4JFFD

Preservation of peptide specificity during tcr-mhc contact dominated affinity enhancement of a melanoma-specific tcr
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
197
structure length
197
Chain Sequence
KQEVEQNSGPLSVPEGAIASLNCTYSFLGSQSFFWYRQYSGKSPELIMFTYREGDKEDGRFTAQLNKASQHVSLLIRDSQPSDSATYLCAVNDGGRLTFGDGTTLTVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title T-cell receptor specificity maintained by altered thermodynamics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 36
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2013-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jffD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jffD02
5EO0A 3SN6N 1UB5B 3L3HB 2DQJL 1N64H 4NNXA 3P4MB 1K85A 3MRLB 3ALPA 3HLAB 4UINH 3U6RB 1NMBH 3BESR 1KXVC 2LVEA 1BEYL 5H2BA 5L7XH 3KVQA 3G5ZA 5A3IC 4HV8A 3U0PB 4LHUA 3TT3L 2WWKO 2XPGA 3DVIA 4UDUA 3ESUF 1YMHA 4F80A 4NGHH 1E27A 1DLFL 5ADOH 2OXHA 3MXWL 4OF3A 4YK4B 4PRDA 4ENEC 1OGAA 4BJLA 1JNNH 1HIMH 3P40A 4IDJL 4P5TB 5I1HH 3F7RA 4TULL 3TYFA 2BOBA 2YR3A 1AJ7H 3QJFB 4BFGA 2IPUG 4NQDB 4LSSH 3IDXL 4IHOA 3ARBC 1UEYA 2HVJB 4KJYB 2K3TA 1FG2A 1QRND 4CBPA 1EVTC 4FFYH 3C09B 1QNZL 2WBWB 3NOIA 1UCBL 2VABB 3I6LE 4HS3A 2F5BL 1E28A 1AGDA 5INDA 4HC1L 5A2JH 5JW5A 1OARL 1QLRA 5HDOA 5BQ7B 4V2CB 1MCWM 1NBZA 4K8RL 3TZVA 4OJFL 3BZEA 3DV6B 1JNHA 1OF2A 2J6EL 4J3OC 4YPGA 3RHWK 3FOMA 3L1OH 5L6YL 4X6DB 3TBVB 3X11B 2KL6A 4P46C 4BUGA 4C56D 2GTZA 4OF5A 1DBBL 5FYLL 2CIKA 4R26H 4ZXBC 2D7TL 2QSCL 1GIGL 4JO1H 1AQDA 1FNEB 1Y18A 3OXSA 1PX4A 5L8LB 4Y5VB 3GSQA 1B0RB 1ZS8A 3QDGB 2JB6A 3DMMD 4JZOB 1NCWH 3HUJF 4FQCL 3TESA 3RVXC 1DQLL 1NGWB 2XFXA 2Y6SC 3CD4A 1NDGA 3L5IA 1I1CA 2Y72A 5TE7H 1RJLB 3HPLA 4M4RA 1N3NB 3L3KB 4CNIA 4PREB 5TQ2H 1WZ1L 3QUKB 4ZNEA 1T04A 4LVOC 1MCSA 5ESAB 4WI5A 3JV5A 5FOBB 2W60A 2PYEE 1E4XI 1VFBA 2JB5L 4KU1A 2VLKD 5ADPH 1AE6H 4DZBA 5CJXC 4LLWB 5FYJD 4QOKA 4XNUH 2YD3A 3EJYC 4QXTA 1JHLL 5D1XB 5D1QA 2EDOA 3X17A 4DEPB 5DR5L 2DDQL 5TPWL 4GAYA 2DRUA 1BBJB 3HI1B 1FJ1B 1EMTH 1ZGLM 3C87A 3DVFA 1EFXD 1CD9B 4OZ4A 1LGVA 1MLCA 5DWUH 4YZFE 1T0MA 2VXSL 5F6IC 4PB0L 4OFIA 3SE4C 5BS0D 3W5NA 3A6CH 1G7QA 4LNRB 3G6AA 2KDGA 1QEWA 3MRQB 4OZGA 5CCKL 5I1LB 5BW7A 4MVBC 5H8DA 4FQJH 3IKKA 1B6DA 2A74B 2AJXH 2BY0A 2DQEL 1RZ7H 4GW4B 1P84K 4ONGH 5E4EB 3CGTA 4LEOB 3VXPB 2DQFA 3I6KB 3SDDC 5CWSB 5KSAC 1AO7A 2R29H 1X44A 4MSWB 1BAFH 3PQYA 2GSGB 4R4NC 2YPLD 4G9FB 2JCCF 1LO0H 1K4DA 1XIWD 3MRNA 4C83A 3SBWA 3AREB 1TTUA 1TJIL 5EZIL 4CU6A 2J2ZA 1GGYA 2XWBB 5DJ2B 1LE5B 1EH9A 2DOCA 5HD8D 4YH6A 2FJFA 1Z9OA 4MWFB 3WN5B 4WGVB 2CO7B 4XP5L 2Q7YA 4GG8B 3RIFF 1A0QL 3RKDD 4KDWA 4D9QE 3NIDF 5ICZB 1HKLL 4HJJH 3H7LA 3L6FB 4JFXA 3MROB 4PJ7A 5ICYA 4U7MA 2EDTA 3WL9B 1IGIH 1YC8A 4GRLC 4DUXA 4G3YH 3MV9A 5DGRA 5FKAB 4LSUH 3AS2A 5FEBA 4LRIC 4EDWL 5SWZA 3VGHA 1U3JA 1EERB 5E2VH 2HG5A 4XWGH 4J4PA 4XC1L 2W0FA 3ARTA 2NW2B 2BFVL 5C0AD 2IG2H 3D2UB 2DQUL 2YPKB 3O6FC 1FVCB 4XNQA 4EUPH 3L3GA 1TVBA 5D2NC 1D9KD 1I4FA 4OLWL 1MI5E 1AY1L 4HKZB 5DFWH 3UJTH 4P9MH 5JXAH 4Y89A 2W07A 4H8WL 5ALBL 4AENB 4MAYA 1CK0L 4LK4A 4U6YB 5DFTA 1F2XK 3ZYOA 3N0PB 4K71B 4PRHE 4K94L 4YHNB 2AKRA 4XH2B 3BPNB 4QHLA 4Z7UE 1E4XL 1TJHL 5DLMH 5HYSA 3FT4B 2UZIL 4BQBA 4KKLD 4OZHA 4OAWB 1MJJB 1QLFA 2R0WH 2V5SA 3MRIA 2GY5A 5IR1A 3DARA 3NZHH 2NY0C 4L4TE 4NQCA 3P11H 1T5XB 5FO9B 4D0DB 2NXYB 1K4CA 1ZVYA 3KPQB 5T5FL 4PJ8B 3KYOA 4OSUH 2P44B 1XR8B 3MV8B 2FX9H 4ZUTA 4POYA 4QLRA 5J1AA 4EIZC 1RHFA 2O61B 4JGUA 1J0IA 4MD5B 2WBJD 3LPGA 2CXKA 4P23B 1A7OH 2F58L 2OSLA 3JV6B 2G75A 4YQXH 5DK2B 3P30H 2VLRD 3UTSA 4QRUA 4K3JH 5FUZL 1ZA3A 3LQAH 4KHTL 1OQXA 1E6OH 3S4SB 4BFIA 3PWNA 3P0VH 4UOW1 1KC5H 1CFQA 5CSBA 3VG0L 4Q9RH 4JM4L 5CJOL 3REVA 4M6NH 4NFBA 5KANG 4A2MA 5DHXB 3R1GH 1N5AB 1YQ2A 4NQED 4PPTA 5ESVB 1A7PH 4I3GA 2NTFB 1ZLUH 4ZOEA 5DXWA 5KSBE 3IRZA 4Y5XA 2BHUA 1ORSA 2AV7B 3T2NL 3BMWA 4XCCH 5H37H 4F3FA 1F4AA 4G42B 4PJAE 5MEPB 3WFZA 4EI5C 4HS6B 2J1KA 4P4RB 1NJ9A 2Y7QB 3JV0A 2FGZA 3OAZK 1SEBB 4LLUA 5ERWA 3DIFB 4ODHH 3OPZH 1IVLA 4ZYKB 4RMSA 4R4FH 3UYRL 1BECA 4QRRE 1GAFL 4TQEH 4MQ7A 5L0QC 1GGTA 2A73A 2R0KH 4DOHE 3OG6B 4Y5YB 1RZFH 4APQB 2AK1H 5C0BB 3PL6C 3IDNA 2EIBA 4FTVB 1K5NB 2BHZA 4G7YH 2X4SA 1X7QB 1XF3B 1B9ZA 5LVEA 1KFAL 1J1PH 5IWLA 4RGMC 2ZOKA 1CU4H 1CLYL 1I8LA 1CICA 2HWZH 1FPTL 1YUHB 4TOYH 4NCDA 5D5MF 4HKBB 1G6RH 3V6FA 3SGEH 4OT1L 4ZAKC 1J05A 4K55A 4NKMA 3PHSA 1DUYA 3QEHA 4ZTPL 2YD4A 2PYEB 4R4BA 1BZ9B 5F7YC 4D9RD 4FP8L 1H3VA 4AEHL 3BKJL 4LASL 3MJ9L 3DYPA 4GSDH 5EA0H 3FB6B 2RCSL 2ESVE 1C16B 1KYOK 2IH3A 3QUXD 1S7WB 4JPIA 4K7FB 2XNAB 4PYGA 1Q8MA 4L3CB 3S5LB 3M17A 3IGAA 3BD3A 5JPMB 1FN4B 2P7TA 4HPOH 4G8FB 1INDL 1HYSC 5IROC 2BVQB 1W0WB 2K9UA 1U8LB 2IALA 3LZFH 3BKYL 5M7QA 2OJEB 3ROLB 4LKCA 1OW0C 5GGVY 2R23A 5F89A 4M1CC 3RWDA 3MCKB 1U6AH 1T21A 4NSKA 1P7KB 1D3CA 3R06A 5DJDA 4WEBL 1H15B 1KTDB 1ZT7A 2HA1A 2AJUL 4F15C 3NH7H 1JGDB 5EU6E 5KVDL 2IH1B 4HZLB 3O8XD 4QTIH 4ZFFA 1HHIB 3D39D 2I9TA 3FMGL 3NFPB 1CCZA 1OD9A 5DA4A 2B1AL 4P4KC 3QIWB 4LQFH 1PEWA 4E5XA 3KYNA 3S35X 5CD3A 1NBVL 4KI5E 1DE4B 3TCLA 2JCCA 4NRZA 3KG5A 1WFOA 4KTDH 3IYLW 1OAXL 3VGDA 3RVVC 1EX0A 5IB3A 1BWMA 2WP3O 2A0LD 5B38A 2PW2A 2YN3A 5IVNA 2KQMA 4MGXA 1ADQH 4RRPG 2EDRA 5HHVH 4F58H 1F90L 4OGXH 1JF5A 3CAFA 4JFHD 3JZ7A 4NBYB 4JHAH 5DI8B 1EHNA 1NCDL 5DS8A 5GGSA 4I8DA 2DBLH 1AXTL 2X9WA 4MCYA 3DETC 3BUYA 4YWGH 1FZJA 1SJHA 2IANE 1I9RH 5GZOC 1T66D 5C0CD 3B9KA 3SDAC 3MCLH 5GRVK 5C9JA 4HQQL 4NUGL 2MWCA 4EUPG 2QQLH 4I1NB 3DURA 1MFBH 5DMYA 2XRAL 2CDEB 4I2XE 1CVRA 3RNKA 4PJ5E 1MI5B 4I48A 3KPSB 4K7PL 4PLKD 1ULVA 4HCRH 3BN3B 4G8GD 4LCUA 3LN4B 4ODSH 1Z9MA 4KPHH 5BMFL 5DQDL 1MHHA 2ZUQC 4PRHB 1UQSB 2NZ9C 5EPMB 1ZHBB 2V5MA 4JG0H 2I9LA 2CDGA 1KOAA 1Q0YL 1EEZA 5CZXD 1HI6A 1G6RA 1IC4L 2BOCB 4Y2OA 2W59A 3MRGA 4P2OA 4RISL 4L4TB 3OG4B 2FDBP 4JM2A 1DBMH 1BIIA 2NY6C 1D5XA 3V5KB 3FO9B 1XGTA 3HC0A 4RFEA 2I24N 1T7VA 4JY6A 5GSVA 3HE6B 3WFBL 5IMOB 2DTMH 1I7RB 2DYPD 5DYOA 3MV01 4KV5E 5MENB 5I0ZA 4OI7A 2CKBA 4WRLA 4NZUL 3O11A 2FO4A 3SKJL 1X9QA 3B2UC 1CGSL 1R3LA 4CL7A 1NBQA 1UB5A 1XCQA 3L3HA 1P4BH 3I6GB 4M43H 3P4MA 3DXAD 1I1YB 2A38A 4O9HL 3UJIH 3HLAA 3U6RA 2IMMA 3MRKB 5JOEA 3C8KB 1G9ML 4X4YA 4ODVH 1J0HA 3AY4C 1Z3GL 4M5ZL 4N8VG 3SOBL 3BP6B 2A83B 4YEFA 4M7LT 2JJVA 3GSXB 3OZ9L 1U3YA 3TCXA 3GO1L 5B38G 3FB5A 4P5TA 1VB9A 5KSBB 3O81A 1NFDF 4C58B 5AYQA 4KXZH 1WISA 3RHWF 1FAIL 4G7VL 4NQDA 1YYMH 1OSPL 4ZPVB 5H37G 3N85L 2WM0A 2HVJA 4HPYL 2MHAB 2VABA 4DGIH 4EOWL 1S3KH 5F3BA 4Q2ZB 4M7LH 1FH5L 4XB8A 4NRYB 5BQ7A 2ZSVB 3GK8H 5FDWA 3MLRL 4NWTL 5D70H 4QRRB 3DV6A 5HYJE 1IE5A 4XXCA 1AGBB 4ODTL 3V4UH 4DOHB 2FX8L 4IJ3B 1FO0L 4X6DA 3TBVA 1K6QH 3X11A 2YSSA 1ETZB 1LMKA 1MCPH 3PWUB 4U1GC 3I9GH 3IDIB 1ADQA 4C4KT 1U9KA 4JCMA 3AM8C 3PIQB 5IVZB 5C2BL 1FNEA 3Q2CA 5EBLB 1AHWC 5E8DL 4Y5VA 1B0RA 4M62L 3D69B 3QDGA 4OZFH 4RSVA 4JZOA 1P5UA 2OL3L 1PKOA 1URLA 2VXUL 4GBXD 1TZHB 1NGWA 5DVOA 4OF7A 3UCRA 2P4AB 1CI5A 5T1KD 1UB6B 5JW3L 3LD8C 3OMZA 1RUPH 5MP6H 1RJLA 1N3NA 3L3KA 3ZKQD 5CEZH 4OCWH 5F97E 4PREA 4PJGE 3QUKA 4DN3L 1QFPA 4XNYL 1CXLA 1SJEB 3QEQE 4HCRA 4XCFH 4ZSOE 4NHUA 2BNRB 3FOLA 3QPXL 4JY5L 5FOBA 3DUUB 1W72L 3RU8L 1N0XH 4FZEH 4XCNB 3DMMC 1RZJC 1YEGL 4LLWA 3IU3B 4PJEF 4Z77A 2J4WH 2ADGB 5D1XA 4BQ8A 2DLEA 5DVNA 5KW9L 1E6JL 4OFKA 5C09E 3BDYL 5ANME 1UWGL 3QQNA 5FCSH 2PTTB 1A7RH 1W8OA 5IEKB 5EOCJ 5IQ9B 5EO9B 1BBJA 3EO0B 1CQYA 1FJ1A 5FYKH 2Z9TA 4E0RB 4HIIB 3TO4B 2P5WD 1S7XB 4WDIB 5ALCH 1DVFB 4Z95L 3VMPA 1MFEL 5DD1L 1DBKL 2YRZA 5D96C 2OR7A 4OCXL 4X7FC 2AK4E 4LNRA 1WZLA 5IJKC 3FQRB 1P53A 4K3EH 2NNAB 3MRQA 1SBSL 1YN6B 1MQ8A 5I1LA 2A74A 1SVZA 5EU6B 3GNML 4GW4A 4MZ2A 5FUCE 4NN6C 3HRPA 3V7AE 1ZHNB 3OX8B 4OM1H 3FFCE 4PJDF 3OR6B 4ZUVB 4LEOA 5I1DB 2P48B 3I6KA 4O2FB 3FL7A 3D9AL 5C0IB 5CWSA 1F4YL 4NM8L 4JFDD 4MSWA 3OAYK 2GSGA 5HXMA 4JDZB 4G9FA 1WVZA 3AREA 4U0RC 4PBVC 1T89A 3V79C 5DJ2A 3UTPE 3HI6H 4E9LA 3DECA 3S34H 4QHMB 3Q6FB 1GZPB 4NOFA 2C1PB 5GS0L 4MWFA 4RGNE 3WN5A 2OLDA 1MJUL 2XZAL 2JTDA 1FORL 4EQ3A 4RAHA 4GG8A 5IV2B 5IFHL 5ICZA 4NJ9H 3QUZC 2A77L 3BRGC 3L6FA 3TNNB 4XX1G 5T3ZL 3ZTNH 4M00A 5CJBA 3TBSB 3WL9A 3TFKC 4NN7C 1JGUL 4PJXE 4UOJA 1UGNA 2IANB 3RDTB 1U8OB 1OAZL 5I1AB 1ZOXA 4I2XB 1CLOH 5F8QC 4PJ5B 3L5JA 4Y4KB 2NW2A 3VXSA 3D2UA 3RKDC 2P24B 5J12C 2YPKA 3U7WH 1FVCA 3V4VH 5JZ7C 1RUQH 2Y06L 2YKLL 4R8WL 4Z7UF 2AXJA 5KVEL 1KELL 4HKZA 5CP3A 4WU7B 2PR4L 4OCMC 3KJ6H 3S37H 1Z2KA 4EIGB 3RUGE 1EHXA 3IFOB 4U6YA 1J8HB 1ZVHA 2FECI 4YHNA 3B5GA 1RD6A 4XH2A 5E5MB 3ORJA 5IBTH 1P4IL 2EKSB 2R4SL 2VLJB 2VKXA 5E6IB 4OB5H 2HLAB 2DM4A 3FT4A 2EDXA 1MRCL 2UZYB 1HSBA 4OAWA 3RY6C 1MJJA 2J5LB 3UDWC 3MUGB 3ZO0A 4YHKL 1T5XA 5FO9A 2JJSA 4D0DA 4XVJL 2SEBB 3KPQA 4C59B 3PDDA 1TVHB 4XPTL 3BE1L 1XR8A 4UB0H 1ZANH 5GS1B 5ETUB 2XKNA 3V8OA 2O61A 3IT8D 4MD5A 4Y19E 5HSFA 1KN2L 1BJ1H 2NY7L 4P23A 4E42B 5T5NF 5D93C 3JV6A 5DK2A 1HXYB 3JTTB 2CRIA 1BREA 3MLUH 3H8NA 1KJ3L 5FDYA 3S4SA 1MWAH 3CDGA 4HF5H 3T0XA 3F7VB 5KSBF 3HMXH 3SGKC 3UPCA 4F7PB 3QDGD 3GMLB 5LGHH 4Y1AD 4X0KB 3H0TA 2E7BA 1H8NA 1N5AA 2LVCA 3Q1SH 5ITBL 3O6LL 1BQLH 3GRWH 1JWUB 2YRPA 5B39B 4TRPL 1MAML 3IS1X 4PJAF 5ESVA 4L8SC 3TH3T 2NTFA 1KJ2H 3ZL4L 1A6ZB 4XMLL 5IM7B 1QSED 2FBOJ 3KAAA 4B50A 4NT6B 3ZKND 1G0DA 3D85D 5DJZA 2J12B 1MREL 4QRPD 3QI9D 2ZG2A 4S1DC 4F7EB 2AV7A 2FWOB 1QBLL 1RZKH 3LIZL 3DVNB 1EIBA 4L5FH 4G42A 5MEPA 4KK5D 5CIPB 4MB4A 2X2YA 1V7ML 4HS6A 5IGXH 4KUCF 3V4PH 3B3IB 4P4RA 2Y7QA 1U91B 5HYJB 2DQHH 1T1ZB 3U9PL 1S7QB 5D7LE 2MFNA 4A6YH 3BKCL 3CK0H 4Q74A 1T5WB 1SEBA 2W1NA 15C8L 3NGBC 1KPUB 3DIFA 4I0PB 4ZYKA 3EYOB 1FGNL 3QUYC 5CUSL 1WBXB 4P9HC 1QLEL 1JPTL 4U6XB 4LU5H 2HT2D 5CFHA 1IFHH 2CUMA 4Y5YA 5JA9A 4APQA 4UTAL 2I5YH 4OZFG 3RWIB 4ORZC 4ZUSB 1K5NA 3QHZL 3CDCA 3SCMB 1UYWH 1FRGH 1X7QA 2ZZUT 4MHHI 4Y16B 1FNFA 3K4AA 2NX5B 3BXNB 4OF6A 4D3CL 1MRDH 4HUNB 3U7YH 3PUCA 3SKUD 4WW1B 1YUHA 2F8VA 4NO3B 1R5VB 4MA1C 5EUOE 4HKBA 4EDXB 1NANH 4U1NB 4C54A 3LB6D 4X99A 1BGXH 3QEQB 1GVIA 1OTUD 3L5XL 4RCAA 4ZSOB 3WCYA 1GHFL 2PYEA 1BZ9A 3FFDB 4EI6A 4HXBL 4LEXL 2FECL 3ULVD 2DMKA 3N1FC 2W9EH 4PYHA 4ZTOL 4RAVB 3DVGB 3QPQD 1QFUL 2O5XH 2C7UB 3FB6A 3FZUC 1VKXB 2VSDA 4HH9B 2GK0B 1S7WA 2YN5A 2EO9A 4F8TA 1S5HB 5E6YA 3VXMD 4K7FA 2XNAA 5DRZB 2CIIB 2EH8H 1SY6H 4WI2A 4QKXB 4FN0A 5DURB 4PD4K 4QGYA 1QPPA 5KVMC 4L3CA 5DJ0B 2UWEF 4JO2L 5FOJA 5JPMA 1FN4A 4YFLF 1HWHB 1NKRA 2BVQA 1MNUL 1W0WA 4N5ED 5E8OB 3BX7C 1U8LA 1YY8B 4OKDA 2DM7A 2OJEA 1MCBA 1A7QH 2AEQH 3MCKA 3MLSH 1P7KA 1MCHA 4QHUB 1IRAY 3FFCB 1A3QA 1OM3H 5I1KL 1MFCH 1H15A 3L7FB 1KTDA 4YEEA 3QDAA 2Q8AL 3MXVH 2OK0H 5J1TC 3QDME 3O9WC 4UV7H 4X9HA 3ARXA 3CJJA 3MRDA 1A5FL 2PXYC 2DQDH 2IH1A 4KI5F 1S7SB 4U1HA 4FFZL 4OLVH 1G9NH 5J13B 4IBLT 3ARFD 4Q6IB 4FQXC 4OD1L 4Q7DA 2GJZA 3HMXA 3QR2A 3QIWA 4P99A 2UYLB 3GSRB 5F44A 1IKFH 1DE4A 3M8OL 3GRWA 4HS8H 1MVFA 2PN5A 3FONA 4DKAA 4YNYB 3O0RH 4YFEA 2FB4L 5L2JB 5GXBB 4KQ4H 3JBG7 1G1YA 1L7TH 3GBNL 1K2DB 4H8WC 5JXEC 3BP5B 1QQDA 3EYVA 3KPLB 4TSBH 4Y4HC 4PJXB 1OOAA 3HI5L 3MBEB 2NXYD 3QRGL 1BQHB 5DI8A 5LAXB 4PJ8D 4JLRB 2HRPL 4OCSL 3MNWB 2FLRT 2WLYA 3MV8D 3WFDH 4HFWB 4OBRA 3DPBA 1NGQL 1PFCA 1IZJA 3MREA 2G60L 5I8OH 4L9LB 3ZTJH 3THML 5BZDB 4AEFA 2CDEA 1KXTB 1MI5A 2NR6C 1NEZB 3UTTD 4AIXA 4WWKA 3I2CL 1TCMA 2F53D 1QR4A 3PP3K 1EO5A 1F3DH 4LPUA 3LN4A 4X4ME 4NFCA 4PRHA 1UQSA 1F58L 5EPMA 1KBGL 1ZHBA 2VLME 1PKQE 1C1EH 4ZMAT 4YXKH 1T66C 4Z7UA 3H3BC 5HDLA 1DDHB 1UEMA 4YDVB 4NKIH 1IEHA 1WIPA 1CGYA 1G0XA 2PNDA 3Q6GL 4KV5F 4B7IA 2BOCA 4B53A 3GHEH 4GQ9L 2EICA 3AGVA 4L4TA 4PLKC 2OR9H 1LO3L 4QNPF 3V5KA 3FO9A 4K3DL 2GTWB 1ERNA 4HBCH 3HE6A 5IMOA 1I7RA 2QSTA 3TN0C 3OQ3B 1EK3A 1I3VA 4IRJD 4PRID 4Y19B 4RFNC 5CZXC 1KF9B 3I6GA 4WO4C 1I1YA 3T1WA 3NPSC 5I0DA 1KSRA 4WCYL 3MRKA 3C8KA 3SGJC 1AGCB 1AGEB 4HFUH 1WICA 1YEKL 2XZQL 5C0BD 2APVA 4FTVD 4MA7H 4XP9H 1BVLB 1T22B 3BP6A 4JFEE 5K93A 3LEYH 4N9GB 4W6WB 1JZ8A 2DAVA 5KSBA 1OT1A 3WNPA 3OV6A 2C3WA 1N6QL 1CVSC 2R4RL 5GRYA 1B88A 4D9LL 4HT1H 4ZPVA 2A6DB 5ISZD 1DTUA 3RTQC 4PJIF 2MHAA 5CJQH 5L2KD 3IU4L 3LRSB 4L4VE 2V2XB 4UT9H 5C0FA 1OPGH 4X5XB 4Q2ZA 4GS7B 5TH2B 5GISL 5F9AC 4N0RA 5FM4A 5D7LB 3MMEB 3PP4L 4YHLH 4KK6D 1DL7L 2AJ3B 2OI9C 1UVQB 1T03H 4QRRA 1U8MA 3RJQB 4TUKL 1WITA 4UQ2B 5AZ2H 5I74C 1VPOL 4UILL 5JPNB 1AGBA 2GFBB 4UT7L 4G5ZL 3GJFK 3WSQH 1TJGH 2AJSH 1AKJA 1EA9C 4XP4L 4Z9KB 1ETZA 3GM8A 3IDIA 3O6MH 2EYSB 4CU7A 3VDBA 1HEZB 3PIQA 4ELMF 1DN0A 3ZYZA 3D69A 4PJGF 2R56L 1FDLH 5EUOB 1GC1L 1YN7B 2N4IA 2QTEA 3C60D 5T33H 1G1CA 1UB6A 1WUNT 2VAJA 5DRNB 3U79A 2APFA 3CCHB 4YBLB 3RFZC 1DP0A 1FZKB 1CWVA 4DKFH 4GW5B 5SX5K 3L5WB 4UINL 3K3QA 4XZUA 3VWKB 2JELL 4O5LH 1R6VA 1SJEA 2BNRA 4XAWL 1I7TB 3AXLB 3DUUA 1UJ3B 3MSPA 1WIOA 4XCNA 1YQVL 3IU3A 3ZDYE 5F1NB 4NZJA 3C6LB 4GBXC 1KEMH 2XN9D 1P84J 1S7UA 1MCDA 2XWTB 2O5YH 1KCSH 4Z7VB 2PTTA 3NA4A 5DDHB 5IEKA 1LNUB 4LCCB 1FNSL 5IQ9A 3RZCD 5EO9A 4H1LB 4HLZG 3EO0A 4YXLH 5I1HL 5HGBB 1VFOA 3SDCD 4M6MH 4E0RA 4HIIA 5T5NG 2VDQH 3TO4A 1AJ7L 4WDIA 1TPXC 4S1QL 4X6CE 1DVFA 4BM7A 5D2NE 1J1OH 3HFMH 2Z93B 2VC2H 1EZVX 5DC4B 4MCZB 3W11D 1BJ1J 1F3RB 3FQRA 4KVNH 2AI0H 3STLB 1F02I 3CLFL 1C5CH 3MLVL 5TDPB 3BO8B 1NL0H 3QDMB 4RQQB 5KOMC 5EU6A 1OLLA 1ZHNA 2X1QA 3OX8A 3ZKMD 4YGVB 1NMCC 2B4CC 3OR6A 4ZUVA 4FFWC 3QWOB 3K8KA 3QB7C 4ETQB 4O2FA 2IAMC 5C0IA 4L8DB 1UACH 2IC2A 2NCMA 3KPSD 3UC0L 4TVPD 3L1OL 3VH8A 4EVNB 4TPRL 1CG9B 3G6JF 4UTBH 5HI3D 3SO3C 4CN1A 3QNZB 1HHJB 4R26L 3QFJD 4NJAL 3SGDH 5CGMA 4JFYB 3DROA 3QCTH 1BJ8A 2E8ZA 5D8JH 1S9XB 4RMQA 4QRQB 5F9OH 4QHMA 3Q6FA 5BV7L 1GZPA 4JCLA 3DJ9A 2C1PA 2AERT 4Z18A 3BIBX 3VRLE 4GAGH 2VTFA 5CP7B 4YDKH 5D2LF 3TIDB 4CU8A 5IV2A 5TE7L 5JR1H 1N8ZB 3HB3C 2BDNL 2EDWA 2J7LA 1H5BC 2IANA 4FNLL 3RDTA 5MEND 1JNLH 5HI4C 5HYQB 1AE6L 2FIKA 1OTTC 3ZTJG 2VN7A 5AWNH 5K9JL 4L4JA 5I1AA 5BRZD 3O3BB 3LAFA 5JOFA 4X9IA 4I2XA 1RFDL 3ARBB 4PJ5A 2NXZC 4Y4KA 1TDQA 1YY9C 1A4KA 2ENYA 3U36A 3I02A 3RUGF 1IC5L 2CQVA 4AK1A 4O2CB 2P24A 1QD0A 1IBGL 4G6ML 3QZWB 4YHPA 4FQLL 1EMTL 1TTGA 4CRPA 1B4JH 3V5HB 5I1GH 3KWWA 3CSGA 2ICEB 2HLFD 3MLZL 3V0WH 3BPCB 4XPAL 5D7JB 1FE8L 5C2UB 5TE6H 3A6CL 3IFOA 3PJSB 2EDDA 4ERSL 3K1DA 3O2VH 4FQJL 5EZLB 2AJXL 3U1SH 1ZGLB 1RZ7L 4OQTL 2EKSA 3BPLC 4JPWL 4XNXH 3MRHB 4PRPD 5DRXB 5E6IA 1BZ7B 3BPOC 1KCRH 2HLAA 3VFUB 3WV0A 4N1CA 3O4OB 3MUGA 4X4XB 2CJUH 1NC4A 4R7NB 4XXDA 1IGFH 2YUWA 3TJEH 3MCG1 3PWPE 1TVHA 3OAYH 43C9A 1QSVA 4IIQC 5FYKU 3ZHDA 5ETUA 5GS1A 1AFVL 4ZUUB 2IQAB 3MZTA 3VH8G 3JWDC 2XQBL 4LVOB 4E42A 2VLLB 2XKSA 1HXYA 3JTTA 1A14L 4MDJB 3CSPA 5C6TL 1AP2A 2ED8A 5CMAB 4R3SA 1YJDH 2DQCL 3TA3C 2ICWA 3F7VA 4HJJL 2C3XA 4HUUA 4JFEB 4F7PA 3I50H 4YHYC 3GMLA 1RVFH 4X0KA 5CZKA 2Z31C 4RMUA 3VGGA 5EIVA 1A6AB 3IDUA 1ZV5A 4FQPA 1OAQL 4S1RH 2L0DA 3PABB 4LSUL 3S36H 1MPAH 1JWUA 4X9GA 5B39A 4ONFH 3NABH 5IM7A 5MEOB 2BXZA 4NT6A 5F7UA 4XWGL 4Z7WE 3QIUA 5F6IB 2CRZA 3KPPB 1IGCL 5JHDB 4FXGB 3P9MB 4F7EA 3IDGB 2FWOA 3D3VD 3W0WD 1A0QH 3GJFB 3DVNA 4F9LC 4KQ3H 2DQJH 1XCTB 3VDAA 5IFAL 5CIPA 2A6KB 3KNBA 1FFPB 1BEYH 3B3IA 1A2YA 3UJTL 2PYFB 5HYJA 1RZ8B 4P9ML 2EDQA 3TT3H 1S7QA 3V0AC 4WENB 1MCCA 1KPUA 3SDDB 4I0PA 3E8UL 3ZKNC 1KTLA 3EYOA 2QQKL 1WBXA 1CN4A 1YMMB 4U6XA 1NUGA 3UZVB 2YZ1A 5DJXB 4M48H 3CFCL 4EN3C 5DZLA 1XF1A 1PYWB 2GT9B 2QSVA 3RWIA 3W9EB 4ZUSA 4KK5C 1DBAL 3P2TA 4TULH 3SCMA 2ADJB 1K8DA 4KRLB 5T1DL 4Y16A 3MV7E 1I1RA 3C5SB 3MOAL 4WFFE 1U8KB 2V6HA 5IF0B 2NX5A 1Z0NA 3BXNA 1KYOJ 1T1XB 1VDGA 4XMKH 3WO3B 4WW1A 4NQTA 3JXAA 4P2RE 4XPGH 4X8JB 1QNZH 5F7MC 3LVEA 4F9PA 3B4NA 4U1NA 1NBYB 2F5BH 4WIQA 4L3EE 1J0KA 1F3DJ 4HC1H 4JQVA 4GKZB 1OARH 3QEQA 4ZSOA 2K1MA 3FO1A 3KXFD 1NSNH 1AXIB 3FFDA 4MXVE 5D6CB 4HBQA 4K3JL 2J6EH 1E6OL 2P1YA 3RVUD 1KC5L 3DVGA 2VO5A 5L6YH 1J10A 3WE6B 4Q9RL 5ILTL 5C09A 4H0IA 4IOFD 4M1DH 4M6NL 3MNVB 2QLVB 1VKXA 1DBBH 2YBRB 3QEUA 1UZ6F 4HH9A 3MNZA 2APXA 1G0YR 2GK0A 4I9WD 4LVNB 4R0LC 1EPFA 2QSCH 1GIGH 1OB1B 1S5HA 3JTSB 4NIKB 4OLEA 1AIFB 5KTEH 4RMRA 4OQ1A 5DRZA 2CIIA 1A7PL 2NY5H 2ATPB 3J7HA 4PJ9A 1CE1L 2JJWA 5ID1B 3OJMB 5D2NB 5DJ0A 5KBNC 5T3ZE 2AK4A 1FYTE 4FQCH 1DQQB 4XI5C 3ULVC 3ARDB 2Z35B 1DQLH 1SYSB 5E8OA 1YY8A 3VD4A 5D1ZC 2HT3D 3P4OB 1LO2L 4XCCL 4U1LB 3H2WA 4LGRB 3ARRA 1QVOB 5MHSD 2CLZB 1WZ1H 2I07B 4KAQL 3FFCA 1SJXA 5EB9A 1U8HB 1MCOL 3L7FA 1M7XA 4LAQL 4JKLA 1XGRB 4KZEH 1CDBA 2JB5H 1Q0XL 3STBA 2FJGB 4MQSB 3OPZL 2OR8A 1AGFA 2NY0B 1S7SA 2CMRH 3T0VA 1F6AA 1OP5K 4N5EC 4TQEL 1CQKA 4HH8A 4Q6IA 4W4OA 5I8EB 4M5YL 3RVWC 1RZFL 5TPWH 3CZFB 3CSBA 4JO4L 1F5WA 4EXKA 4EZMA 1KCUL 2DM3A 5EU3A 2UYLA 3GSRA 1J8HD 1U42A 4M4PA 4JY4B 5CGTA 4PB0H 4GUPB 5CBEB 3T2OA 4PJCF 4YNYA 1F00I 1OAKL 2VLJD 1G7IB 5L2JA 4NQXB 1K2DA 3AFLA 4G6FD 5CCKH 1QSFD 3KPLA 2F54E 4YHMH 3ARFC 2Q3AA 4MZ3A 1BF8A 4PJXA 2EEDA 3BEVB 4IRSD 4P5MB 4W81A 5F72S 1S9WB 2A2QT 3A67L 2EXWD 1PG7L 3MBEA 3G9AB 5LAXA 2D4DA 4JLRA 4HEPG 4GKOA 4KK8D 3MNWA 3JWOL 5TF1L 4HFWA 1Q9KB 1WFNA 3G6DL 3CFBB 3CVHL 4CW1B 5CGYD 3KHOA 1E4WL 2CKBL 3LDBB 1DLHA 4L9LA 3CNKA 2VZ1A 5DTFA 4GG6E 1VGEL 3AB0B 1CXHA 5BZDA 2X40A 5EZIH 1NEZA 5L88L 3ZSTA 1PQZB 2DQIL 1RU9H 3FB8B 1TENA 4HPOL 3RUGA 2X4TB 1A47A 4UNTA 3WS6C 3JV4A 4OUOA 1A1NA 4K9EC 4BQ9A 4M3KB 4PY8J 2P8MB 2GYSA 4PGZA 1WGOA 2BERA 1DZBA 5DVKA 4JN1H 4DK3A 2DM2A 4TNWK 3WMSA 1DDHA 1HKLH 5CZVL 1U6AL 1UKQA 4YDVA 4HWZA 5FA3B 5L0QB 1NCTA 5AUMB 3F58H 5IEHB 4HC1A 2HT4D 1C5DB 3EIFA 3RA7L 3NH7L 1QRNE 4EDWH 1XGYL 3PGCB 4JKWA 3PWPB 3NA9L 4RGMB 4XC1H 1Y6NR 3MUZ1 1EUUA 2X4NB 2BFVH 1JJUA 5F6HI 5J7CC 4Y19A 4ZODA 1UADC 4LQFL 3SQOL 4DJMA 3NFSL 4CN6A 4IEFB 4OLWH 5FCUL 2ICWJ 4N5UA 4WU5B 4C56E 1AGCA 3S96A 3O3EB 2GI7A 1AGEA 3VFTB 1ORQB 1AD9B 2ZOLB 4K94H 5EC2B 3VW3L 1ADQL 4F58L 5GRZA 1KUMA 1E4XH 1OTSD 1TJHH 1BVLA 1T22A 4R2GD 2NX5D 1HHHA 4X5WB 4KKNA 2UZIH 4GRWF 1HILB 2DBLL 1IGJB 4Z7WB 4LPXA 3OF6A 4YWGL 3ALWA 3BZFB 3OGCB 3L7EB 4OD3H 5DHVH 3C6SB 5T5FH 1WCQA 2A6DA 4DWHA 4AMKL 6FABH 4M6OL 1Q9LB 2QQLL 2ZSWB 3AAZB 1AC0A 3B6SB 3LRSA 3I3EA 2WSKA 4X5XA 2VLKE 4HCRL 3IFNH 5ACZB 5FYJE 3T8XB 3QULA 5D7LA 2X89D 3MMEA 4ZNCD 1FGVH 4Y8AA 3CVIL 4KPHL 3PP3H 5FUZH 1EXUB 2PO6B 3C5JB 1IC1A 2W0LA 4F15B 2AJ3A 1LO4L 1UVQA 5C3TA 5EFIB 2VQ1B 5IW1B 4WHCA 4UQ2A 3ILPB 3VG0H 5JPNA 2FD6L 3WDJA 3IDJB 2GFBA 2Q86B 5HY9A 4JZNA 4FABL 5F1SA 2VB5A 4ZUWB 4N8PA 1RULH 2EYSA 2XICA 5DQJB 4DKEL 3MV7B 1HEZA 1G84A 4FG6C 3BZDA 1EUTA 2VSCA 1DBML 2NY4D 2ZJSL 2ARWA 4TUOB 3WO4C 2QR0B 2Q8BL 3O4LD 2DTML 1JE6A 5EUOA 5DD0H 2BSTB 1YN7A 2ZWLT 4L3EB 2V5RA 4KMTL 2V7HB 1GOFA 1P6AB 5DRNA 4XVUD 3CCHA 1FZKA 1P4BL 2IMNA 1XGUA 1U8QA 4GW5A 3L5WA 3UJIL 3OKDA 4QT5B 1EV2E 3RRQA 1FIEA 3VWKA 1T6WA 3I84A 4TYUA 2YPLE 3FO2B 2XQYK 3BAEL 1I7TA 1UJ3A 4HUMB 5IIEB 1S9KC 2O26U 1SMOA 4WGWB 5HJ3A 4Z5RB 2AXFA 5F1NA 4BQ6A 3C6LA 4RBPK 4X6CF 3S37X 5B8CC 5DJCB 4JZJA 4NNPL 3NCCB 3U82B 2G9HB 4HUVA 1TZIB 1BMGA 5DDHA 1LNUA 4LCCA 4KROB 4H1LA 5LCVH 1FYTB 5HGBA 1KFAH 3TPKA 2EECA 1CLYH 4JGJA 1X6NA 3PF2A 3KGRA 3WHE0 2ZUQB 1JV5A 1T3FA 3RX5A 3MLPA 3RWFB 4MCZA 5HYIA 2X70B 4OT1H 5DFVD 4YHOH 1CFSB 3RBSA 3STLA 4HIHB 5SV3A 3BSZL 2W0KA 5EZOH 3V6OC 2XY2A 4ZTPH 3BO8A 3CX5K 3QDMA 4RQQA 3GEWB 4FP8H 4MMZC 1MRFL 3EYQD 3IF1B 5C0AE 4AEHH 4Q9CA 5D70L 3OBAA 3QHTC 1X5YA 3QWOA 3RGVD 4ETQA 2NY6B 2D7MA 1P7HL 3MJ9H 4L8DA 4PV8B 2RCSH 4MNGB 4EVNA 1C08B 4G43B 1KB9K 3P73B 1CG9A 3GJFH 3KPRB 1MIML 2KH2B 1Y6KR 3QNZA 3VRLF 1FL3B 1DQMH 1RJYB 4RWYH 4ODUB 4JFYA 1LD9B 5DRWB 4HJ0D 3HRZB 1INDH 2DWEB 4QRQA 4NZRL 3ZKMC 3BKYH 1IKNA 1X5AA 3PWVB 2F54B 2HJKB 1CXKA 2CRYA 5JO5B 5DHVA 5SX4H 5AEAA 5CP7A 4I0CC 4LNVA 3TIDA 1CBVH 1LK2A 3OL2A 3DGCR 4G6JL 5I71C 5CEZL 4OCWL 1N8ZA 2QQNL 2J88L 1FL5B 3BI9X 4WEBH 3N1PC 3W9DB 4H0HB 2MTPA 5C0JA 1MEXL 5SX5H 3LPWA 4HDIB 7FABH 4RNRB 3TPUB 1GSMA 5GPRA 1N0XL 4FZEL 5HYQA 4QGTA 3O3BA 2RQ8A 4GG6B 3DYMA 2J4WL 5FIEA 5I73C 3ARBA 1RHHA 2B1AH 4G9DA 3ZZ1A 2VLRE 3WFCH 3BRFA 4X83A 3GSWB 3QZWA 1U3HA 2BX5A 1NBVH 4EJ1C 2NW3B 2B39A 4OTXL 3V5HA 3V52H 2WMPA 4G6AD 1NCUA 1U2CA 1OAXH 4GQPH 2ICEA 43CAB 5ALCL 1JYVA 1TITA 1YDPB 3BPCA 4XP6L 1PKQA 5D7JA 2P45B 4MX7B 2XACC 4FQHB 1WAAF 4NQEE 2UVFA 5DA0B 1F90H 1AR2A 3PJSA 2NY2D 5EZLA 1ZGLA 5GGVH 4U1GB 4JPVL 2FEDD 3BISA 3MRHA 2WWKT 1NCDH 3WJLA 1RMFL 5DRXA 5I16B 3T65B 1BZ7A 3VFUA 1AXTH 1Q9WB 1HCFX 1AHWB 4X4XA 4Y8DC 2HLFC 3WHXB 2R2BA 4R7NA 2Y23A 3E3QC 5TJWK 4ZFGL 4LVHC 4NUGH 3CFIC 1TZGL 2R2CA 2XRAH 1P2CB 3ZDZE 1ZGLP 1D6VH 3QO1B 1J5OL 4K7PH 4ZUUA 2OZ4A 1HQRB 3PNWB 2IQAA 4C56B 3S34L 2FR4B 4JO3H 5DQDH 1WF5A 2VXTL 3VA6A 2VLLA 1LP9F 4PJBF 4BZYA 5GS2D 4MDJA 5TF0A 4XC3H 3JUYA 1FZOA 3LEVL 1V05A 2MPAL 3DMMB 5CMAA 5MI0B 4Z7QE 4JFEA 5D1QC 4MB5A 4Q9BA 1IC4H 4LCWB 5D9SB 3QG6B 1MFAH 1HDMB 1A6AA 3T0ED 3PABA 2AGJH 5EU4A 3S97C 2XXCB 3BEWB 3REWB 5MEOA 4IMLB 3U30C 5DSCB 3BN9D 2VN4A 4L4VA 3KPPA 3SE4A 1T7YA 3MJ9A 1LE9B 4FXGA 1YYLL 5D96B 2FBJL 3IDGA 2VLKB 5BW7C 3MUJA 3SKJH 1YA5A 5E03A 1CGSH 3GJFA 4LCIL 1XCTA 1KNOB 5IVXE 1F13A 4O9HH 2YOCA 5HGDB 2A6KA 3U0TB 1MCJA 1FFPA 2PYFA 1RZ8A 4NN6B 3S37L 1G9MH 1E4KC 1EFXB 4CAGA 5E2TH 3UP1A 5MERB 4M93C 1JHKH 2XTJE 3WDIA 3GKWL 4AG4L 1O7VA 1SEQL 2QADD 4CDGC 3G08B 1A64A 4S0TD 3IJHB 3OAUL 5BS0B 3SBWC 5DJXA 3TO2A 4HKXA 4NO2B 3GO1H 4PLJD 1PYWA 3BT2H 2GT9A 3UPAA 3W9EA 3JWNC 2B20A 4U0RB 3E6FB 2ADJA 4KGJA 4M7ZC 3FN9A 1JNJA 2BVTA 3TIEB 1FAIH 3C5SA 5SWZE 1U8KA 4LOUD 1OSPH 4U05A 4WV1C 1T1XA 4MXVF 1FL6A 4HPYH 4X8JA 4EOWH 5JQ6H 4LLMB 1NBYA 3SE9L 4I13B 5HVHC 5I6XB 1RK0B 4GKZA 2VWEE 2YPLB 3D39E 1WBZB 5DD6B 5E95B 5B4MD 5DEFB 1U8PB 3DSNA 1XIWB 3HZYB 3MLRH 4PJHE 5F88B 4NN7B 5D6CA 4LRIA 4HF5L 4MDIB 4ODTH 4J4PC 1TTFA 2FX8H 4QCIA 3WE6A 3KDMB 5LGHL 3MNVA 5EBGA 2YBRA 3FQXB 5DMKB 3Q1SL 1BWWA 1OB1A 3JTSA 1M6OB 5C2BH 1AIFA 4EQ2A 3GRWL 5E8DH 2DMCA 4OV5B 2D7NA 3AMKA 5ID1A 5D2NA 5IBLC 2D0HA 2L4OA 5KVFH 2OL3H 1DQQA 1Z9LA 3VXTB 3ARDA 4JFHE 1SYSA 4YHZH 1PDKA 4EXPX 1JYXA 3P4OA 4ENED 2QKIA 4AJ0A 3IJSB 4L5FL 4NO5B 1QVOA 3DUSB 1SVCP 2CLZA 4DN3H 5C0AB 4XNYH 1R3HB 1YECL 5FYKD 4ZQKA 5C0CE 3V4PL 2DQHL 35C8L 4IDLA 1XGRA 3QPXH 4JY5H 4Z6AT 3CK0L 4IOIB 1W72H 1BM3H 1D9KB 4N68A 1YEGH 3WS3B 2FJGA 1R5IB 1NCCH 4WJ5B 3S88L 1JP5A 4X6EB 1D6EB 1X4YA 5KW9H 4AM0B 2BK8A 3BDYH 3BQUD 1UWGH 1RI8A 2VITA 4JE4B 1QYGH 5I8EA 4LP4A 1CE6B 4H5SB 3CZFA 5EU7E 4ALAH 2R0LL 4JY4A 3U7YL 1WC7B 4GUPA 1JFQL 1MFEH 4P46D 1DBKH 5DD1H 5CBEA 4OCXH 4XHQA 4NQXA 5KAQG 2YMXH 4NQSB 3UPRB 4ZXBD 5T1LB 3G5VB 3T3ME 3MA7B 5JW4Q 1KLFA 1SBSH 1S7VB 4H26B 4M9PA 1BGXL 3EW3B 3GNMH 4M61B 3BEVA 1EDQA 3GUTA 5A1AA 4GG6F 1HNGA 4F7TB 5IOPB 4NWUL 2WBJB 5E6ZA 4NHCH 3JSSA 4L8SB 2Y6SD 3GSNB 1F4YH 1Q9KA 3QWRA 2OMNA 3CFBA 3WLBB 2VLRB 3DXAE 5FKPB 2VDLL 3T2PA 3LS5H 4CVZB 5LKNA 2XV6B 3QQ9C 2EIEA 2F15A 2HJLB 4UQ3B 5IW6A 2JIXD 1PQZA 2HRLA 3FB8A 3BP4B 1X5XA 2DKUA 5DT1L 1JYWA 2X4TA 3NIFE 1MJUH 2XZAH 1CF8L 3MZGB 1YPZE 4WEUD 2P8MA 5HHQB 3EJZC 1I9JL 3NGBB 3BDBA 5IFHH 3KS0H 5CGYC 2BJML 2HFFB 1NH6A 5FA3A 5T3ZH 2AJYL 3V95A 5AUMA 2VDMH 1OM3L 1IAII 1SM3L 1JGUH 4MAUH 5IEHA 3MXVL 5JHDD 1C5DA 5IFJB 2J8OA 1OAZH 4UV7L 1BZQK 3TVMA 5IWLC 3WKML 4OFYA 1CD8A 2DQDL 3WXWL 3KLSA 3PGCA 1CL7I 1I8LC 3LHPL 3PWPA 3EHBC 4OLVL 1G9NL 4HIJB 5CD5C 2X10A 2X4NA 1DUZB 2E9BA 1OP5H 5FO7B 4PY7B 4N0YL 5EOQL 1ACYH 3A6BL 2YKLH 2GJ6D 2Y06H 4R8WH 3T2QA 3RBGA 3SDDD 5CILL 5KVEH 2ZNWA 1KELH 4J8RB 5KSAD 1YMMD 2HT4C 4WU5A 4R4ND 2YUZA 3O3EA 4HK3N 1ORQA 4CADB 1AD9A 2F8OA 4NN5C 4UDTB 1KCKA 5EC2A 2FNBA 1DQDL 4TSBL 1ZHKA 2CPCA 1P4IH 2R4SH 1NCBL 4E41D 1FCCA 4U7KA 2YWZA 3HCVA 1JN6B 4X5WA 5BO1L 4UI2A 3VFOB 1MRCH 1HILA 4KY1H 1IGJA 4Z7WA 3BZFA 3OGCA 3L7EA 4XVJH 5IROA 3QRFM 4XPTH 2RB8A 1Q9LA 3BE1H 4RGOL 4ODXB 3F65A 3AAZA 3R0NA 4GRLD 5IVXB 1OW0A 3DRTB 3B6SA 2DD8H 1M05B 4AQ1B 2AEPL 4HZAA 3OKLB 4R2GC 5ACZA 3FN3A 4P3WA 4JHZA 4LGPB 1JTPA 3CU7A 1N2RB 4AYFA 1EXUA 1QFWI 2PO6A 2ZUVA 5CHNB 4U31A 5E9DD 3C5JA 2BVUA 5EFIA 2VQ1A 5IW1A 1C1EL 3LQAC 3ILPA 1IEBB 3O6FD 3MJ7B 3IDJA 2Q86A 3QXTA 5GSRB 3RI5K 3QNYB 2P5WE 2R2EA 4ZUWA 3UBXB 5ITBH 2P42B 3GHEL 5DQJA 3MV7A 5D7IE 2D7PA 2XA3A 1MAMH 4TRPH 1NUDA 4I77H 4XMLH 1GJIA 1OD7A 4TUOA 2QR0A 3ZHKA 3Q3GB 1CTNA 1HINL 3BOVA 2FYYB 3MRCB 4G6KL 2BSTA 2F9BT 2R1YB 3VMOA 2XYCA 1QBLH 5AAMA 3ZKXB 4L3EA 3O8XB 3D39B 1QHOA 1A7BA 5JMOC 4PJHB 1V7MH 4NCC1 4QT5A 4JFDE 3U9PH 3SDYL 4XRCB 3BKCH 3FO2A 3IXTB 4HFUL 5GS3A 1QFHA 5BV7B 2HN7B 5IIEA 3B9KC 1FGNH 5CUSH 4X4MA 4OIBA 1UXSB 1QLEH 4Z5RA 3EDEA 1JPTH 3LV3B 4BK5A 5TGBB 1CGTA 1KPRB 5DJCA 2WUCH 1CL7L 4UTAH 2D4FA 2GAZB 5D72H 2G9HA 1TZIA 4XVUC 1U58B 1FYTA 1V3MA 5D71H 4D3CH 3O6KH 1ZKAA 4MNHB 1BFTA 2YZ8A 1NMAL 3QO0A 3RWFA 5CINL 5B3JF 2D7QA 4UT9L 2X70A 1OPGL 3TH4T 5C0CB 2C4XA 4HIHA 3L5XH 1ZAGA 1YEHL 4P2OC 1GHFH 3GMOA 4HXBH 5D6DC 5L9DL 4PS4L 2ZG1A 1R3IL 3IF1A 5K59E 4X7SL 4ZTOH 3DUHA 1T03L 4KZDL 4J7RA 5AZ2L 3NCFB 3G5YB 1QFUH 1CT8B 4G8GB 3DX6B 4EI5D 4PV8A 4G43A 3P73A 2F74B 5FYJH 3DX8B 3TN0B 4FS0A 4LHQB 1U93B 1FL3A 1RJYA 1CXIA 4RFNB 4ODUA 3TNMB 1REIA 3H9SB 2E7CA 3CH8A 3E1F1 3MRBB 4WI7A 3G04A 3HRZA 4WO4B 2X4PB 1JYNA 3NPSB 5D7SL 3ULUL 4C4KO 4KJWC 3S36X 2H2SC 4D0CB 2F54A 2HJKA 2BNUB 5T33L 5JO5A 3FQTB 3PL6D 3EYFB 4Y88A 1K8IB 1A3RL 2DYPB 3P9WB 2VR5A 4QWWD 4YK4C 1BP3B 4HHAB 1V7NH 3VG9B 1FL5A 3W9DA 5I1KH 3WUWB 2R9HD 4P5TC 3UMTA 2Q8AH 4O5LL 4HDIA 1MCFA 4RNRA 3TPUA 1A5FH 4PB9H 3H42H 3MLTB 3DXAB 4FFZH 1RSFA 4WW2B 1CGVA 3UXFA 4PGJA 5FFLA 4GG6A 1KIQB 4ZAKD 1KEML 5EN2B 3CH1B 4RBPH 4XWOC 5DC0A 3RTQB 2O5YL 2G5BB 3BH9B 5C7XL 2VZ3A 2NW3A 4ESKA 3M8OH 1GPOL 3VWJD 1YPZB 43CAA 2Z92B 3QHFL 1YDPA 3QDGE 5HHMD 25C8L 2CR6A 4Y1AE 2DLGA 4G8EB 3O2WL 2V7NB 4ZD3H 1J1OL 3GBNH 4XXCC 4MX7A 4FQHA 1CGWA 4DTGL 3KLDA 5ACMA 5I74B 2AI0L 2WK2A 1MCEA 3LH2L 4CVUA 1QSEE 2N1KA 4PBWD 1QRNA 3HI5H 3QRGH 1A22B 1YC7A 1NGYB 4QRPE 5I16A 4LDEB 2E8YA 2HRPH 4OCSH 3AM8A 3T65A 3ZDZF 3WNMA 4POZD 3BGMB 1Q9WA 4GOSA 2ESVD 4P59L 1AHWA 5CBAB 1NGQH 2FLBT 3WHXA 1DQTA 1TQCB 2G60H 4UTBL 1JBJA 1TCRA 4HGMA 3THMH 2ORBL 3N50A 2ZUSA 2W91A 5FV2A 1P2CA 3QO1A 1C7SA 2R0ZL 4U7SA 3I2CH 1HQRA 3L3OB 4AQOA 3PNWA 5D8JL 5IHUH 4C56A 2FR4A 5JDSB 1F58H 1KBGH 5TFSL 4GAGL 4P4KD 1HN1A 4HWUA 5LG1A 5JR1L 3DMMA 2D0GA 5CEXA 3D0LB 4ZS6D 3SJVD 4D8PB 3GKZA 2VDOH 1GGCL 3Q6GH 4FMFA 4GBXB 4PTTB 4X6FB 5AZEH 1TVDA 1DANT 4NC2B 3QG6A 5D9SA 4GQ9H 3CMGA 1HDMA 5F8RC 5T1KB 5JOPD 2LAGB 1OWRM 1LO3H 4LL9A 3QDJD 4PTUB 1JNLL 3TF7C 2IPTH 2BY1A 4YXHH 4K3DH 5AWNL 3BEWA 2LU3A 3REWA 1CDCA 4IMLA 5IHZA 3NTCL 4LPVA 1LE9A 1L6ZA 1Z6JT 2VLKA 4G9FE 1QBML 1K3ZA 5IBUG 5IJKA 5INCB 3UO1H 1KNOA 3DETD 1I1AD 3MQIA 5DO2D 5HGDA 3U0TA 3UZQA 4WCYH 3V0WL 1UA6L 3SDAD 4CUCA 4PJ7F 5TE6L 3V6ZB 1NMCB 1YEKH 2XZQH 3LMJH 1EFXA 1GOGA 3VXME 5IG7A 5B3NA 3EFFA 5MERA 2P5WB 1G7JA 2HAZA 3U1SL 3IJHA 4XNXL 5D7IB 5BS0A 3SO3B 5LGKA 1DFBL 3C2AL 3ABZA 4NO2A 1T89C 5J1SC 1G9EA 3CFDB 2NZ9D 4U49A 1N6QH 3E6FA 1P7QD 2R4RH 3TIEA 4GT7A 4DN4L 4JFFD 4F7CB 4QY8B 1FFNB 2OXGA 2X4UB 2DKMA 2Z8RA 4P9HH 1CFBA 4LLMA 4JFDB 2V5YA 2LQRA 2JE8A 3OKKA 5GISH 1RK0A 3WNKA 2YPLA 4HKJB 3F7YB 3PP4H 3N9GL 3DI3B 1WBZA 5DD6A 4RZCB 5DEFA 1U8PA 5T1MB 1XIWA 2BRQA 3HZYA 5F88A 5LXGH 3KPRD 1FVDB 3KS0J 1RZGB 4HG4J 2H26A 4ORGB 4TUKH 2YD5A 1JVKA 1OGTA 4PJFE 4UILH 4ZFZB 4MDIA 1CFNB 4UT7H 4LOUC 1YJDL 3B2UD 4OZHF 4H0GA 1DEEB 3FTGB 4XT1C 1WFUA 3NCMA 5DJAB 1FP5A 1LILA 1NLDH 2PF6A 3D25B 1KCVL 3T0BA 5DMKA 2FJHB 4J3VA 3TYGL 3UTQB 4KKAD 1M6OA 2Y07H 3QQ3B 4ONFL 3HG1D 5GRJL 2Q3ZA 4OV5A 5CSGA 2AEIT 2MSPA 1IQDB 3B8SA 4X80L 3WFEL 5B4MC 2R56H 5IHBA 3KHQA 3LN5A 1GC1H 1HKFA 4Z7OE 3QUMB 3HZMB 3VXTA 3K1KC 1T2QL 1QUNA 2FL5B 5BZWB 2YD6A 4XPFH 1YNTB 3IJSA 4KQ3L 3MV8E 5HGHB 4NO5A 1ZLWK 1WV7T 2RJMA 3DUSA 1IC7L 5C0AA 1R3HA 3BPLB 2C3VB 1IGYB 2JELH 3GMNB 2YHGA 1X5GA 2PTUA 3BPOB 4XAWH 4ZPTB 3ZT7A 4DUVA 5EWIL 4IOIA 3ZE2E 4KC3B 1QRKA 1D9KA 1Y0LB 2BSSA 4AZ8A 2EDHA 3RY6A 1YQVH 2JJSC 2W9DH 3WS3A 4WJ5A 3UYOD 1KPVB 4X6EA 3P0YL 4Y4FD 2F53E 2MKWA 4AM0A 3CFEB 4M48L 1KGCD 4HAFA 1FNSH 3K7UA 3T3MF 4H5SA 4IIQB 1VA9A 1INEL 4G8IB 4WUUD 5HGGS 2VRAA 1HHGB 4S1QH 3TBTA 1WC7A 4XMKL 3C9NB 4YUEH 4XPGL 4HX1B 1WWWX 3MTRA 4NQSA 3UPRA 3WEXB 5T1LA 3G5VA 5HGAB 4L9DA 5DMGC 3CLFH 1S7VA 1X5JA 4H26A 3ZDXE 6CGTA 3MLVH 2P8PB 4NQVB 4UT6L 4KKBC 2VDNL 4PRBB 4YHYB 3BQUC 1ZT1B 2R8SH 4LSVL 4M61A 2XQYG 1NSNL 5HPOA 1X5LA 1KIUA 1JGLH 1FCGA 3EAKA 4PRIE 2WBJA 4BZ1L 5IOPA 1A6WL 2P46B 3GSNA 3UC0H 4J3SA 4YDIL 4TPRH 4M1DL 4X7DC 4X7EC 3WLBA 1NC2B 2VLRA 1UKSA 3MRMB 5FKPA 4CVZA 3NCBB 5FAAA 4NJAH 1JUFB 5KTEL 2HJLA 4UQ3A 4IS6B 2NY5L 2UZXB 5IW3A 1OP3K 5C0BE 1JWSB 3LKSB 4FTVE 4FXKB 4Y1AB 3DV4B 3BP4A 4UIMA 5BV7H 1BFVH 5E7BA 2M1KA 4CKVX 4LCWD 4NQEA 4P57B 5TE4H 5HHQA 1QSEB 1DN2A 2Y5TB 3NIGE 4F33B 3D85B 3QBTB 4KRMB 4QRPB 3QI9B 2HFFA 2BDNH 1A21A 4Y5YC 4APQC 1IJ9A 4KH2A 5ISZE 4FNLH 4KZEL 5DD3L 4G80B 3FB7B 2Q20A 5L2KE 4KK9C 2DS4A 4HJGB 2DWDB 4MHHG 5K9JH 1VEOA 1JF6A 1KIPB 2CMRL 3IDMB 4HIJA 1UH3A 1RFDH 5EORL 4RAUB 1NAMB 1IC5H 5FO7A 4LHUG 2ILLA 2P47B 1IBGH 2YD9A 4F57H 4G6MH 4FQLH 5JNYB 1GCFA 1TETH 4KUZL 4OLUL 5BVPL 5I76B 4M1GL 4J8RA 3EO1B 3MLZH 3T4AB 2EC8A 4XPAH 2VQUA 3GJEB 1FE8H 2EH7L 1QKZL 2NZIA 3D5OF 4QHKI 5LWYL 1JPFB 4MD0B 2ZUTA 4CADA 3ZYIA 4UDTA 5ICXB 2YXFA 2V2WB 4ERSH 2CUIA 4JPKH 2BNQD 4YHML 1YEDA 4OQTH 4O4YL 4JPWH 2C26A 1JN6A 4HIEB 4R0LB 1D5ZB 3ULSB 3WFHB 4MXQD 5HHOB 2WQRA 3OKNB 3OSKA 1UXWB 4JN2B 1VSCA 4FQIH 3TLRA 3QUZD 3RI5F 1OCWL 2QL1A 2FEEI 2Y36L 4ODXA 3TFKD 1TLKA 4J6RL 3T1FB 5IVXA 1AFVH 2VISB 3DRTA 2EDJA 3DRQB 4WTWA 4RGND 1M05A 1HSAB 4K2UL 4M7JL 3OKLA 1RU9L 3QUXA 2IJ0C 2XQBH 5TQ0L 4NBZB 5A2KH 1N2RA 3VXMB 4Q9QL 2XN9E 2MQ3A 1A14H 3EDJA 5CHNA 2F8XC 5C6TH 2AABH 3JVGA 3PWLB 4JN1L 3AC0A 1IEBA 4PG9B 3CPLA 2DQCH 2K7PA 3NPZB 4YE4L 3MJ7A 4MD4B 2H32B 1ZT4B 3X13B 5JZ7D 3S7GA 5GSRA 1T2JA 3QNYA 3SE3A 4OUUB 4I3SL 4LSRH 3F58L 1OAQH 5J6GB 3P4LA 3CC5B 4KJQD 4U6TA 1N5YL 2YC1B 2VR4A 1L9MA 5I19H 3MRCA 1IGCH 3SKNB 2R1YA 1SQ2N 5I2IB 5EDXA 2DIBA 3AS1A 3O8XA 4WVRA 2QHLA 1RZKC 3D39A 3GSVA 1FFQA 1CGUA 4JKKA 5IFAH 1QZ1A 3ARFB 4PJHA 4WTZA 3KPSE 2VE6A 4TVPE 3ZT6A 1DJSA 4PJFB 4Q97A 4XRCA 4CMMB 3IXTA 2HFEB 4I5BB 1R24A 3QFJE 1B2WH 2A6IB 2HN7A 2Y25A 2BVEA 3E8UH 4J1UB 1IT9H 4JM2F 4PRAB 2QQKH 1RY7B 1X5FA 3HR6A 1UXSA 2PTVA 1LWRA 2ZCLH 5EIIB 3LV3A 5TGBA 1S78C 4NDMB 3CFCH 1KPRA 3BKML 4KTYA 1I1FB 3WIIL 4WWKC 1DBAH 5J8OA 4K8RD 1U58A 3QG7H 4MLIA 5T1LD 5T1DH 3C8DA 3MOAH 5GGRB 3DX7B 4OD3L 1KB9J 5SWSD 4DFHA 2AEWA 6FABL 3ARGD 4OIAA 5K59F 1VESA 1VENA 1N59B 4J3XA 1XAUA 4B5EA 5FYLD 4EBQH 5MENE 5C0CA 3VXOA 1Q72L 3SEPA 5M94B 3IFNL 3OKEB 5CSZA 3V7MA 5SX4I 3HE7D 5JW4M 5BRZE 1FGVL 3BWUC 4K7PX 3UTTB 4S1DD 2YEZB 2EE3A 2BZDA 2FRGP 3HE6C 1T7WA 2F53B 4AT6B 3G5YA 1CT8A 4G8GA 2NY3D 5ILTH 4LBEB 3SE8L 3DX6A 3HNVL 1EO7A 3D6GA 2F74A 3DX8A 1J87A 4DQOH 3WJJC 1RULL 1KLGB 1ED3A 4Q58C 4OQTA 2V2TB 2AXHA 3TNMA 1CE1H 1F4WH 2OQJB 3QCVH 2FEEL 4WO4A 3QUYD 1BFOB 4JDVB 3LEXB 5DD0L 2WWMD 2FSEB 5DD5H 1VADB 3SGJA 1LO2H 3EDFA 1M7IB 4MNQB 3FQTA 1F8TH 2W92A 1K8IA 3UAJC 2DYPA 4I4WB 1T1YB 4KAQH 5T3XD 2OTUB 3U4EB 2XY1A 2IBGA 3GI9L 1MCOH 5DMIH 1UC6A 4LAQH 4X6DF 3WUWA 2MMXA 3Q48A 4IRJB 4PRIB 1ITBB 5IP4A 5IJVB 2EKJA 4NC0B 1Q0XH 4TNVK 5K9QI 2DN7A 2N56A 3DXAA 1WBYB 3ZHLA 3BD5A 2DF3A 4WW2A 5C86A 4H88L 1KIQA 2DBJA 4OM0H 1G9NC 3O41B 5EN2A 4M5YH 2OZ4L 2VUYA 3CH1A 2G5BA 4JO4H 5GJTL 3BH9A 3R0MA 4XB7A 1KCUH 2VDPH 4QWWC 1NGPH 5LCVL 3LSOB 1T0PB 2R9HC 3RWCB 2VXQL 4M8VA 1YPZA 4P2QD 2Z92A 3FQNB 1OAKH 2XIDA 3VFGH 3FZUD 2Z0BA 3OJVC 4L3AA 5HYSG 1C12B 4G8EA 3TGXA 2V7NA 3RPKA 3WIHL 1XGPB 4IJ3C 4DGVH 5DUBB 3OKYA 5AG9A 4YHOL 2B0SH 1SYVB 1LDSA 4F37F 5EZOL 4POUB 4U0QB 2VH5L 5ISZB 5EU5B 3SHSA 1C8PA 1NCAH 2X42A 3FAWA 3A67H 1PG7H 5L2KB 1NGYA 1L6XA 1EHLH 3JWOH 1C7TA 4O2EB 3D3VE 5E1AA 5TF1H 5CBAA 3VWJC 3G6DH 2BNRE 3CVHH 3MA9H 3WO4B 1E4WH 3QJHB 2CKBH 3FHAA 4MA8L 2VXVL 1DBJL 4GMSL 1HH9B 2WINA 5D7KD 1EEUA 1IM9B 1NGZB 3CDFA 4D0BB 3LQMA 1VGEH 1DQML 2V17L 3TEUA 4OGYL 4RWYL 2WBKA 1O0VA 1HK6A 3O9WD 5L88H 2DQIH 2PXYD 1U41A 3L3OA 2Q76A 3UROR 3EYUL 4W6XB 4POZC 5JDSA 4FQXD 4AEIL 4NCC2 4DVRH 5F93C 5CZVH 1CBVL 1X3DA 4JANB 1M7DB 3VD5A 3D0LA 1H9VA 4D8PA 4X9FA 4GBXA 1IGTB 4PTTA 4X6FA 1L7IH 3C60B 2X9YA 3RA7H 2W0PA 2I27N 5T1KA 7FABL 4BH7B 4MQXD 1H3PH 5FGCE 1XGYH 3TO4C 12E8L 3KPOB 3NA9H 5JXED 1T83A 2GW5A 3IJYB 1Q94B 5FYJU 2N7AA 4JRXD 1LHZA 5E8PB 3MLWL 3LKOB 4Y4HD 1JI2A 1N6UA 4PLOB 3KXFE 3ZE0E 2YXMA 1I3UA 3SQOH 3WFCL 3NFSH 2LFGA 1FNAA 5SWQB 4ZS6C 4LCYB 5FCUH 3V52L 2XN9B 1ONQB 1XR9B 3RZCB 3EGSB 4I9WE 3V6ZA 5JIIA 1AQKL 3KLAB 3V8CA 4TSCL 3SDCB 4B41A 3VW3H 2P5WA 2NR6D 3ARQA 3MYJB 5DJ8B 4JRYB 2NLJB 5GGVL 3WDHA 4KI5C 4JG1L 5D7IA 1JZ7A 1A1OB 3K74B 3K8LA 5EO0B 3T3PF 3CFDA 1I1AC 1A02N 5DO2C 1X5IA 3T4YB 1K9TA 5MHSE 4F7CA 4AMKH 4M6OH 4YIQB 2HTKC 4QY8A 2EDBA 5LBSL 1FFNA 1V3KA 1VFMA 4BQCA 3AS3A 1D6VL 4BYHA 1E27B 2JK5B 5C07D 4JFDA 3WUZA 3RPIB 2APWA 1U8NA 4XTRD 4HKJA 3F7YA 4PRDB 4UNUA 5KZCD 3CVIH 4JO3L 3U2SB 3QFJB 3CFKB 4RZCA 3S9DB 2H41A 5T1MA 3TN0D 1FVDA 1LO4H 1P69B 3BZ4A 1RZGA 3ZE1E 1SHMA 4XC3L 5JORA 4ZFZA 2FD6H 1CFNA 1NAMH 3INUL 5FM5O 4Y4KC 3H9SD 4FABH 1DEEA 1MOEA 3ULUE 1A9BB 3FTGA 1J8HE 4JREC 5CLWA 4M02A 1UH2A 5DJAA 2EXYC 2JJUA 4WO4D 1MFAL 2I26N 3GMMB 4NNYB 3EFDL 2DTSA 2FJHA 4DKEH 4NC1E 2VLJE 2WQ8A 1E28B 1AGDB 2ZJSH 3GDBA 2AGJL 3ISWA 3QQ3A 4H20L 3PE9A 4DUWA 1IQDA 2Q8BH 3IAGC 2W38A 3BZEB 1HE7A 3QUMA 3QWQB 3HZMA 3CVHA 3IXAB 4JAMB 2FL5A 4JQIH 4KMTH 4LRNL 5BZWA 3KPMB 3FOMB 3MACL 2IF7A 1RUMH 2CK0H 5BRZB 1NFIB 4KJPC 1YNTA 5HGHA 4OI8A 1B4RA 2VDKH 3MRLA 4HWBL 3VGEA 2CIKB 5E6IC 4YDLB 2C3VA 1IGYA 2IQ9L 4KKAC 4CMHB 3OXSB 2E7LA 3JUZA 3BAEH 3GMNA 1N0LA 3U0PA 4AIOA 4ZPTA 3RTQD 3RVTD 5E2TL 2JB6B 1Y0LA 3WNNA 1JHKL 2A6JB 2LV4A 1RIUL 1KPVA 1MVUB 1FFOB 3EOBB 4LVHB 4NNPH 4D2NA 1FNHA 1IARB 4WNQB 1CFVH 4MA3B 1JTOA 3BT2L 5JQHC 3EKCA 2NPLX 1F45A 3K46A 3NVQA 3UYPA 4G8IA 3QJFA 3HUJE 4XNZC 4PRPB 1HHGA 5CJ8A 3ZKSD 2IEPA 2W60B 4KJYA 1YEFH 1FNGB 3C9NA 4I0KA 4HX1A 1MHEB 4Y2DD 1DANU 3WEXA 5JQ6L 5HGAA 3CU1A 2HFTA 3BSZH 4Y4FC 5DK3A 4JFQB 4HUKB 2P8PA 4NQVA 5D1QB 1ZVSB 4CGTA 4UZGA 4YDJB 4GAYB 1MRFH 5GRXG 4PG2C 4LSPL 1G6VK 3QIUC 1HH6B 1ZTXL 3EOYG 3SDXB 3U30B 3VFRB 1MIMH 1NQBA 2P5ED 3MRMA 4Z8FL 4YC2B 1JUFA 4PP1C 3VFNB 1KJVB 5CP3H 4KTEL 4XPBL 4IS6A 3VGAB 2NMSA 1JWSA 4FXKA 4Y1AA 4L1HA 3DV4A 4NZRH 5KVFL 1U36A 2NX5E 4YHZL 4I0PC 2X5PA 4P57A 3HZKB 1JZ5A 2AJVL 1H0DB 1YEIH 1A7NL 1QSEA 4M93B 3MYZA 4G6JH 2Y5TA 3T0AA 3PQYB 4F33A 3D85A 2QQNH 4QRPA 2J88H 3QI9A 3QXWA 1ZLWH 2EDFA 1MEXH 1OAYL 2YS4A 3D3VB 3W0WB 4UAOC 3SCMC 1R0AL 5ESAA 3QEGL 1Y6MR 4G80A 4HMDA 3FB7A 1BM3L 3L3IB 4HJGA 2DWDA 1NCCL 4YZFF 1KIPA 3IDMA 3TJHD 4PY8I 4LAJH 3WNLA 2YA1A 4WV1B 4DK6A 5IT2L 1GRWA 2BP3A 2HTLD 4RAUA 4F9PC 1NAMA 1NUNB 1QYGL 4JQVC 2C5DC 5F9DC 3F7PC 1BHGA 1RIVL 3HI1A 4ALAL 5C8JB 4FFWD 4OTXH 4I18C 5J9PB 5HVHB 2IAMD 3T4AA 3EO1A 1RZIB 4XP6H 3K4DA 5HI5D 1ZLUK 3CXDL 3FT2B 3SY0B 5FHAL 2YMXL 3ROOB 5FM8A 3NIDE 1JPFA 4MD0A 1KB5L 5ICXA 2V2WA 4J2XA 4LSTH 4JPVH 5FGCB 3FRPA 3O4LE 1RMFH 1D5ZA 4PJ9C 3ULSA 3VXPA 3L3GB 3WFHA 4HWEH 2QV2A 4NHCL 1VFAB 1N26A 3UJJL 4N0FB 3OKNA 3MODH 4GKSB 3KXFB 1N6VA 1UXWA 4ZFGH 4BH8B 4JN2A 2VERN 3HB3D 1TZGH 5I1CL 3EO9H 2Y9RT 3LS5L 1MJ8L 1J5OH 3VXNB 2AKRB 1BPVA 5FUCC 3T1FA 2VISA 5E4IA 3DRQA 5HI4D 4O51B 2XWBA 1LE5A 5E2WL 5J11C 1HSAA 1OP3H 1OTTD 2VXTH 4XVTH 3VXMA 4MXQC 2BVYA 2NXZD 1YY9D 3BD4A 4GW1B 5E7FA 3LEVH 2MPAH 3PWLA 5IMMB 1PLGL 4PG9A 1K4CB 4MD4A 2H32A 3MROA 1YJDC 1ZT4A 2B1HL 4W4OC 3X13A 2PW1B 2XXMB 5C0EB 1MSPA 2VDML 3DGGB 2KZWA 4OUUA 2XT1B 4LPWA 3U48A 4MAUL 4LLDB 5FKAA 4L8BB 5J6GA 4RGNC 1Z5LB 3KYMB 4R9HA 2AXGB 5I1IL 3CC5A 3ARUA 2YC1A 2KKQA 3SKNA 1YYLH 3PWNB 1EVUA 2FBJH 4V1DD 5I2IA 1YZZA 2QSQA 1ACYL 4LCIH 2LTQB 3S3SA 3ARFA 3ARWA 3MBEC 4JHWL 4ZG1A 2BVPB 3QIBD 5A43C 4PJFA 3PV7A 4W70A 4CMMA 4MS8C 4AENA 2HFEA 1FLRL 4I5BA 4KJQC 5FGBC 5IHLB 2A6IA 4J1UA 3GKWH 1QACA 2MOVA 1NGXB 4PRAA 4AG4H 1SEQH 4L9LC 3H3PL 3SKMB 3OAUH 5EIIA 2X7LB 4NDMA 1LEKB 4G6FB 1I1FA 3IAQA 2B5IC 1S7RB 1QSFB 2AV1B 4KY1L 4W4NA 5I9QB 3HNTH 2H45A 3NCJH 3P3YA 3W5MA 2HMIC 4IRSB 5GGRA 3TA3D 5EULV 3FRPG 4PJ8A 5FGRA 2Z31D 3WS6A 1EGJH 3MV8A 1N59A 2DD8L 3SE9H 1C5BL 2B8OT 3OKEA 4HUWB 3IDNB 3FO0L 1NC2D 4IMKA 4M6AA 1GGBH 3NACL 4K8RC 3VRIB 1ZMYA 3UTTA 4OIIL 2BVOB 2YEZA 2ZOKB 4QXUL 2F53A 4AT6A 5IB1B 1K3IA 4LBEA 5DC9B 4WY7L 3V9FA 3ARGC 4XX1E 4MLSA 5F1OB 4CVXB 1KLGA 3AUVA 4FQ2L 3CMOL 3HUJB 2V2TA 2GSIB 3FKUS 4I77L 4TNVF 2OQJA 3HE7C 2RHEA 2NY5C 4R4BB 1J11A 4EUPB 1BF2A 2XZZA 1BFOA 4JDVA 3SO5A 2FSEA 2P43B 1VADA 1L9NA 4EN3D 1A9EB 2NY3C 1QPXA 4RIRB 4I4WA 4LARH 1T1YA 4JPIB 2OTUA 1VGKB 4PGEB 1YECH 3U4EA 1B6UA 5A16B 35C8H 3R8BB 3CLEH 4IRJA 4PRIA 1IILE 1DCLA 1UWXK 3M17B 5ESQB 3P77B 3TT1H 3S88H 4NPYB 1WBYA 1OWWA 3EZJB 3PHOB 2WWMC 2CXGA 4NYLB 5C9KA 4N0UE 3O41A 3EJJX 2WUCL 5F89B 5C0BA 5A2FA 4FTVA 4GH7B 5D72L 3IDYB 3BH8B 1XF3A 2R0LH 4P2RD 5DJDB 3LSOA 5D71L 4R2GB 4Z76B 5AYUL 5KVGH 3O6KL 1JFQH 2K7QA 3X12B 1RZJL 5F71A 4P5KB 1C12A 2QHRL 1ITCA 4LGSB 4C55A 3FAXA 3U83A 2FX7L 5DJYB 5DUBA 3T0EE 4BUHA 1I85C 2M8XA 2G5RA 3MLXH 4LSDA 1SYVA 1O5DT 5HHOD 2JJTA 3VXRD 2C3GA 4MJ5B 5ISZA 4X7CC 5EU5A 1E0OB 4XI5D 4E5XB 5L2KA 3MJ8B 4KDVA 2ADFL 3NMEA 1UFUA 4NWUH 3B43A 5GS0D 4O2EA 5D1ZD 4N8VB 3VRJB 3ET9F 1PG7W 3QJHA 1C16A 2VDLH 5FYJL 1HH9A 4D0BA 1ACZA 1NGZA 3RAJL 3VFWB 1R5WB 2PW2B 5E70A 4YBLC 2A9NL 1JL8A 3S4SG 3L3DB 3WBDA 4MJ4A 3HHRB 3S5LA 4Z7VE 3VWKC 2WANA 3ZSSA 2PUQT 4G8FA 5F7DB 5DT1H 4KKCC 3KJ4C 1CF8H 2NY4B 1IL1B 3ROLA 3RVWD 2DICA 1TQBC 1I9JH 3C08H 3B9KB 3BIAX 2BJMH 3O4LB 1M7DA 4JANA 1EGJA 4JZJC 3MX0A 1RJCA 2AJYH 1IEAB 4KRPC 1IGTA 1V7NL 3RNKB 1SM3H 5ID0B 1P1ZB 1BD2D 3C60A 1KACB 4LCCC 3ZE0F 1JGDA 5CKGA 4BH7A 4PB9L 3H42L 3WKMH 3WXWH 3LHPH 4HZLA 3OAZH 1YEEL 5F7EL 1HHIA 1T7XA 2N7BA 2YK1L 1Q94A 2IFFL 1I3RB 3LKOA 3NFPA 1JTTA 4N0YH 5EOQH 4LSQL 5F6HJ 3A6BH 5SWQA 3AU1B 5E08H 4LCYA 3K4ZA 5CILH 2XN9A 3EYSL 1EAPB 5I18H 1ONQA 1A6TB 4MQXC 4ZD3L 3RZCA 3EGSA 4MJID 3KLAA 4YFDB 1X4XA 3SDCA 3VGFA 1UCTA 1DQDH 3MYJA 4NP4L 4K94C 5DJ8A 1NCBH 2RIKA 3LN9A 3KLHC 3F62A 5BO1H 1A1OA 5FXCH 5CEYB 1XCQB 5I8KL 4WUKL 3T4YA 4XPHH 1IKNC 5E8EB 3C5ZD 4X4YB 4MJ2A 4YIQA 4RGOH 2LU7A 5FYKE 3RGVB 3ZE1F 3BJLA 3S8WA 3KPSA 2RAMA 2DJSA 2JK5A 2AEPH 2F19L 5A2IH 3Q5OA 3ULUF 1NFKA 3K2UH 4XAKD 3RPIA 2NQCA 5IHUL 4OLZH 1XF4B 4IRZL 5F7WC 3U2SA 3FB5B 3CFKA 2BCKB 3QFJA 5GHWL 9CGTA 4XMPH 5JTWA 3S5LG 4HAGA 2IGFL 3QFDB 2XA8H 1I3GH 1A9BA 3J8F7 2VDOL 5AZEL 1T20B 1WEJL 2FHCA 3GMMA 4NNYA 1U3HC 3NN8B 5F3BB 4TSAH 1NFDE 2FH6A 2QBWA 4LFHG 3FQWB 2Q7NA 5IUSA 2IPTL 4MNQD 4YXHL 4XTRC 4M7KH 3WXVL 1BJMA 4NZDA 5D7JC 5FDWB 4FQ1H 3HTLX 1HINH 4G6KH 1WT5A 5MENA 3IXAA 4JAMA 5LQBL 3KPMA 4ONHB 2YSSB 4XBEH 5BRZA 1NFIA 3MGTB 3UO1L 2BHYA 4ACPA 1D5BB 4LP5A 4F2MB 2X9XA 3WJLC 2ERJB 5FB8B 1MCIA 1CDIA 3UBXI 3SDYH 3GSNL 1F4XH 3GHBL 3O4OC 1PAMA 3LMJL 4QRSB 1IAIH 3H9YA 2ZCKL 1L0QA 2A6JA 2EYTB 1MVUA 1FFOA 3EOBA 4NO0D 2A83A 2NTSP 1CL7H 3GSXA 2CSPA 3F12B 2LE9A 3OKOB 4QRTB 4WNQA 4MA3A 1GZQB 2D9CA 2NY2B 1LEGB 1ZLVK 2DLIA 1IM3B 3HMWH 5D5MB 3OHXB 4NHUB 4PRPA 2E9JA 3FOLB 2ITCB 3ILQC 1FNGA 3BWAB 3RVTC 1NMAH 1MHEA 1KTKE 5CINH 4P9HL 1QP1A 5JHDE 4Z77B 4FG6D 1CXEA 3SQBA 2VDRL 5F9JB 4JFQA 1X5KA 1YEHH 1FYHB 2CLRB 4NRYA 4RX4D 4WFGD 2ZSVA 1ZVSA 2GHWB 4HLJA 5L9DH 1I9IL 1HHKB 1YEJL 4LDOB 4PS4H 1R3IH 4YDJA 5FV1L 3B9EA 5T3XL 3UTOA 2IWGA 1MIEH 5LXGL 4X7SH 1IM9D 1WZMA 4KZDH 1V8HA 1X5HA 3MUY1 4PJEE 3ES6B 4OFVA 1HH6A 4N0UB 3SDXA 1CLCA 1KG0B 2GJ6E 3PWUA 1EJOL 3VFRA 1NLDL 4Y2DC 1YMME 1A6PA 4S1SH 5IVZA 3HKFA 3VFNA 1KJVA 5EBLA 2VR9A 5DHYB 2Y07L 5J4MA 1F6FB 4MB3A 5E94B 3F5WB 4PRNB 1CD1B 3KR3L 3LS4L 4HGWB 5D7SH 3ULUH 2GKIA 3RZWA 4E41E 5F70A 1MAKA 1TZHA 4CJ1A 5C0NC 3T0EB 1E4KA 1VEMA 3HZKA 4TTDD 1H0DA 1A3RH 2HFGL 4XPFL 3RGHA 1QFWH 4U1IB 2WUBL 1BVKB 1MLBB 4BA8A 2D03L 4PJDE 5C70A 3D3VA 3VXUD 3W0WA 4TTGA 1QOKA 5C08D 4AL8L 2W9DL 4Q0XH 3L3IA 3Q5TA 4WV1A 2ADGA 4J23A 3WYRA 5JMRA 5C7XH 1EO8L 5E9DE 5C8JA 2QADB 2EIZB 1T4KB 5J9PA 1GPOH 1B0GB 4N0CC 1S7XA 3MFGB 3QHFH 1RZIA 4JRYD 25C8H 1PSKL 3LCYA 3O2WH 1EEQA 4YUEL 3FT2A 3SY0A 3ROOA 4DTGH 4LDLB 5KS9E 2NNAA 4N9OB 3LH2H 3TJHC 4JFOB 1YN6A 1ZLSL 2Q1EA 2XZCL 4LVNC 2HTLC 3VXSB 2R8SL 2F5AL 2Q87A 5EUKB 2P49B 4LHUD 1MCLA 1T80A 1JGLL 1CIDA 1H3XA 2ARJB 2DL2A 3HR5B 5I1DA 3EOTL 4P59H 2EE2A 2ZKHL 1VFAA 4N0FA 3GMPB 3ARDC 1ZWIB 4GKSA 3KXFA 5HI5C 4BH8A 4OZFB 2P8LB 4JDZA 2ORBH 1OGAD 3QNXB 5CIPH 2NYYD 4DGYL 2L7UA 3VXNA 2J3SA 2CLVB 2R0ZH 3VFVB 4O51A 1BFVL 2VMFA 3BYYA 1NAKH 1HSBB 1F4HA 4PJXF 5TFSH 3NCYS 3LRHA 5TE4L 3M07A 5EOCH 1FIGL 2V9TA 1ND0B 4GW1A 3K2MC 1EEYB 2X1XR 3RY5A 2EDNA 5IMMA 4YBQD 3VFMB 3ARZA 3TNNA 1GGCH 2KZ1B 4DW2L 2PW1A 5FHBL 1FZMB 4Z0BH 5C0EA 4LLYB 4WI3A 3TZVD 3DGGA 3TBSA 3VA2C 2XKNB 3DHMA 4LLDA 1U8OA 1VACB 4L8BA 3B9AA 1Z5LA 3KYMA 2AXGA 4KHXL 5E56A 4UNVA 1OHQA 3NTCH 2HKHL 1JCKA 2DQGH 5E8NB 1HCVA 3MJ6A 3CDGB 1JIBA 1QBMH 4F57L 3W81A 1S5IL 3PHQB 4O58H 1TETL 3IFPB 3H0TB 4N1EA 5L8JB 2FGWL 2BVPA 3BQUB 1S9YB 4UOW0 4WU7A 1UA6H 2C1OB 2ENSA 1ZEAH 3PWJB 2V5TA 3WLWC 1G9MC 4YO0B 5ITFB 1J8HA 4JKPL 3V0VB 5DJZB 2BRRH 1NGXA 4JPKL 3LDBC 5E5MA 4HEME 4P46B 3SKMA 1NFDB 2VLJA 3AB0C 5EO1B 3U0WH 3ARYA 2X7LA 1DFBH 3C2AH 4ZXBB 2W65B 3B2VH 3CSYB 4TUJB 1LEKA 1S7RA 1QSFA 2AV1A 3RKPA 2ID5A 4QOKD 4X4ZA 1AC6A 3QIBC 2DI9A 4IRSA 4DN4H 5J3HC 1PG7X 4U6VL 4FQIL 4UUJB 1J1XL 1N7ML 2SEBA 5D1QD 4KFZC 3GSUB 4Q6YA 4HK3J 4OLXL 3NFNB 2VZVA 4PGCB 3PXJA 4NM4H 1ROWA 4WI8A 1X5ZA 3I75B 3N9GH 4WFHE 4HUWA 4DZ8B 3TVMC 4OGZA 1AI1L 3HNSL 4PV9B 4RRPA 3VRIA 2JIXB 2BVOA 2A1WL 2AABL 1BBDL 4K23L 3BGFC 5IB1A 5FUOH 4GMTL 4KMLB 1IAOB 1FBIH 3DSFL 1RAMA 1KCVH 4LSRL 3TYGH