4JFKA

Increasing the efficiency efficiency of ligands for the fk506-binding protein 51 by conformational control: complex of fkbp51 with (1s,6r)-3-[2-(3,4-dimethoxyphenoxy)ethyl]-10-[(2-oxo-2,3-dihydro-1,3-benzothiazol-6-yl)sulfonyl]-3,10-diazabicyclo[4.3.1]decan-2-one
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Increasing the efficiency of ligands for FK506-binding protein 51 by conformational control.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 34
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4jfkA00
2PV2A 1QPFA 3O5JA 1J4IA 1NMVA 4DRIA 2KFWA 2XP3A 2ZQUA 2RUDA 4JYSA 1NSGA 1J4HA 2PPOA 2VN1A 1FAPA 3O5KA 3JYMA 2ZQVA 4QIBA 1JVWA 2XPBA 1FKKA 1QZ2A 4TW8A 1Q6UA 1D6OA 1C9HA 1FKGA 1N1AA 2DG3A 2VCDA 2ZQSA 4JFKA 2MPHA 5HW7A 5HWBA 1KT1A 1L1PA 2DG4A 1T11A 3KAIA 4ODLA 1R9HA 4O2TA 2KE0A 2F4EA 3UQAA 4G50A 3TC5A 2RSEA 2PV3A 2XP4A 2K8IA 2PPNA 3UQBA 4DRNA 1M5YA 1P5QA 3KZ7A 4R0XA 3NTPA 2IF4A 4ODMA 3VAWA 4JFLA 3OOBA 5I98A 4LAWA 2MLYA 2M1IA 2F21A 4NNRA 3KCEA 3CGNA 3KABA 4W9QA 1FKIA 2MLXA 2KGJA 3NI6A 2FAPA 2KR7A 2LGOA 5DIVA 4TX0A 1FKJA 4TW7A 1ZK6A 1FD9A 1Q1CA 2ITKA 2L2SA 1JNTA 4N19A 3UI5A 5DIUA 1TCOC 2RURA 2MLZA 3O5OA 4DT4A 2ZR5A 1FKHA 1FKLA 4ODKA 4JFMA 4GGQA 4DRMA 1BKFA 4DRHA 2XP8A 2LKNA 2RUCA 3MDYB 3UI4A 1U79A 1FKRA 4ODOA 2XP5A 3O5PA 3O5QA 1FKBA 3IHZA 4GIVA 4U85A 4BF8A 4C02B 1FJDA 4TYOA 2KO7A 2Q5AA 4DIPA 4MGVA 5B8IC 3O5LA 3CGMA 4JFJA 1FKFA 2MF9A 1ROTA 2LJ4A 4DRJA 1YATA 4J4NA 1Y0OA 2MNTA 3O5FA 2DG9A 4LAVA 3RGCA 3TCZA 2JZVA 3ODKA 1D7IA 3IK8A 1PBKA 2KI3A 3PRBA 4DZ2A 1EYMA 2OFNA 4IQCA 3I6CA 2PV1A 5DITA 2XPAA 2XP6A 3EY6A 1J4RA 2F2DA 1BL4A 3H9RB 3KACA 1HXVA 2ZQTA 4IQ2A 1J6YA 1EQ3A 4IPXA 3IKDA 3UF8A 2RQSA 2UZ5A 3O5EA 4QT3A 3RFWA 1D7HA 3O5RA 4DROA 1B6CA 4G2PA 4LAXA 5HUAA 2AWGA 3O5MA 2ZR4A 1ROUA 2D9FA 4FN2A 1YW5A 4DH0A 5HW8A 1D7JA 2M08A 5HT1A 4ODNA 4J4OA 3WH0A 5HKGA 4QT2A 2PBCA 1QPLA 1A7XA 1F8AB 3FAPA 3KAFA 2N87A 2RUQA 3NRKA 1Q6HA 4U84A 1FKSA 5J6EA 1PINA 3JXVA 3B7XA 1NMWA 4ITZA 4DZ3A 4TW6A 5HWCA 3O5DA 4DRPA 3LUOA 1W26A 3KAGA 4JFIA 4DRQA 4FAPA 1Q6IA 3GPKA 3O5IA 3PA7A 2XP9A 1ZCNA 3KADA 3JYJA 5HW6A 4DRKA 5BXJA 4MSPA 5HTGA 5D75A 1FKDA 3O5GA 3UQIA 1KT0A 1F40A 2FKEA 2LPVA 4W9PA 3TDBA 2PPPA 4LAYA 4W9OA 1JNSA 2XP7A 3PRDA 2Y78A 4ODPA 3UI6A 5GPGA 3IKGA 2M2AA 4ODRA 4TNSA 4U86A 3KAHA 1FKTA 2ZR6A 4ODQA
chains in the Genus database with same CATH superfamily
3WD1A 4DRIA 2KFWA 2ZQUA 3CHEA 4W9OA 5GPGA 2PPOA 1FAPA 2XPBA 1FKKA 1Q6UA 1NH6A 1TFVA 5HWBA 2ZQSA 4WKHA 3ARQA 1NWUA 5DEZA 2FDMA 3WQWA 2F4EA 4WK9A 2RSEA 2XP4A 2K8IA 4DRNA 1D2KA 1HKMA 3NTPA 1E6RA 2DSVA 3VAWA 3OOBA 4Z2GA 1NWRA 3ARSA 2F21A 3GTYX 3KCEA 4NZCA 2KGJA 2KR7A 2LGOA 4WJXA 1ZK6A 1FD9A 1JNTA 3WD0A 1TCOC 1LL4A 3CHDA 2ZR5A 1FKLA 3AS3A 2WK2A 4GGQA 4DRMA 4DWSC 3CZ8A 2LKNA 1ZU8A 3RM4A 4NSBA 3O5LA 2G8ZA 4MNLA 1IX5A 2MF9A 1ROTA 2LJ4A 4DRJA 2WLZA 2WLYA 3IK8A 1PBKA 2KI3A 3PRBA 4P8WA 2OFNA 3G6MA 4IQCA 4HBEA 3H9RB 1HXVA 2F2DA 2ZQTA 4AY1A 4IPXA 1EHNA 3O5RA 1B6CA 3ARRA 2ZR4A 1ROUA 4FN2A 2M08A 4J4OA 2ESCA 1OWQA 3WH0A 1X6LA 4ZPTR 3KAFA 1QPLA 2QF8A 2N87A 2RUQA 1PINA 3JXVA 3FY1A 3B7XA 1NMWA 1FFRA 1W26A 4JFIA 4FAPA 1ZCNA 3KADA 5D75A 1JCHB 3O5GA 1ZBVA 4URIA 3UQIA 2FKEA 4R5EA 4Q7NA 1JNSA 3PRDA 3AS0A 2OLHA 4TNSA 5DITA 3W4RA 4ODQA 2PV2A 3G6LA 1J4IA 2XP3A 2DSZA 3ARPA 1J4HA 2VN1A 5GPRA 4ZPWR 3B9DA 3ALGA 2B31A 4PTMA 1C9HA 4MAVA 4HBOA 4Z2LA 3AS1A 3KAIA 3RM8A 3B9AA 3UQAA 1X6NA 2PV3A 4MNJA 2EULA 1M5YA 1WB0A 4P8UA 2IF4A 2DSWA 4JFLA 2MLYA 1W1VA 3CGNA 3KABA 1FKIA 2MLXA 3WD2A 5DIVA 1FKJA 1GRJA 1LG1A 3UI5A 1KFWA 2RURA 2MLZA 4DT4A 2DPEA 4ODKA 3WIJA 2DT0A 4LGXA 4DRHA 1E6PA 4WKFA 2XP8A 3MDYB 1W9PA 1NWTA 1FKRA 1HKIA 4ODOA 3O5PA 4C02B 1VF8A 1W9UA 1FFQA 2Q5AA 2IUZA 4Z2KA 1UR8A 1FKFA 3RMEA 3O5FA 5HKGA 4DZ2A 1EYMA 4MNMA 3I6CA 3ARXA 2PV1A 2XP6A 3KACA 1J6YA 3IKDA 1HJWA 4ML4A 3RFWA 1XRVA 4G2PA 1D7JA 5HT1A 4XAKA 3ARWA 1K9TA 4QT2A 1F8AB 1OGBA 3NRKA 2DT1A 1JNEA 4WKAA 3WKZA 3WD3A 1SR0A 4TW6A 2YBUA 3LUOA 3WL0A 4DRQA 1Q6IA 1EDQA 4UDMA 3PA7A 3AQUA 4DWSA 4DRKA 3WD4A 3ARYA 1KT0A 1F40A 4W9PA 3TDBA 2B5UB 2A3BA 3IKGA 1ITXA 4S3KA 1QPFA 4Z2JA 4W5UA 3O5JA 5HW7A 1HKKA 2RUDA 1NSGA 3O5KA 2ZQVA 1QZ2A 1D6OA 2DG3A 1FKGA 1N1AA 2VCDA 1L1PA 2MPHA 1KT1A 4ODLA 4O2TA 4G50A 4Q22A 1H0GA 3ALFA 3UQBA 1GUVA 1P5QA 3KZ7A 4Z2IA 4ZPVR 1UR9A 5I98A 1LL6A 2M1IA 4NNRA 4P8XA 3NI6A 2FAPA 1GOIA 4TX0A 4TW7A 2ITKA 5DIUA 3O5OA 1FKHA 3EIPA 4DWSB 5JH8A 4HARA 2A3CA 2RUCA 3UI4A 1U79A 3WQVA 5DO2A 3O5QA 4U85A 1W9VA 3IHZA 1FJDA 4TYOA 2A3EA 2KO7A 5B8IC 2DT3A 4JFJA 4S3JA 1HJXA 4J4NA 2MNTA 3PR9A 2JZVA 1D7IA 1W1PA 2DSUA 1J4RA 3ARTA 1EIBA 1H0IA 1EQ3A 3BMBA 4QT3A 1D7HA 4DROA 4LAXA 2AWGA 3O5MA 5HW8A 4DH0A 4L72B 3RM9A 1WNOA 3BXWA 2G41A 1LQ0A 2WM0A 3B9EA 1E6NA 3FAPA 1A7XA 4MNKA 1OGGA 5J6EA 4ZS6A 3ARVA 4ITZA 4DZ3A 3WL1A 1W1TA 1W1YA 1ZBKA 5HWCA 4DRPA 3KAGA 3O5IA 1ZBWA 3JYJA 5HW6A 1LG2A 5BXJA 1HJVA 1FKDA 1GPFA 2PPPA 2Y78A 4ODPA 3KAHA 1FKTA 3B8SA 1NMVA 4JYSA 4QIBA 1RD6A 3JYMA 1JVWA 4TW8A 4JFKA 2DG4A 1T11A 1R9HA 1O6IA 4IT6A 2KE0A 4KQZA 3TC5A 1E9LA 1ZL1A 2PPNA 2YBTA 4WIWA 4R0XA 4ODMA 4P8VA 4IT4A 2P4VA 4LAWA 4W9QA 5DF0A 1NWSA 1Q1CA 2L2SA 4N19A 4DWSD 1ZBCA 4JFMA 1BKFA 2DT2A 3FXYA 1CTNA 5HBFA 3OA5A 2XP5A 4BF8A 1FKBA 4GIVA 3CHFA 2O92A 4DIPA 1LJYA 4MGVA 4MTVA 3CGMA 1YATA 1Y0OA 2DG9A 4LAVA 3RGCA 3TCZA 3ODKA 3PRAA 2XPAA 3EY6A 1BL4A 3AS2A 4IQ2A 3UF8A 1SYTA 2RQSA 2UZ5A 3O5EA 5HUAA 5GQBA 1E44A 4L3NA 3AROA 2D9FA 1YW5A 4Z2HA 4ODNA 1WAWA 1XHGA 3GU0A 2A3AA 2O9OA 1LL7A 3ARZA 2PBCA 4U84A 1E15A 1Q6HA 1FKSA 1E6ZA 4QZVB 3CHCA 3O5DA 2AOSA 3ARUA 3GPKA 2F23A 2XP9A 1JNDA 4MPKA 2PN0A 3CH9A 2PI6A 4MSPA 5HTGA 1ZB5A 2LPVA 4KR0B 4LAYA 2XP7A 3UI6A 2ETNA 3QOKA 2M2AA 4ODRA 4U86A 1HKJA 2ZR6A
chains in the Genus database with same CATH topology
3WD1A 4DRIA 2KFWA 2ZQUA 3CHEA 4W9OA 5GPGA 2PPOA 1FAPA 2XPBA 1FKKA 1Q6UA 1NH6A 1TFVA 5HWBA 2ZQSA 4WKHA 3ARQA 1NWUA 5DEZA 2FDMA 3WQWA 2F4EA 4WK9A 2RSEA 2XP4A 2K8IA 4DRNA 1D2KA 1HKMA 3NTPA 1E6RA 2DSVA 3VAWA 3OOBA 4Z2GA 1NWRA 3ARSA 2F21A 3KCEA 4NZCA 2KGJA 2KR7A 2LGOA 4WJXA 1ZK6A 1FD9A 1JNTA 3WD0A 1TCOC 1LL4A 3CHDA 2ZR5A 1FKLA 3AS3A 2WK2A 4GGQA 4DRMA 4DWSC 3CZ8A 2LKNA 1ZU8A 3RM4A 4NSBA 3O5LA 2G8ZA 4MNLA 1IX5A 2MF9A 1ROTA 2LJ4A 4DRJA 2WLZA 2WLYA 3IK8A 1PBKA 2KI3A 3PRBA 4P8WA 2OFNA 3G6MA 4IQCA 4HBEA 3H9RB 1HXVA 2F2DA 2ZQTA 4AY1A 4IPXA 1EHNA 3O5RA 1B6CA 3ARRA 2ZR4A 1ROUA 4FN2A 2M08A 4J4OA 2ESCA 1OWQA 3WH0A 1X6LA 4ZPTR 3KAFA 1QPLA 2QF8A 2N87A 2RUQA 1PINA 3JXVA 3FY1A 3B7XA 1NMWA 1FFRA 1W26A 4JFIA 4FAPA 1ZCNA 3KADA 5D75A 4URIA 3O5GA 1ZBVA 3UQIA 2FKEA 4R5EA 4Q7NA 1JNSA 3PRDA 3AS0A 2OLHA 4TNSA 5DITA 3W4RA 4ODQA 2PV2A 3G6LA 1J4IA 2XP3A 2DSZA 3ARPA 1J4HA 2VN1A 5GPRA 4ZPWR 3B9DA 3ALGA 2B31A 4PTMA 1C9HA 4MAVA 4HBOA 4Z2LA 3AS1A 3KAIA 3RM8A 3B9AA 3UQAA 1X6NA 2PV3A 4MNJA 1M5YA 1WB0A 4P8UA 2IF4A 2DSWA 4JFLA 2MLYA 1W1VA 3CGNA 3KABA 1FKIA 2MLXA 3WD2A 5DIVA 1FKJA 1LG1A 3UI5A 1KFWA 2RURA 2MLZA 4DT4A 2DPEA 4ODKA 3WIJA 2DT0A 4LGXA 4DRHA 1E6PA 4WKFA 2XP8A 3MDYB 1W9PA 1NWTA 1FKRA 1HKIA 4ODOA 3O5PA 4C02B 1VF8A 1W9UA 1FFQA 2Q5AA 2IUZA 4Z2KA 1UR8A 1FKFA 3RMEA 3O5FA 5HKGA 4DZ2A 1EYMA 4MNMA 3I6CA 3ARXA 2PV1A 2XP6A 3KACA 1J6YA 3IKDA 1HJWA 4ML4A 3RFWA 1XRVA 4G2PA 1D7JA 5HT1A 4XAKA 3ARWA 1K9TA 4QT2A 1F8AB 3NRKA 1OGBA 2DT1A 1JNEA 4WKAA 3WKZA 3WD3A 1SR0A 4TW6A 2YBUA 3LUOA 3WL0A 4DRQA 1Q6IA 1EDQA 3PA7A 3AQUA 4DWSA 4DRKA 3WD4A 3ARYA 1KT0A 1F40A 4W9PA 3TDBA 2A3BA 3IKGA 1ITXA 4S3KA 1QPFA 4Z2JA 4W5UA 3O5JA 5HW7A 1HKKA 2RUDA 1NSGA 3O5KA 2ZQVA 1QZ2A 1D6OA 2DG3A 1FKGA 1N1AA 2VCDA 1L1PA 2MPHA 1KT1A 4ODLA 4O2TA 4G50A 4Q22A 1H0GA 3ALFA 3UQBA 1GUVA 1P5QA 3KZ7A 4Z2IA 4ZPVR 1UR9A 5I98A 1LL6A 2M1IA 4NNRA 4P8XA 3NI6A 2FAPA 1GOIA 4TX0A 4TW7A 2ITKA 5DIUA 3O5OA 1FKHA 4DWSB 5JH8A 4HARA 2A3CA 2RUCA 3UI4A 1U79A 3WQVA 5DO2A 3O5QA 4U85A 1W9VA 3IHZA 1FJDA 4TYOA 2A3EA 2KO7A 5B8IC 2DT3A 4JFJA 4S3JA 1HJXA 4J4NA 2MNTA 3PR9A 2JZVA 1D7IA 1W1PA 2DSUA 1J4RA 3ARTA 1EIBA 1H0IA 1EQ3A 4QT3A 1D7HA 4DROA 4LAXA 2AWGA 3O5MA 5HW8A 4DH0A 4L72B 3RM9A 1WNOA 3BXWA 2G41A 1LQ0A 2WM0A 3B9EA 1E6NA 3FAPA 1A7XA 4MNKA 1OGGA 5J6EA 4ZS6A 3ARVA 4ITZA 4DZ3A 3WL1A 1W1TA 1W1YA 1ZBKA 5HWCA 4DRPA 3KAGA 3O5IA 1ZBWA 3JYJA 5HW6A 1LG2A 5BXJA 1HJVA 1FKDA 1GPFA 2PPPA 2Y78A 4ODPA 3KAHA 1FKTA 3B8SA 1NMVA 4JYSA 4QIBA 1RD6A 3JYMA 1JVWA 4TW8A 4JFKA 2DG4A 1T11A 1R9HA 1O6IA 4IT6A 2KE0A 4KQZA 3TC5A 1E9LA 1ZL1A 2PPNA 2YBTA 4WIWA 4R0XA 4ODMA 4P8VA 4IT4A 4LAWA 4W9QA 5DF0A 1NWSA 1Q1CA 2L2SA 4N19A 4DWSD 1ZBCA 4JFMA 1BKFA 2DT2A 3FXYA 1CTNA 5HBFA 3OA5A 2XP5A 4BF8A 1FKBA 4GIVA 3CHFA 2O92A 4DIPA 1LJYA 4MGVA 4MTVA 3CGMA 1YATA 1Y0OA 2DG9A 4LAVA 3RGCA 3TCZA 3ODKA 3PRAA 2XPAA 3EY6A 1BL4A 3AS2A 4IQ2A 3UF8A 1SYTA 2RQSA 2UZ5A 3O5EA 5HUAA 5GQBA 4L3NA 3AROA 2D9FA 1YW5A 4Z2HA 4ODNA 1WAWA 1XHGA 2A3AA 2O9OA 1LL7A 3ARZA 2PBCA 4U84A 1E15A 1Q6HA 1FKSA 1E6ZA 4QZVB 3CHCA 3O5DA 2AOSA 3ARUA 3GPKA 2XP9A 1JNDA 4MPKA 3CH9A 2PI6A 4MSPA 5HTGA 1ZB5A 2LPVA 4KR0B 4LAYA 2XP7A 3UI6A 3QOKA 2M2AA 4ODRA 4U86A 1HKJA 2ZR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PV2 A;  1QPF A;  3O5J A;  1J4I A;  1NMV A;  4DRI A;  2KFW A;  2XP3 A;  2ZQU A;  2RUD A;  4JYS A;  1NSG A;  1J4H A;  2PPO A;  2VN1 A;  1FAP A;  3O5K A;  3JYM A;  2ZQV A;  4QIB A;  1JVW A;  2XPB A;  1FKK A;  1QZ2 A;  4TW8 A;  1Q6U A;  1D6O A;  1C9H A;  1FKG A;  1N1A A;  2DG3 A;  2VCD A;  2ZQS A;  4JFK A;  2MPH A;  5HW7 A;  5HWB A;  1KT1 A;  1L1P A;  2DG4 A;  1T11 A;  3KAI A;  4ODL A;  1R9H A;  4O2T A;  2KE0 A;  2F4E A;  3UQA A;  4G50 A;  3TC5 A;  2RSE A;  2PV3 A;  2XP4 A;  2K8I A;  2PPN A;  3UQB A;  4DRN A;  1M5Y A;  1P5Q A;  3KZ7 A;  4R0X A;  3NTP A;  2IF4 A;  4ODM A;  3VAW A;  4JFL A;  3OOB A;  5I98 A;  4LAW A;  2MLY A;  2M1I A;  2F21 A;  4NNR A;  3KCE A;  3CGN A;  3KAB A;  4W9Q A;  1FKI A;  2MLX A;  2KGJ A;  3NI6 A;  2FAP A;  2KR7 A;  2LGO A;  5DIV A;  4TX0 A;  1FKJ A;  4TW7 A;  1ZK6 A;  1FD9 A;  1Q1C A;  2ITK A;  2L2S A;  1JNT A;  4N19 A;  3UI5 A;  5DIU A;  1TCO C;  2RUR A;  2MLZ A;  3O5O A;  4DT4 A;  2ZR5 A;  1FKH A;  1FKL A;  4ODK A;  4JFM A;  4GGQ A;  4DRM A;  1BKF A;  4DRH A;  2XP8 A;  2LKN A;  2RUC A;  3MDY B;  3UI4 A;  1U79 A;  1FKR A;  4ODO A;  2XP5 A;  3O5P A;  3O5Q A;  1FKB A;  3IHZ A;  4GIV A;  4U85 A;  4BF8 A;  4C02 B;  1FJD A;  4TYO A;  2KO7 A;  2Q5A A;  4DIP A;  4MGV A;  5B8I C;  3O5L A;  3CGM A;  4JFJ A;  1FKF A;  2MF9 A;  1ROT A;  2LJ4 A;  4DRJ A;  1YAT A;  4J4N A;  1Y0O A;  2MNT A;  3O5F A;  2DG9 A;  4LAV A;  3RGC A;  3TCZ A;  2JZV A;  3ODK A;  1D7I A;  3IK8 A;  1PBK A;  2KI3 A;  3PRB A;  4DZ2 A;  1EYM A;  2OFN A;  4IQC A;  3I6C A;  2PV1 A;  5DIT A;  2XPA A;  2XP6 A;  3EY6 A;  1J4R A;  2F2D A;  1BL4 A;  3H9R B;  3KAC A;  1HXV A;  2ZQT A;  4IQ2 A;  1J6Y A;  1EQ3 A;  4IPX A;  3IKD A;  3UF8 A;  2RQS A;  2UZ5 A;  3O5E A;  4QT3 A;  3RFW A;  1D7H A;  3O5R A;  4DRO A;  1B6C A;  4G2P A;  4LAX A;  5HUA A;  2AWG A;  3O5M A;  2ZR4 A;  1ROU A;  2D9F A;  4FN2 A;  1YW5 A;  4DH0 A;  5HW8 A;  1D7J A;  2M08 A;  5HT1 A;  4ODN A;  4J4O A;  3WH0 A;  5HKG A;  4QT2 A;  2PBC A;  1QPL A;  1A7X A;  1F8A B;  3FAP A;  3KAF A;  2N87 A;  2RUQ A;  3NRK A;  1Q6H A;  4U84 A;  1FKS A;  5J6E A;  1PIN A;  3JXV A;  3B7X A;  1NMW A;  4ITZ A;  4DZ3 A;  4TW6 A;  5HWC A;  3O5D A;  4DRP A;  3LUO A;  1W26 A;  3KAG A;  4JFI A;  4DRQ A;  4FAP A;  1Q6I A;  3GPK A;  3O5I A;  3PA7 A;  2XP9 A;  1ZCN A;  3KAD A;  3JYJ A;  5HW6 A;  4DRK A;  5BXJ A;  4MSP A;  5HTG A;  5D75 A;  1FKD A;  3O5G A;  3UQI A;  1KT0 A;  1F40 A;  2FKE A;  2LPV A;  4W9P A;  3TDB A;  2PPP A;  4LAY A;  4W9O A;  1JNS A;  2XP7 A;  3PRD A;  2Y78 A;  4ODP A;  3UI6 A;  5GPG A;  3IKG A;  2M2A A;  4ODR A;  4TNS A;  4U86 A;  3KAH A;  1FKT A;  2ZR6 A;  4ODQ A; 
#chains in the Genus database with same CATH topology
 3WD1 A;  4DRI A;  2KFW A;  2ZQU A;  3CHE A;  4W9O A;  5GPG A;  2PPO A;  1FAP A;  2XPB A;  1FKK A;  1Q6U A;  1NH6 A;  1TFV A;  5HWB A;  2ZQS A;  4WKH A;  3ARQ A;  1NWU A;  5DEZ A;  2FDM A;  3WQW A;  2F4E A;  4WK9 A;  2RSE A;  2XP4 A;  2K8I A;  4DRN A;  1D2K A;  1HKM A;  3NTP A;  1E6R A;  2DSV A;  3VAW A;  3OOB A;  4Z2G A;  1NWR A;  3ARS A;  2F21 A;  3GTY X;  3KCE A;  4NZC A;  2KGJ A;  2KR7 A;  2LGO A;  4WJX A;  1ZK6 A;  1FD9 A;  1JNT A;  3WD0 A;  1TCO C;  1LL4 A;  3CHD A;  2ZR5 A;  1FKL A;  3AS3 A;  2WK2 A;  4GGQ A;  4DRM A;  4DWS C;  3CZ8 A;  2LKN A;  1ZU8 A;  3RM4 A;  4NSB A;  3O5L A;  2G8Z A;  4MNL A;  1IX5 A;  2MF9 A;  1ROT A;  2LJ4 A;  4DRJ A;  2WLZ A;  2WLY A;  3IK8 A;  1PBK A;  2KI3 A;  3PRB A;  4P8W A;  2OFN A;  3G6M A;  4IQC A;  4HBE A;  3H9R B;  1HXV A;  2F2D A;  2ZQT A;  4AY1 A;  4IPX A;  1EHN A;  3O5R A;  1B6C A;  3ARR A;  2ZR4 A;  1ROU A;  4FN2 A;  2M08 A;  4J4O A;  2ESC A;  1OWQ A;  3WH0 A;  1X6L A;  4ZPT R;  3KAF A;  1QPL A;  2QF8 A;  2N87 A;  2RUQ A;  1PIN A;  3JXV A;  3FY1 A;  3B7X A;  1NMW A;  1FFR A;  1W26 A;  4JFI A;  4FAP A;  1ZCN A;  3KAD A;  5D75 A;  1JCH B;  3O5G A;  1ZBV A;  4URI A;  3UQI A;  2FKE A;  4R5E A;  4Q7N A;  1JNS A;  3PRD A;  3AS0 A;  2OLH A;  4TNS A;  5DIT A;  3W4R A;  4ODQ A;  2PV2 A;  3G6L A;  1J4I A;  2XP3 A;  2DSZ A;  3ARP A;  1J4H A;  2VN1 A;  5GPR A;  4ZPW R;  3B9D A;  3ALG A;  2B31 A;  4PTM A;  1C9H A;  4MAV A;  4HBO A;  4Z2L A;  3AS1 A;  3KAI A;  3RM8 A;  3B9A A;  3UQA A;  1X6N A;  2PV3 A;  4MNJ A;  2EUL A;  1M5Y A;  1WB0 A;  4P8U A;  2IF4 A;  2DSW A;  4JFL A;  2MLY A;  1W1V A;  3CGN A;  3KAB A;  1FKI A;  2MLX A;  3WD2 A;  5DIV A;  1FKJ A;  1GRJ A;  1LG1 A;  3UI5 A;  1KFW A;  2RUR A;  2MLZ A;  4DT4 A;  2DPE A;  4ODK A;  3WIJ A;  2DT0 A;  4LGX A;  4DRH A;  1E6P A;  4WKF A;  2XP8 A;  3MDY B;  1W9P A;  1NWT A;  1FKR A;  1HKI A;  4ODO A;  3O5P A;  4C02 B;  1VF8 A;  1W9U A;  1FFQ A;  2Q5A A;  2IUZ A;  4Z2K A;  1UR8 A;  1FKF A;  3RME A;  3O5F A;  5HKG A;  4DZ2 A;  1EYM A;  4MNM A;  3I6C A;  3ARX A;  2PV1 A;  2XP6 A;  3KAC A;  1J6Y A;  3IKD A;  1HJW A;  4ML4 A;  3RFW A;  1XRV A;  4G2P A;  1D7J A;  5HT1 A;  4XAK A;  3ARW A;  1K9T A;  4QT2 A;  1F8A B;  1OGB A;  3NRK A;  2DT1 A;  1JNE A;  4WKA A;  3WKZ A;  3WD3 A;  1SR0 A;  4TW6 A;  2YBU A;  3LUO A;  3WL0 A;  4DRQ A;  1Q6I A;  1EDQ A;  4UDM A;  3PA7 A;  3AQU A;  4DWS A;  4DRK A;  3WD4 A;  3ARY A;  1KT0 A;  1F40 A;  4W9P A;  3TDB A;  2B5U B;  2A3B A;  3IKG A;  1ITX A;  4S3K A;  1QPF A;  4Z2J A;  4W5U A;  3O5J A;  5HW7 A;  1HKK A;  2RUD A;  1NSG A;  3O5K A;  2ZQV A;  1QZ2 A;  1D6O A;  2DG3 A;  1FKG A;  1N1A A;  2VCD A;  1L1P A;  2MPH A;  1KT1 A;  4ODL A;  4O2T A;  4G50 A;  4Q22 A;  1H0G A;  3ALF A;  3UQB A;  1GUV A;  1P5Q A;  3KZ7 A;  4Z2I A;  4ZPV R;  1UR9 A;  5I98 A;  1LL6 A;  2M1I A;  4NNR A;  4P8X A;  3NI6 A;  2FAP A;  1GOI A;  4TX0 A;  4TW7 A;  2ITK A;  5DIU A;  3O5O A;  1FKH A;  3EIP A;  4DWS B;  5JH8 A;  4HAR A;  2A3C A;  2RUC A;  3UI4 A;  1U79 A;  3WQV A;  5DO2 A;  3O5Q A;  4U85 A;  1W9V A;  3IHZ A;  1FJD A;  4TYO A;  2A3E A;  2KO7 A;  5B8I C;  2DT3 A;  4JFJ A;  4S3J A;  1HJX A;  4J4N A;  2MNT A;  3PR9 A;  2JZV A;  1D7I A;  1W1P A;  2DSU A;  1J4R A;  3ART A;  1EIB A;  1H0I A;  1EQ3 A;  3BMB A;  4QT3 A;  1D7H A;  4DRO A;  4LAX A;  2AWG A;  3O5M A;  5HW8 A;  4DH0 A;  4L72 B;  3RM9 A;  1WNO A;  3BXW A;  2G41 A;  1LQ0 A;  2WM0 A;  3B9E A;  1E6N A;  3FAP A;  1A7X A;  4MNK A;  1OGG A;  5J6E A;  4ZS6 A;  3ARV A;  4ITZ A;  4DZ3 A;  3WL1 A;  1W1T A;  1W1Y A;  1ZBK A;  5HWC A;  4DRP A;  3KAG A;  3O5I A;  1ZBW A;  3JYJ A;  5HW6 A;  1LG2 A;  5BXJ A;  1HJV A;  1FKD A;  1GPF A;  2PPP A;  2Y78 A;  4ODP A;  3KAH A;  1FKT A;  3B8S A;  1NMV A;  4JYS A;  4QIB A;  1RD6 A;  3JYM A;  1JVW A;  4TW8 A;  4JFK A;  2DG4 A;  1T11 A;  1R9H A;  1O6I A;  4IT6 A;  2KE0 A;  4KQZ A;  3TC5 A;  1E9L A;  1ZL1 A;  2PPN A;  2YBT A;  4WIW A;  4R0X A;  4ODM A;  4P8V A;  4IT4 A;  2P4V A;  4LAW A;  4W9Q A;  5DF0 A;  1NWS A;  1Q1C A;  2L2S A;  4N19 A;  4DWS D;  1ZBC A;  4JFM A;  1BKF A;  2DT2 A;  3FXY A;  1CTN A;  5HBF A;  3OA5 A;  2XP5 A;  4BF8 A;  1FKB A;  4GIV A;  3CHF A;  2O92 A;  4DIP A;  1LJY A;  4MGV A;  4MTV A;  3CGM A;  1YAT A;  1Y0O A;  2DG9 A;  4LAV A;  3RGC A;  3TCZ A;  3ODK A;  3PRA A;  2XPA A;  3EY6 A;  1BL4 A;  3AS2 A;  4IQ2 A;  3UF8 A;  1SYT A;  2RQS A;  2UZ5 A;  3O5E A;  5HUA A;  5GQB A;  1E44 A;  4L3N A;  3ARO A;  2D9F A;  1YW5 A;  4Z2H A;  4ODN A;  1WAW A;  1XHG A;  3GU0 A;  2A3A A;  2O9O A;  1LL7 A;  3ARZ A;  2PBC A;  4U84 A;  1E15 A;  1Q6H A;  1FKS A;  1E6Z A;  4QZV B;  3CHC A;  3O5D A;  2AOS A;  3ARU A;  3GPK A;  2F23 A;  2XP9 A;  1JND A;  4MPK A;  2PN0 A;  3CH9 A;  2PI6 A;  4MSP A;  5HTG A;  1ZB5 A;  2LPV A;  4KR0 B;  4LAY A;  2XP7 A;  3UI6 A;  2ETN A;  3QOK A;  2M2A A;  4ODR A;  4U86 A;  1HKJ A;  2ZR6 A; 
#chains in the Genus database with same CATH homology
 3WD1 A;  4DRI A;  2KFW A;  2ZQU A;  3CHE A;  4W9O A;  5GPG A;  2PPO A;  1FAP A;  2XPB A;  1FKK A;  1Q6U A;  1NH6 A;  1TFV A;  5HWB A;  2ZQS A;  4WKH A;  3ARQ A;  1NWU A;  5DEZ A;  2FDM A;  3WQW A;  2F4E A;  4WK9 A;  2RSE A;  2XP4 A;  2K8I A;  4DRN A;  1D2K A;  1HKM A;  3NTP A;  1E6R A;  2DSV A;  3VAW A;  3OOB A;  4Z2G A;  1NWR A;  3ARS A;  2F21 A;  3KCE A;  4NZC A;  2KGJ A;  2KR7 A;  2LGO A;  4WJX A;  1ZK6 A;  1FD9 A;  1JNT A;  3WD0 A;  1TCO C;  1LL4 A;  3CHD A;  2ZR5 A;  1FKL A;  3AS3 A;  2WK2 A;  4GGQ A;  4DRM A;  4DWS C;  3CZ8 A;  2LKN A;  1ZU8 A;  3RM4 A;  4NSB A;  3O5L A;  2G8Z A;  4MNL A;  1IX5 A;  2MF9 A;  1ROT A;  2LJ4 A;  4DRJ A;  2WLZ A;  2WLY A;  3IK8 A;  1PBK A;  2KI3 A;  3PRB A;  4P8W A;  2OFN A;  3G6M A;  4IQC A;  4HBE A;  3H9R B;  1HXV A;  2F2D A;  2ZQT A;  4AY1 A;  4IPX A;  1EHN A;  3O5R A;  1B6C A;  3ARR A;  2ZR4 A;  1ROU A;  4FN2 A;  2M08 A;  4J4O A;  2ESC A;  1OWQ A;  3WH0 A;  1X6L A;  4ZPT R;  3KAF A;  1QPL A;  2QF8 A;  2N87 A;  2RUQ A;  1PIN A;  3JXV A;  3FY1 A;  3B7X A;  1NMW A;  1FFR A;  1W26 A;  4JFI A;  4FAP A;  1ZCN A;  3KAD A;  5D75 A;  4URI A;  3O5G A;  1ZBV A;  3UQI A;  2FKE A;  4R5E A;  4Q7N A;  1JNS A;  3PRD A;  3AS0 A;  2OLH A;  4TNS A;  5DIT A;  3W4R A;  4ODQ A;  2PV2 A;  3G6L A;  1J4I A;  2XP3 A;  2DSZ A;  3ARP A;  1J4H A;  2VN1 A;  5GPR A;  4ZPW R;  3B9D A;  3ALG A;  2B31 A;  4PTM A;  1C9H A;  4MAV A;  4HBO A;  4Z2L A;  3AS1 A;  3KAI A;  3RM8 A;  3B9A A;  3UQA A;  1X6N A;  2PV3 A;  4MNJ A;  1M5Y A;  1WB0 A;  4P8U A;  2IF4 A;  2DSW A;  4JFL A;  2MLY A;  1W1V A;  3CGN A;  3KAB A;  1FKI A;  2MLX A;  3WD2 A;  5DIV A;  1FKJ A;  1LG1 A;  3UI5 A;  1KFW A;  2RUR A;  2MLZ A;  4DT4 A;  2DPE A;  4ODK A;  3WIJ A;  2DT0 A;  4LGX A;  4DRH A;  1E6P A;  4WKF A;  2XP8 A;  3MDY B;  1W9P A;  1NWT A;  1FKR A;  1HKI A;  4ODO A;  3O5P A;  4C02 B;  1VF8 A;  1W9U A;  1FFQ A;  2Q5A A;  2IUZ A;  4Z2K A;  1UR8 A;  1FKF A;  3RME A;  3O5F A;  5HKG A;  4DZ2 A;  1EYM A;  4MNM A;  3I6C A;  3ARX A;  2PV1 A;  2XP6 A;  3KAC A;  1J6Y A;  3IKD A;  1HJW A;  4ML4 A;  3RFW A;  1XRV A;  4G2P A;  1D7J A;  5HT1 A;  4XAK A;  3ARW A;  1K9T A;  4QT2 A;  1F8A B;  3NRK A;  1OGB A;  2DT1 A;  1JNE A;  4WKA A;  3WKZ A;  3WD3 A;  1SR0 A;  4TW6 A;  2YBU A;  3LUO A;  3WL0 A;  4DRQ A;  1Q6I A;  1EDQ A;  3PA7 A;  3AQU A;  4DWS A;  4DRK A;  3WD4 A;  3ARY A;  1KT0 A;  1F40 A;  4W9P A;  3TDB A;  2A3B A;  3IKG A;  1ITX A;  4S3K A;  1QPF A;  4Z2J A;  4W5U A;  3O5J A;  5HW7 A;  1HKK A;  2RUD A;  1NSG A;  3O5K A;  2ZQV A;  1QZ2 A;  1D6O A;  2DG3 A;  1FKG A;  1N1A A;  2VCD A;  1L1P A;  2MPH A;  1KT1 A;  4ODL A;  4O2T A;  4G50 A;  4Q22 A;  1H0G A;  3ALF A;  3UQB A;  1GUV A;  1P5Q A;  3KZ7 A;  4Z2I A;  4ZPV R;  1UR9 A;  5I98 A;  1LL6 A;  2M1I A;  4NNR A;  4P8X A;  3NI6 A;  2FAP A;  1GOI A;  4TX0 A;  4TW7 A;  2ITK A;  5DIU A;  3O5O A;  1FKH A;  4DWS B;  5JH8 A;  4HAR A;  2A3C A;  2RUC A;  3UI4 A;  1U79 A;  3WQV A;  5DO2 A;  3O5Q A;  4U85 A;  1W9V A;  3IHZ A;  1FJD A;  4TYO A;  2A3E A;  2KO7 A;  5B8I C;  2DT3 A;  4JFJ A;  4S3J A;  1HJX A;  4J4N A;  2MNT A;  3PR9 A;  2JZV A;  1D7I A;  1W1P A;  2DSU A;  1J4R A;  3ART A;  1EIB A;  1H0I A;  1EQ3 A;  4QT3 A;  1D7H A;  4DRO A;  4LAX A;  2AWG A;  3O5M A;  5HW8 A;  4DH0 A;  4L72 B;  3RM9 A;  1WNO A;  3BXW A;  2G41 A;  1LQ0 A;  2WM0 A;  3B9E A;  1E6N A;  3FAP A;  1A7X A;  4MNK A;  1OGG A;  5J6E A;  4ZS6 A;  3ARV A;  4ITZ A;  4DZ3 A;  3WL1 A;  1W1T A;  1W1Y A;  1ZBK A;  5HWC A;  4DRP A;  3KAG A;  3O5I A;  1ZBW A;  3JYJ A;  5HW6 A;  1LG2 A;  5BXJ A;  1HJV A;  1FKD A;  1GPF A;  2PPP A;  2Y78 A;  4ODP A;  3KAH A;  1FKT A;  3B8S A;  1NMV A;  4JYS A;  4QIB A;  1RD6 A;  3JYM A;  1JVW A;  4TW8 A;  4JFK A;  2DG4 A;  1T11 A;  1R9H A;  1O6I A;  4IT6 A;  2KE0 A;  4KQZ A;  3TC5 A;  1E9L A;  1ZL1 A;  2PPN A;  2YBT A;  4WIW A;  4R0X A;  4ODM A;  4P8V A;  4IT4 A;  4LAW A;  4W9Q A;  5DF0 A;  1NWS A;  1Q1C A;  2L2S A;  4N19 A;  4DWS D;  1ZBC A;  4JFM A;  1BKF A;  2DT2 A;  3FXY A;  1CTN A;  5HBF A;  3OA5 A;  2XP5 A;  4BF8 A;  1FKB A;  4GIV A;  3CHF A;  2O92 A;  4DIP A;  1LJY A;  4MGV A;  4MTV A;  3CGM A;  1YAT A;  1Y0O A;  2DG9 A;  4LAV A;  3RGC A;  3TCZ A;  3ODK A;  3PRA A;  2XPA A;  3EY6 A;  1BL4 A;  3AS2 A;  4IQ2 A;  3UF8 A;  1SYT A;  2RQS A;  2UZ5 A;  3O5E A;  5HUA A;  5GQB A;  4L3N A;  3ARO A;  2D9F A;  1YW5 A;  4Z2H A;  4ODN A;  1WAW A;  1XHG A;  2A3A A;  2O9O A;  1LL7 A;  3ARZ A;  2PBC A;  4U84 A;  1E15 A;  1Q6H A;  1FKS A;  1E6Z A;  4QZV B;  3CHC A;  3O5D A;  2AOS A;  3ARU A;  3GPK A;  2XP9 A;  1JND A;  4MPK A;  3CH9 A;  2PI6 A;  4MSP A;  5HTG A;  1ZB5 A;  2LPV A;  4KR0 B;  4LAY A;  2XP7 A;  3UI6 A;  3QOK A;  2M2A A;  4ODR A;  4U86 A;  1HKJ A;  2ZR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...