJYH 2IBZY 3O3EB 4A6YL 2OTUB 1F2QA 5FYJU 5DC0A 3WUWG 4X80H 4OCYL 4AENA 5MI0C 2GQHA 4LDLB 2AEPH 3QUML 5E56A 3T4AA 1U9KA 3P9MB 2SEBB 4YHNA 2V5TA 3O9WB 1OGAB 2X4PB 4OD2B 5M7QA 4RGNE 4Z7WA 2X2YA 4NC0B 15C8L 1ED3B 3VMPA 3CSPA 3QEQA 1CGVA 1IAKA 5FHBH 1WCBA 5FYJD 2EIEA 4L3EB 5J8OA 2HRPL 3E6FB 2VDNH 1QACA 1WVZA 4RGND 5DS8B 5DRZB 4GJTB 1EHLH 4PJHA 5JPNB 4K3GA 2X1WL 5C2UB 4JHWH 2FGWH 1J1PL 5E8EB 5BQ7B 3ROOA 4W6WB 5HHPA 4KHXL 2GK2A 2NQCA 3FTGA 3ZE2E 1A6WL 3QNZB 1D5MA 2VLJE 3HPJB 2O5XH 3V8CA 5DWUL 1AGFA 2NZ9D 4K9EL 4JZNB 3VXMB 5HI3D 4P4KD 1XF1A 1NCDL 2XKNB 3S4SG 3I84A 1FYTE 4R7NB 4I48B 2VKXA 5DMJB 2MWCA 4Z0XA 4HFWB 2BVOB 2OL3B 3UTOA 5EOTB 1EBPA 3BO8B 3DVGB 3KPSA 1HHKB 3GHEL 3HTLX 1MJJA 4JG0L 1A7OL 1B0RA 2HKHL 4U6HA 3E6FA 1V7ML 1PZ5A 3FHAA 5K9JL 4F80A 1AGBA 1AP2A 4E0RB 1NLDL 4RCAA 5BRZA 2DLIA 5C7XL 5D1QA 1T21A 3TH4T 5E5RB 3AMKA 2HRLA 4ACPA 2XKUA 1QR4A 2VR4A 3RDTC 1QUNA 3OG4B 4CU8A 3ARBC 1MCSA 2AW2A 2YPLB 3GZKA 5D6CB 5A2FA 3X3FL 1ITCA 3JWOH 3A6OA 1ZLWK 4Y19D 1HHGB 3RRQA 3MRPB 4NQXB 4LLDA 4TQEH 5JHDA 5J3HD 3RNQA 5DQDH 5AZEL 1CFSB 2FATL 1M7XA 3QQNA 4WUKL 5EO1B 1SVZA 2EDXA 4RGMC 5DHYB 3RHWK 3JTSB 1YJDH 3Q6GH 1MVUB 4G5ZH 5DVOA 4FNLH 4DFHA 2Z31A 1B0RB 2WIMA 4U6HB 3DWTA 4YZFF 4FQLL 2I5YH 4DGVL 4TSAH 4U1HA 1TENA 1IKFL 3JWDL 3RVTC 3HRPA 4KI5C 4OQTA 4XX1G 1F4WH 1YMHA 4LL9A 3GSWA 1CTOA 3GIVA 3M1BB 2BDNL 4HS6B 1NL0L 2UZXB 4WUUE 1DN0B 2APFA 4C56D 2AERT 3PIQA 4OCXH 2YPLA 4OCMC 5ECJE 1MNUL 3VFUB 1EHAA 1EJ6A 4ODSL 5ESVB 4UT7L 2R29L 1NBVH 1EHNA 4I0PC 4DW2H 3IVKB 3LEVH 4MXVF 4P23A 3ORJA 4GAJH 3DETD 3BPLB 3KPMB 4PLKC 1SBSH 4R96A 4XPTH 3UPAA 3NGBB 3GBML 1A9EA 5ID0B 1G7LB 3S36X 1LE5B 4UT9H 3Q6GL 5TH2B 1XAUA 1ZT7A 1CD1A 1YYLL 3FCTA 3BZFA 3MLYH 2ZNWA 4EI5D 3MLTB 1P4BH 1P4IL 3MLUH 4JPKL 5C0CA 4QRPD 5FKAB 3SDAA 3MJ9H 4XPTL 3PWPE 2UZIH 3UP1A 1PQZB 1ORSA 5MI0B 3WDHA 3GKWH 1JHTB 3D25A 3LAFA 5HHXH 2R0ZH 4FQHB 5I1AB 2VN4A 4G7VH 5CD3B 4LASH 3T3PF 4GO6B 4HWBA 1W2KT 4NZDA 5TE7H 1V05A 5ABDE 1OB1A 5EOCH 5HD8D 3T0BA 4MD0B 5GZND 5EWIL 3RNKB 1NQBA 3EOAA 2H8PB 1T1WA 1NJ9B 2AXFB 4B7LA 3NN8A 1D5BA 2Z8RA 1JN6B 1JWSA 2AAVA 3GMOA 2W9DH 3RU8H 3WO4C 3MV7D 3IFLL 3GI9L 3DROA 3I6KB 5C0IB 5F7KC 1I8MA 2NW2B 1IT9H 1LD9A 2OSLB 4E41B 1PYWB 5EUOE 5T5NF 1CG9A 5E2TH 1ZEAL 3QFJD 3KXFA 2P49B 3IDMA 1A7BA 3VRJB 1DEEB 3VXSE 4XP1H 2CDGB 3KLAA 4NO0D 1N7ML 4OZIB 4I77H 3P4OB 5CSGA 1MCRA 1RV6X 2EYRA 1JBJA 2NX5D 1NFDF 4OAWA 2A83A 4CU7A 2VLRE 3MNVB 4NNPL 4WV1A 3FFCB 2Y5TB 3HFML 2R0WH 3QQ9D 5IQ7H 3IDJA 3WLBB 2WINA 3WYRA 5IR1A 1FIGH 3MTRA 1Z9SA 5HDBF 1XGYL 3QXVA 5SWZA 3TIDA 4YHYC 1JF1B 3ZT5A 4WO4A 3VA6A 3DTXA 3DGGA 5E8PB 2OBGA 4OCRL 1OWWA 1BIHA 1TNNA 3MRRB 3AM8A 5IEHB 3CFEA 5H35B 4ZFOB 4MXWL 4TSBH 2DKSA 4LHUA 5J57B 1AC0A 3FCTB 4GXUM 5DUPH 1AC6A 2VXTH 5C07A 3PWNB 3GSNL 5KSBF 4PRAA 1UADC 2AXGA 3RAJL 4FQJH 2HJKB 3NACH 1HNGA 3T1WA 4JANA 3G6JF 1SEQL 5D1ZC 3MJ8A 4OJFL 3GFUA 4M9PA 5EG6C 4U0RB 4KZDH 4YDLC 1DBJL 2MMXA 4RRPG 4OFVA 3V5DB 2ATKA 4LPTA 3AREC 2WMPA 1OLLA 1MFBH 5E2VL 2ERJC 1TPXC 2IAMC 2HLAB 3NIGE 4NWUH 5L6YL 2KQNA 4R96B 1TVDA 4QO1A 2EEDA 3BPCB 4Q2ZB 3NCFB 3TBYB 5BV7B 3O3AA 4ONOA 3HNTL 1YY8A 3LS4L 3PABB 1RIUH 2XN9A 1LEGA 5DK3A 3V8OA 1EZVX 1RUAL 4JREB 2I26N 1TZGH 3CVHA 1NCCH 4RMVA 4P2OB 3KLDA 5B38A 4WFGE 4IS6B 4JHZA 5E5MA 1AO7B 4PJ5B 5CEXB 4I9WE 4IRZL 1CG9B 3G5XA 4GW5A 4XNMB 4NWTL 4J3SA 5H2BB 4G8GA 1RIUL 3AREB 5E24E 2APBA 3U0WH 1I8KB 4WFGD 4HPOH 1KJMA 3DPBA 1NFKA 3TYFB 3U9UB 4X6CB 1CD9B 1IC5H 5EN2A 3W81A 2Q7YB 4MX7A 5EFIA 4OCYH 2BSRB 4XPHH 1NJ9A 1KXVC 4K3JH 2PYEA 2CDFB 2MHAB 4JLRB 4G9DA 4DAGL 1LP9F 5GRVL 3WLWD 5JIIA 1DUYB 1P5VA 2R1YB 4KQ3H 1ZT4B 1CL7I 2Z8WC 3S97C 3KLHC 2MQ0A 3EFDL 3QHFL 1JIBA 1JVKA 2EDDA 1LQSR 1BF8A 2NX5B 5K9KA 2I9LA 3QJFB 3T8XA 3TJEL 2F54E 3SCMD 1Q0YH 4Q9BA 5EU6D 1FZMA 1I85C 3QFDB 5K33A 5ADOH 1I3GL 4HXBL 4YGVB 2DQFA 5HVHB 3C2AH 4LARH 4LLDB 3ABZA 5J9PA 1ZLUH 4CL7A 1F6AB 1K85A 1DLHA 3E1F1 4JR9L 3HC0A 3S37H 3I85A 4IMLB 5EU3A 2K3TA 3AMLA 5CGMA 1PZ5B 4HW6A 5C7XH 1W0YT 3JWNC 1QFPA 1UM5H 3QDME 3DRTA 4QRRA 4JM2F 4U1HB 3EO9L 2X09A 3RL1B 2HT2D 4ENEC 3MOQA 4I18A 2WANA 3AS1A 2DDQL 3QCVH 5DHVH 4QRTB 1R5VA 1J5OH 2YUXA 3SDXA 3VFOB 4MB4A 5HI4C 1VFAB 4YNYB 5T1DH 1MI5D 4OM0H 1MOEA 1RJLA 3STLA 1FH5H 3RGVD 3I50L 4Z7VE 2W0LA 4N8CL 5D8JL 5C0BE 2GJZA 4GLRH 1UGNA 4ZTOH 5HBBA 2VDRL 3MXWH 2QSCH 4S1RH 5LBSL 3TCXA 1N0XH 3IB4A 1MJ8L 1FNEA 1U8PA 3V5HA 4QGYA 2AP2A 5INDA 1JK8A 4JQVA 2ZJSH 4K7PL 2C9AA 3HN3A 3LEYL 2GIYA 2HP4A 3K8MA 1S7WA 4U1IB 1M71B 1T4KA 3OB0K 1I1YA 1M7IA 3PJSB 1YPZE 4KVCH 3SGDI 1WIPA 3ULVL 5BV7H 1J10A 2VMFA 4RISL 2VLKD 2V7NB 4JGJA 4EKXA 5F7DB 3D3VB 4NT6B 3OKEB 3OHXB 5IFAL 4YDIH 5KSVA 3QZWA 2NTFB 3TV3L 1VGEH 4ZAKB 3T4YB 2BX5A 2MJWA 4TSCL 3QNYA 1IC4H 4WU5A 1QP1A 5F3HB 4ZFGH 4C56B 3MV9B 2XG5A 4NO5B 3D1MC 5DYOB 5FIEA 5KN5A 4JFOA 4OT1H 2Z8SA 3PP4H 4YHPB 3TIEB 1NCNA 4CN6A 4F7MB 4LSRH 2C1OB 2Q20A 4JHAH 5KSUA 3U79A 3V6OE 5BMFL 2J5LB 1KB5A 1F4YH 1YEEH 3L3HB 3QEUA 5HGDB 3GK8H 4PTTA 5IVXB 1FRGH 2N56A 3W11D 1K8IA 5JTWA 4LRNL 2PTUA 1X5ZA 2JK5A 1OHQA 4UUJA 1U8NB 3TLRA 4IRSA 4YAQA 3JSSA 1JMZA 1EGJL 4FTVE 4LF3B 4NJ9L 4PR5B 12E8H 3NCJH 3VFSA 4HWUA 1UKQA 2W9LA 3N06B 4XPHL 1CVRA 4PJ7B 5SWSA 1OCWH 2B1AH 1BFOA 1A6ZA 1PX4A 2X42A 4LQ1A 3T2PA 3B3IA 1SMOA 4ZYKA 1UWEH 1JGLL 5DA0B 4HT1L 4IRZH 1P84K 2DI9A 5IB5B 1VGEL 4LKXB 5MERA 3RWDA 1E6JL 3DGCR 3MNWB 2NY0C 5DSCB 2B4CL 3ZTJG 1U95A 3TVMB 2H2SD 4QRQB 4TTGA 3GJFB 4XMPH 3SGJA 2C3HA 4HBCH 5ANMA 4YO0B 5KBNC 3ZL4L 4XCCH 3HMXA 1NBZA 2PO6D 4FG6D 4DN3H 2VXUH 5EZIH 3EYSH 3GMPA 4BFIA 1MRDL 4JRYA 1JZ8A 3GK8L 2J8HA 3VFRB 4Q0XH 1GC1C 3BIBX 1N64L 4LVOB 4RIRB 1EXUA 3W11C 1UYWH 3QPXL 1QG3A 2YBRB 3MV7B 4E5XA 4JQXA 4F9PA 4G6AD 1FSKC 1H0DB 4V2BA 4JFEB 3RI5K 4XPGH 2AJVL 2E6QA 3QUZD 4P23C 2GJ6E 3DRQB 5C0CD 1EA9C 1V5JA 3MLSL 1SEQH 1D6VL 3OQ3B 4W70A 5LKNA 3ULVC 5HVGB 1U93A 5E8NB 2DLGA 2HH0H 1G7MA 3ZE1F 4ELMB 4NRXA 4BH7A 2GJ6D 4IS6A 2X4OB 1RMFL 1BD2A 4L9DA 4NKMA 5IM7A 5SX5K 1IJ9A 2VLKB 1F4XH 2FHBA 4G42B 1RI8A 2A77L 3QWQB 3FB5B 4X0KA 5C1MB 4JJHA 4Y5XB 3I2CH 5ESAB 1KF9B 2BRRH 2IFFH 3QIUC 4I8DA 5KSUB 1BQLL 1FG2B 2MHAA 1FZKA 4JLRA 3O4LE 2FYYA 4GG6E 1A22B 4EI6A 5L2JB 3CGTA 2HKFL 4R7DB 4S1DD 3UTSE 3NCYP 4HIJA 2PO6C 4FQQA 1HHHA 3VXTA 1TQBB 2W60A 1CF8L 4BSJA 4XXDA 4NOFA 3IYLW 1RZJC 3L3GB 4ZOEA 1NCWL 4I77L 5D4QA 4H20L 2UZIL 1A4JB 4LLVB 3LKNB 5HD8C 1X4ZA 4YDKL 2YUZA 4PJDB 2F5AL 2Y4SA 3NCEB 1JPFA 4FQCH 2BOBB 4KV5E 4DAGH 1NCWH 3O3BB 3ECBB 3BXNA 4YHPA 1CDHA 2XTJB 4M6AA 4PJBB 3C8HA 5CJ5A 3MLVL 1A6WH 4HQQL 4IRJA 3C9NA 4IMKA 2G75B 4F7TB 5L88L 3TIDB 3CUPA 1HOCB 3VXME 4JY6B 5GRVK 4ONFL 2PO6A 4NBYB 1NBVL 3HMXL 4ZAKC 1ZANH 5ADOL 2HJFA 4ZUTA 4NYLA 4PGDA 5IBUB 4PGCA 3BDYL 2NW3A 3T8XB 4FQPA 1MNUH 4Y5VB 1YEJL 1ONQB 1BBDH 5I76B 1MFDH 3F62A 4WTZA 2LTQB 2XWTB 2MKLC 4PBWD 5FGRA 3QUYB 2N7AA 5J6GA 3TCLA 3SCMC 4EDWH 3G5ZA 2XNAB 4JY5H 2DQTH 4XB8A 4OUOA 1NAKH 1X3DA 1IEAA 4APQB 4G43B 5IKCA 4X6CA 4NHCL 1GC1H 32C2A 4Y16B 4DGIH 5SV3A 2UYLA 4P3DA 4QRUB 5DF0A 3MLYL 3BH9A 3QIBD 5I73C 1OAQL 1VGKB 4I3RL 3BKJH 3OV6A 2ZSWA 1IMHC 2V7NA 5IMKB 5EFIB 4ESKA 1OSPH 4BKLA 4PGBA 3FO0L 3ZKMD 4Q0XL 3W82A 1YY8B 4EQ2A 5HYQB 3QUYC 3RGHA 1OAYH 1CXLA 1L9MA 3EFFB 3SCMB 3BRFA 5EBMA 1INEL 2OP4H 1ZWIA 2L7JA 4G8GE 5BW7A 3MJ9L 5SX4H 3OX8A 1X5FA 3ZE2F 1OWRM 1EZVY 2DIBA 4LU5H 1V8HA 3VGHA 4WY7H 2EC8A 1QEWB 2W9EL 3FQWA 2ZWLT 4QTIH 2J6EL 4UTAH 1FN4B 4PGJA 2AJXH 3D85D 4EDXB 1CFBA 3TYFA 4D3CH 1INEH 2LABA 3GBMH 2V9RA 4JDZA 3WHE0 1JE6A 1MQKH 1CGWA 4BM7A 2NY6B 1HQRA 4XVJL 5C08A 2JF1A 2A9NH 1JNHB 3OB0H 1UWXK 1QPPA 3RWEB 5F3BA 2Y25A 2CIKA 2NX5A 1WV7T 1N3NB 2QQLL 4FNLL 3C60B 1UZ6F 4WV1C 5HGHA 2YD5A 4OZHB 1FDLH 4P9HC 3REWA 5BW7C 3BEVA 1BFVH 2Q8BH 1MI5B 5K59E 1P7QB 3IXTB 3D0VA 3MOBH 2FO4A 1MCIA 4LQFH 1XGYH 3BP7A 1CTNA 4HMEA 2NY1C 1OSZA 1QFHA 2NXYD 3VFUA 4PY8I 4GKSA 4WO4C 4F7EB 5IQ7L 5IIEA 1LHZA 4ZXBC 2IQ9L 5I66A 1LK3L 1W72H 4WWKD 3R8BB 1LE9B 3DBXA 1YEIH 1XGQA 5E00B 3H9ZA 4WI8A 3OAYK 4M3KB 5I8CB 3U36A 3WS3A 1MPAH 4A2MA 1IGML 5IT2H 3U46B 1UWXH 1U3HC 4N0FA 4UOW1 3G6AA 4K2UH 1JPFB 5D5MF 3L5WA 2COQA 2X1XR 2YC1B 1B6UA 4PD4J 5KVEH 3P4MB 3LPFA 5DURD 4HIIA 1K6QH 3P0YH 3KPRD 4XI5C 5DJZB 3LEXA 3HE6C 4CJ1A 3T2QA 4YDKH 4PBXA 2CIIB 2JE8A 4KH2A 3TWCH 3HI6L 3BAEL 1QFWM 3REVB 1N6UA 2A6JA 2DQHH 4ZFZB 1DDHB 1NFIA 5GGSY 4Y8DC 5IHUL 4KROB 2UWEF 2R0WL 1INQA 5HHQB 3C2SA 1YY9C 2IADA 2EYTB 3DVFA 5CILL 5CP7B 2NTSP 4M5ZH 3G5ZB 3QNXB 3FMGL 4Y4HD 2OXGA 5DFVC 1H9VA 2AV1B 4M43H 3T08A 2Z31B 1FNHA 3RPIA 3MGOB 2FX7L 3VH8B 1WWAX 2BC4B 3OR6A 5FO9B 1P69B 5HHOB 1RUPL 5KSBB 3RKDC 2DMBA 1D6EB 3EFFA 5I74C 4WFHE 4MVBD 3P0GB 3GMNB 5D7IE 3KR3H 3IDNB 2OS7A 3F12A 4JQVC 3C5ZD 4LLYA 2VAJA 1BFSA 1JHLH 3AS0A 4HIIB 3FFCE 5D2NC 1VEMA 5TE6L 4FG6C 4MYWB 5ITFB 1DBBH 5IW6B 2CGRH 3WD5H 2BY1A 4LFHD 4PUBH 3RTQA 3BX7C 3BEVB 4OD3L 1EEYB 3QXDB 4D2NA 3BXNB 1KLGA 5DXWA 1CXHA 2C4FU 1JWMB 3E6HA 4Y5YA 4XPFL 3WS6C 3ZDZE 3DUHA 2OMBA 4XP5H 2HTLD 5I73B 4NM8L 5IOPA 3PWPD 3RWJB 5C6TH 2AEWA 1JZ3A 3IDGB 1HDMA 5EUOF 1GYAA 4F57H 1VENA 1TJHH 3P11H 3ALWA 3Q48A 4XVSH 2K1MA 5F72S 4OCNC 3ZT7A 3N85H 2DTSA 4U1GC 4NQCA 4XXDB 5BRZE 5EBLA 5C0CB 3WFEL 1FCGA 1O5DT 5LWYH 1P9MA 5D5MA 3KPNA 4NKIH 3D0LA 1UXWA 1YYLH 4FFWC 4YR6B 1XR8A 2X7LA 1W72B 1EIBA 1H15A 2UWEE 4KRNA 5DD5L 2CPCA 2QBWA 1CLOL 3SDDA 1U0QA 3P2TA 1A6TA 1YYML 4FQXA 3RWGB 2FSEB 4KK9D 3UTTD 1FFPA 3TO2B 5TE4L 3P73A 5MEQA 3WS6A 3ZKNC 4UUJB 1F5WA 2OR8A 5HHME 4MJ5B 3X12A 4NDMA 4RGOL 1IQDB 1U8IB 3HNSL 5T1MB 1U42A 1TLKA 1UH2A 3HR5A 4NO2B 1UB5A 4QHMA 3VGDA 1XIWB 3IDIA 4JRXA 4NO3A 2WUBL 3QWOA 5E0QA 3NPSC 1TZHB 5DDHA 1RAMA 4KROD 1P9MC 4JFYA 3HC3H 2NY4B 3LQMA 4GRLB 1A14L 4ELMA 5ALBL 3MA9L 2UV3A 1WT5C 1HEZA 3SDCC 5E7BA 1A6VL 1BQUA 4MXVE 4POZD 1X5IA 4KRPC 2FBOJ 4X98A 1IAIH 1TIUA 2XN9D 3WNMA 4FQHA 3JV5A 3MBED 5F88B 5I1AA 3LB6D 4FQ1H 3TNNB 5K9JH 5ANMB 4LVHC 5C0GA 2JB6B 4HCRA 3VH8G 3DMMD 5C9KA 1K2DB 4EDWL 1BOGA 2YD9A 4HEPG 3WHXA 2CJUL 2X70B 3ULVE 3RWFA 5T1LA 2AK1L 4C4KT 1EX0A 4W6YB 4NQCE 5JQ6H 4CNIA 4LSTH 1G7IA 4LLAA 1J8KA 3CH1A 5IG7B 3OKKB 3X3FH 3EKCA 2GJZB 5F9AC 5FKAA 3SDAB 1NGYB 2P44B 3TN0D 4OI9A 5CCKL 2D4FA 3REWB 1WTGT 1XMWA 3MBXH 3MRMA 1A1NB 3QUXD 4ORGA 2G9HA 2OYPA 5GS0D 2EC9U 4GKZB 4RA0C 1GOHA 5LAXA 3OKEA 3QUYD 2UWEA 1L7IH 3MC0A 2YZ8A 4JAMA 5AG9A 4CAGA 1N5AB 3PQYA 4JZJC 3QIUA 4UILL 2IAND 2DWEB 2HWZL 5DRWB 3UTPD 4LSUL 3PHSA 1E6OL 3CXDL 2OX5A 2P24B 2H3NA 4ZMAT 2ZPKL 4QRPA 1TCMA 5HI5D 1YDPB 4J23A 1IC1A 1ORQA 4HJ0C 1EDQA 2FX7H 1XF2A 4FHBD 2FCBA 4KPHL 1MHHB 5JDSB 3WXWH 1QZ1A 1VFBA 2E7LC 5CLTA 1IGYA 4ZO9A 3W9DB 4DCQA 5D7KD 5HVHC 2XA8L 1UCBL 5MEQB 1DE4A 1IGFH 2NPLX 3TZVC 4MHHG 3MSPA 1U92A 3S7GA 3G9AB 5MP6L 1JZ5A 2EIDA 1QSEB 2PR4H 1TITA 2QLVB 1OTTD 2AVGA 3DJ9A 4OF6A 5BQ7A 5CUSH 2DLFL 2BJML 4ALAH 3QRGL 1WBYB 3EGSA 4Q6IA 1SJHB 1TCRB 2E3VA 5JHDB 5H37G 3VXOB 4NKIL 4JQXC 3HS0A 4OLUH 5CINH 2R0ZL 3VFTB 4TULH 3IKCA 1BP3B 3L3OB 2OM5A 1YNLH 5EO1A 1TQCC 3DETC 1FVDA 3CX5K 3QHTC 4GW5B 4XNMA 1OLZA 3FN9A 5DZNA 1ADQH 3FO1B 4Q9CA 1QRND 2B4CC 1YYMH 4XVSL 2R9HD 2WBJB 3PHQA 4M6OH 2AQ1A 1M05B 5FUOL 4B0MM 1A7QL 4X6DE 1JFQH 1UB5B 4QHMB 5AYUL 5HI5C 5FO7B 1YEIL 1PJ9A 3MGTB 1DQML 4XP9L 4DOHB 3GB7B 3WFHB 3UO1H 4Y5VA 1U95B 1W0VB 3TVMA 1XCTB 5L9DL 2C4FT 5SWZE 1P7QD 4Z76A 5IVXE 3G6JA 5IW6A 1HEZB 5D1XD 1EAPA 3BO8A 4J4PC 3BMVA 1P7KA 3NZHH 3VFMA 2PXYA 3GBNH 3WFBH 3RVWD 3PGDB 5HDLA 1MRCL 5JO5B 4L8BA 4OCXL 4MNQB 1K4CA 4FQ2H 5ILTL 5F1SA 5IW1B 3FB8A 2P8PA 3CCHB 4YGAB 2Y7QB 4OFYA 5I74B 1BGXL 1Q1JH 1S9XB 1QA9B 4S11A 3MLWH 3S3SA 4LCCC 2F5BH 2JB6A 5IBLD 1FE8L 4N0FB 4NZRL 3CH1B 3H9HA 1JHLL 5MEOB 1KB5H 3RUGB 5E8PA 5GGTH 5CJQH 1I1FB 4XBPA 1XGPB 2VB5A 5ESQB 3WFDL 1KB9K 2FIRT 1VESA 3NAAL 1WZMA 5B8CC 3REVA 4B53A 1MHPL 1YC7A 2BVEA 2O5ZH 5FA3B 1IBGH 3P3YA 3OL2A 4WCYH 1ZK9A 1N59A 3FRPA 3PWLB 3WSQL 1DLHB 4N90E 3BW9A 3MV7E 2G2RB 2JJWA 4E9LA 5KVEL 3CXDH 1DP0A 4JFEE 2JJTC 3KLHD 3MGOA 1AO7A 2HVJB 1XR9A 3QNXA 2EDBA 4X8JB 2AV1A 2HAZA 3SKOB 5JDSA 1NMBH 1B9ZA 3P0YL 3H9SB 4YEFA 3BPCA 3NIDE 2ADIA 2ZG3A 1HI6A 1UCBH 1MLCA 3U7AA 4FP8L 3B2UC 4GAGL 3QA3B 4G8FB 3I75B 4N1CA 3TNMA 5SV4A 1AHWA 3F12B 4YHIB 5B21A 3O4LA 3MZGB 5K9OB 1A6TB 3IDYB 2OJEA 4J1UA 1MHCA 3GRWH 2X1QA 5E5UB 2H2SC 1IQWH 1DLFH 3HCVA 2OL3L 4ZOAA 4N1HB 4LNRB 2RFXA 3IFLH 5LGKA 2ID5A 3RL1A 1MIEL 4PYGA 3C5SB 1BIIB 4GXVH 5FO8A 5ALBH 3M45A 1FGNL 4G9FA 4QXUL 2Q8BL 1UEMA 2FIKA 4YHZH 3TN0A 3RWIA 4UNVA 4NQSA 2HMIC 4MNQD 4XP4H 4Z7UB 3BGMB 2VR9A 4IOIA 4LVHB 5IKCB 4V1DB 1KCUH 1QR1A 4MWFA 4LEXL 1NCTA 1R3HA 2P5WD 1FPTH 4M6ML 2CRIA 3FB7B 3BP5A 1T2JA 2PW2B 1F3DH 3KXFD 5F9OL 1X6LA 3ZSSA 3N9GL 1RK1B 4ZUVA 4HKXA 4B50A 1W0WA 4JFDD 1CT8A 1TXKA 4D3CL 1OSPL 2F53A 4OZIA 4JRXB 4NO3B 1AR1C 5D2NE 5GPRA 2RIKA 1X5LA 2R39A 4H25B 4ZUWB 3WFEH 2AGJH 4OV5B 1XZ0A 3Q6FA 1FN4A 1S9VA 5KSAC 3NZHL 5I30H 1J86A 1BEYL 1IGTA 5C0ND 3I3BA 3QULB 4JO4H 4XMKL 3RIAF 1UZ6E 3CFBB 4U4BA 5GGQL 3P11L 4OD1L 3D3VA 1QSFD 3BWAA 1M6OA 4NT6A 5F8QC 1GVIA 4R4ND 4TNWF 3ZHDA 2AGJL 1MFNA 2R23A 3H3PL 2EXYD 2VITB 3P40A 5TE4H 3VXSB 3UJIH 3P4NB 4XBGB 3WUWB 1PSKL 3U83A 4O2CA 4DKFL 1FZOA 3H9SD 4PJXE 5D1QC 2DYPB 3KYOA 3BPOC 2HG5A 3TH2T 4WVRA 5IK3B 3LH2H 1ADQL 2UYLB 2WBWB 4JANB 5D1ZA 2VXUL 2FYYB 3LN5A 4OF7A 4PRNA 3G5VB 5TF0A 3ULUF 3QDGE 4PJGF 1FYTA 2HN7A 4APQC 2ADJB 4G5ZL 3V6ZB 4NJ9H 3ZE0F 4YWGH 3T0AA 5LQBH 3G08A 2F74B 3QFJB 3EOTH 5DD3H 3QO0A 1TVHA 1WGOA 3WCYA 5E00A 1FZJB 3SN6N 2CO7B 3FKUS 5LGJA 5MP6H 1N5AA 2CMRL 5FM5O 1Q72H 3NBNA 3LKRB 3VRLF 3GNML 4MJ6A 3HMWH 3I02B 1CQKA 4XI5D 3WXVL 2BSSA 5TDNB 1I8LC 2EH7L 5EZOH 3RGVA 3V6OC 2VISB 1KENL 3ARGB 4ZPVB 4WENB 2EZ0D 2Y36H 4JRYE 4IRJB 2P5WB 4TSCH 4ZFGL 1MWAL 5DMKB 1I75A 3NIDF 2DLTA 1YUHA 1KC5H 4M5YL 2V5MA 2J8UA 3O8XB 1YY9D 1I1FA 4XBPB 1FL3B 2V2XB 4ZYKB 1Q9KA 2HWZH 2JKXA 3FTGB 3GHBH 2BVQB 4G6JL 4D8PA 1NC4B 3C87A 1C5BH 4PJEF 3MJGX 1DR9A 3MLTA 2HFGH 1OGAE 3RWCA 1HILB 1EVUA 1G9MC 5DD1L 3LMJL 4M9OA 5DVLA 1FAKT 2Z93B 4M5ZL 3DSFH 1YEKL 4L3EE 4XNXL 2CLZA 1T5WB 3LIZL 4JY4B 2AJVH 4NQDD 1N0XL 2GKIA 1EO8H 3ARGC 3GI8H 2YMXL 5F7YC 1J8HE 3L3OA 3QHFH 1TVBB 4JPVL 4NNYA 2BHZA 3V52H 1F4XL 5FB8A 3SDAC 2E7MA 3ULUL 1DJSA 1ZA3A 3OKLB 1QFWI 5J56B 2BNRA 2KPNA 4R7DA 4U31A 1AD9B 1MRDH 3HE7C 4J4PD 4Y5XA 3QQ9C 3MRCA 2YK1L 1EEZA 1YEDA 2WW8A 1RIVL 2ITDB 3GIVB 4F9LC 1MFAL 1KEGH 2B4CH 4LCWB 5JOPE 4QHNB 5ITBL 5FEBA 4ZTPH 1UKTA 2EKSA 1YN6B 4O9HL 4RMRA 5GGTL 4WI4A 2K7QA 4NQEA 5ERWB 4L4TD 1NMCB 2D7OA 2E5EA 3KPPA 3D0LB 3EYSL 2JTDA 3D2UA 2BK8A 5D7SH 1R5WA 4GW1A 5I15L 3O2DH 5KVGH 3PF2A 1JPGB 1REIA 1F6LL 4HSQA 5GISL 2AJXL 1CI5A 5EDXA 3VE0A 1CDIA 5E1HB 4K7PY 1GOFA 1HKLL 2ZUTA 1V7NL 1L7TH 5L8JB 4HUUA 1S9XA 4Z78A 1CGUA 1CR9L 1SYVB 4NDMB 1SQ2N 1IEBA 3UDWA 3QIBC 4WUUA 3VCLB 1KCVL 1U92B 4N9GA 4DVRL 1FAIL 2ADFL 3L5HA 3BSZH 4I48A 3IU3A 1JPTL 5C0FA 1SHMA 3ARBD 2X89A 4CMHB 1NPUA 1LDPL 2Z8VC 1MJJB 4P9MH 3OJMB 3L1OL 4YPJA 4YHLL 4LPUA 4P49A 2DIJA 3BKCH 2Z91A 3D48R 5I1CH 3IS1X 3RQ3A 1LNUA 4OB5L 3ZDYE 4OLXH 1GGCL 4HX1B 3UTPE 2P8MA 2IH1A 4O2EA 2EDYA 4ZODA 2ZUXA 3GM0A 5D7SL 3ES6A 4F8TA 1K2DA 2H1PL 1SEBA 3D39A 4OT1L 4WHYH 3DX6B 3ULVF 4KHTL 4U1KA 1GGCH 3LKPA 4YAQB 3S35L 5E1AB 4EN3B 1D9KA 2BJMH 4ALAL 4WUUB 2P8LA 3PL6D 2ZKHL 3BIKB 4MD5B 5FM5M 4S1RL 5LBSH 3BFOA 5IFAH 1FVEA 4M6NH 4FQLH 2VLJA 4LVEA 2VE6A 3GKZA 1E28B 1BOGB 3ETBF 4L9LA 5HDQH 5FXCH 4R0LC 3NFNB 2XOTA 4G42A 4D0DB 3SE4C 4YFDB 4K7PH 4KKCC 4NO0A 2DWEA 1NAKL 1IM3A 4NGHL 3RWGA 4Q97A 3BPLC 3RIFF 4PR5A 5ERWA 3O6KL 1YEHL 4ORGB 4PRHA 4WI5A 4KV5F 3FQUB 4OCRH 4WWKC 5SWQA 1S9WB 4YO0A 3ZDYF 1N4XL 2ITCB 4ZSOB 5T3XL 3RPIB 3ZSTA 3QO1B 3AAZB 2VC2H 1WJ3A 1S5HA 2YUVA 4XPBH 2YD7A 2DMKA 1M7DB 2PF6A 5GRWA 1NUGA 4L5FL 5CBAA 1KG0A 1RZ7H 3BZ4A 4L4TA 4G7VL 3LKNA 1XF2B 4CN1A 1HZHL 3FONA 2AK4B 4S1QH 3VXNA 5C2BH 1Z3GL 2F8VA 5C86A 4PJEA 4OI8A 4X6FA 1ZHKB 4K07A 3TVMC 2O5ZL 4FFZL 4PJGA 1CFTA 1MHEA 1T1ZB 4OGYL 1QOKA 4Y2DC 4J4PA 1I9RL 2EH7H 3ARBB 1OPGH 4PREB 5EZOL 3UZVB 2BNRD 4I13B 1UZ8A 1EERB 4EBQH 1MFEH 3RWFB 3IDNA 3LKQA 4XTRC 4RWYL 1UWGL 1CDBA 3VDCA 5ESAA 1G1YA 4JO2H 3HI5H 5HY9B 1F3RB 1MLBA 2FZ3A 2V2WA 3OR7B 4NQDA 4RGNB 1O0VA 4H8WH 1RFDH 4LSSL 3MA7B 1NAMA 2GAZA 5GSRA 3VXRD 1LEGB 1RZKH 4WI7A 2BRRL 3LZFL 2CO6B 4XNQA 1VFAA 1KBGH 5IMLA 1CXIA 1JNLL 3KYOB 4DN3L 1GCFA 5HGAA 1RVFH 1HE7A 3DVNA 3RU8L 1S9YB 4MNGB 1HYRC 1VDGA 1J0YA 5BVPL 1H8NA 3EDDA 4XCNB 4ZS7H 4WUUD 1I1AD 5I1KH 4TUOA 5E2WL 5ICXA 1ZLVK 5ACZB 2X4UB 5IMKA 3GSVB 5CBEA 4XHJD 4QRRB 3D9AL 5T1MA 2NY2C 4ODHL 1WLHA 5HVWA 1A6VH 4K9EC 4J2XA 1MWAA 4NN5B 4AEEA 3IU4H 3CC5B 5D96B 5C0AE 3V0VA 1NC4A 2NY6C 4RAVA 3MJ7B 5DRXA 1EPFA 1FYTB 3BQUD 3SEPA 1OT2A 4OZGF 3JVGC 1SEBB 2FB4L 3D39B 3D2UD 1HILA 4OCSL 1OW0A 1TMCB 1Z2KA 1RK0A 3KNBB 4HF5H 5EPMA 4OLZL 2BVPB 2X44D 1KUMA 4ZNEA 1DEEA 2DQUL 3NGBC 4XWGL 3LRSA 1I9JL 4N0UA 5C09E 1EEYA 3QXDA 4LSVL 4X6DB 3C60C 4LP5A 5BOZG 1OOAA 4M6MH 1F4AA 5IB3A 5I0DA 4PJDE 5C70A 5CHNA 1KELH 3C8DA 1BZ9B 1G1CA 4WNQA 2XTJE 1HDMB 3U0WL 4XC1L 1X6NA 4BJLA 4WGVB 3DX8A 1FBIL 4TSBL 1ES0B 4YHOH 5GRXG 5JW4M 1RHHB 3IDXH 4PP2B 4HCRL 1TQCB 3PWNA 4G6FD 4JM4L 5FYKE 4EN3C 2AXGB 1QBMH 4AEIL 4MMXC 3SPVA 3ULUD 3SKJL 1Q9OA 3VGAC 3W2DH 1KSRA 5DJAA 1YJDL 5EUOA 5CZKA 1S7QB 5KVDL 1M1SA 4HKJA 3W9EA 2F8XC 4NQDB 2DAVA 3FO9B 5I75C 1KIUA 1SYSB 4MLIA 3HLAB 3MLZL 3RZCA 5FKPB 5EU5B 4UILH 1MFBL 1J7VR 2OR9L 3H7BA 3FQWB 4KJPD 3QEQB 4N8VG 2VZSA 5E08L 1LO3L 1JMXA 1LO0L 2VRAA 3VGGA 4PJDF 4J12A 4HAFA 1E4XH 2FLBT 4GQ9L 5EWIH 3V4UL 2ITDA 3L3JA 5E94A 3KPQA 5DK0A 1MY7A 1ZLVH 3OGCB 4H1LG 4POZC 1NLDH 1BLNB 3GSWB 3DXAA 2FRGP 2FX8L 1IARB 5AD0A 1Z3GH 2E9IA 1WTLA 2VDQL 3HCVB 4LKCB 3P9LA 2NY7H 2XY2A 3CC5A 3FT4B 3CLEH 3IAQA 4G7YH 4FQIH 2WQ8A 4RAVB 4U6XA 3UTQA 4BFBD 4PJIF 1MWAH 4AH2B 1DVFB 4FN0A 5C07E 2DLFH 3WKML 1OF2A 2QSCL 2VDRH 3MXWL 5CILH 3EHBC 1FYTD 3GSOA 2WINB 3HB3D 5DMIL 4U6VH 4Y2DB 4K9EH 4MB3A 2BMKB 1IGFL 4W6XB 1ZTXH 1Q9WB 1RZKC 2DBLH 2HJLA 1A7OH 2HKHH 1GGYA 3D85A 3EJZC 3VXUE 4LGRB 2E7LA 3VG0L 5I2IB 1LP9B 1D9KB 4YE4L 1P2CB 1FL3A 4N5UA 4Y1AB 4ZOCA 2P1YA 7FABH 3WBDA 4G6MH 5FDWA 4Z7VB 3EO9H 4GH7B 2M8XA 1E28A 3CU1A 4WI2A 4Z7QE 5IM7B 4P4RA 1ES0A 2WWKT 3B8YA 4EI5C 3WNNA 3O45B 1LE9A 3SKMB 5E08H 1G7PA 1N5YL 4Q9QH 4F2MA 4O4YL 1TJIL 4Y5XC 2IAMB 3QDMA 4L8BB 5EZJA 4P46A 4UAOB 4XP6L 2Z91B 5GJTL 3K81A 5HYFA 2ESVA 4XXCA 3M8OL 2NZIA 2GK0A 1HKFA 4DGYL 3QBTB 5IHLB 1U3JA 5GRJL 3BKYL 5DEGA 4KK6D 3VJ6A 5JHLL 1E0OB 4JREC 2JIXB 2XZQH 3QXTA 1MREL 1KIPB 2VDOL 4LLUB 1RJYB 1A3QA 3GRWA 2R2EA 3MGTA 7FABL 1CICD 5ETUA 5DQDL 4M7LT 4KKNA 3RY5A 4MA3B 4M7KH 4YHOL 2EDTA 3PIQB 4YE4H 1XF3B 1T89A 3TBWB 3L1OH 3FB6A 4KK5D 5B38B 5L9DH 4QXWA 2YRPA 2QKIA 5B3JE 2I5YL 4CVWA 1I9IH 2DQCL 1ACYL 4P99A 2IF7A 3ECBA 3ME0A 1ORQB 4R90H 5DJDB 1EFXD 3LDBB 5F96L 3TO4B 1OAQH 3N1PC 5CUSL 2EIBA 1KCVH 4ZD3L 1N5YH 4Q9QL 2DJSA 4ZSOA 2RCSL 5C92A 1QLEL 4W81A 3C8KA 2ORBH 2AS5M 3PJSA 4BSVA 5KJRH 5DLMH 4KY1H 5DFTA 5FYLD 2AEQL 4BQ8A 1T83A 3MV8A 5D1XC 4RGOH 5BMFH 1PLGH 2VSDA 4H25A 5DURB 1A7NH 5HHOE 1JNLH 5JA8B 3V5HB 4S2SA 4M48H 3MJ9A 1ED3A 2YWZA 3PDGA 5F7EL 3MRPA 3TBWA 3IFPB 1I1AA 3QUMA 5I75B 2H32A 2J88L 4YHNB 2WLYA 4NQCD 2UZYB 3WNPA 1RIVH 5CS7A 4KUCD 4Y8AA 1S5IH 2J3SA 4HFUL 2YPLE 4XBEL 4DGVH 5KSAB 1G84A 4Y4HB 1K4DB 1A47A 3SBWA 5J11C 4OV6F 1T5XA 5JUEL 5I1JH 2E8YA 2MTPA 2IH1B 1KCSL 3IRPX 4MAYC 5FGCE 3Q5YA 3CUPB 4WUKH 3FAXA 5MEND 4P59H 4OF5A 3FJTA 1AO7D 3IF1B 2XPGA 3PWJA 3TPUB 3ARED 4GS7C 5JHLH 2EICA 2GSIA 2W9DL 4UI2A 3MRKA 1EAPB 4K94H 1FVEB 1VFMA 3IS0X 3MYZA 3P0VL 1AGFB 4HV8A 3B9KD 4OKDA 3ILPA 3VFPA 2P24A 5C8JA 3R1GL 3UDWC 3EYFA 4JVUA 4Y88A 1U8JB 1C1EH 3WDIA 3HUJB 3FZUC 4JDVA 4Y2OA 3VRIB 4ODTH 5A2KH 5JQHC 1A8JH 1AQKH 3WNLA 3MOBL 1VPOL 5C0EA 4YK4C 4DK6A 5EU6B 1MCKA 3E0GA 1DANT 1FDLL 2EDNA 5I1IH 3O2DA 4TUOB 5JUEH 3VWJA 4QOKB 4M43L 3GSRB 1RMFH 5E99H 3O11A 3T1FB 1KN2L 2J4WL 3KGRA 3D2UB 4UV4L 2L7UA 4Z8FL 4X7DC 4P2QD 3CJJA 1G9NC 4AMKH 1L4IA 4MVBC 3V4VH 5C0GB 4X0KB 4O2FB 1QKZH 4FZEH 1U58A 1D5ZA 3S34H 4GRMB 2OR9H 1HQ4B 1P84J 1JPSH 1JGUL 1MCEA 2G2RA 1ITBB 1BQLH 3DURB 3Q2CA 1QSFA 1AGBB 2R29H 4Q9RL 1F11A 3VFVB 5T3XE 2R2BB 4OLWH 5CCKH 3BISA 3BUTA 4U1NB 5DJXA 2ZOKB 5E4EB 1RJCA 1T3FA 3C6LB 1DSFL 1BM3L 1HXYA 1LGVA 4P5KB 5I1EL 4M8QB 1IL1B 5C6PB 4XZUB 4M02A 2EO1A 3V5DA 1VERA 4NQCB 5D6DC 5EN2B 4UQ2B 2VLLB 1YN7A 2HVKA 1CWVA 1H5BB 1SJEA 3J8F7 2EYSB 5DSCA 4J3TA 1BFTA 2Q1EA 2A74B 2GFBB 1FFOB 2X4SA 3VGFA 2LU4A 3SDDB 4Z0XB 1CE1H 4QXGH 5MENB 3R4DA 2FL5B 2ESVD 2IPTH 2IEPA 5C08E 5IUSA 2FHCA 4C4KO 4NM8H 4BUHA 3T0VA 5C3TA 3DBXB 1RVFL 3KPOA 3O3DB 3QEQD 1I1RA 1R5WB 5T3ZE 2AV7B 2NY5H 4KK9C 1LEKA 4DK3A 1LWRA 2KH2B 4ODXB 3GSNA 1A5FH 3EOYG 5C2BL 4ISVA 4ZPVA 5I19L 4TNVF 4P5TD 4TUJA 1HXYB 4PJFB 3SGEH 4X6BB 3EZJB 5EU7C 2GTWA 3TN0B 3H42H 3HE6D 4KMLB 1FNFA 3CFCH 3RX8A 5LGJB 5DFVD 1S7UB 3SQOH 4GRLA 5FUCE 1D5IL 2BC4A 4JFHE 3MREB 1CR9H 4JJ5B 3BP6A 4EBQL 3QO0B 5EPMB 3KLAB 1KTKE 2VDMH 3PDDA 4PJHF 4UV4H 3QJFA 4M00A 4JFXB 1DVFD 5B3NA 2IPUK 3SDCD 2R0LH 1JNJA 5GIRA 1JGVH 5IIEB 3O9WA 1INQB 3ZTNH 4IM8A 3R8QA 4FABH 1K9TA 2JELL 1KYOK 4TUKH 2B7DT 4PJ7E 4U1JB 1MCCA 1JTPA 1I8LA 3C8KB 2GEEA 1J8HD 3DXAE 4BYHA 4YHKH 4PJAA 4AL8L 3U9PH 2IBGA 3UYPA 4OZIF 1RZ7L 4HH8A 3Q5OA 5EBWB 3SE3A 1NDGB 1LO5B 3DUSB 5L2KA 1MI5E 2RHEA 3CX2A 1BJ1H 2QV2A 4NZTH 1RPQA 1AO7E 1UWGH 1M7IB 3SCMA 3VDAA 3BWAB 3WO3B 4HHAA 1FL5B 4EXPX 3R1GH 5F7WC 2FEEL 4XVUD 3MBXL 2BNQE 1H3VA 4CVUA 3RY6A 1DBAL 2HFGL 3MCKB 2ENSA 1SY6H 3O6KH 2D03L 5DGQA 1DDHA 1NFIB 1NKRA 2VWEE 1U8PB 2NXYC 2GHWB 3VXMA 5B8CA 2J2ZA 5GGVH 1CGXA 5H2BA 2W1NA 3VU2A 2G60H 4X4YA 5FYJE 1T22A 4OCWH 1NMBL 3MFFB 1F3DJ 4MLSA 1S7SA 1U8LA 4X5XB 2DQDL 4F33B 1LDSA 3SY0B 2YD6A 5KAQG 1QVOA 4OFKA 1LE5A 2J8UB 1MEXL 5EBMB 3FRUB 5ICYB 3RJDA 4LCCB 3QCUL 5IEHA 5EU4A 5E94B 1ZLSL 1Z0MA 1MJ7L 1J11A 5HYJA 3DV6A 1G7IB 1R3HB 3VG9C 4Y4KC 5GGSB 3QISA 4AIXA 1N4XH 3SKMA 5F6IB 4X6BA 3TA3A 5KVDH 3O8XA 1N2RB 4PJHE 2JELH 4M5YH 2RQ8A 1IZKA 5J9PB 3DYMA 3ZYOA 5TQ0H 3VI3E 3CAFA 3MQIA 5CZXC 1OSZB 2K9UA 3D6GA 4P5TB 5TQ2L 2H2PC 1WZ1L 3UAJD 4POYA 1G7HA 1W8NA 3F6IA 5I66B 4K23L 4QCIA 1WBXB 1EAJA 3SGJC 3EJZD 1EMTL 1INDH 4IDJH 4S1SH 4UTBH 1IGIH 5ENWA 4NWTH 1DQJA 1DQDH 1IKNA 2ATPA 5J3HC 4APQD 1QVOB 4HEME 4LNRA 5IEKB 5C0BB 1EUUA 5H8DA 3SDCB 3I6KA 4HJJH 5KOVC 3WIIL 2F53E 4ZO7A 4JZJB 1I8IB 1AGCB 1T7ZA 3EFDH 1CDGA 4ODBD 2BSTB 5CHNB 1CFVL 1EEUA 4JPWL 2VITA 3WIFA 5MHSD 1GRWA 2L0DA 4WJ5A 1KLUA 1IGCL 2V9TA 5DJAB 1YPZB 1FORL 3S98A 5E5MB 2HG5B 1F45A 4XP5L 1MREH 4QEGA 5HDQL 3MV8E 1ZHNB 2V7HB 4K71B 3A0OA 4WFED 5CSZB 1TETL 3QDAA 1YEJH 4U1MB 1YQVH 2HLAA 1AD9A 3QG7H 4QYOB 3TBTA 4PRHB 3VFWA 3U7WH 3ZDZF 3P77A 2FJFB 3M8OH 4BK5A 1JTTA 1J1OH 3KPLB 3L3IB 1F6FB 1NDGA 2DL9A 1IGIL 3MLRL 1DBBL 3NVQA 3HUJF 5D7IA 1J87A 1L0QA 1ZT7B 1YNLL 3MXVH 1X5KA 3W0WE 3Q5TA 4N0RA 1F42A 4QKXB 1L7TL 3NPZB 1JF5A 3F7QA 3WIIH 2X9WA 5CD5C 5I1HL 2M2DA 4E41E 2ZG2A 4HAGA 2ZCLL 4PJFF 3RWHA 2E7CA 5C0EB 2DQIL 1KN4H 4JZOA 5JNYA 4X4YB 4F7CB 2Z35A 2GITA 5JIHA 4JHBA 4M7JL 2I9TA 5DR5L 4POUB 4AMKL 3U9PL 2NYYC 3H2WA 3OWEA 1P1ZB 4AIOA 2HVJA 4GXVL 2OTWB 1NGXB 1OCWL 4HG4K 3WJJA 5I9QB 4TRPL 4TPRL 1F90H 3TJHC 3N0PB 4BZ1L 5HHVL 3LKQB 3V2AR 1S5HB 1B2WH 2G75A 4F7TA 4V1DD 5J6HB 1DVFA 5LCVH 1B3JA 3RTQC 2XY1A 3M07A 3FQXB 4MDIA 5IB1B 2A6KB 3ARDB 1RZGA 3PGCB 2GYSA 1H8SA 2XKNA 4PGEA 2MCPH 3KXFB 1FG9C 5D70H 2EYTA 1VEOA 3L3KB 4NC2B 5CWSB 3C60D 4JFDB 1D5XB 4I0PA 3SGDH 4WI3A 5JW3L 1KPRA 5DMGD 1AGEB 3V4UH 4U1JA 3DSFL 3ZYJA 3FO1A 4PJXB 3ESVF 4P5TA 3BW9B 3U4BL 5JQ6L 1G9NH 2LAGB 4PLJC 3UC0H 2APXA 1BREA 4E41A 4OUUB 5ACZA 1M05A 2DKUA 3MYJA 1CL7L 5CBEB 4PD4K 1CDUA 3MLVH 4AL8H 5C0BA 4GAGH 1CFNA 4NFDA 5TH2A 2X4RA 3VG9B 1TZHA 2XZAH 3BUYB 1E4KC 2BERA 5KZCB 5SWQB 4J7RA 3OGCA 5F88A 4WCYL 1IAOA 2XQYK 4JJ5A 3JV6B 2H26A 1XGPA 1JGVL 2W07A 2WP3O 4KKAD 4KMTL 2HFEA 3SDDD 5ISZB 1G0XA 1ONQA 3BP4A 4KQ4L 3DHJA 3NH7L 1JYXA 1XGRB 5IMLB 3I50H 5BZWB 4NN6B 4TN9A 3QIWA 3EOBA 3RNQB 1TZGL 1T22B 4YHMH 4F7EA 3GSNB 1DQDL 2JB5L 5MENA 1A1MA 4OCLC 4HIXL 4PRPB 2I25N 4NIKB 5DO2C 2ICWB 1RJZB 5CEZD 1UZ8B 1G7QB 3QO1A 4E5XB 4OLWL 3HE6B 1P4LA 1KJVB 2IGFL 1E4KA 3MREA 4LEXH 1D5MB 3U2SB 2QHLA 1VACA 4Z5RA 3LKOA 1PEZA 4PJ7A 1KC5L 1GSMA 4XHJC 3IFNH 3CMOL 1XCTA 4Z77B 3EO0A 5F3BB 3O4LB 4JAMB 2AK4A 4XRCB 3VXNB 1UQSB 3ROLB 3PWPB 4NHUB 3QIUB 1HSAA 5I1GH 4L8SB 2DF3A 3UTSB 2O61B 3JWDC 4KKBD 2IANE 1K8DB 3NA9L 4LPXA 3QG7L 4QWWC 3NZ8A 5MEPB 3G5YA 1JV5A 3C5ZA 4XNZB 2G5RA 1HXMA 4ZDHB 2IAMA 5JOEA 3UJIL 4XNUL 1OP3K 1FZKB 1T80A 4TVPL 1LEIB 1MHHA 1J8HB 3D69B 4YPGA 1XGUA 1BJ1J 2C26A 4UU9B 3PXJA 1U8QB 3THML 4KK8D 4DUXA 1AH1A 4HLZG 5GISH 1WBZA 2RBLA 3O3UN 2H9GA 3LQAC 2VR5A 1YN7B 1AXIB 2UY6A 4Z7WF 4O02H 3LB6C 3HG1E 3MRNA 2XZCH 2VXQL 4YQXL 5FF6A 4P5MB 4JFZL 4D0DA 1RFDL 1DFBH 3SE4A 4GBXA 2B2XL 4YEEA 1DQTA 1BVKA 1IGYB 3C5ZC 1FV1B 3ALPA 43CAA 25C8L 4M8VA 5SWSD 4NRYB 2QADC 2WWMD 1OTSC 2P5EE 5FUCC 2A6JB 5F44A 5C9JA 3GSXB 3OKYA 2CLRA 4X99B 4HH9A 5BRZB 2XWBA 4X4XA 1UKSA 4LOUC 3OB8A 5DD0L 4AENB 3JWOL 1ZSDA 4KJWD 2FNBA 5EO0A 3T77A 2UWEB 4ZAKD 5F1IB 4R4BA 1ZGLP 3KJ6L 2EH8H 1GGUA 4JRWA 5HHNB 5J12C 2NNAB 1HZHH 2RGSA 2VQUA 1LNUB 3MO1A 4F37F 3BN3B 4L5FH 4U3HA 1CDJA 4WO4D 2QSTA 3AXLB 1T5WA 3NA4A 4ETQB 1A2YA 3CLEL 5JZ7C 5AYQA 2B5IC 2RB8A 4Y19E 3SKNB 1VKXA 4I18C 2NY4D 4GRLD 5EIQA 3TYGH 1BAFH 1NBQA 5DEFA 5FUZL 1I9EA 3BT2H 4TVPE 3MRGA 4PLJD 1EO7A 4LSUH 2A77H 5JMOC 4DZ8A 1PD6A 2XWJB 4WRLA 3RY6C 4M7ZB 5C0BD 1C7SA 3E6HB 3U0PB 1GHFL 4PRPA 3CFKA 5I2IA 5HGHB 3D18A 4PJGE 2ZJSL 1FHGA 3CDGB 4QY8B 3RI5F 3G5VA 1H3TA 1JGEB 1Y18A 4CVXB 2PXYC 1JGDB 4JFYB 3FN0L 3EDKA 3TT1H 1J0IA 5IMOA 4JFFE 1A4KA 4X80L 5IVXF 1RSFA 2NY2B 1CGSH 1DQQA 2FJGA 3KPPB 3UJJH 1BFVL 1RUAH 4F2MB 4OSUH 1KPRB 3ARYA 3L7FA 3SKOA 5FYLE 4YDVA 1XGUB 5TPWL 5IK3A 3ZL4H 1BX2B 4FQXB 5A1AA 2EDHA 2MSPA 5L6YH 3O8XC 1KLGB 3BESR 1JV5B 1XFPA 3EYOB 3OKLA 1JHKH 2ZCHH 3F58H 2XRAH 4Y2DA 4EN3D 4QOKA 3S6CA 4JM2D 4Z7QF 2HJLB 2FLRT 2BNRE 1MHCB 4PP1C 2XIDA 4W4OA 2Z93A 3QWOB 2E6JA 35C8L 1H3WM 1RULL 2EE3A 1EV2E 1DQLH 4U6XB 5CLWA 1AIFA 2WBKA 4PV9A 5GS2H 4HWNA 2GJ6B 3O6FD 4OD1H 32C2B 4Y16A 5F89B 1E4XI 2OTPA 3RHWF 4OAWB 3VXSA 1JUFB 3RVUD 3INUL 2C3XA 1A5FL 3N85L 1QQDB 2R15A 2Y6SD 3G6AB 2X1OA 4U2ZA 4UDUA 5DJ6B 3QDMB 3CZFA 4R8WH 1BVZA 3TO4C 5GZOC 2P5WA 4ENED 3LN5B 5E03A 1RHHA 4GMSH 4GUPB 4NN7B 4JFQB 4PS4H 3AM8C 5CIPB 5DJYB 4GG6B 1TDQA 5CP3A 1A3LL 4MCZA 4ONHB 1J0HA 3U4EA 4I1NB 4CMMA 4PTUA 4R97C 5IQ9A 1GHFH 4R6UA 4X7SH 1FZJA 2RFXB 4NQVB 1CD0A 4PRBA 2D0HA 4QHNA 1PKQE 4G6AC 5LGHL 1NLBL 2FBJL 4NZUH 2A83B 3WL9A 1II4E 1TZIB 4PY8J 3T0EE 1FIGL 1SY6L 3CLFH 1JWMA 1KGCD 4ZOBA 3AREA 2YRLA 3DI2B 1HH6B 5BXFA 5DWUH 2H32H 4Z7UA 2P7TB 3TBTB 3QDGB 4JO2L 4LMQE 3MJ7A 4OZFB 4JCLA 4ZXBA 5F71A 5SWZB 5J4MA 5JOFB 4ZQKB 1F58H 1VEPA 4EUPB 1Q9LB 4NQEE 1KIRB 5A40E 1JZ4A 3AB0B 3B9DA 1DBML 3LQAL 3TBVA 2MFNA 3D3VE 1OP5H 5K9KB 5E8DH 1BECA 2V2TB 3VXRA 1U8HA 3D39E 1C5CH 3H9YA 5LGHH 1UJTA 3DO7A 5IP4A 1RZFH 5BV7C 2YPVL 1C5BL 5KVFL 4BELD 5D9SA 4G7YL 1K6QL 4FMKA 9CGTA 3H3BC 3RVTD 3KYMB 3QI9C 5D7LD 1ZA6A 2W0FA 4WDIB 4M62L 2ICEB 4Y16D 1F8TL 1MCWM 1XZ0B 4AM0B 3QP3A 4JO1L 3QIBB 5T3XD 3AU1A 3V7AE 1HH6A 5HTSA 3SE9L 4M7ZC 1G9EA 1TFHA 4LP4A 4HGWB 5JW4N 1MPAL 3MA9H 1QBBA 1T0MA 1W8OA 3LD8B 2VXQH 2XTLA 3BZEB 3BIKA 4MD5A 4FTVB 4ODWA 1Z0NA 4OM1H 4F9PC 1LO3H 4WHDA 1OTUC 5E4IA 3BEWA 5HDBE 2DQEL 3I3EA 5E6ZA 3HA0A 4Y4FD 3MRJB 4RMSA 3DOSA 3WXWL 1PG7X 5I18L 4B5EA 1F2XK 2F19H 1MCPH 3U4EB 2XWTA 4KXZI 2VISA 3GMMB 5ILTH 4PLNC 1ZEAH 4JY6A 4R2GC 3I6LE 3L9RB 5T5NG 1RUQL 3CSGA 1XGQB 2W92A 3VFMB 1F6AA 3WLBA 4FXGA 1WWWX 4Z18A 5C0NC 3BI9X 2QADD 2WWMC 1XF4B 1HSBB 3QEQE 4U49A 5GJTH 5D7JB 1K4CB 2XI9A 3VMNA 5J1TC 2XZCL 4N1EA 1BGXH 1E27B 4PG2C 1ZT1A 1CVSC 1GOGA 3KJ4B 4PBVC 3L5JA 2YEZA 2EXYC 4LIQH 4U3XA 4QHLB 2NCMA 1MJUH 4NRZB 3BWUC 3NCMA 1FORH 3L3GA 2F19L 3OAUL 4JFHD 1MCLA 4L4VB 1AXTH 2LE9A 3FQRB 3I75A 4HLJA 1OF2B 4HKZA 3AXLA 1FGVL 1U8NA 5C0IA 1CFQA 1FLRH 5DZOA 1X7QB 2IC2A 5C0RH 2QHRL 1BEYH 4DEPC 1KPUB 4K3DH 2FO1A 3VG0H 5GS1B 1T04B 2BZDA 2CXGA 5DJ2A 4WI9A 4WWKB 5CINL 1D5BB 4LCUA 5HGAB 4OD3H 1B88A 2YOCA 2DWDA 4FFYL 4HUXB 4GMSL 3VWKC 1ADQA 1T0PB 2OI9C 4HJJL 4UTAL 3RKDD 3IU4L 4IMKC 5EB9A 2XYCA 4HS8H 4AT6B 2GY5A 4PJ8A 1KTLB 4Z7UE 3EDJA 1XT5A 5AZEH 2CK0L 3V79C 2DKMA 1ND0A 4ZAKA 3BYTA 3IDMB 3CVHH 1R5IB 1JHKL 1YEDB 5E2WH 1LP9E 4N5EC 4GRWE 5I76A 3L5XH 1NH6A 5F1KC 1KJ2B 5JIPA 2DI8A 2FZ3B 2VSCA 1D3CA 4HUNB 4HUWB 1AGCA 4XNZC 3C6SB 3BVNA 4PG9A 1U93B 2FJGB 5E8NA 5EA0L 4JN2B 4RFEA 2FJHA 2BY0A 1SJVA 4C56A 4GOSA 2ZUUA 2A6DB 3VW3L 1YNTB 2BNQD 4G80A 5F1OB 4OZGB 1JYWA 5DHXB 3BD5A 1HHGA 2BY3A 1NFDB 1RIHH 4YDJB 2Q7NA 3SJVE 2BVOA 3OPZH 1CICC 3BDXA 3HZMB 2NY0D 3MV7A 4OLVH 1QHOA 3MV11 1I1YB 8CGTA 2BVUA 5H37H 3IU3B 3T0WA 1PVHA 3JVGA 3FN0H 2Z31D 4PYHA 1NC2B 3O0RH 4PJBE 4LSPL 2JLLA 3F5WB 4PLOB 4U7MA 5J1AA 5CGYD 1KNOA 2DQDH 2FGWL 3AB0C 3MRKB 1YEGH 1WC7B 3E2HC 1EJOL 4NQED 3QH3A 3OKMA 4X5WA 4X9HA 5HGGS 5D7JA 5GGTA 4HV8B 3HMXH 1U91A 5KSBE 4XCFL 1S7RA 4CJ0A 5BJTA 4IRJD 4K55A 1FFOA 3SDXE 3TA3B 5GGVL 5DZLA 5T1LD 3GUTB 5FHBL 3HS0B 1BAFL 1R6VA 3LN4B 1A4JA 4FFVD 3MLXH 4LLVA 2IPKB 1U3HA 3FQNA 4MJID 1X5HA 2CLVB 4RMUA 4JN2A 2IAMD 3GO1L 3RA7L 1S9YA 1QTYT 4RMWA 1CFSA 4N9GB 4Z7UF 1QSFE 4I2XA 4QLRA 4TVSa 4X99A 3S9DB 2ZCLH 2A2QT 1JRHL 4JPIB 1WEJH 1S7SB 3ARWA 4QNPE 4YDVB 3KYKL 2H41A 1BF2A 5KTEH 3HC3L 4YC2C 3TYGL 2A0LD 1GGIH 3EYVA 1FO0H 3O6ML 2V17L 3GJEB 5KJRL 1QNZH 3DARA 1VADA 1F90L 2L4OA 1CQYA 1IAIL 1JWUB 2A73A 4WW2A 2R9HC 3K4ZA 4D9RE 1D6VH 4MHHI 1X5GA 3C5JA 4Z7NF 5CZVL 4R2GB 4UBDD 3L7FB 4Q6IB 4YBLB 3UZQA 1U8OB 2IH3A 3SDXF 4ODHH 4FXKB 1FIEA 1K5NA 1URLA 5KSBA 3BAEH 5DHYA 5F6HI 2Q8AL 1M71A 2XRAL 1WAAA 1AGEA 3UCRA 4OFPA 5TF1L 3EYFB 4DZ8B 3IGAB 5BVPH 3RVXC 2FD6H 1LILA 4NKDB 3U6RA 1XF5A 2JCCE 1CYGA 5KVGL 3W0WD 5BZDA 1LEIA 5I15H 3STBA 2Y07L 3HI1B 4XCCL 4GAYB 3E3QE 4XTRD 1IKNC 3SO3B 4NM4L 3SKJH 4RDQG 5IFHL 1KB9J 3LZFH 3ZHLA 1OQOA 1IEAB 4APQA 2NXZB 2VAAA 1CLOH 4WW2C 1J18A 1PG7L 1XEDA 2NY0B 2ZKHH 2DTMH 4OZHE 4S0TD 4D9QD 3VFNB 4ERSL 4Y5YB 5IFJB 5J6GB 2CIIA 1A9BA 2HT2C 4XP6H 4QRTA 3FFDA 3TT1L 3VFOA 3QCTH 4S0SD 3B6SB 1IM9D 4BK4A 2CLZB 3HG1A 4OFIA 1TPXB 4EIZC 1NDMB 1CBVH 4LK4A 2VWEC 4FFWD 3H8NA 3S96A 1WZ1H 2AJYL 3RBSA 4CU6A 4OSUL 4X9IA 1U3HB 1OGAD 1Z9LA 3TT3L 1HSBA 4C83B 5IJVA 5DD6A 5EU6E 3TA3D 5INDB 3O6FA 1WBXA 2D9CA 1T20B 4PJBA 4L3ED 5I71C 3X3GL 5AWNL 4HPYH 1DBKL 1DEDA 1DSFH 4NQSB 5FO9A 1RUPH 4PJCB 5DVMA 1A64A 1N6QL 3NA9H 3X14A 3MRLB 3P73B 1GAFL 5J1AB 5ETUB 1OTUD 4F7CA 1EGJA 2BY2A 3OHXA 1RZ8B 1NUNB 4G3YL 5C9JB 3PGCA 1EFXA 4JKLA 4P4KA 2M26A 4NO0B 1H5BA 2BP3A 4NQTA 2QEJA 4C54A 1S7WB 3CFJB 1JWUA