4JFFD

Preservation of peptide specificity during tcr-mhc contact dominated affinity enhancement of a melanoma-specific tcr
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
197
structure length
197
Chain Sequence
KQEVEQNSGPLSVPEGAIASLNCTYSFLGSQSFFWYRQYSGKSPELIMFTYREGDKEDGRFTAQLNKASQHVSLLIRDSQPSDSATYLCAVNDGGRLTFGDGTTLTVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title T-cell receptor specificity maintained by altered thermodynamics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 36
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2013-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jffD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jffD02
5JXED 3PV6B 1HHHA 5GGQL 1IE5A 1X9QA 2JB6B 4WI5A 3P30H 4GRLD 3QIWC 4XI5D 3R0MA 3L7FA 1JF6A 4O02L 3BE1L 1NMCB 3IVKB 3QJFB 1L4IA 4M1DL 5EUOF 1E6OH 5LBSH 1FCCA 3LEXA 5B4MC 3LN9A 5FHBH 3GMNA 3MRKA 3NACH 5IWLC 1RZ7L 5E8EA 3EO1A 1KIUA 4LCCC 4XCCL 2H3NB 4LF3A 4AEFA 1RZKL 1F3DJ 3TZVD 4P5TD 2R4RH 4ELME 4JHAH 1R3KB 2EC9T 3C60A 3FAXA 5DJ6B 4KRNA 4TSBH 5SWSD 4ODHH 1RVFH 1EFXB 4I1NB 3F58L 4RGMC 4KKBD 4NQSA 4D0BB 3MCG1 4NQCE 4YAQA 3PP3K 5FYKE 1T0PB 1QFWH 3S34L 4N0UB 2DQFA 1TPXC 1MFAL 2CDFA 3LIZH 1JZ2A 4X7TA 4MAUH 1U8MA 5D5MF 3H8NA 2WAHA 3INUH 3EYSH 3RVVC 2DF3A 1FDLH 1R3HB 1HCVA 4JFFB 3DIFB 2ARJQ 2CUHA 3VJ6B 4U1HA 4NKOB 4PJ9A 4O58L 5CJXC 1G6RL 4P2RD 2EDLA 3GMLA 2B20A 4X6BA 1NL0L 4WW2A 1WAAF 4WGVB 1NMAL 3EGSB 2X40A 3TH3T 1VFUA 4YZFF 4Y16C 5B8CB 4MX7A 3FN9A 2LABA 1UB6A 1NGPH 3O4OB 2MKLC 4LSRL 4YWGL 1WFUA 2E8YA 2A0LC 4NC1E 3OJVC 2EIBA 3DARA 4YHPA 2Z4QB 5D2NB 3TFKC 4ZAKD 3JWOL 3OJ2C 1OCWH 1OTSD 3NH7L 5GZNC 3ARED 3C60C 3X11B 4MJ6B 2X4PA 1JGVH 1BOGB 4AG4H 4Q2ZB 3OR7A 4OUUB 2YRZA 2GT9B 4PGJA 4EEEA 3MRCB 4MJ5B 3MRRA 2O5YL 4WWKD 3ULUC 4PJBB 1IT9H 5CSZA 5E9DE 3T0EE 1QYGH 4OLWL 2XZZA 4XP1H 1BX2B 3S88H 4P2CG 3BD4A 2FO4B 4PRNB 3IXTB 3MRQB 5CLTA 3RGVC 5ENWB 3SQOL 3FT2B 2BNRB 3H3PL 4U05A 3DXAD 3IFOA 4CGTA 3OXSA 5K9JL 4HKXB 3BUTA 2A83A 1AHWB 5C0AA 4Y5YA 4YGVB 3DO7B 2VISB 4AIOA 3I02A 4X99A 2UV3A 5GISH 2ADFH 5FHAH 2WINB 3I3DA 3F62A 4WW2C 5E1HB 5H2BA 3S96A 5J1SC 4X8XA 4F80A 2F54B 1X5JA 3Q1SL 4IDJH 4S1RL 2R56L 1HQ4B 1JGUL 2MQ3A 4LHUB 2ICWA 3E6HB 4V1DB 5J13B 5FYLD 4ETQB 1YJDC 4M93C 3N9GH 1P9MC 5DMYA 3O2WL 1PJ9A 2DLEA 2IBGA 3FQXB 5DWUL 2BZDA 1Z9SA 4P0DA 2DQUH 4PS4H 1DBBH 4M3JA 4EIZC 5IJKC 3O3EA 3CFEB 5GRVL 2YOCA 2R0ZL 4FZ8L 2EIDA 4PJHE 4PLNC 4WY7H 1U8NB 2MFNA 3S36X 1RJCA 2EYSB 2X4QB 4GXUM 2MPAL 1S7SB 4QRPE 4EUPH 5EIIA 1F13A 4YDLC 3S36L 1H3VA 3DHMA 3C2AH 3MC0A 4HMCA 4I2XA 2AP2A 5B38A 4CMMB 1P7KB 1UH4A 2VDPL 3X12A 3WKMH 3NVQA 1M7IB 5I8KH 1DN0B 3KHOA 3CK0L 1TZHB 4ZUSA 2X2YA 4PJBF 2X9YA 4WI7A 1ZANL 2XNAB 4GG8B 1IRAY 2D9QB 4NYLA 2ZCKH 4PP1C 4UNUA 4CADA 3TJHC 4Y5YC 2VDNH 4FFYL 3FO0L 1TVBB 5GGUB 5DR5L 3LQAL 3BKCL 2EDTA 2VXSL 3I85A 3QEQE 5C0CE 3BFOA 4KUZH 3L9RA 1C7TA 5GGTA 2BVEA 4M6OH 5ICXA 2N4IA 3WFEL 2NXYB 1XF2B 1GGTA 3EYUH 4JKKA 4NWTH 3GSNH 5FUOL 3WN5C 1SVZA 3CVHB 3MGAA 2I9LB 2DD8L 3OKKB 4GFTB 5JHLH 3QG7L 3FFCE 5EWIH 2XZCL 4EDWH 4FABH 1KCLA 2FD6L 4C56A 2QADB 4NQDB 3QWOA 3VWJC 4FTVD 4KVNL 2W60A 3AU1B 2IMNA 3OXRA 1DQJA 5EOTA 1QSEE 5BV7H 2E9WA 1ODAA 2WWMD 5ESQA 1MHPL 4EBQH 3HC0A 1ZT1B 4XVTH 3VFOB 3EOTL 3ZLQC 2ZUSA 5F7KC 3VGGA 3CUPB 4PGEA 3T0AA 3LS4L 2UVEA 4PJGB 4YLQT 3D39B 1PG7H 2P8LB 4LMQE 4QHMA 5EOCH 4N8CL 1A9EB 1XGPA 3FKUS 5FM5M 5JW4Q 3DETC 3QCVH 4DZBA 3K80A 3OAYH 2WBJB 1A1NB 2HT4C 1MFEH 1QHPA 3L3DA 2EICA 2KUTA 3DI2B 3IFLH 5IMKA 3KPLB 5EBLA 1H3UA 4GMSL 4OGYL 5ICYB 2GCYB 1CD1A 2P8PB 1CGTA 3QNXA 1K9TA 4UT9L 4OCRH 4G6ML 4GW5B 4JRYD 4QHLB 3MA7A 4G8IA 2ITDA 4UQ2A 2NZ9C 3BAEH 4R4NC 4W6YB 1I3GH 1LWRA 5HVWA 5HDQH 4RGOL 1JHTB 2FEDC 3LD8B 2OXHA 3TVMC 3MRJB 2CD0A 5HHOD 3M17B 2UUDH 4JQVA 2JCCB 1JPGA 5DUMH 4JO3L 4MXQC 4MD4A 1MI5A 1MRFL 3VWKD 2I07A 3T2QA 2AJXL 4ELKB 1FVEA 1YNLH 3WL9A 2OYPA 3QUXA 3DI3B 3EDKA 4KDWA 4G9FA 4LDOB 4X9HA 4QXTB 5CBEA 4L9DA 3L5WB 3O9WA 1VEPA 1Q0YL 1HIMH 4G5ZH 4R2GD 2LAGB 3QBTB 3P4MB 1CGUA 4OCYL 4PJGF 3MUJA 5KSUB 2EIZA 1QPPA 1IC7L 3OB8A 1F58L 4OBRA 1TZGH 4OZHB 1A6VH 3PE9A 4G6FD 5JHDE 1ES0B 4X6CA 4UIKH 4Q9BA 5CP3H 1AO7B 1I7ZA 5JIIA 1OM3L 3V6ZB 4AIXA 1JV5A 5C08D 3T0VA 4QNPF 2MCPL 3BPOB 5FOBB 1CFBA 2NLJB 1A1MA 1AGCB 2D03H 2V7NA 3IDXH 3T77A 1J18A 2YPLD 4HH8A 5FK9B 3QO0A 3U48A 1L7TL 2VR9A 3EOBB 2IH3B 3QUMH 4HWBH 1KN2H 3G6JB 5MERB 3VI4F 5DUBA 4LKCB 4JQVC 1PGRB 1OAXH 2HKFH 4ZTPL 4DEPC 4RRPG 5BVPH 3DUUB 5DURB 3MBEA 2OBGA 3OG4B 2JCCF 2QQNL 2H41A 3B9KD 4LEXH 4M6NL 1P69B 2XRAL 3S37X 4U31A 3L3KA 1K6QL 2A9NH 5D7LB 3H9ZA 2WBKA 4WUUE 2FX7H 2HJFB 5E94B 3S37L 5FYJL 3QUXC 4WW1B 5J57B 3BH9A 3H9SE 1UADC 4NHUB 5DJYB 3ZYZA 2R39A 3VFRA 4K7FB 4LOUD 4YPGB 1I1AD 2HFGH 2YRPA 4I3SL 1NSNL 3GDBA 1Q94A 4KWUA 1X5GA 3HNTL 2VB5A 4LMQI 3OAYK 4D9RE 1XZ0A 5F3BA 2ICWJ 1E4WH 2VQUA 5KVDL 3P3YA 1H15B 1AGDA 4OZHF 1JMXA 2GI7A 4FMKA 5D6CA 3L3OB 4LCYA 1XCQA 2DS4A 1I8LA 2UWEB 4Y4HB 3GIVA 4KQ3L 5A2JH 5GS2D 3PGFH 1HOCA 3SJVB 4KTDH 3SGJA 4TQEH 4KKLD 3GIZH 2UUDK 4EI5D 3UTTB 1E28A 2X9XA 2XPGB 3L6FB 4OLUL 4DVRL 3G6JF 2X1OA 4M3KB 3G08A 3BP7B 4Z95H 1CQKA 5T5FH 5IEHA 2HFFA 1R3LA 5HHVL 4ZPTB 5EU4A 5C09E 4WEBH 1NUGA 3P4OB 4YBHA 3DUSB 3CVHL 4LFHG 3TBWA 5GS0D 2J2ZA 3ZE0F 4NSKB 2EKSA 1KLGA 4OM1L 4LFHD 1RK0A 1QSFB 2AJSH 3O3DB 4KK8C 1MFBH 2ZG3A 3E0GA 4JFQB 2P5EE 3L3JB 4XRCB 5EFIA 3RIFK 3G9VA 3ULSA 1M71B 4MA3A 3VXUA 2O5XH 5FF6A 2NY3D 4CDGC 2XN9E 1EO8L 4ODVH 3U0PA 2E7HA 1IC4H 1W72L 2I25N 1JN6A 1KT2A 4NO0D 4Y4FD 1EJOL 4AT6B 2AEQH 2VDML 3FT4B 3PNWA 3NCFB 2DQCL 2C3GA 5H37H 4JFEE 2UWEF 4MLSA 5D6DC 1IEBB 4Z7UE 2B2XH 3TJEL 1Q0XH 4L3EA 1S9KC 1A6ZB 3UDWA 2NNAB 4LRNL 3M8OH 4QT5B 1QRNB 1B4RA 4F7CB 3K2UH 1FIGH 2W59A 3I3EA 3K8LA 4PGBA 1RZ8A 4RAUA 5E08L 4WJ5B 2IPKA 1BVKA 3BRGC 1KYOJ 4HSQA 4P57A 4PRBA 5IV2B 3LKNB 1PZUB 3KPSD 1PEWA 3UJIL 4HUMB 2W9DH 2BVYA 3H9HA 3D3VE 4PGZA 2QQLH 4F7TB 4L5FL 5E00B 1R3JA 3SDYH 2X4NB 4K94L 3GSQB 2BY1A 1XMWA 1MVUB 3TYFB 3QFJD 5T1MB 2ZPKH 5DD3H 1KSRA 3UYPA 3D85B 2CK0H 2NZIA 1P2CA 4NKDB 4OKDA 3I6LE 4I9WE 4HFUL 5K9KB 1WZMA 2YUZA 2A6KA 5D1QA 3DBXA 4WO4B 4HXAL 5LVEA 4KK9D 5FKAA 1LEKA 4W4NA 5C0BA 5F7UA 3VU2A 2ZG1A 2X4SA 1VA9A 4Z76B 5EUKA 1K4CA 3O8XD 3L1OL 4F7MB 2AV7A 4GG6A 1IAOA 1U93B 5IMMB 3CFBB 3GSWB 2BDNL 1FVDA 3HI6H 3IAQA 1UA6H 1OTUC 4LPWA 5J56B 1EUUA 3SDDA 2GSGB 4I0PD 3GNML 5B8CC 2EDEA 1QFWI 3EOAA 4JGMA 2A1WL 3DRTA 1CS6A 5CZKA 4G8EB 3IXAB 1A4JB 3QPXL 4J3UA 1T2JA 3SE3A 1XR8B 2VZ1A 3HI5H 2PYEE 5TE4L 2ZSVA 1T66C 2FIKA 4X6EA 4H0HB 3VXME 5F3HA 1V3MA 1DTUA 4ORZC 3DMMB 5HBBA 2LVEA 2ZUYA 4C58B 3UZVB 2IAMD 2ITCB 3IRPX 4FFVC 2H2PC 4LQFH 4IS6B 4KXZH 1RFDL 1KXTB 1YEGL 1S7WB 3BPNB 1OGAA 5EOQL 5FECB 3H0TA 2V5SA 3PF2A 4Q9QL 4UV4H 3GRWA 3S8WA 1DUZB 3MRDB 1JPTH 5ELIA 3KJ6H 3P2TA 3PWVB 1QP1A 1ZVSB 4NZUL 2VLME 2RBLA 2HTKD 2NY4B 2HVJB 4RQQB 4G6KH 1GGCL 2QR0B 3A67H 3BHBB 1MAML 1RK1A 1DL7H 3KDMB 5D1QC 5ITBL 5DJCA 1WUNT 4RAVB 4ONGL 2APTA 5CBAA 4GLRH 1QOKA 3MRGB 3MV9B 4TSCH 4OCXL 5I15L 1GAFH 4FP8H 4HG4J 3VDBA 2VITA 5DZNA 4QOKB 4MSWB 5CGMA 4FXGA 5C0RH 4N0YH 3V5HA 4OV6F 4XHJC 4GXVH 5ACZA 2IADB 5C92A 3ZHDA 3WNNA 3QXVA 5JIKA 1A5FH 1JF5A 2BP3A 3VH8B 1YEEL 4J3WA 5GS3A 1L9MA 1RMFL 3LQZA 4R90H 4PJDA 1LEGB 5I8CA 3KR3L 1EAPB 3OSKA 4P5TA 3S3PA 3SE3C 1IQWL 4AEHH 3LAFA 2VUOA 1RHHA 3MNZB 4PPTA 2PUQT 4RFOH 1WVZA 3ZE1F 2OR8A 5SWSA 3U9UB 1IAMA 3F7YA 1T3FB 1S7TA 1T22A 1CFVH 4UB0L 5INCB 4ENEC 4M7LL 4MNQD 3WFHA 5T33L 5C0IA 25C8L 2Q3AA 2D7OA 2ZUQB 4Z0BH 4ZFFA 4JO1L 3WJLA 1PKQE 1LD9B 2F5AH 3KLHD 2EH8H 1ED3A 3I50H 2FX9L 1V7MH 5FXCH 4BZ2L 2F8XC 1MWAA 4ELMB 2E7CA 3QEGL 1XF3A 3WLBA 4GBXB 4UT7L 2VDQL 4NJAH 1PZ5A 3RL2B 1JUFB 4MA8L 4NIKB 5L2KD 1IZKA 4NQCB 1OAZL 2J8UA 1EV2E 1XGRA 1MRCH 5KVFL 5ADOH 4CU7A 1A64A 1H3PH 4UT6L 5DK2B 1A22B 2Z0BA 3OPZL 4CBPA 4U3CA 3HAEA 4LLVA 1WWCA 3TO4C 1ZV5A 5FM5O 2CK2A 2IF7A 3HE7D 2DL2A 1GZPA 2B5IC 4RFEA 5BW7A 2XKSA 5IBTL 3LRHA 1SJEB 5DA4A 1CXFA 4NZDA 2YS4A 3FOMA 1OY3B 4Q6YA 2J5LB 1AQKL 3VG0L 5E1AB 3TLRA 5D9SB 1JWSB 2AEPL 4N68A 4Y2DD 2NY0D 4NWUL 3VFSA 6FABL 1YY9D 4U3HA 2NR6C 2GJJA 2GTZA 5IIEB 2AGJL 5JQ6L 3WUWG 1GGBL 4XXCA 1WT5C 1KB5A 2VXQH 1MCCA 1CDUA 2OL3B 1E27A 1RJLB 3DGGA 4S10A 3CFKA 1RSFA 2NY6C 3WJLC 2DBLH 2X70A 5KOVC 4KMTL 5HGHB 1ZTXH 3STLB 3SCMD 1MHHA 1KJ3L 1MCEA 5BRZA 1VPOH 4PG9A 4X0KA 4H1LH 1OLLA 2EE2A 1YPZE 4WU5B 4XGZA 2RAMA 4ELMF 4XP5H 3DXAA 1S7XA 2YSSB 3O3AB 4PJAE 3RTQD 2XQBH 3UPRB 5TDOB 5J7CC 1S9WB 2NYYC 5F96H 2VC2L 5EIVA 4P3CH 4O51B 5DJDA 5IQ9A 1CGSH 1U8IA 4KH2A 2QTEA 4P9HH 5DYOA 4S1SL 3TNNA 5E9DB 3FQUB 3T0EB 4OLXH 5GGSA 2JLLA 2FLBT 1CFTA 4XC3H 5E5UB 1Y0LB 1K5NA 4EDXB 5CJOH 4AENA 3H7BA 3K8KA 2ED9A 1XGTB 3QHFH 2EDJA 3HPJB 3BP5B 4Q58C 5IVNA 3FTGA 4F3FB 1LK3H 2W9EH 4K8RC 4KKAD 4OIIL 1PLGL 2YKLH 1JPFA 1CLCA 4KY1L 3QWRD 1UM4L 5T3ZD 3D6GA 3X3GH 1IAKB 4ZQKB 1J12A 2VABB 2OJEB 2W91A 3IDJA 1CU4H 5HY9B 1VEOA 2GFBA 4YDIL 2R4SH 1WJ3A 4O5LH 1BQSA 5MEQA 4ZO7A 5BQ7A 4UMGA 2EXWC 2F74B 5HHQA 3RA7H 1BVZA 4PJFA 3E3QC 5IR1B 4IHOA 3GBML 4NHCH 1I3UA 3D2UA 2DQHL 2FX8H 3B4NA 4Q74A 5B3JE 5DVLA 4PJHB 1KTKE 2NCMA 5DHYA 1UACH 1JNHB 4NQEA 4U1JA 5IJVB 4P2YA 1EFXD 3MA9H 4QRPB 1HHJA 5DD6B 5JPMB 4UTAH 3Q6GL 3HC4H 1MCFA 4TUJB 2DAVA 1N59A 4NOBA 2LQRA 1FFOA 1P5UA 3VFVB 4KC3B 1JP5A 4EI6A 2R0KH 5DS8B 1MRDH 5DEFB 3V0VA 3IB4A 2D31B 3QUKB 3V7AG 4JY5L 4FG6D 1KPRA 4KU1A 3U30B 4JFFD 4TVPH 4MB5A 5C0GB 4Z77B 2O5ZL 4HIHB 4PRDA 3G5ZA 4EXKA 2R2HA 5I1CH 3QEQB 5C0CB 1F6AA 3TN0C 5CJ5A 5IKCA 3K7UA 4NDMB 1RU9H 4JVPA 1YN7B 4FQCH 4NN7B 3CU1A 4NFBA 5SX4H 1G9NC 5EU7E 4D9QE 4DUWA 1OT1A 2BOBA 1U0QA 1SYSA 4BUHA 2CO6B 2LVCA 1X5KA 5F6HJ 4KJQC 3FFCB 2D7MA 5HI4C 1QKZL 4HJJH 3QIBA 2DOCA 4R7NA 3L5IA 4UQ3A 1CWVA 3SQBA 2B4CH 4OD1L 2Q87A 1QSEB 5I66B 5T1LB 1NFIA 1IGML 2ORBH 4YXHH 4YBLB 4PJHF 4WTZG 3ILQD 4XWGL 4ZOEA 3HMXH 3KPQA 3A0OA 3WFBH 4L1HA 4NKMB 4GAFB 5HVFB 3SKMB 4WENB 4X9FA 1Q72L 1A7PL 2Z9TA 3BP4A 3NN8B 1CBVH 4ORGB 4ZUVA 1KJMB 1IILE 4OQTL 1QBMH 3ARTA 4YGAB 2BNRD 4LSDA 3HC3L 3U0TB 2WBWB 4JRYA 5DMIL 5E5RB 1HEZB 4Z7WE 1RZJC 3CDGA 1S5IH 1JPSH 2GITA 4MVBC 5HGAB 3VGBA 5E4EB 1PX3A 5I9QB 3ZKSD 4R3SB 1NGYA 4RGNE 4FQ1L 3PDOB 5DQDL 3VXTB 5DJ0A 5HHOA 4ZNEE 3V0AC 3AAZA 3ZT5A 4P5KA 1VGEL 1G9MH 2AXJA 2F54D 4B41A 3RWJB 4QHNB 4X6DE 2OSLB 1UCBL 4YHIA 4YE4H 3W0WA 2Z92B 2VXVL 2HT2D 4PJCA 5D7SL 1UXSA 4KI5C 2P5WA 3ZSTA 3PV7A 5FYJD 5AAMA 1HXMA 5C0ND 5GHWL 4E5XB 4NCC2 2Y36H 4UILL 2DQDL 3QI9A 3VXSE 4JRXA 1FGNL 2WIIA 1DQDH 1F97A 3I6KA 3WIHH 5DHVA 2VQ1A 1FO0B 4ODUA 1VACA 1RIVL 1YEDB 5C6TL 3C8KA 1X5LA 5D4QA 4PJ7A 2NY1B 3C6SB 3T8XB 4YFLF 1TTGA 3ARVA 4JAMA 2C7UB 2DTMH 3E2HB 4LNRA 1U95A 4OAWB 4X4XA 4YQXL 5JOFB 3V8OA 3VGHA 4UTBH 2HT3D 3BGMB 2DI9A 4P3DB 4BH7B 2GSIB 1QLEH 3PJSA 3Q5YA 2V5RA 3WXVH 5KS9A 4JPWH 4LLUA 3AROA 3O45A 3N1GC 4PV9B 4LBEA 4I18B 1NCWH 2YPLA 3B3IB 3QRGL 3OKNB 5JHDB 1C1EL 1MIEH 1EEYA 4GRMA 4OF3A 4S1QH 1F90L 3M1BB 5F1OB 5J6HB 2NXYD 4UUJA 4I3RL 5F9OL 1ZLWH 5DJAA 3QZWB 3B9KA 4LVOB 5D2LA 3KPPB 5DQ9B 4JLRB 2VAAA 4RRPA 1D9KC 4PD4J 1WBXA 2WMPA 2QADD 1IBGH 4NQDD 3PG2A 3QI9C 4PB9L 1QNZL 3ROLB 5J9PA 1SEQL 4AJ0A 1D5ZA 4X4MA 4N1HB 5EN2B 1I1AA 3MCLH 1SM3H 1I9JH 4XWOC 4U1LB 1CIDA 4K3JH 2PW1A 2VUYA 4WUUB 5BJTA 2P8MA 4HKJB 3KPOB 1J11A 4Y19E 1IKNA 3FFDB 1RUML 3RNKB 3NAAH 2H45A 3H9SB 1FAIH 5DSCA 1JTTA 4NO2B 4OUOA 1CGYA 3D39D 3TV3H 4JN1H 5J11C 1IGYB 5F7EH 3RX8A 4IRZH 1NGXA 3RNQA 4ZSOA 3PIQA 4XMKH 2C1OB 4JDZB 4DK3A 3MX0A 4GW1A 4L8DA 5SX5H 3MLRH 3G9AB 2J8OA 2WBJD 1FG2B 1F2XK 2HLFC 5I1AA 3OKOB 1LNUB 1P7QB 2WWKO 1JWUB 4Y5VB 5E99H 3VFUA 5F7WC 4HPOH 4I48B 4QEGA 4EI5A 3UO1L 2XT1B 5HYJA 3IETB 4I3GA 3O6LL 1D5XA 1F45A 1MCRA 2ZOKB 5EZOL 2WUBL 3DSNA 2W0FA 4K9EH 4HGWA 1NKOA 1QD0A 1HSAA 5GGRA 5JXAH 4Z7VA 1OT2A 4HC1A 1N0XH 1PY9A 4MQTB 3RVTD 3TYGH 3U36B 3OKDA 3C6LB 1K8DB 3FQRA 1LO3L 3RJDA 3O6KL 4JB9H 2ZOLB 3ZYIA 3MCKA 5IB3B 43C9B 4JKMA 3PABB 5T3XH 5EC1A 5AD0A 3BZEB 5C09B 4DCQB 5E8DL 3VRJA 1FIEA 3TT3L 3AVEA 3V6OC 1S7RA 1KIQB 4NM4L 4ZFOA 1CE6B 1DQQB 2PTVA 3UBXB 2ZKHL 3MLUH 1U6AH 3ULUH 3P11H 4QTIL 1D6EA 4Z8FH 2G2RB 5JO5A 4M8QA 3WE6B 4K7PX 4I5BA 5CGYD 4NO0A 4M62L 4K7PL 1ZA3B 1CE1H 4IDLA 4AL8H 1A7OL 3VRLE 3CFJA 3LKPA 1NDGA 3GMQA 4QRRE 5MENE 2R15A 2XN9B 5CD3A 2R2EB 1KBGL 1AO7D 2DDQH 1C5BH 1I9EA 3BH8A 2BSSB 1S7QB 3FB6A 4Y0GA 3QR2A 4OGAD 4X7DC 2NY5H 6CGTA 3VG9C 2B0SH 1ZLWK 3IGAA 12E8H 4IJ3B 2H32A 1YJDH 3RY6A 4JFEB 1FVCB 3P0YL 4LL9A 3QQ9D 1UZ6E 4LEOA 1R3IH 5CEZD 4KRPB 1TJGL 4X7SL 4Z7UB 3KPSA 2D4DA 2Z31B 1YEFH 4U3XA 5HGGS 4GLRI 4NNPL 4JZNA 1IGIL 2GY7B 3R4DA 4XAWL 3Q3GA 8FABB 1BF8A 4XVSL 4OLZH 4NO5B 3B9EA 2LU4A 3WFZA 3C5SA 3O2VL 4W81A 1KXQE 3QFJA 3LKOA 2XWBA 4MXWL 4TOYL 3QXDB 1S9VB 4GBXC 5D7LD 2UZXB 4YR6B 3V0WL 1KC5H 1NAKH 3UTSE 4ZYKA 3ARGA 5DC9B 3H3BC 4MHHG 1DSFL 1YYLH 4IOIA 5CIPB 4FA8A 1JZ3A 1VFBA 3WIFB 4X7FC 4HUKB 4XPFL 5DO2D 1JRHL 1NGWA 3MJGX 3D3VB 4NQXB 2H1PH 5F88A 1A4KB 3O8XA 1J05B 1I1FB 1MCPH 1EXUB 4OKVB 1FO0L 2XWJA 1J0KA 4XBPB 1TCRB 5H94B 3DGCR 3GMMA 3NIFE 4YC2C 1W0YT 4I0PA 3VFGL 1INDL 3KYOB 1UKQA 3IJHA 4IRJB 4HF5H 3TPKA 3D0LB 4MNGA 1OW0C 1JGDB 1I7TA 2D7NA 4F7PA 4U1KB 2J6EL 4IRSB 5IB2A 2EYRA 3I75B 5E8NB 4ONHB 4N0CC 3RVWD 2DLFL 4Y4HD 2E6QA 4DTGL 4F37K 1XH3B 4G6JH 5GIRB 4L9LA 1NCAH 3SJVD 1F6LL 3D0VA 2IAMA 5DRZA 4PTTA 4FQQA 1T80A 1IGJB 4JM2D 3GB7A 4LQ1A 4TVPE 4Z7UF 1QBLH 1R5WA 3MLYL 2BVPA 3V52H 2PYEB 2QSCH 3NTCH 1VKXB 4QXWA 2CXKA 1L7IL 3EO9L 3VXMB 5I1LB 3OBAA 1MPAL 5ISZE 3H9YA 3P9MB 2OI9C 2Z35A 1ZA6B 5DD5H 5IFHH 2XWTA 3TBTB 4D2NA 3BW9A 3ARGC 1G6RA 3IJYA 1WFNA 4MA1B 4YUEH 5I73B 4X83A 3ZTNL 5DI8B 1QSFD 3M45A 1T7ZA 1TIUA 4NJ9L 2LFGA 3IDNB 1A0QH 3L95A 1NBVL 3FT3A 5DJ2B 3RZCA 5D7JC 3IU3B 1JI2A 5IFJB 4XNQA 4KKCC 1AQDA 3P30L 4GQ9L 2ZJSL 1ZSDB 4L8BA 1JYNA 2EE6A 5BV7B 4O2FB 1T20B 5I17A 4JG0L 4MJ4A 4DKFL 1RZKC 3ZDZE 5GGTH 5DQJA 4WDIA 1BBJB 3FQTB 1T1YB 5D93C 3NACL 3CC5A 1A7RH 1R5IA 4YO0B 1T5WA 4WHTB 3B9AA 1EAJA 1I85C 2ICEA 2YN3A 3TBSA 4PB0H 2DIJA 4QO1A 5ILTL 4F2MA 4HH9B 2D9CA 1ONQA 2AJYL 4HUXB 3GK8L 4MCYB 1F4XL 5CHNB 3UJTH 1KIPA 2W65A 4JKPH 4WI3A 1ULVA 4NRYB 1X6LA 3MV7E 5LCVH 3VXPA 4ODSH 3U79A 2Q20A 5E5MA 4RMQA 4FQIL 3LIZL 3IS0X 4AH2A 5DTFA 4LDLB 1S78C 5L2KA 4MAUL 3GHBH 1PKQB 4HIJB 2CLVA 4ZFZA 5ESVB 3INUL 4FZEL 5C2BL 5BVJB 4NT6A 4B0MM 3QNYA 1FSKB 3SHSA 3KYMA 2VL5B 5GQBA 1U3YA 3D85D 5DRXA 4QY8A 3GSUA 3RZCC 2W9LA 3PQYA 3Q48A 5LXGH 5MP6L 2Q7YB 1KN4H 5I1KL 5L9DL 1FJ1B 3CSYA 1KCSL 1PYWB 4L4TD 2P47B 3GUTA 4WO4D 1IM3B 4H88L 4YDKL 1JHKL 1M7XA 2IQ9H 2RQ8A 4OGXL 3ZTJH 1FN4B 3TT1H 4CVZA 3Q2CA 2JK5B 4KJPD 4ERSH 5EUOA 4Y2DA 5CEYA 2C3WA 2GQHA 5SWQB 4NFCA 4MYWB 4LCUA 4D3CL 1H8OA 5TH2B 4MDIB 3IKCA 4QHUB 1N3NA 3I6GA 2YEZB 2HFEA 5FA4B 1MJ7H 1U8HB 5DJXA 1MCOH 4YIQA 3WO4B 2O26U 2MTPA 3ECBB 2CDEB 5T5NF 5F7DA 3CVIH 2VDRH 1WWAX 1KGCD 3CLEL 1H5BC 1TMCB 3N1PC 1CQYA 4GH7B 3WDJA 1PX4A 3BKMH 3MV01 3R8BB 1UZ8A 3G6AB 3DMMD 4XVJH 4HT1L 5EZLA 5JZ7D 2YRLA 3ARWA 4FQ2H 5F1IB 5B22A 3PWNB 3SDAD 2ZCHL 3Q6FA 5D5MA 1MCIA 4NM8H 5I0ZA 5SX4I 2I60H 3QHZL 4J8RB 5C07E 1DE4A 2AJ3B 3F5WB 1YPZB 5DJ8A 1YA5A 4ZUTB 3B2VH 1FL6B 4PJAB 1WISA 2OR9L 2VH5H 1UKTA 2DM3A 2NY4D 1QG3A 2UY7A 1C5CH 5J6GB 43CAB 1CGXA 3EFDH 2P7TB 5IF0B 2C3HA 2EXYD 4IDJL 3PV6A 4TYUA 3QWRA 2AQ1A 3RY5A 2JB6A 3MPCA 4P4KC 4OD2B 4QGYA 4E42A 1GL4B 3MV9D 4HXBH 1JWMB 2VLKD 3RKDD 4LU5H 2AJUL 4HIEB 4P2OB 3IVKA 4M9OA 2PO6D 1OD7A 3QJFA 3TESA 3O6FB 4QOKD 4ZDHA 3P77B 3VH8G 2F53E 2PR4H 5I8EB 4OJFH 1ZVHA 3IJSB 5AWNL 3MBXH 2XFXB 2EDRA 5I71B 1SJXA 4WY7L 1ZKAA 3QDGA 2D7PA 4NOFA 3RWCB 2H3NA 3U1SH 1QZ1A 2JKXA 1JRHI 4M03A 2BC4B 1A6AA 3WXWH 3JV5A 4OZIE 1R3KA 5DJ6A 3RIFF 3VMPA 1NBQA 3LHPL 5GJSL 4HUWB 3KPRE 4YX2L 1TJHL 4AY0A 2CLRB 3I3BA 4PBXA 1KCKA 1OQXA 2OX5A 4PYHA 4OIAA 1U91B 4KKNA 3VGAC 1QSVA 3TBYB 3NIGE 2H8PB 3X14B 3E2HC 1F8TH 3JTSB 1HHIA 2BRRL 1I8MB 4UINL 4OI8A 1R3HA 4GKOA 4UBDD 1U92A 3SO5A 4NQCD 4CW1B 1YPZF 1Z5LA 1QA9A 3VJ6A 4NKOA 4PJAF 3SKNB 5I30H 4ZTOH 2IMMA 2YUXA 3FRUA 4K23L 3RWFB 3RHWK 3JVGA 1K4DA 2L7JA 3ROOB 3EGSA 4ZMAT 4DW2L 3ULVC 3ULUE 3D69B 5HD8D 1CFNB 2GJZA 4QWWC 5KW9L 4YPJA 3T1FA 1GGIL 4CVXB 3SY0B 4P2QE 2AI0L 3WNPA 1BREA 4EBQL 5C9JB 1ZHBA 4PLJD 1T7WA 4XVTL 1CL7H 5I1HL 4MDJB 1LP9E 5IVXA 4GKNB 4DAGH 1BOGA 5I0DA 2OTWB 3HG1E 4QXUH 4OUUA 3MFFA 3HA0A 5IOPB 1J1OH 1FHGA 3EJZD 3MRCA 3DNKA 4WTZA 4F58L 4PJBA 1Q9WB 1V3JA 3DV4B 5DD0H 1BX2A 2CGRH 4DKDC 1MLCB 3MRQA 2X44D 4N5EC 5B3JF 5ENWA 3FT2A 1CCZA 3D25A 1CF8H 4HKXA 2VIRB 4YGVA 3DO7A 3MQIA 2VISA 4W68A 1YC7A 1NCTA 1HHGB 1S9XB 3LCYA 5DJZB 1YN6B 5E9DD 3T0ED 4HULB 5IHUH 3P0GB 4PR5A 1HK6A 4JY4A 4XBGB 3QAZB 3MUZ1 5TQ2L 2HH0H 4U7KA 3C5ZB 3DHJA 3D48R 2HN7A 3ARBA 2CRMA 3TGXA 1OGTA 2JIXB 4Z7WB 3E6HA 1IQDB 4JZJB 4ETQA 1A7NH 5JPNA 3KLDA 5IESL 4RGNB 1RZGB 2KKQA 4U1MB 1WTLA 4XTRC 4C59B 5SV4A 1YNLL 5LWYL 4X6DB 4RA3A 2J88L 2CIKB 2RHEA 1VERA 3EDJA 4U0RB 3U0WH 4ZO6A 2EYSA 5JUEL 5CFHA 5ANME 2J7LA 1U8QB 1KCRH 3VRIB 1CDYA 4ALAH 1O0VA 1P7KA 4M7KL 4RSVA 3VXSB 1TQBC 3CNKA 3GJEB 1WICA 4NQUA 5CD5C 4DKEH 5IMOA 1IFHL 3KWWB 4G6AC 3L3HB 1ZWIA 5JLZB 4QRPD 1MUJA 1SEBB 4JVWA 4U6VL 1OB1B 2Y07L 3DX7B 4GG8A 4GKSB 4K2UH 5IGXH 3DURB 4XZUB 4KJYB 2H26B 2W0PA 2FJFB 3PL6C 5GGUA 5EO0A 1DVFB 3MXWL 5GGSY 1HHKB 4I2XE 4OI7A 4NZTL 1XF2A 1ORSA 4M5ZL 5BS0A 3ARBC 1KN2L 1HI6B 3QUZB 3RU8L 4KRMB 4H20L 3CVHA 4H5SB 2V2TB 4XCYB 4Z7WF 1FNGB 3QEQD 5C0CD 3MUGA 1GCFA 5SV3A 5CINL 4NQDA 2FH6A 5TF1H 3QIUA 5E6YA 3PXHA 1NGZA 5DC4B 2QLVB 1R5VB 2Z31C 2NX5D 3RWEB 5IW6A 4M4RA 3MROA 3W9EB 1SY6L 1RUPH 5L88L 3GMOB 4C83B 4PLOB 2P43B 4X6DF 5BO1H 4JFOB 3ILPB 3FFCD 1JIBA 1ZT1A 2QHRL 2GHWB 5FFLA 1CZ8L 1UWEL 3TC9A 3CUPA 2E7MA 4BZ1L 3NZ8B 1W72A 4PJGA 3REWA 3BVNB 3GRWH 2GYSA 2EYTB 2B1HH 1QSED 5C7XL 5T1LD 3PWLA 2AJVL 4GAGL 1KF9B 4X9BA 3WO3B 3R1GL 3SBWA 1I75A 1CGWA 2OLDA 5DRWB 5HGBA 2N7AA 4I77L 4YNYB 5FA3B 5KSAB 3T1WA 3HFML 4GS7B 2Y7QB 2WBJA 3QA3B 1A1NA 5HHXL 5BXFA 4Y19B 3DX9B 2Z8SA 4YHNA 3RFZC 1BIIB 3LN5B 1MEXH 3KPLA 1N5AB 2CMRH 1BFSA 1MCNA 5ICYA 4Q6IB 4Y89A 5CJQL 2GCYA 3LZFL 1YEJH 2P8PA 1KULA 1DBAH 3FN0H 4JG1L 4TQEL 4KHTH 1UWXH 1SJVA 4PRPE 1K3ZA 3E8UH 4MQXC 2AABH 4GW5A 4QHLA 2OJZH 5EPMA 5DXWA 1NLDL 4LP5A 2CJUL 4YFEA 4GSDL 4DGYH 1OWWA 5T5FL 4PJ8B 3TCXA 2Q86A 4KUCD 4WEBL 3FQNB 3NCJH 3QIUC 1G0DA 5IBUB 4XP4L 4YXKL 3F12B 5GRZA 3MYZA 2X89D 3EJJX 1T6VN 4QHKI 3UJJH 5F72S 1R24B 4XT1C 4ELKA 2G60L 2QSVA 1AIFB 5DEGB 1GIGH 3T2NH 1FLRH 3HZKA 1DEDA 4LCIL 3FZUC 2XZQL 4JY6B 4QXTA 5KSVB 3MLPA 3C5JA 1MWAH 2L4OA 3MRPB 1C16A 4CDHA 5I73C 3O3BB 1DDHB 5JTWA 5L7XH 5KSUA 2NY1D 3QUYB 2VR5A 1ZS8A 5JQHC 1DBKH 2AW2A 5EULV 2AJZB 3VXQA 2FDBP 3OGCA 3Q5TA 4GRWH 4LGRB 1X4YA 2NQCA 2G5RA 3RZWA 2MKWA 4O9HH 1AO7A 4RZCB 3KVQA 3PHQB 1QLRB 3V6ZA 3IDGB 3HAEH 5BV7C 2FB4L 3LB6C 1ZE3C 4RWYH 5J3HC 1JZ8A 5K33A 4MQSB 4G9FE 1AR2A 2F8OA 1JK8B 2NLJA 5GGVL 4I0CC 4WHYG 4QRRB 5JHDD 1EVTC 4BQCA 4K8RH 5FK9A 3MJ9L 5MENB 3RVXD 5DF0A 3VXNB 3CFDB 4OFKA 3EOBA 4XX1E 1NQBA 2YC1B 3EAKA 3LEYL 5MERA 4LLWB 3QZWG 1N6VA 1T1ZB 3K3QA 3EJYC 1ZT7B 4K94C 4NRXA 4P46A 1Q9OA 4X6CE 2W9DL 1S9YA 3KYAA 1BQLL 1U8OB 1KB5H 3MRNA 5D7LA 5C3TA 3SDYL 5E94A 2HJFA 4HK3J 1YEIH 4ZXBA 5I16A 1SBSL 1MF2H 4WW1A 2QEJA 2HWZH 2VZVA 4JJHA 5CP7B 4PJXE 2AEWA 5I1IL 1MFCL 3KLAA 4NBYB 4K7FA 4YPGA 1RQ5A 4LSUL 1FSKC 1XIWB 1NLBL 2YUVA 3RI5K 5IMLB 1RHFA 3KYKL 2P4AB 4LNVA 5D70H 4WUUD 3RIAK 4D9LL 3UTSB 2PKDA 5K59E 2V5TA 3MRBB 2BY0A 4W4OA 2WZPD 5HVGB 3H9SD 5FB8A 1HSBB 2EDWA 3IDUA 4X80L 4EKXA 1NFDA 4UOW1 5D71L 1C08A 1P4BH 5AUMB 5A3IC 3L3OA 4WVRA 4KTEH 1HZHL 1UWXK 2UWEA 4P23B 4Y4HA 5CAYB 2LTQB 4D9RD 4OB5L 2XA8H 5GS1B 4J4PC 3SJVA 3GJFH 4R6UA 1CT8B 4RMRA 4NGHH 1P7QD 3VRLF 3OZ9L 1ND0A 2YPKB 4OT1L 1RURL 1GZQB 2Z8RA 3FAWA 1MIMH 4JM2A 5A2FA 3OJMB 4GOSA 3V4PH 3UTZB 2XPGA 4P46C 3BP7A 4KDTC 4I8DA 1A6UH 1WIOA 4ZPTA 1JGEB 2PCPB 4KMLB 4DQOH 1XEDA 3P4OA 5L6YH 3DO3A 3DUSA 5HYFA 4BQ6A 4JPIB 2A6DA 5C0DB 3NPSB 1JPTL 1YDPB 4ZXBC 4R97B 1UZ6F 4NSKA 1JGLL 4PRIE 2HKHH 3C6LD 1S8DB 3OTTA 4P4RA 1KELH 4XC1L 3LDBB 5JR1H 2FL5B 5DFVD 3O3DA 1UQSB 1GH7A 5EA0H 5C09D 5DUPL 2DQJL 5C6PB 5ISZB 3KPMB 4XRCA 5CMAB 3VE0A 2IG2L 2W0KA 1VENA 2X4TB 4NP4H 2BSRB 3HRZB 2HTLD 4W4OC 5DK3A 5E95B 3OR6B 15C8H 1XGQB 2R0LL 4XNZB 4XB8A 4LSPH 1BZ7A 1LHZA 2CH8A 5IT2H 1U8JB 3PP4L 2BNUA 3MOAL 3FT4A 5EB9A 4POZD 5KG9B 1RZJH 1J9CT 3SO3C 3NIFF 4DFHA 1XT5A 3EFFB 2XN9D 4LRIA 3DVFA 4AEIH 4FFZL 1I1YA 4FQLL 2VNCA 1OARL 1N7MH 4CVUA 3GMRB 1A6ZA 3AS0A 1CFVL 5TDPA 5I71C 2HFTA 1BMGA 4U1NB 5AZEH 1OAQL 4F7CA 4ODXB 3TWCL 1LDPH 3QDJE 5EU6E 4UI2A 4JFED 1IGTB 1WFOA 4ISVB 4KRPD 5IV2A 2PXYB 2AQ3A 3PHOB 1G7JA 3RWIA 5F44A 5GGRY 3VDCA 1PVHA 1MNUL 2R9HD 3MV11 3FO2B 2C1PB 4F57L 4HS6A 5D96B 2X9WA 1IGFL 4F7TA 1YUHB 2X4NA 2NXZB 5HI3C 3GSQA 3MV7B 1YYML 3TYFA 4P49A 1MRCL 5T1MA 1YY8B 2XZAH 2QSTA 1T03L 1I9RH 1N64H 1NGQH 3MOBH 4L3EE 5I75B 5MI0C 2HMIC 1QO3A 1W0VB 5I74C 5GRYA 2V9TA 1MCQA 3MODH 5K9KA 3FOLA 1BFOB 2XICA 1FORL 4L4TA 4LSTH 5D1ZB 1JZ5A 4L8SB 5FUZL 4P59L 4Z76A 3D3VD 3S7GA 3OX8B 2DQEL 4HW6A 4ZFGL 4FNLH 2IPTL 3CFBA 5EOCJ 4I9WD 1B4JH 2GSGA 5D7KE 1AE6H 3LV3A 2WV3A 3S98A 4LAQL 3NCYP 4IRJD 3GJFK 2M8XA 3ZT7A 1EGJL 4G8EA 5KSBA 3IXAA 1U3HA 4GMTL 4K3EL 3G6DL 2OMNA 4IRSD 3BPLB 3MZTA 1A4JA 2D0HA 4WNQB 2MSPA 3V5DB 4JQIL 3ZKNC 2VXQL 1XR8A 1JMZA 3OKEB 3S35L 3ZDZF 2BSED 1ZHKA 2R2BB 4BSWA 3UCRA 3DMMA 2EDDA 2V9QA 3T65B 2CIIB 2ITCA 3ZT6A 1N5YH 1LDSA 4S2SB 3DV6A 5K9QG 4M1CC 3GKWH 1S7WA 1ZHNB 3BYTA 3SDAA 4LSQH 1X44A 4JQXC 5HDBE 5DHVH 5FECA 2XQBL 2PYED 2FJGB 2GAZB 3V4VH 1DQTA 1N6QL 1ZAGA 3GHEL 5LGHL 4E0RB 3VXMD 5C0EB 3HNSH 1CD9B 1ZVSA 3QIWB 4KHXH 2OR7A 3UC0H 3CJJA 1G9EA 5KTEH 2HVJA 4RQQA 4ZO8A 3GMPB 4OM0H 1AXSB 3RBSA 1M4KA 1IVLA 4XVUC 3AS2A 4ZS7H 1ORQB 4DUVA 2XY1A 2ZG2A 5C07B 3C08H 1URLA 1G7PA 1CL7I 1G1CA 3MV9A 2VLKA 4LCCB 4KK6C 1LE9B 1LO0H 3OAUL 2PO6A 2VLMD 2ZCLL 1OGAE 4QOKA 5I1GH 3C5ZC 1PD6A 1NCUA 3QG6A 4HWUA 3MLSH 3WKNA 4FQPA 4Y4KA 1CU4L 1NBYB 4ZD3H 3CLFH 4RGMB 3VH8A 2RCSL 1U3HC 5ETUB 3QO1A 2Y6SD 1QQDB 4ZNCD 3OB0H 1JNNL 1TPXB 1MFDL 1V7NL 4LLQA 2F53B 4OLVH 3HI1B 1E0OB 2H2SD 4BFGA 1AKJA 5INCA 1T6WA 4KJWD 3DWTA 3CDFA 5F1SA 1FE8L 2ATKB 3MOQA 3CMGA 2EDNA 2FO1A 4OZIB 1AI1H 1XF5A 2R1WA 5F9WC 4OQTA 3C87A 3I2CL 1WV7T 3RL2A 4G9DA 1EHLL 1JUFA 3KPRB 1FYTE 4WUKL 4PJDE 3BP6A 5FKPA 2CR3A 4Y16B 2FATH 1F42A 1QBAA 2XG4A 2J4WH 4F15C 1PAMA 4DGIL 1AH1A 1MJ8H 5K9OB 5EIQA 3W5MA 3EYFA 2NW2A 4UDUA 1RIHH 3AMLA 5GRUL 3EO1B 1DVFC 1FFNA 4MWFA 5IUSA 3B6SB 1R6VA 4JM4H 5ALCL 3C60B 4YHOH 4PRAA 4Y4KC 1SJEA 5C6WH 1V05A 4NQSB 5E1AA 1D6VH 5D9SA 2GUOB 4PJ5E 4YAQB 1JWSA 2J8UE 1LGVA 2Z91A 4JCMA 5TPWH 4XP6L 2CDFB 4HV8A 2ZWLT 4X7TB 4JKLA 1U8MB 1W0WA 3RGVB 4G3YL 3KPNB 4PP2B 5FCUL 4Z78B 3T08A 1RJLA 1HH9B 1RZIB 4HC1H 4YXHL 4MGXA 1M6OA 4P2QB 1Z9LA 5AZ2H 4FQJH 4HLZG 5ADPL 3STLA 2IBBA 5I8OH 3CAFA 2FR4B 1P4IH 1LP9B 3BN9D 1CIUA 4XNYL 1IGCH 2X6MA 5TE7L 4YBQC 3D5OF 4X6BB 1FZOB 4OZIF 3HG1B 4WW2B 1JE6A 3O3AA 1DBMH 5TDOA 3SDCA 1S9WA 5D8JH 1RUAH 1XF4A 3LKSB 5C0FB 3OGOE 5JNYB 4M93B 1LO2L 5E9DA 3FQUA 4R8WH 1DQLL 2YPVH 5FGSA 5IB5B 3E3QE 1IM9B 3NIGF 5D1XA 2WLYA 1XGTA 3KYNB 3HPJA 4OF8A 2FGZA 4B5EA 5EH1A 5BRZE 2X4PB 1CFQA 5IFAL 3UZQA 1KEML 1OAYH 4YDLB 1IAKA 2DBJA 2WM0A 4HWEH 5DD1L 3DYPA 4P2OD 5HY9A 4M5YH 4N9GB 3O6FD 4U6TA 2H32H 2YBRB 2BVQA 3WIHL 1NC2B 3ULUF 5A16A 4DN3H 2I27N 2VDKL 4JJ5B 3IFOB 3OXSB 2A83B 3OWEA 4DVBA 4Y5YB 1F4YH 3GEWB 4X99B 4UU9B 4PJHA 4CU6A 5INDA 4F33A 4HHAA 3ORJA 2DTML 1EPFA 4R96B 1H0DB 3UAJD 4TULH 4NKQB 5JDJA 3G5XB 5ANMB 1BAFH 3S96B 1LP9F 2SEBA 3WD5H 5JPMA 5ESAA 1UH2A 3SDCC 5I19L 2FBJH 3IFNH 4X8JA 4NNXB 5GGQH 4WW2F 5F8QC 1JPST 2ICWB 3B43A 4YEEA 1X7QA 3UTOA 3WN5B 3QPQD 2FBOJ 5HPMB 3PWPE 1ITBB 1NCWL 4O02H 5DS8A 3BE1H 3QYCA 3ZO0A 2ZP0T 5D1XC 3VWJB 2D31A 3WEXA 3NPZB 5C0GA 4W6WB 4Z77A 4GQPH 4HIHA 1UM6L 1TZIB 1RZ7H 1UM5L 4QXGL 4NQEE 4XCCH 3QEQA 1RZKH 5C0CA 1HYSC 4QRTB 1HDMA 5HYQA 2RJMA 4NDMA 1YN7A 4I2XB 5B38B 4TTDD 2NX5A 1NCDL 4OLYH 2G75B 3RDTA 4Z5RB 1U8KB 3VXOB 3F58H 4JFPB 3QRFM 2ESVD 5EZJB 3QXAA 2AV1B 3S34H 3TIDA 3WNKA 1X4XA 5DRNA 4XCFL 1MFAH 4NYLB 2HYMA 4CADB 5HPOA 4Y1AA 4D9QD 4NUGH 5I66A 1FNSL 3L9RB 1MHEA 3DX6B 4LCWA 5ICXB 1KTDB 4X7EC 1XIWC 1RIUH 1MCKA 4HGMA 1G6RH 3HZMA 5ITFB 4A6YB 4YHKL 1KIRB 5J1TC 3K4DA 1OTTC 2HVKB 1G7LB 1UYWL 1NL0H 4KI5E 3SKMA 3K4ZA 4D0CB 1NMAH 3NN8A 1NUFA 3JTTA 3IU4L 1QFUL 3FONB 1KJMA 4YXLL 1EHAA 3U7WL 3TVMB 2X7LB 1A9BB 3U0TA 2W60B 4LSRH 1MSPA 1HEZA 4YWGH 3QDMD 5L8JB 4FXLA 3UTPE 3EUUA 4R3SA 3HR5B 4XPBL 4LARL 3PDOA 3VD4A 3JWOH 3DVIA 2AEIT 2DQIL 3NH7H 5J1AB 4YHZH 1VEMA 3ES6B 3C5ZD 4HIXL 4PGEB 4PRPB 5EBMB 3RDTC 5JXAL 4HFWA 2OSLA 2JIXD 3BZFB 3QXWA 1CLZL 5F6IC 4NBXB 4RGND 1XGPB 2O5YH 4YJZL 5J8OA 4JRYE 3SDXE 4GJTB 4OLWH 4LVHB 5JDSB 3LQMA 2W92A 1NCBL 1B88A 1L9NA 5IMKB 5T1KB 3CGTA 3HE6D 1IEAB 4LVNC 1P84K 5K9JH 3EYQC 2FHBA 3KXFE 5CWSB 5HHOE 4ONFL 3C6SA 4WI6A 2NW3B 2HRLA 3QNXB 1A7QL 1MQKL 1VADB 2C26A 2C7UA 3FCTA 3VXSD 3NFNA 4KK5C 3LPWA 4G8IB 1Z2KA 4UQ2B 1CE1L 4MJIA 1OPGH 2J6EA 3W0WE 4OAWA 2P5WE 2BNQE 5JOFA 1A3LL 2E3VA 3BGMA 3Q1SH 4S1RH 4P3DA 2R56H 2I5YL 2GSIA 1JGUH 1I9IL 2F19L 5J06A 2IJ0C 4JRXE 3MGOB 1JPGB 2AXFA 4CMHB 4DEPB 3FMGL 4PV9A 1C7SA 2WIMA 3QQ3A 4I18A 4MD4B 3O2WH 5JHDA 3ZKXB 5DWUH 3TPUB 4X4YA 3QEUB 2B4CC 2EZ0D 4IOFD 2YUWA 3M1BA 1A47A 1ZLSL 1FVEB 1T4KB 2R0ZH 4FZ8H 1B9ZA 1X3DA 2VLRA 2HLAB 1R3IL 3QUXB 5F8RC 4KZDL 4G9FB 3UYOD 1I7RB 3QUZD 2MPAH 4OCSL 5DK0A 1CDHA 3BISA 1ZGLP 3QZWA 5L2JB 2R23A 3KPPA 1PSKH 5FO7B 3S36H 3CFCL 5GS0L 5DQ9A 4JLRA 3DTXB 1J0ZA 5DFWH 2WP3T 4M48L 2VDPH 5KVEH 3CSGA 1ZK9A 3IS1X 5F1NB 3ABZA 3ROLA 2YPLE 3CK0H 1KC5L 1CICC 4X6CB 4OD3L 4JPVL 1AGBB 3WLWC 1ZANH 3T09A 3AM8C 5E2WL 5HDLA 3OKYA 1P53A 3C09C 4RAHA 1GRWA 1JV5B 1VSCA 2H1PL 2VKWA 4FFYH 1MCPL 3FO0H 4JDTL 2IANA 3LQAH 3BKCH 2VXSH 4M1GL 3RHWF 3RNKA 4EN3D 1HH6A 5D2LE 4PJXB 3VW3L 1BZ9B 3IAGC 3WFEH 4Y88A 4TNWK 1BEYH 3MXVL 1P4LB 1IGYA 1JTOA 2Y1VA 2W07A 2BCKA 5EZIL 5FUOH 5KZCB 4LIQE 4JDZA 5KSAD 4G8GA 3BUYA 1BFVL 4H25A 4HWZA 4EVNB 1FL5B 2DD8H 4JFDE 4Q9RL 1FG2A 3QG7H 4Y19D 1JZ7A 3MBEB 3OKOA 1LNUA 1RZFL 4KVNH 4G7VL 3ZKMD 3L3KB 3F6LA 3V6OE 4I48A 4O4YL 3SGEI 1XFPA 3B9VA 1YMHB 3P9WB 3MACH 5MHSE 3BH9B 1OAKL 1ZHLB 2ZOKA 4JZOA 1MHPH 3RPIB 3VFRB 3EOTH 2QSCL 4JPKL 4F8TA 3TA3C 1Q94B 1D5BB 5IBUG 1ZLVH 3LS4H 4PJ8D 4MA7L 1AGFB 5BMFH 1DLFL 3C6LA 3W82A 4XNXL 1XZ0B 5F3BB 3SN6N 2ZOLA 4BSVB 5IB3A 43C9A 3PABA 5EU5B 4HDIB 1AGDB 2Q8BH 4DCQA 1FZJB 4HKZA 3UPAA 3UZEA 1NCCH 5D7IE 4X6CF 3UYRL 2VL4A 1CLOL 4LCYB 2QHLA 1XCQB 5HYJE 2W38A 1WZKA 2I9TB 1DQQA 3ARXA 4F9LA 3HHRB 4GMSH 4RIRA 4K3HA 4PRIB 1WCBA 4OGYH 1WBZA 3EHBD 3S3SA 5DHXB 2QSQA 5EO1A 1GHFL 1IAIL 4UT9H 4PJXF 4Z7VE 4G6MH 4NN5C 4GAJL 3QUYD 1AGEB 3TH2T 4RGOH 5T1DL 3V4UL 1KCVL 3G08B 5IB1B 4A6YL 2HFFB 5K59F 2R2EA 1YEKL 3BMVA 4C4KT 2EC8A 2BSTB 1S7QA 3NCEB 1RD6A 5GRVK 5JW3L 4JO3H 4M7ZC 5C0JA 1KENL 1MRFH 2EKSB 1KLGB 1B0RA 1D7FA 4PJEE 3HB3D 1T0MA 3EW3B 2AJXH 4OQ1A 4IIQA 2X4UA 3DVNB 4QRRD 5MEND 4PGCA 4NQTA 3BKJL 1FRGL 3GI8L 4TUKL 2PF6A 4JKPL 3WCYA 3ARDC 4R0LA 5E70A 5KVGL 3JV4B 5EFIB 5HI5D 1Q0YH 3ULSB 3ZE2E 4MA3B 8FABA 4O2CA 4TPRL 3IDIA 1T2QL 4NO5A 4OCYH 1TFHA 3QDJB 4DOHE 1OQOA 1K3IA 5EU6B 5L8LB 4HJ0C 1FNFA 4BZYA 5SWZD 3F6IA 3U0PB 1IC7H 3IRZA 1F58H 5TFSH 1JN6B 3QXDA 1KT2B 1S9VA 5BOZG 4YR6A 3MO1B 5B21A 2KQNA 2XACC 3O4LA 7CGTA 2MHAA 5CZXC 1JYWA 1OM3H 4F9LC 5CIPA 3WIFA 2XA3A 5LXGL 3D3VA 4NQXA 4BUGA 1A4KA 3W2DL 2MCPH 1EXUA 4K9EC 3KPSE 1J0IA 4XBPA 5EG6C 4L3EB 1TCRA 5H94A 1EZVX 1AR1D 3PWUA 3KPTA 3UTSD 1L7TH 3KYOA 2NTFB 2YXMA 4PGBB 3B2UC 1CVRA 1RZ8B 4RAUB 3D0LA 5F89A 4M61A 4JFZL 4MAYD 1DLHB 4U1KA 2D7TL 4HPYL 1BVKB 4IRSA 2ARWA 3OAZH 4KROB 1RUKL 4P57B 4ZTPH 1DEEB 1P1ZA 3MTRA 5E8NA 4ONHA 2QQNH 4M6NH 4PLKD 1ZT4A 2XRAH 3EDDA 4P23D 2JB5H 5DGQA 3ESVF 2P48B 1K6QH 1XH3A 2GK0B 4IIQC 5GIRA 3S37H 3CVIL 2VDRL 1ZLVK 3KNBA 1P2CB 1BJ8A 1J1PL 4R0LC 5DMGC 1VFAA 4PGDA 5GPRA 3N0PB 2XKNA 4I3SH 1NSNH 5D1QB 3DBXB 5FKAB 3HTLX 2X4SB 3BO8A 5I1LA 3HNTH 1EMTL 4ETYA 4PJ9C 2BJML 4R4FL 1VCAA 4KV5E 2AV7B 3P9MA 1IAOB 1ZA6A 4PV8A 3TBTA 1FVDB 2F5BL 5KVDH 4M8VA 3SOBH 1A3QA 2NY5C 4L4VE 2H6PB 4P48A 1N26A 3EOAB 1A14L 3EFDL 3IDNA 3STBA 4KQ3H 5ISZD 5DJ2A 3X13B 3IU3A 4KAQH 1X5XA 2DIBA 2ZSVB 2ZZUT 1PBYA 4ZOAA 1F6FB 4O2FA 2GJ6A 4PTUB 3I9GL 2EDXA 4XMLL 1E6JH 4OLUH 4DVRH 3REVB 4BFBD 3U4BL 1BBJA 3MREB 3FQTA 1H3WM 1T1YA 5FOJA 4S1DD 5HHVH 3TIEA 4TNVK 1OGAB 4YO0A 3H0TB 3CVHH 5TGBA 2NY7L 5MEOB 4OM1H 5JA9A 4HH9A 3GSRB 4HUXA 4MCYA 2XTJC 5CHNA 3ELAT 4APQA 2DI7A 1RK1B 4JFXB 4NRYA 1HINL 1WIPA 1F4WL 4Y8AA 1ACYL 3TO4B 4GAYB 2PXYD 4YDJA 1F8TL 1EO8H 4B50A 1PKQA 4HIJA 2B5IB 2CKBL 5ESVA 4FXGB 5LJYH 1W72H 3BGFC 5ACZB 3NFPB 1EJOH 2NXZD 4XPGL 4RDQF 3MV7D 4XP9L 2VDMH 2FECI 5HDBF 3LQZB 2DQCH 1FYTB 2VYRE 4PJDB 2B1AL 5I8CB 4HZLB 3X3FL 1RHHB 5T3ZL 3TJEH 3TP4A 5TE6L 5D1ZD 1NJ9A 3OKLB 3VFMB 3LH2L 2LV4A 4L3CB 1S7TB 4LRNH 4HUVB 1A1OA 3OAZK 1FN4A 5C0IB 3NA4A 2DQGL 2NY6B 3ZL4L 5C86A 4NN6C 1B6DA 2OQJA 4PJIA 4B53A 1XF3B 3UJIH 3WLBB 1BWMA 2DQTL 5E7BA 1J10A 1T1WA 4MDIA 3MLZL 5A40E 3TO2A 1UVQB 2YEZA 3PQYE 2BY2A 3GSXA 5GZOC 4OIBA 4PJ5B 1B2WL 2LE9A 2J8UB 4K94H 1XGRB 4APQC 5ICZB 5H35B 3RI5F 1HKFA 5I6XC 3QULA 1IAII 1JFQL 3RIAF 3O41B 4NQVB 4HFUH 3HAEB 3G6AA 4HJGA 1TJIL 2YD6A 4XBEL 2FJHA 5IBLD 4WHCA 4HXAH 4FQHA 5F1IA 2R0WH 3PWNA 1GZPB 5J89A 4RFEB 5FGCE 3FN3A 4ZUWB 1BQHA 1T83A 2BDNH 1YPZA 1P6AB 4ZUTA 3QIWD 2WUCH 3GNMH 2NY2C 4PJAA 1WC7B 3SKJL 4NZRH 3NMEA 1K2DA 1MCJA 2A1WH 3VFSB 1BD2A 2Y5TB 5JOPE 3NBNA 2Q6WA 4MD0B 4PJDF 1X5FA 1AFVH 5B4MD 1G7IB 4M6ML 3QPXH 1C12B 4FXKA 1T5XA 5C07D 1KB5B 1UJ3A 1AP2A 5TE4H 4OD2A 3MV8A 3CFKB 2Y06L 1AD9B 2DRUA 4P2OA 1SY6A 3LMJL 3O6FA 3P77A 2L7UA 4HS8L 5BRZB 2HJKA 1HWHB 4I4WB 1IMHC 4X0KB 1RFDH 1YEGH 1GYAA 3U0WL 2DKUA 5EOQH 3WS3B 2HA1A 5EU3B 1F11A 4OF7A 4Q9QH 5DJDB 5IQ9B 2DTSA 1OVZA 1LO4L 4XCNA 3TNNB 3H42L 4NZUH 4LVHC 4YHLL 2F53D 2J8UF 3BN3B 1WF5A 5GGSB 2X1QA 5BZWB 4DKEL 1K5NB 3PWJB 5EC2A 1GGCH 4AENB 1MAMH 3H7BB 3RVVD 2QQKL 4L29A 4ZS6C 2VWEC 3ULVE 5GRJL 1U91A 1NBZA 4ONGH 3RP1A 5F21B 2H8PA 3GJFB 2ATPA 2CRZA 1JPFB 3PGCB 3JTSA 3TN0B 4HK3N 2YA2A 3QDGE 2UZIL 3KPRD 4G42B 5DDHA 2VN7A 5ID0A 2XI9A 3NFSL 3OF6D 4Y16D 2APFA 3LY6A 4NCC1 3MRHB 3JUYA 1GC1L 4CMHC 1YEEH 1BM3L 1RMFH 2OK0H 3RL1B 3ZKXC 1MH5A 5HHQB 3BX7C 2A0LD 3KR3H 3PWPB 4N90E 1IQWH 3B8SA 1UJ3C 4FQXA 3W11C 3ROOA 4PYGA 2C3XA 3TFKD 3D2UB 3WIIL 5C2UB 4UB0H 4ODTL 2XV6B 2UVFA 3D69A 4M7LH 5T33H 2ESVA 4AK1A 4QHKJ 5GZND 3C60D 4JO1H 1YEHL 3O9WC 4NQEB 1ADQL 4U1JB 1RUQL 1HHJB 2BERA 3P4NB 2FX9H 5DVKA 4LLMA 1BGXL 4CVXA 4G43A 4NNYA 1CXLA 3EZ8A 1N59B 4JGUA 1OSZB 2VDQH 3ZHKA 1FFOB 4MDJA 3ULUD 2YWYA 4MA8H 4GKNA 5IEKA 4EI6B 3K46A 1OAZH 1VB9A 2OTWA 3RGVD 5IB4B 5DA0B 3V0VB 5KVFH 4OZ4B 4UT6H 1BIHA 1KPRB 4YK4C 4P2QD 4DWHA 3VMOA 1O7VA 3MRFB 3S6CA 2VTFA 4U6XB 1Q9WA 1VESA 3DV4A 5CS7A 4YDVB 1OHQA 4KPHL 4HCRL 1F6AB 3VGEA 1NAMB 3HG1D 4Y7MA 1WBYB 2VIRA 35C8L 3MJ9A 3MR9B 5IBTH 3QDMA 3SGKA 1JHLL 5IVXE 4KHTL 1S9XA 1AQKH 3VG0H 5HVHC 1SYSB 1PDKA 4OF0A 5KJRL 1LQSR 3MBEC 3BDXA 2AEPH 1N4XL 3MYJA 2Q8AL 3U83A 1QLFA 4FQXC 3H3KA 1IM9D 2DMCA 3QIBB 5E6IA 1E4JA 4U6YB 5JQ6H 5JW4N 1GGBH 4Z7WA 3AGVA 1IQDA 4JZJA 1M1SA 1S7VB 4H8WL 1NFIB 4CRPA 4U1MA 1YQVL 3SKUD 4ZNEA 1KJ3H 2AERT 3KPQB 3UJJL 5CUSL 1INEL 5CLWA 3ZDYE 3HE6A 4LASH 1U8LA 2OZ4L 1P6FA 2VC2H 1NC2D 4AZ8A 5CSBA 3VRIA 1EERB 3CXHK 3DVGB 1VGKB 4PP1D 4EOWL 4JRYB 4Z18A 3SDXB 3TJHD 1I8LC 4MD5A 3CDGB 2GITB 4RX4A 1NGYB 2R8SL 3A6BL 4ODWA 4AM0B 3KXFB 3SGJC 5JLZA 5DJ0B 5HHOB 1SEBA 2BY3A 3AAZB 1OB1A 4GKSA 4P5KB 3BJLA 4OIIH 5KOMC 1PLGH 1FPTL 1N6UA 2Y4SA 4U0QB 3DURA 4XZUA 4KY1H 2H26A 1KPUB 4BQ9A 2FJFA 1UM4H 3W0WB 2V2WA 5KBNC 2VDOL 2P5WB 2BNQB 1IZJA 4FFWC 1D9KB 2IFFH 4FMFA 1HXMB 2D2OA 4HK0B 1HHKA 2A74B 1MVFA 4HUUA 4KI5F 2DIAA 4YDIH 3T0XA 3VWJD 5E6IC 3QI9B 4J6RH 2X4OB 4JRXB 2WIIB 4CJ0A 1R0AL 2VQ1B 3CSPA 4ODUB 3MJ7A 2CSPA 3C8KB 3FRPA 4H5SA 5L0QC 5B38G 1G1YA 3GBMH 1U58A 1IJ9A 1FNGA 1I1CA 2J12B 3RVUC 4CU8A 2DQHH 4H0IA 1EIBA 1X5HA 3BQUA 1R5VA 1TITA 3RWEA 5AYUL 1IC5L 3SKOB 4LPCA 1NMBL 1U95B 1DQML 3Q6GH 5ABDE 2HWZL 5J11B 4C83A 2GK2A 3O6ML 4JFOA 3ARFA 3ILPA 3KG5A 1AD0B 1T04B 2C4XA 4MNHA 5J4MA 5BS0E 3DETD 5FDYA 1J1XL 4LLUB 3CPLA 5FO9B 4EN3A 3MJ6A 4LBEB 5HHME 8CGTA 2HT4D 3BKYL 2YPLB 4QCIB 3VMNA 1QVOA 5JORB 1EEYB 2EYTA 1H3TA 4GRMB 3G5YA 4BKLB 3SDXF 4JFHD 3OQ3B 4JY5H 2AKRA 2N56A 2O5ZH 5FA3A 5KSAA 3AFLA 1GVIA 2Y7QA 4CJ1A 3QA3A 3UDWC 3DX9A 2FHFA 3B9KB 5D2LB 2NZ9D 4KMQA 4R4ND 1N5AA 1KFAL 2VAAB 4Q6IA 2FEDD 1FZKA 2PW2A 1WBXB 3VFTA 3TVMD 3MMEB 4NGHL 4KROC 4NCDA 5CEZL 5DMKB 4MXQD 4JFDB 3RUGE 3GO1L 1G9NL 1Z6JT 1QKZH 3BWAA 4D8PA 2PW1B 4PJ8A 4OD1H 5BJTB 2P8MB 1PEZA 4GUPB 3BQUC 1H3XA 1IGMH 4PRPD 5I76B 2VXTH 1Z9OA 4XNMB 3VI3E 3CH1B 4U1SA 4P9ML 5JXEA 4XWGH 1R24A 2E27L 1GJIA 1NGXB 3ARFC 5JR1L 3PIQB 4GRLA 2R1XA 2XOTA 4GW1B 1LVEA 4L8DB 1Q72H 1A7PH 3MRMB 3FO9A 1KCUL 5I1AB 3ZTJG 3MRPA 3SDDC 3MNWB 4KVCL 2OP4L 4G80B 4OQTH 4E41D 5T1KD 3HC3H 3JV6A 3JWDC 1DDHA 5HYSB 4X6FA 3VFUB 1WIUA 5DMIH 5D7IB 3QUYA 4K7PY 4HQQL 1NPUA 5HYJB 1NDMB 5F7FA 4JREB 2QV2A 3O0RL 2AJZA 2LU3A 5FDWB 3VG9B 4KZEL 1EGJA 2H9GB 1MAKA 3TZVA 4FQ1H 4UDTA 5CZVL 1U42A 5DQDH 5E2JA 2ED8A 4HGWB 3MLXL 3TEUA 4RZCA 4WFGE 5DLML 3CXDL 3IDGA 3HZYA 5FUCE 3NABH 5D2LF 3CX5J 4KQ4L 2JJTA 2VXVH 1NAML 5D7SH 4N8VG 3SE8L 3FQRB 1MJUL 1KLUB 5IHZB 4QRRA 5GHWH 2VZUA 1E4XL 2D3VA 4IMLA 5AD0B 3CFDA 4UILH 1I3VA 2DQDH 4R9HA 5I1JL 3BRDA 2V17H 1FGNH 2JF1A 4R7DA 1S7RB 4AYFA 4ZFOB 5CSGA 1RIVH 3QUXD 5C6TH 4G9FD 4L8CA 4PJEB 1RJZB 4XX1G 4M43L 1T89A 3ALWA 5SWZA 5JO5B 4P2RA 5JXEC 4I5BB 3KJ4C 5ACLA 2FNBA 3QCUH 3VFWB 4GRLC 3C2SA 4PREB 4HBCL 4XI5C 4YC2B 4U1GB 1A6TA 4YQXH 2R2CA 1A02N 4AQOA 3CFJB 3D9AL 1NDGB 1AJ7L 3QH3A 4DOHB 5CD3B 1VHPA 3FB6B 2OTPA 2R29L 3QRGH 2QL1A 1C1EH 4G8FA 2O61A 5D7IF 4ZAKA 1F90H 3IGAB 5DT1L 3TZVC 5C71A 4P5TC 2H32B 2X4RB 4MAYA 4GKZB 1X4ZA 1EEUA 1HSBA 3AREA 4LEOB 1UFUA 1KNOB 2PN5A 5AUMA 4WI4A 4I3RH 5F9OH 2VE6B 3KPSB 1N2RB 4KKBC 4JO4L 5KZCD 1AXTL 1A6WL 3NZHL 4PY8I 3CIQA 4Z7VF 3CSBA 5GS1A 2IFGA 4WWKA 3F7VA 3C5SB 3WFCL 3LKOB 1BJMA 2OI9B 1QNZH 2YPKA 3KGRA 3KS0J 1GZQA 4WRLA 3T4YB 4YHML 3BOVA 1SEQH 4OF5A 1KJ2B 4MJ2A 4ZYKB 3ARGB 5E0QA 4WFED 1T1XA 3BD5A 4IOIB 1N5YL 1VFBB 1EEZB 4LSSH 1YQ2A 3WS6A 4NKIL 2R69L 4Q0XL 1JGEA 5EBWA 1NFDE 2FWOA 2PCPA 5F88B 4TSAL 2ED7A 4PJEF 4MS8C 5E8OB 3OL2A 3L3IB 4KK8D 3V4VL 2PNDA 1RUMH 5D7JB 3GMMB 5GXBB 2YA0A 4KHXL 3UC0L 1UWGL 3V6FA 1F4HA 3U9PL 1IKFL 3HLAB 1SJHA 2FSEA 1RULL 1UQSA 3ZE2F 1I7TB 2EDYA 3GI9L 3RWGB 5BW7C 2YD7A 3LEVL 5ISZA 3WUZA 4PY7A 2YK1L 3U4EB 2B39A 5FM4A 4U1IB 5CMAA 5D93B 5CCKL 2X4TA 3RJQB 5E2TL 4ZAKC 3OJDA 3L3GB 4PRID 4L4VB 1OTSC 1CR9L 2VLJE 2YA1A 5GJTL 3UO1H 3AREC 2IAMB 1K8IB 3O6LH 3MLSL 3WSQL 5FGRA 4XXCC 5E2UL 5EZOH 4DGVL 2WUBH 4N9OB 3GB7B 4JN2A 5DZLA 3CZJA 5JIPA 3IDYC 3A6CL 4Y5XA 3SE4A 5F9JB 2A6JB 4GXUN 4BELD 3MNVA 3FO1B 4WWKC 3EFFA 3IFPB 1HQRB 1LO3H 3GMRA 3O6KH 3MRLA 2XWTB 2MQ0A 1YMME 5KN5B 1CK0L 5E8DH 3TT3H 2VKXA 4M4PA 4LIQL 3WS6C 1LO5A 4NM4H 1G7HB 4ISVA 3L95B 2ZKHH 3RZCB 4JFYB 4XNQB 1AQDB 3T4AA 4L8BB 1S5HB 4ZPVB 1TVHA 3QDJD 4RFNB 2BMKA 5EU6D 4M62H 4K7PH 1A7OH 1FL3B 1QR4A 5DQJB 4I0KA 1KV3A 4WDIB 3BSZH 3LRSA 1OTUD 4QRSA 3LKRB 1CYGA 3RWDA 1KBGH 1BFOA 2YMXL 4FTVA 4KV5F 5E2VH 1T5WB 5D1ZA 2LAAA 5TDNB 4L8SA 2ICEB 2FLRT 5TQ0H 3TBSB 3L5XL 2ENSA 4BJLA 4F2MB 4L3ED 1G7QA 1ONQB 4MQ7B 3P0YH 1OF2B 4Y5XC 3SE4C 4XNUL 4H26B 3WIHA 1T66D 1TJGH 2W65B 1H5BB 4X7SH 3OHXA 2AK1H 1J0JA 3VXPB 2C4FU 3R06B 4NNPH 1IGIH 5E5MB 4XAWH 3EYVA 4MHHI 4XVSH 4FFVD 5DTFB 2H2PD 4QRQA 4KROD 4WNQA 4AH2B 4BFIB 1HKLL 3V5DA 1HNGA 5DEZA 4U2ZA 5IW1B 3O2VH 1KEGL 4KRLB 2CLVB 4L4TE 1CLYL 3OKEA 4MXWH 4NT6B 5D7KD 4TOYH 5JA8B 3V0WH 1MCWW 1J0HA 2V7HB 3T65A 1D5IL 1DSFH 2CIIA 2VJXA 4NO3B 3RGHA 3S97C 3BRFA 4BK4A 4ZUUA 5DRXB 3V79C 1P4IL 1PY4A 4QY8B 1JRHH 4TNWF 3VD3A 4O2EB 3P73A 3PQYB 5JOEA 1FQ9C 4N0FB 3CSYB 2FJGA 2GAZA 5D1QD 5LGKA 1OOAA 3TNMB 1II4E 5C0EA 5KSBE 2A38A 5FYKL 3HMWL 4NPYA 4P4KB 3QIWA 3VFGH 1OAUL 3SPVA 4RDQG 3IF1B 3ARSA 3K1DA 4W6XB 3B5GA 4WIQA 1TNMA 3U6RB 4LHUG 1AXSA 1G7MB 4R26L 2J6EH 5FGCB 2X10A 4LCUB 1ORQA 4XHJD 3GBNL 4LHUD 3VWKA 4V1DD 1Q9KB 5IWLA 2WWMC 2DLFH 4LCCA 1MREL 4DTGH 3I6GB 4XMPL 4WFFE 3N85L 3JWNC 3T04D 5DJXB 4YIQB 1OAYL 3QIBC 5DZOA 1XCTA 4IM8A 5ACMA 1NBYA 3U46A 4ENED 1UZ8B 5I18L 5IHBA 5ETUA 2EH7L 1YNKL 2VXUL 5EZLB 4AIZB 4N1CA 1L7IH 3EO9H 1FBIL 3W9DB 2JJWA 4JR9L 1MFNA 3VGAB 1MPAH 2OL3L 2P49B 5EO9B 1WWWX 2ADGB 1F4YL 3MV9E 2VLKE 1V3LA 1REIA 5C08A 2N7BA 3ZTNH 3ETBF 4JVUA 5I1DB 4NJ9H 1KG0A 1KJ2L 2C3VA 5B3NA 3IFNL 3THML 3BDBA 1RY7B 1NBVH 2CDGB 5E8PA 4XXDB 1LK2B 3ZKQD 2ERJC 4UAOC 4G7YL 3TO4D 3KPRA 4GQ9H 3DROB 4E42B 2ZJSH 5HGDB 4Y16A 3OF6A 4JG0H 1L0QA 4ZDHB 4DKFH 3DYOA 5K9OA 2MJWA 3VWKC 1KJVA 3TH4T 2ARJB 1CN4A 4OZFH 3QDGB 3AUVA 1UB5B 4HMEA 1FYTD 2WK2A 1BVLB 3B6SA 1SYVB 1A6AB 5GSRA 2NR6D 1SVCP 2R1YA 3IT8D 4JDVB 5ILTH 4OLYL 1LILA 2AJYH 4R2GC 3GK8H 1G84A 1F4XH 5I2IB 3EO0A 4XPAH 1NANI 2GUOA 2DKSA 2NY6D 3K8MA 1NFKA 1MHCB 1ETZB 3U7YL 2DLGA 3MJ8A 4FQIH 3BESR 1INQA 4WCYL 1WZ1H 1HHIB 3RGVA 3KPNA 4PP2A 4Z78A 5D72L 3HUJE 4XPHL 1RZIA 1HH9A 4NUGL 4FZEH 5C2BH 4D0DA 1HXYA 1U92B 2NYYD 1T2XA 1FGVL 4P2QA 4PJ5D 3HAEG 1Z5LB 1QA9B 1QR1A 3QNZA 1RIUL 2KH2B 5BZDA 3SEPA 1EO7A 1OSPL 2A9ML 3J7HA 2G5BB 2FR4A 1LP9A 3C8HA 4MS8D 3MLTB 3FRUB 1HNFA 2CLZA 5MP6H 1FZOA 3HG1A 5I1KH 5L9DH 1K4DB 1KCSH 4Z0XB 4LKXA 1RJYB 4H88H 4YDKH 1JHKH 3LKSA 2A73A 4OGXH 5C0FA 5JNYA 2WANA 1IL1B 5C9KA 2ZUXA 4K8RD 1P9MA 1Q1JL 3ULVF 2GJZB 3FB8B 3B9KC 4URTB 5IB5A 4P5MA 3TCLB 3T1FB 3QEHB 4Z7OE 1IM9A 1BFTA 5F70A 3ARYA 1SMAA 2P46B 3KYNA 5IJKA 4D3CH 1ZHBB 4P3WA 1BF2A 2IBZY 4JO2L 3CMOL 5IVXB 4YHZL 3OKMA 3LS5L 1A6PA 2EXWD 2OS7A 4LOUC 1I1AC 4A2LA 2DICA 3P0VL 4XPTL 3MFFB 3LN4A 3CLEH 3BEVB 2IGFL 1MJJB 1TQBB 4N9GA 1A7BA 2YBRA 3RAJL 1IKNC 4HT1H 3B5TA 5BRZD 5E56A 3L5HA 1NC2A 1B0GA 1FYHB 1CVSC 1S3KL 4XCEA 3OMZA 2ZCHH 3D25B 4JJ5A 4Y4FA 3QHZH 1LE5A 2P5EB 3G5VA 4UU9A 3PL6B 3JSSA 4OCMC 1WEJL 2XQYK 1DFBL 1BLNB 1PW3A 2OR9H 1H0DA 4L1DA 4R96A 4PR5B 1OPGL 3D87B 2HJLA 3G5XA 4JY4B 4RISL 5ANMA 5GRWA 5ALBL 4KKLC 1JYVA 2HN7B 3ARBB 4EI5C 5CIPH 4NNXA 1OGTB 4LGSB 4JREC 4NC2B 5GRXG 3WN5A 1V3KA 1L6ZA 1GPOL 4K3DL 5IVZA 5JPNB 1I4FA 2E7BA 5HPMA 2AJUH 4TNVF 1FNAA 3TN0D 4OSUL 3VFPB 3T0BA 3VWJA 3HPLB 3MLWL 5AWNH 5GS0C 3FB5A 3FB7A 2E6JA 2Z8VC 1AY1L 1NUNB 4DN4L 1D5MB 1CG9B 1EBPA 1QACA 1TZIA 3MUY1 1EEQA 1T7VA 4OF6A 5DURD 4QRTA 4KJQD 3PWPD 1PSKL 5IVXF 5M95B 4PUBL 5HI4D 5I1EL 2A2QT 5IQ7L 1DANU 2Y25A 3LHPH 4OCWL 5GJSH 2BOCA 3VA6A 3BDYL 2G75A 4Z5RA 3D2UD 5KVEL 1U8KA 3VXOA 1Q9LB 2NY3C 4JFPA 4YX2H 4GW4A 1FFPB 1TJHH 4UV7L 5EZJA 4BFEA 5IMOB 2AV1A 5CILH 4NQED 2HRPL 5KANG 4LLYB 1MOEA 1ZWIB 1MUJB 4M00A 4OTXH 1T21A 3MRIB 4Y4FC 3BIKB 4LSVL 2YR3A 4NC0B 1J5OL 1JJUA 5SX5K 4U1GC 2MOVA 3RX5A 2BRRH 5EO0B 4UINH 1DBJL 3ZDYF 2CQVA 3DX6A 1KTDA 1BEYL 4EUPB 1XGYL 4A6YA 1ORSB 2NX5E 5ITFA 5BS0B 1KIRA 1WLHA 3O2DL 2HVKA 3QHTC 4K23H 1G7LA 5HHMB 4MVBD 1XR9A 2F58H 3MLVL 3LKQB 4B7LA 1RPQA 4D0CA 2KZ1B 2YD5A 1TLKA 3FONA 3RY6C 4DW2H 3MUGB 3TVMA 2X7LA 1A9BA 4EXPX 3B8YA 1QEWB 1U8PA 3QIUB 1NGZB 2NTSP 2Q3ZA 2VDLL 1Z3GL 4UIMA 4Y1AE 5IW6B 3UTTD 5KW9H 1G6VK 3MROB 2AK4E 3EYOB 3AXLB 5LQBH 3MACL 7FABL 1FH5L 2BFVH 1GGIH 3ULVL 2FGWL 1S7UA 4KI5D 3HR5A 1ERNA 2AI0H 2CUIA 4LCWE 4WI2A 1A3RL 3G04A 4WEUD 3NCMA 5I1HH 3QIBD 5J1AA 3ES6A 4PRPA 5EBMA 1W72B 3REWB 3RUGB 5BMFL 3BZFA 4NRZB 3GFUA 4KK9C 3GSNB 3PWLB 3UTPD 4JHWH 3O8XC 5HGBB 4AEEA 4EZMA 2Q8BL 4JANB 4F58H 2FRGP 1NCCL 4YEFA 5BXFB 5JDSA 3ZYOA 1QFOA 4KI1A 4YHNB 4R4BA 2CR6A 4I0PC 3C8DA 3VXRE 4E41A 5T1KA 1IEAA 1UXWA 4RWHA 1FNLA 5CWSA 3NIDE 3V9FA 5LBSL 1E6OL 3W39B 2NW3A 1VADA 5FHBL 4OZGE 4TN9A 5EPMB 2VLLA 3SGDI 3RY4A 5TQ2H 1J8HE 1YZZA 4C54A 4L9LC 1NH6A 2R4RL 3QDHA 4PBWD 4MNQA 2Q86B 3KXFD 2IAMC 4JHAL 1JL8A 3MGOA 4DK6A 4RNRB 4TSBL 5GGVY 4ODHL 1RVFL 5IESH 3BIAX 2FIRT 1BECA 1N8ZB 2GIYA 3TPUA 1QRND 1TDQA 3QEUA 3W0WD 4N8VA 4CL7A 1W2KT 2P5WD 2BNQD 1QFWL 2Q7NA 3V5KB 3LVEA 1D9KD 1T4KA 4CNIB 5LWYH 2HLAA 5LAXB 2J88H 2HTKC 3HZKB 3QI9D 1EK3A 4JRXD 1I7RA 5JUEH 4MJIE 3C5JB 3BI9X 5J12C 2IPUK 5L2JA 1DN2A 1C16B 5FO7A 3EYSL 4J3VA 1FDLL 4HEPG 4XWOD 3DTXA 3CX2A 4M7KH 3RUGF 3JZ7A 1ZS8B 2RFXA 5F1NA 5TFSL 1C5DA 3VXQB 3OGCB 3HE7A 1IFHH 1FCGA 1AGBA 4U6VH 2Y07H 4YHYC 4HLZH 3L7EB 5JW5B 4RFNC 5AYQA 2I26N 3VI3F 4WV1A 2VLRE 3R0NA 1NGPL 3JWOC 5EORH 5ID1B 4OCLC 5GSVB 2HLFD 4PJXA 1BZ9A 2AXGB 4LK4A 2K1MA 3MXWH 5HHNA 1NEZB 4NZTH 1MCDA 1P4LA 4M5ZH 1OCWL 3A6OA 32C2A 1JF1B 2JTDA 3RU8H 2DWDA 4H20H 1JGVL 3W5NA 3EDFA 3KLHC 4EVNA 1FL5A 4NRXB 3WUWA 4P46B 4AG4L 1F3JA 1Q9OB 1S9YB 3SCMA 3U82B 5CINH 2OM5A 2JB5L 4LLDA 3MRNB 1ZGLB 3HS0A 4YFLI 5IK3A 3AB0C 1IT9L 4ZXBB 1YMHA 2IANE 3RTQA 3BPCB 1SY6H 5I16B 1QYGL 5L88H 4XP1L 3S88L 2IQAA 3RRQA 1ZHLA 3JUZA 4JFDD 4MZ3A 2DWEB 2J3SA 3RPIA 2QHRH 2MNUA 3KLAB 2ZUUA 2D4FA 3DX8B 1CZ8H 1UWEH 1D5BA 4LDEB 2CKBA 4BZ1H 3QUMB 1A2YA 4G8GE 3J8F7 2QKIA 5F93C 1AGFA 4MXVE 5GISL 2ADFL 5FHAL 4PRHE 3HE7C 5C7XH 1CDBA 5MHSD 1HWGB 2AJVH 4GAGH 4BSVA 3HZVB 3N1MC 3R1GH 3NA9H 5EU5A 2OTUA 5FB8B 2ADIA 4U6HA 5HJ3B 4HDIA 4I77H 3SOBL 1FZJA 1NFDB 1WAAA 1C08B 3HFMH 5HHXH 4WV1C 5ECJE 2OCFD 5LG1A 2I9TA 4HUNB 3N9GL 4Y2DC 5HYSG 4PRIA 2NY0C 3SO3B 2NMSA 5CJQH 5LGJB 1YY9C 3LZFH 4J2XA 4KAQL 5D6DA 5FCSH 2DQUL 4JG1H 4PS4L 1DBBL 1ND0B 5B39B 2BVUA 1P84J 4JM2B 1AGEA 1E6JL 2DYPB 3QT2A 5HYJD 1NLDH 1C8PA 2CJUH 4GSDH 5IB1A 1CXKA 3SCMC 3C2AL 2VLJB 3M07A 4IMKA