4JFZH

Structure of phosphoserine (psab) scaffold bound to pser peptide
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
223
structure length
223
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMSWVRQAPGKGLEWVASIATGGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRGYSSTSYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab light chain
publication title Nature-inspired design of motif-specific antibody scaffolds.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 2013-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jfzH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jfzH01
2OTWB 5F7UA 5L6YH 1XF3B 1ZLWK 4JPWL 5MERA 4X0KA 4NDMA 2YPVL 5SX4I 4PGDA 4KAQH 1I4FA 3U0TB 1NUFA 1J10A 3O81A 4KVNH 3O3DA 5FYLD 3CUPB 1X5YA 3CGTA 1MWAB 4GQPH 4N1HB 4LPCA 3P77B 3AU1A 3GO1H 2WBJD 4FQLL 4MA7H 3K2UL 3SKJL 3VXQA 2BY1A 5C09E 2XTJB 4QY8A 1CICB 4PP1D 2X10A 3WLWD 1QFWI 2EH7L 4U0QB 4XXCC 2FYYA 3FB7A 4H20H 1Q72H 3B2UD 3X11A 5FF6B 5I8KL 1T5WB 2OTWA 4GLRI 1XF3A 3ULUD 2A77L 1LNUB 5TH2B 4DTGL 3FQUA 4OCRL 4NQED 3U0TA 3MV8E 1D5IL 2VIRB 4DQOH 1UCTA 1G7HB 3CUPA 3NH7L 4H8WH 1RUAH 1MWAA 2O5ZH 4L8SB 2CH8A 3P77A 3T2OA 2GJJA 4XXDB 1TXKA 1TMCB 1DVFB 5CBAB 3O0RL 1FL3B 2H45A 1LO2H 4JB9H 3MA7B 4WWKB 1XF1A 2YD5A 1CICA 3E8UH 4B50A 4ZUVB 2AV7B 1T1YB 2JB6B 2M26A 4ODTH 3QIBB 5FF6A 3SDYH 1T5WA 1V8HA 1T1XB 4PJFE 3ZE0E 3ZKND 4JRXB 5I0DA 3T0DA 3NIDF 1LNUA 5TH2A 4N0CC 5DMJB 1CD1B 2XQYK 5DWUL 2VIRA 4YHPB 1G7HA 1J0KA 2FIKB 3TVMC 4L8SA 2OL3L 3CC5B 5DLMH 5HHOE 4OD3H 4XXDA 5F7KC 1DVFA 1MJ7H 5E6ZA 5CBAA 1FL3A 3MA7A 4WWKA 4YHOH 5E2JA 5JXAH 3O11B 5DXWA 4ZUVA 1WC7B 4NSKB 2AV7A 4O51B 1MRDH 4YQXH 1T1YA 2IAMB 3BPNB 2JB6A 4UTBH 1KCLA 3QIBA 2VITB 5I76B 4Y88A 1T1XA 4JRXA 5MEOB 2FSEB 4P48A 5IWLC 2PN5A 2P24B 5D2LE 4X8JB 3UJIL 5D93C 1CD1A 2VDML 2NY5C 1KIUA 2QADD 3THML 4YHPA 2FIKA 4TSAL 2JJSC 3CC5A 4W4OC 1J8HB 5F6IB 4AY0A 3JV5A 1FG9C 5E2WL 3EO9H 5IFAL 1AR1D 2HT4C 3ARQA 5AZEH 3IXTB 3NFNB 3D69B 1ZGLB 2F54B 3O11A 3VU2A 5GRVK 1WC7A 4NSKA 4O51A 3RI5F 4Y4KD 1ADQL 2HH0H 2VITA 5I76A 4CN1A 5MEOA 2FSEA 1WWWX 2P24A 3TJHD 4X8JA 1AY1L 2CDEB 3NA4A 1M7DB 5E8DH 3RFZC 4AT6B 3T2PA 2EDDA 2JELH 4YWGH 1UFUA 3BN9D 4V1DE 1J8HA 5I1CL 4RIRB 4MVBC 1ZVHA 3SGEI 3IXTA 3NTCL 3NFNA 5BVPL 1ZGLA 3ELAT 4PB0L 2F54A 4L1HA 3GSVB 2F53E 4LSSH 4EUPG 5E00B 4TNWK 4S1DC 5CCKH 5I1GH 4APQB 1IVLA 4OM1L 3EYQD 1DBJH 1XF4B 1ZLVK 5AYUL 2CDEA 1M7DA 4PJFB 4N8VB 4AT6A 4P5KB 3BD5A 5GS2H 3BZEB 1FZJB 4M6OL 3D39E 2PYED 4TN9A 2R9HC 2IANB 5HDLA 4PTTB 1OY3B 3VCLB 1R3JB 2IGFH 4RIRA 1BWMA 5GGSY 2CK2A 3O2DH 2VDKL 1OAYH 5GISL 1N5YH 3RTQD 1NEZB 3QDJE 2VZ1A 2Z31B 3GSVA 2BCKB 3HN3A 4LVNC 1P69B 1RULL 5E00A 4PJCF 5J0BA 5LWYL 1A6VH 3EFDL 5I8OH 5IOPB 5SV3A 4APQA 4TULH 1WZ1L 3HZKB 2ORBH 2VLMD 4Q74A 2NTFB 2YN3A 1XF4A 3VFUB 4PJ8B 4RDQG 5JUEH 4O58H 4PJFA 2B20A 3BZDA 4P5KA 3DARA 4GFTB 5CD5C 4WENB 1FZJA 4TVSa 1DQTA 2IANA 4PTTA 3VCLA 1R3JA 3IFNH 4Q9BA 1HEZB 5KVFH 2NX5D 2VC2L 2FZ3B 1NEZA 2Z31A 2BCKA 4NQDD 2AABL 4C54A 4PJIE 1CVRA 1JMXA 1RZ8B 4MD4B 1IM9B 5IOPA 1FC1A 2VQUA 3HZKA 2VLLB 3SKOB 4PJBE 2NTFA 3VFUA 4JPVH 3K3QA 3LIZL 2Z8VC 5TE6L 4KDVA 3T0XA 3AY4C 4YHNB 2YOCA 3EFFB 3MBXL 5F1KC 4F7TB 1ZHKB 2QEJA 3FO2B 5GGRB 1I3GL 2EDXA 4M03A 1HEZA 3UROR 2FZ3A 2A2QT 4GXVL 4FABL 1J5OL 4LF3B 4XVSH 2X4QA 3CVHA 1RZ8A 4MD4A 3S9DB 1IM9A 4J6RL 2DTMH 2DBJA 2VLLA 3SKOA 3P4LA 1GGBH 4PV9B 4R4FL 4TNWF 3P0GB 5ADPL 4YHNA 5CEYB 3EFFA 2I5YL 1MFBH 4F7TA 4HLZG 1ZHKA 4EIZC 1TVDA 4GAJL 3FO2A 3GHBL 4JO2H 4PIRF 5GGRA 5HHXL 4FRWA 1ZVSB 5DQ9B 3CDYA 3CMOH 1QRND 4P2QD 1JPFB 4JFDE 4UT7L 3BSZH 1HH6B 5E6IC 5C0AD 1S5IL 3PHSA 4NGHH 5KANG 3QRGH 3T65B 2EDOA 4OSUL 4YH6A 3WLBB 3H9HB 3QZWG 3L7FB 3IS1X 1MFEL 3LKRB 3HNVL 3KPMB 1W72H 5L7XH 4XCEB 3TIDB 4ODHL 2ATKB 5HYSG 3MV9B 4PV9A 5I30L 3BKYL 4AYFA 4DAGH 2WZPD 5CEYA 2ZJSH 1JPSH 1QFPA 1U3HB 3LB6C 4LHJB 2UY6A 3C2AH 1BF2A 1MCOL 2XYCA 1MIML 1ZE3C 1ZVSA 5DQ9A 3NZ8B 1H0DB 3MOQA 4YE4L 1JPFA 4BZ2L 4LQFL 1HH6A 3MUGB 3HUJE 1FGVL 2JJTC 4KDWA 4NYLB 1BIIB 4Z7UF 1QKZH 3KPQB 4OAWB 1FRGH 4PJHB 3T65A 4AEFA 3QUYD 3A67H 1QPXA 1A9EB 3H9HA 3WLBA 3RHWF 3L7FA 3QDJA 2D2OA 4H0HB 4HIJB 3LKRA 3KPMA 1WFUA 4D3CH 4XCEA 3TIDA 2ATKA 2WM0A 1DQMH 3MV9A 3CLFH 4J2XA 1YDPB 4NJAL 3RRQA 5E56A 3S88L 5I73C 5IJVB 5FYJU 2RCSH 1U3HA 2HJKB 4NZRL 3GRWH 5KSUB 1MPAH 2OXHA 5H2BB 3VW3L 5CZVL 3EAKA 3K2MC 3NZ8A 1H0DA 4LSUH 4BUHA 1RUML 3MUGA 1TQCB 5F72S 2LVEA 4NYLA 1BIIA 4MDIB 3KPQA 4OAWA 4X6DF 4PJHA 3NCYS 4UIKH 1IGFH 2QQKH 1A9EA 2DYPB 3VMOA 4HIJA 1ORQB 4LGPB 2VMFA 4W6XB 5E8EB 1YDPA 1D5ZB 1RZGB 3GJFK 4LVHC 5IJVA 1QFUH 5KZCD 4M02A 2HJKA 4Z7WE 3JUZA 4WI9A 4OZHE 5KSUA 5D5MB 2GSIB 4FTVE 2APBA 5H2BA 2AAVA 3MLVH 4P3WA 4Y5VB 1LILA 3OGCB 3HZMB 4NIKB 3MXWL 4FQCL 4DGIL 1P7QB 2A0LD 2OR9L 4MDIA 4QNPE 5BMFH 1YPZF 4JFDB 2J1KA 1PKQE 2E9BA 1VEOA 2DYPA 2LU4A 3ARBB 3JTTB 4UINH 3ULVD 1ORQA 2RR3A 1BZ9B 3WDJA 2V9TA 1UJ3C 2ZOLB 3TBTB 4KZEH 4G6FB 5T5FL 2NW2B 5HVGB 5MHSD 4HSQA 3TPKA 4I3SL 3PGFH 5E8EA 3O2WL 1A14L 4JQVC 4J4PD 5FCUH 3T3ME 2J5LC 1D5ZA 1RZGA 3KYMB 4TPRL 2N7AA 1BZQK 2AJVH 2RQ8A 5DMIH 5D8JH 1GZPB 5C2UB 5CLTA 5D5MA 2GSIA 4BSJA 1VSCA 3K8LA 4Y5VA 2DLFH 3HZMA 4O4YL 3WFZA 3N9GL 1P7QA 2PTVA 4PLKD 4XMLL 2W9EL 4JFDA 3ZYOA 1OTUC 3IDGB 3ARBA 3JTTA 4U1NB 4OIBA 2X05A 3RBSA 4JGMA 1BZ9A 3FRPA 2ZOLA 4JM2B 3TBTA 2NW2A 5C09D 3PGDB 4TTDC 1R6VA 4FFWD 4F8QA 1AXTH 1OSPL 4G43B 2G5BB 1GZPA 3HB3D 1MCRA 4QRRE 3N50A 5F96L 5E95B 1JTOA 4L29B 2YKLL 1VGEL 2OX5A 2OXGA 1AD9B 3BWUC 4KROB 5B39G 1CVSC 2DS4A 4ZUWA 1L0YA 2ED8A 4L4JA 3FONB 3GMNB 5F1OB 4PJ9C 1LO0H 1YEGL 3IDGA 3NFSH 1EERB 4U1NA 1GC1L 1L9NA 3MRLB 3D3VE 5IMLB 3PDGA 3Q6GH 4JM2A 3TJEH 4OFVA 2JKXA 4DKFH 4ALAL 3PGDA 2YD4A 1I7ZB 4Y16D 1VKXB 3BDXA 2FATH 4ELMF 3AFLA 1AO7E 4G43A 2G5BA 3DXAD 1I9JH 1Q0YL 1ZWIB 4OQTL 3FOMB 1J1XH 3O4LE 4L29A 3ZYIA 1RAMA 4KQ4L 3CVIL 4Q6IB 4Z7WB 2DMCA 1AD9A 3S7GA 1T22B 5FGRA 5TFSL 3PABB 2AJYL 2P5EB 3QDMD 5JPMB 3QWQB 1CXHA 3I9GH 3HPJB 5C07D 3FONA 3GMNA 1YY9D 5DR5H 4Z8FL 5HHOD 3SGKC 3MRLA 5KSAB 5IMLA 1T7VA 1TJHL 3SDXE 4HS3B 4Z7QF 5SWQB 1I7ZA 1VKXA 4M7ZC 2ICEB 4P9HH 3OKYA 5GRJH 1O7VA 3SCMB 3MV11 2EECA 3PWPB 1ZWIA 2HTLD 3SOBH 3FOMA 1HZHL 2ARJB 5FYJD 2P44B 4Q6IA 4WU5B 4KK6D 2DD8H 4Z7WA 5F9WB 1T22A 4TRPH 4K7PY 3PABA 1NUDA 2P5EA 4G6ML 5JPMA 1G0XA 4LRNL 5E8NB 1E0OB 4F58L 2BRRH 3HPJA 5I9QC 1IILE 5GSVB 4FQJL 5D4QA 4JFEB 4OM0H 5KSAA 3TYGL 3BO8B 1KLFA 3GMMB 4HS3A 1A6WH 2X09A 2XZQH 1WBYB 3KPNB 5C08E 5SWQA 2ICEA 7FABH 3KAAA 5EIVA 3F65A 3IAQA 4M5ZH 3SCMA 1IGIH 2V9QA 1IEAB 3PWPA 4EOWL 2ARJA 5C0FA 4WU5A 4F33B 4LRIC 3L6FB 3MC0A 3F6IA 3HI6L 4G7VL 4XNXH 5E8NA 1A7PL 4BQBA 2HRPL 4NC2B 2MCPL 5GSVA 3ILPB 5BVJA 4QO1A 4GMTH 4V1DD 2VXTH 4HWNA 4OF8A 2DQIL 4NCC1 4HUVB 3BO8A 1UXSB 2NY5H 1V5JA 3GMMA 5GGVY 1BLNB 3MLRH 3KPNA 1WBYA 4L9LC 3RY6C 5M94B 3MGAA 5HGHB 3ALPA 1CWVA 4QRQB 1MEXH 1QP1A 4MD5B 5KAQF 1IEAA 3QSKB 5TE4H 3G6DL 5MEND 3FT4B 2IBZX 3EZ8A 4KH2A 4F33A 4J3OC 3L6FA 3GGWB 3TC9A 2VAAB 2KQNA 4CADB 1NANI 1S78D 3KPSE 4IRJD 3ILPA 3PWLB 2OK0H 2FH8A 3E3QE 3FRUB 4PGZA 3I2CH 5C0ND 3AS0A 4NT6B 4HWEH 4U3HA 4U1GB 4HUVA 3LQMA 4U7SA 1UXSA 2NZ9D 5FHBH 5HGHA 4QRQA 4K3HA 5AUMB 4PJ7F 1BFSA 1C5CL 2EDKA 4MD5A 2VXQH 5D1QD 4ONGL 1CK0H 2W91A 3FT4A 1I9IH 1IAIL 4JHAL 1H8SA 1AO7A 3IDYB 4UI2A 3QFDB 1EHXA 4KXZH 3GMLB 4KPHL 3GGWA 3VI4F 2VAAA 2HAZA 1RULH 3NCMA 5F7FA 4CADA 3EFDH 3OZ9L 1KJ3H 4HT1H 3RZCC 2E7BA 1WZ1H 4IRSD 3FRUA 4UV4H 4KI5E 2QHLA 4NT6A 1OP3K 4CRPA 2NY0B 1GAFL 1JPTH 5IFJB 1I85A 4LCIH 4XGZB 4MZ3A 2MWCA 2BNQB 2E7HA 4KKCD 3VFNB 43CAB 3SDXA 3BYYA 2J6EA 5AUMA 1KLUB 1NC2B 5C08B 1T03L 3W0WD 4JG0L 3ROOB 5FYKL 4R4BB 1NCTA 3QFDA 4TUKH 3GMLA 4ZFOL 3MCLH 4DUXA 4Q97A 1NCUA 1QO3B 3VRLE 1AGCB 3SJVD 3IKKA 1T2QH 1UH2A 3LY6A 1P9MA 3MRMB 4HJJL 3SDDC 3VXTB 4L3CB 5KJRL 3WFDL 5IFJA 4XGZA 4POYA 2BNQA 4HJ0D 3VFNA 43CAA 4PJ5E 2HT2C 3LN4B 1HINL 1KLUA 1NC2A 3G6JF 4M43L 1AXIB 5C08A 2VLKE 1CTOA 1U8HB 2IPUG 3ROOA 5JPNB 2ITDB 3QEQB 4YHKL 3C9NB 2NZIA 4R4BA 3SDAD 4WCYH 2BP3A 4GG6E 3OF6A 1QO3A 3RVUC 1AGCA 1HQ4B 1W8OA 3G9VA 3BJ91 4JFHD 2F8XC 3MRMA 3N1QC 4LK4A 3DVGB 3MRRB 1MCCA 5EWIL 1I75A 3R8BB 4L3CA 3R0NA 4KTYA 4KK5C 3C6LB 3V52L 4YDIH 3N1MC 4JZJB 1S7TB 1IAIM 5DZLA 3S36L 3QT2A 3LN4A 2B0SL 1FG2B 4A2MA 5HPMB 1G7JB 4OIAA 1U8HA 4HKZB 1SJEB 5JPNA 2ITDA 3QEQA 3C9NA 3W2DL 5INCA 1T7YA 3C5ZC 2F8VA 2UZYB 5D2NB 3MACL 4MXQD 3LRHA 4HJGB 5L2JB 1HQ4A 3LQAL 3DVGA 3MRRA 3HNVH 3A0OA 2DQGL 1QSFB 4PLNC 2VDRH 3C6LA 4XP9H 4JZJA 1S7TA 3M17B 1LWRA 4PJXF 1YEIH 5KBNC 1JPST 4LEXL 1FG2A 1QBAA 5HPMA 3ARFC 5F9OL 4ACPA 1G7JA 1OF2B 4HKZA 5DRWB 1SJEA 3AXLB 3EUUA 2X9XA 4P2OB 1NCDL 3VWJC 5D2NA 1NFKA 4X80L 4HJGA 5CEZD 3FN0H 5L2JA 5I8CB 2AQ2A 1G7PB 3MLXH 3MBEB 4GKNB 4MMZC 1OAQH 4P46D 1N0LA 2MJWA 1QSFA 4BSVB 4MGXA 2CKNA 2O5YL 4AQOA 5DUPH 3ZSTA 1DSFL 1JWMB 2PTTB 3DOSA 1JHKH 3M17A 4FQHB 2QQLL 3V8OA 2NPLX 4D0CB 5E4EC 1OF2A 3VW3H 4N90D 4GBXD 5DRWA 1GXEA 5GS0C 4PJ5B 3AXLA 4WNQB 4P2OA 4PBXA 4UUJB 1DQLH 1AI1L 1J1OH 4FG6C 1INEH 3NIDE 4MCZB 2XN9E 5IHBA 2ZCKL 5DJZB 5I8CA 1G7PA 4CVZB 4FZEL 1DEDA 5C3LD 3MBEA 4GKNA 3IDNB 3V0VB 1CDIA 4FTVD 4BSVA 2EH8L 4FMKA 3VXSD 4PD4J 1JWMA 2PTTA 4ZD3H 4FQHA 4IJ3B 2APFA 1V3LA 3RWEB 3MRGB 2YPLD 4D0CA 3QUML 2CR6A 5GS0L 4PJ5A 1JE6A 5GGUB 5B8CC 2YN5A 3TH4T 4UUJA 3O8XD 2OR9H 4MCZA 1Z0NA 5DJZA 2V5MA 2I9LB 3S37L 4CVZA 1GOHA 3L3IB 5A2LH 5GZND 3QIWB 4OCWH 4NZUL 5DQDL 3IDNA 3V0VA 3WFBL 4NM8L 1BVZA 5I71B 2NY2B 5T3XL 5E03A 4L8BB 1AGBB 5EBMB 4EN3B 1S9KC 2ZUXA 4AQ1B 5KN5B 3O6KH 1BQHB 3R06B 3RWEA 4YXLH 3MRGA 3O2DA 1FV1B 4P2YA 4QTIL 2XRAL 3CNKA 1AJ7L 2XG4A 1FORL 3B8SA 3U83A 4KUCD 5GGUA 5CHNB 1EO7A 1HN1A 4LKCB 5IGXH 2I9LA 4K3JL 5LVEA 1MJUH 1MCNA 4ZSOE 3L3IA 4KRPC 3JUYA 3L5IA 2DQUL 1QA9B 3QIWA 5CZXC 4CGTA 4XCYB 4J12A 2NY3D 3IAPA 3QHFL 3QXUA 3LV3B 4L8BA 1AGBA 5EBMA 4EN3A 2YZ8A 1KJ2H 4YDLB 3OX8B 4M6NL 1KENH 1BQHA 3CFCH 3R06A 3MNWB 4K7PH 1OSPH 4J23A 4MXWH 1FV1A 3LEVH 5JW4Q 5HYJE 1UGNA 4RQQB 5A2KH 4GRWF 1DLFL 4HF5L 3HG1B 5DSCB 2ZG1A 3H9SD 4Y4FD 1P7HL 2LAAA 5CHNA 1FFPB 2AEIT 1NLBH 4LKCA 1KC5H 1U42A 4RGNC 2Z8WC 1YEHL 4TNVF 3FFCB 2XN9B 2B2XH 1QA9A 2PKDA 5D7KD 3TN0D 1G6RB 4XCYA 3PQYE 5IJKC 4J7RA 3LV3A 1QLEH 4U6XB 4NN5C 1RIUH 4N0RA 5ESVB 2ZUSA 1NKOA 3OX8A 1WTGT 3MNWA 4K9EC 2OZ4H 4NNYB 2GJ6E 1S5HB 1IAOB 2ATPB 3LMJH 4PJCE 3IKCB 3OBAA 1OL0A 2UUDK 3UBXG 3C2SA 3HG1A 4IMKC 4LMQI 5DSCA 3CLEH 5TFSH 3RVXC 5EU3B 5H94B 1J0HA 5EC1B 1OPGH 5GGVH 1FFPA 1W72B 4KV5F 4RMTA 4X6CF 3EDDA 2AJSL 3FFCA 1DBMH 4XP5L 2XN9A 4YDKH 4PR5B 1G6RA 3QO1B 3UYRL 3FL7A 2G60L 3EOYG 2D7QA 4U6XA 4U31A 1N3NB 2ZSVB 2WK2A 5ESVA 4DFHA 4OQ1A 5L8LB 1CLYH 3KPTA 4NNYA 3VGAC 5JTWA 1S5HA 1UADC 4A6YL 1IAOA 2ATPA 2B4CC 3IKCA 4ERSL 2C3GA 2DM2A 3HE6D 2R2CA 4EZMA 1CLOL 1I1FB 4EUPH 5EU3A 2RAMA 3LH2L 1YYLH 5H94A 3UO1L 1W72A 1DQQB 2BVUA 1EUUA 2C5DC 2H6PB 4TVPH 5GZOD 1CR9H 4X9BA 4F3FB 5E0QA 1HWGB 4PR5A 5D1XD 2AXGB 1FSKC 1QHOA 3HMWH 4ZSOB 3QO1A 1SHMA 4HIIB 5CKAA 1N3NA 2ZSVA 5DK2B 4YEFA 12E8L 4JO4H 1NAKL 2IC2A 3R4DA 1A6ZB 1FFOB 5JQ6H 1YC8A 4XVTL 3P4NB 4JY6B 5IFHH 2B4CL 3ZKXC 3VWKC 1N64H 1I1FA 3BIBX 3NA9L 3OV6A 2AK1H 1DQQA 1T1WB 2VXSL 3HE7C 2H6PA 4HUWB 1KELL 4F3FA 5FM4A 2D0GA 3AMLA 2VH5H 3EOBB 4FQIH 2FH6A 4ZSOA 5JOPE 4HIIA 1Q1JL 2ED9A 1CIDA 3MA9L 2NNAB 2B7DT 4G80B 5DK2A 3VG0H 3PQYB 5JHDE 2VKWA 4Z18A 1Q38A 1A6ZA 1FFOA 2ICWB 4L5FL 3KPSD 3G6DH 3P4NA 4JY6A 3VFGH 2WNGA 1RIVH 1JP5A 3VA2C 4BZ1L 5C9KA 2DM7A 5A40E 1TFHA 4U4BA 5ICXB 3U7AA 5ABDE 2IMMA 3C60D 3DMMC 1OP5K 4EBQH 4HUWA 4KJQC 1Y6MR 3ZDYE 1NGQL 3EOBA 4MSWB 4GUPB 1FNSH 5I74C 4JDTH 5AD0B 2NNAA 4G80A 2APTA 3PQYA 3S3PA 3LPFA 4MLIA 2BERA 3IB4A 2EYRB 2ICWA 1QOKA 4JFZL 4Z7UE 2OS7A 3X3GL 1EEQA 4K3GA 1KN2L 3S35L 3MOBH 2VE6B 4EXKA 3IAGC 5ICXA 4MAYB 1NGYB 1NBVH 2NQCA 1GJIA 4AIZB 2WINB 5MI0C 4PRDB 4MSWA 5IVXF 1GAFH 4GUPA 4PY7B 5AD0A 1DFBL 3LKPB 4HLZH 1KB5L 2V17L 1TJIH 1YYMH 2ZUQC 1YN6B 5EUOB 2EYRA 4N8CH 3ARUA 4X6DE 4M61B 4FP8L 3QQ3B 1B6DA 4GRWH 2XY1A 2MQ0A 1I3VA 2VE6A 1TZIB 4LLAA 2B1HH 4MAYA 2X70B 5IBUG 1CZ8L 1NGYA 1HI6B 3HRPA 3SE8L 2WINA 3QDGD 8FABB 3DSNA 4PRDA 1CD0A 1KCKA 3GSNL 1RUKH 4F80A 1RI8A 4OIIL 4PY7A 3LKPA 4BFIB 4JQIH 4C56E 3KPOB 1YN6A 5EUOA 4MJ4A 4PRHD 1BD2E 1YPZE 1EA9C 4M61A 1W0VA 3QQ3A 3LN5B 4KRLB 5D70L 5DUML 1V7NH 1TZIA 1F6LL 2X70A 3QEHB 5IR1B 1HI6A 4NWUL 4YC2C 8FABA 4KJWC 3ZMRA 3V4PL 5F1NB 1MCIA 2VXVL 1X9QA 1FYHB 1CBVL 2KKQA 4BFIA 4LPXA 1JIBA 4Y1AE 4ZMAT 1BVLB 2VDNL 5DEZA 4XXCA 3DECA 4XPHH 3LN5A 1V3KA 1MRCL 3E1F1 4LP5A 2WBJC 5JXEA 2MKWA 3QEHA 1MF2H 5IR1A 4XP4H 4PP1C 3WLWC 3RX7A 1QSEE 1F6AB 3WE6B 5CGMA 4OZFG 5F1NA 3TVMB 3B2UC 4H0IA 4N0FB 5T5NG 3U7YH 2D7TH 1FNFA 2D7OA 1BVLA 3CPLB 5F9OH 1HCFX 1KV3A 2DQCH 3LN9A 5D1ZD 1LP9F 5FYLL 2Q20A 4JRYE 2APXA 1MSPA 2H8PB 4WUUB 5L2KD 4JKMA 2XG5A 2ITCB 3HI1B 2GTWB 5D93B 4U6VH 3REVB 2AJXH 4GO6B 3PP3H 4UOJA 3BGMB 4ELME 1A7QH 5GHWL 5IQ7H 1F6AA 3WE6A 4OFKA 3RNKA 3TVMA 4ZTOL 3FQXB 2O5YH 3ZE2F 1BAFH 1IBGL 4OZIB 4DWHA 3ZKNC 4N0FA 5BJTB 5E2UL 3OJMB 2AKRB 2YEZB 3CPLA 1YNTB 3HLAB 2CKBL 2DMKA 4Q7DA 5IHUL 1ADQA 3FJTA 5BRZB 2H8PA 4WUUA 4UOW0 2ITCA 3ECBB 4HXBL 5IWLA 4KJPD 3HI1A 2GTWA 5DVOA 1FBIL 4Z7QE 3REVA 4MJ6B 3BGMA 4Z6AT 4LDOB 2WQ8A 4PJDF 1EFXB 3DIFB 2JJSA 3FQXA 3UAJC 4M9OA 5IVNA 4OZIA 4W4OA 4M5YL 9CGTA 2FRGP 4K23H 1NUGA 5BJTA 4I77L 5GGQH 2AKRA 2G75B 3O9WD 2YEZA 3ZHKA 3QBTB 1JHLL 4BSWB 1YNTA 1F2XK 3HLAA 4O5LL 4F2MB 2ENSA 3ECBA 2DM3A 3WYRA 1F4AA 2YSSB 3WIIH 4NO0B 5HDQL 4MJ6A 4YGVB 3WFBH 1JTPA 2AEWA 3TT1L 2Y6SC 4LAJH 1EFXA 3DIFA 1B6UA 4YEEA 1AGDB 4HBQA 3TJHC 3IU4H 3VXRB 2G75A 3TCLB 5CGYC 4BSWA 3WHXB 1X5GA 4LVNB 4ZOBA 4M93B 3QQ4B 4E9LA 2Q3AA 4F2MA 3BN9C 2PR4L 3HTLX 2MCG1 4K3JH 2YSSA 5C3TA 4NO0A 4L1DA 4YGVA 4W68A 5HYJD 4POZC 5E7FA 3GBNL 4XB7A 5FEBA 3RY4A 1CXFA 1CL7H 5FOBB 2FGWL 3EYQC 3SEPA 1AGDA 1M05B 4NKQB 2R2BB 3VXRA 2VDOL 3TCLA 4ODSH 3WNNA 4U7MA 4N68A 1FLRH 5CSBA 1A9BB 4FQ1L 1FDLH 5C70A 3WHXA 3H0TB 1RIHL 5F7WC 4LOUD 5T3ZH 3QQ4A 1NL0L 2HVKB 4HK3J 4X6BB 1OGAB 2NXYD 1KCVL 5EU7C 2O93L 3U4BL 1U2HA 1HYRC 4XZUB 1XF5B 5D7JD 4PV8B 3RTQC 4HGMA 4NUGH 2IBZY 4PJ7E 3VFVB 5FOBA 2GT9B 5D7LE 2P1YA 4KHTL 4E42B 3B5GA 4HQQH 1TZGH 5E9DE 2VYRE 4LSVL 1M05A 2R2BA 1LVEA 3FMGL 4JHZA 5DD0L 1I8IB 1ZHNB 4YX2L 3VI4E 1EVUA 1A9BA 3H0TA 4GRLD 2QR0B 2HVKA 1ACZA 3ARPA 4X6BA 1OGAA 3G6AB 4NRZB 1IC5L 3T0EE 3O3BB 2NXZD 2FB4L 4WI4A 4X4XB 3HNSH 2B5IC 1I1AC 2MFNA 1DUYB 2W0PA 5FAAA 2AJSH 1DVFD 4XP5H 4XZUA 1XF5A 4LHUD 4PV8A 3AY4A 1AP2B 4K3DH 4WWKD 4ZG1A 3VFVA 1C1EL 2G60H 2GT9A 4E42A 4AEIH 5DUBB 4DZ8B 4XPGH 3QUKB 4NKOB 1OD7A 5DRZB 2QL1A 4K9EH 4OI9A 5HHQB 1I8IA 4MNGE 4RFNC 1ZHNA 3BVNA 4JRXD 3QRFM 5BV7H 1K85A 1ZKAA 4XWGL 4DW2H 1RJZB 2QR0A 5TQ0L 2ZUTA 3G6AA 4H88H 2E9IA 3Q6FB 4NRZA 3LH2H 2R0WL 4JPIB 3O3BA 4LPUA 4EI5D 5FGSA 3CFDB 4PJEB 2ZSWB 4X4XA 3K8MA 3CCHB 1UACL 1DUYA 5F8RC 4OLUL 4XAKE 5DJCB 1YMHB 1AP2A 4MCYB 1RURH 2CUIA 3D48R 1JGEB 3VRIB 1NMBH 5DUBA 4DZ8A 1TIUA 2IAMD 3FOLB 3QUKA 4NKOA 1CFVL 2FX9H 5DRZA 3HCVB 2F5BH 2F74B 4OGAC 5HHQA 1KNOB 2X1OA 3AS1A 4QOKB 4WY7H 4RMWA 4XCCL 1MCEA 5TDPB 1RJZA 5K33A 2F5AL 2IG2H 3Q6FA 4JPIA 1E4XI 3MV7E 1JNJA 2VWEC 3CFDA 4PJEA 2ZSWA 5D6CB 4OCSH 3CCHA 5IROC 1KELH 1RQ5A 2VXUL 4MWFB 5JHDD 2HFGH 5DJCA 2XKUA 3MRNB 1YMHA 3HMXH 5J4MA 5I73B 4MCYA 2AXHA 3HC3L 4LCUB 1MY7A 4OFPA 1JGEA 3VRIA 5LCVL 1TCMA 1NCAH 3BIAX 4S1RL 2XZAH 3FOLA 4X5LA 4QRPB 2Z4QB 3HCVA 3BE1L 5DO2D 5IQ9B 2F74A 1QBLL 1KNOA 4QOKA 2JJTA 1ZEAH 5TDPA 4BZ1H 1L4IA 2A6JB 4XCFL 1DQDH 4LIQH 1CCZA 4X6EB 5D6CA 1G0DA 2EE9A 3V6OC 3QULB 3OSKA 2EDNA 5CILL 2DKUA 1RMFL 4MWFA 1Q9KB 1MUJB 3MRNA 1GGTA 1PX4A 4LCUA 4Y8DC 3VXUE 5FDYA 4HULB 4QRPA 2Z4QA 4APQD 5IQ9A 2A73B 5KSVA 4TVPE 3ZTJG 3A6CL 1S9VB 3DGGB 3SE4C 1PVHA 2A6JA 4Z7VB 3QNXB 2P5WE 2DDQH 3CDGB 3BXNB 1XGYL 4RAUB 4X6EA 3FHAA 4WFHD 1AE6H 4DCQB 3NOIA 1UJ3B 2Q8BL 3QULA 4NQCE 3MZGB 4WFGD 2IAND 3K1KC 1Q9KA 2J5LB 4IOFD 3W11D 4OFYA 5FUCC 2Z31D 4UMGA 4H1LH 4L4VB 1AQDB 2A73A 5D7SH 3VA6A 4FZ8H 3QDHA 4PJ8D 1S9VA 3DGGA 2H41A 4P3CL 4Z7VA 1WVZA 3QNXA 5HBBA 3CDGA 3BXNA 3QXAB 4RAUA 1INDL 3WO4C 1IQWL 4HUMB 4D9LL 5FUZL 3QPXH 4DCQA 1UJ3A 1MAKA 1EV2E 5I1HL 4JQVA 2A0LC 5A2JH 3U46B 2F15A 2A1WL 1N7MH 2IBBA 5F97E 5MEQB 3MODH 1OGTA 3GNMH 5I1KH 4O2FB 4L4VA 1AQDA 3TFKD 5SWZB 1A5FL 2XI9A 4P5TD 1FGNL 1E6OL 4MQXD 4JKPL 1TVHB 2HT3C 4ZAKD 1I1CA 5D70H 5F8QC 4PJ9B 1KLGB 2PNDA 4R7NB 5K93A 3QXAA 3OKMB 3LPWA 3FQNB 1DANT 1FH5H 4YHML 1XEDA 4XP1L 4NQUA 2BY3A 1N6QL 1ZT7B 2FEEI 1S7SB 3OG6B 1BBDL 3U46A 2I07B 3IDJB 5F6IC 4QKXB 3KLHD 1S7XB 3RNQA 5H37G 4OQTA 1BFTA 5MEQA 5AYQA 1KOAA 4O2FA 3U9PL 2H9GB 1OW0C 5SWZA 3QCTL 2F58L 2W60B 1BMGA 3VXUB 5KSBF 4FFWC 3H6JA 1TVHA 1U8LB 1TETH 4HAFA 4ZOEA 3BGFC 1QSED 2XV6B 5I8EB 3WXWL 1KLGA 4YFLI 4R7NA 5C6TH 2CGRL 3OKMA 3FQNA 2YWZA 4P9ML 4OKDA 1IQDB 3DV4B 2P5WB 3WFCH 1RUPL 4IOIB 4EDWL 3FB6B 1ZT7A 4HXAL 4M7ZB 2YUWA 1IKFL 2Y25A 2I07A 2IPTH 3HA0A 3IDJA 5HHVL 1S7XA 4GRWE 3EZJB 1G9MC 3I84A 1Z9LA 1II4E 2FDBP 3UTZB 1F4WL 1KPVB 1IAKB 3CX2A 1UZ8B 2H9GA 3VXUA 2W60A 5DC4B 3H42H 5HYIA 4Y16C 5FYLH 3MRIB 1BVKB 3IVKB 2AEPL 1U8LA 2WWMC 3LS4H 3MMEB 4CL7A 5I8EA 5I9QB 1JVKA 1AQKH 4KY1L 3HKFA 1MNUL 4HFUH 2EXYD 4ZQKB 3CX5J 3SGKA 4EQ2A 1X4XA 1IQDA 3DV4A 5J8OA 2P5WA 2BSRB 2CXGA 2R56L 4IOIA 1IGML 3D0LB 2H2SD 3FB6A 3UTTE 4JANB 5CFHA 5A16B 3O2VL 1IBGH 2FHCA 4UILL 4XVJH 4RX4A 1YY9C 3I75B 1G9ML 3BMVA 3ULUH 3UTZA 3RA7L 1KPVA 3SE3C 4PLJC 1IAKA 5HY9B 3B9EA 2ADGB 1UZ8A 3SKNB 1B88A 5ALCH 4CN6A 1CQKA 3NBNA 4KV5E 3MRIA 2BJMH 4FFZH 1BVKA 3IVKA 5EZIL 2VR9A 2UY7A 3MMEA 4JDVB 4KKAD 4X6CE 5DJ0B 1VFOA 4ZQKA 4WI6A 1I7TB 1T1ZB 4KK6C 2BSRA 4WTZG 2D7MA 5K9QI 3D0LA 3OMZA 4L9LB 4JANA 1PFCA 3MV01 5A16A 1OTTC 4S1SH 4TUJB 3RPKA 3I75A 4HV8B 1JL8A 2HWZL 3QB7C 3OKDB 5HY9A 3D85B 5HGAB 3RWGB 2DYPD 3SKNA 2ADGA 4LRIA 2ARJQ 4X7EC 1JHLH 3MUY1 4AEHH 5H35B 3C09B 2BVEA 1N0XL 5DJ0A 4JDVA 2ZKHH 3R1GL 1I8KB 5HVHC 1UYWH 3GKWL 5HHMB 1I7TA 3WDIA 4RWYL 5FO7B 3O6FD 4L9LA 5JDSB 3I6LE 1T3FB 4TUJA 4LAQL 4O9HL 5J7CC 1P7QD 3P0YH 4HV8A 1CE1L 1OAXL 3L3GB 4H0GA 3OKDA 1OAKH 1MHCB 1OAUL 3D85A 3MRCB 5HGAA 5EBWB 3ARBD 2WLZA 3RWGA 5HVFB 3CVHL 5H35A 4G6FD 4GS7C 1NDGB 1A3LH 4V2CB 3WUZA 1I8KA 3FO0L 4RRPG 1K2DB 4EDXB 4RGMB 2RFXA 3F5WB 4N5ED 1TLKA 5FO7A 4KI1A 3GFUA 3RGVD 4BFBD 3GBNH 2WQRA 5JDSA 1T3FA 1IT9H 4LNVA 1S78C 4ONFL 5DD5H 1RZFL 4TTGA 4P49A 2GTZB 1E4KC 5FKAB 4CMHC 1Y0LB 2EEAA 4QGYA 3KR3H 5I1EL 2PW2B 3OB0K 1DN2A 3GM8A 3L3GA 4OUUB 1MHCA 3MRCA 3FTGB 5EBWA 4LCWE 1MQKH 5BQ7B 2NZ9C 3I3DA 4NOFA 3G08B 3VD5A 4DK3A 2VKXA 2Q8AL 1NDGA 3SDDB 2YS4A 5D1QC 2DQHL 5D7LD 1K2DA 4EDXA 4C4KO 2J8UB 5BS0E 4Q9QH 4PP2B 2LVCA 1ZT4B 5E9DD 3F5WA 1QHPA 4AEEA 4K3EL 1T66D 3AM8C 1CG9B 2PYFB 5T5NF 4PG2A 1WIOA 3SGDI 3BH9B 3LKOB 1F58L 3EDKA 2GTZA 1N4XH 4WO4B 5FKAA 2KBGA 2P45B 4FQ2L 4LSVH 2PW2A 1BWWA 4OUUA 5ALBL 3FTGA 4L3EE 5DD1L 3UJTH 2OTUB 2AK4D 5BQ7A 2JCCF 4DGYL 4PRID 4D9QD 3BAEL 3G08A 4B5EA 1FZMB 4KKCC 3RUGB 32C2B 3MO1B 3SDDA 2XZZA 2VZ3A 3T09A 5IVXE 4Q9RH 2J8UA 1NGXB 5TF1L 4PP2A 1ZT4A 3RX8A 5CLWA 1CG9A 5GRUL 3ZTNL 4GW4B 2PYFA 5E2TH 4I2XB 1Q8MA 3ULVF 3BH9A 3LKOA 4HKBB 3HAEH 5KOMC 4XT1C 4B7LA 4QRSB 4WO4A 3ESUF 4HKJB 1MLCB 3DX6A 5EORH 2OTPA 1F4XL 1GGUA 1XGRB 3C5ZB 3ISWA 2OTUA 3WXVL 2X5PA 1BOYA 1FZMA 5C0RH 4N9OB 1MREH 3RUGA 32C2A 4L8CB 3MO1A 4M6MH 4QWWD 2P46B 4L4TE 4YIQB 4UAOC 2VZOA 3QXWA 1NGXA 4QGTA 4ZNEA 4G9DB 4QHNB 3ZDZF 2ESVE 2BK8A 2DJUA 4JN1L 3SDAC 3JV4B 2Y07L 1JN6B 1G7LB 1P6AB 2WWKT 4I2XA 1KCRL 4GAGH 2F19H 3EYUH 3FQTB 4HKBA 5T3ZE 1GPOH 4UT9H 2YD2A 3GZKA 5HJ3B 4QRSA 3ARFB 4M8VA 1C7TA 3J7HA 4HKJA 1MLCA 3H2WA 3MV7D 3JWNC 1IGCH 4M48L 1XGRA 1ZV5A 1BEYH 3VWJB 3B9KD 3MJ9L 3MTRA 4JFED 3V4UL 1KTRL 3EO1B 1KIRB 4L8CA 3FN3A 4YIQA 4GH7B 4HPYH 4PBWD 4G9DA 4QHNA 1JNLL 1ULVA 4CUCA 3QO0B 3H9ZA 1QQDB 5D7IB 3JV4A 1JN6A 1G7LA 4JO3L 3FQTA 2N7BA 5HJ3A 1UQSB 3ARFA 5DDHB 4S1RH 5E4EB 3QUMB 1S7QB 4UBDC 4IHOB 2APWA 3WJJC 5B39B 1YEEH 3VWJA 3B9VA 3VFPB 4Y19E 4JFFB 3EO1A 3GI8H 1DANU 2HKFL 4ZS6D 3T0WA 1KIRA 4OB5L 1P5VA 4YDJB 2LFGA 3SO5A 4ORZC 1CGTA 1G9NH 1M71B 1FHGA 4LGRB 4X98B 1QQDA 4IDLA 5D7IA 4I8DA 2AI0L 2Q7YB 4D0BB 5J9PB 3UMTA 4F7MB 3GB7B 1LP9E 1UQSA 5DDHA 3QUMA 3QUXB 3WIHL 1S7QA 1U58B 5IBTH 4LASH 1KCSL 5ID1B 5B8CB 5TPWL 2VNCA 4QHLB 4ZUSB 5B39A 3DETC 4NQCD 3ZT5A 5DFTA 3VFPA 4CU7A 4JFFA 1JGLL 4LSQL 1RVFL 3IFPB 4UB0L 2JIXB 5J57B 2E9JA 3HNTH 4ODWB 2J88H 4YDJA 3ZE2E 1WCBA 4L4TB 1M71A 1IAMA 1RFDL 5IVXA 4X98A 4FNLH 1EHLH 3OR6A 3UTQB 5I1IL 5L8KB 3MLWH 2Q7YA 1U3JA 5CINH 4D0BA 4Y5XB 5J9PA 2V6HA 3X3FH 4F7MA 3GB7A 1YNKL 3QUXA 5FHAL 1U58A 2D4FA 5ID1A 5B8CA 2CK0L 2YRLA 4QHLA 5B38G 1J0IA 4ZUSA 5HD8C 4HDIB 4X7CC 2PF6A 3MNZB 4GXUN 1OM3H 4KRPB 3IFPA 5KSAC 2JIXA 1BP3B 4K8RC 4U1HB 4ODWA 1IQWH 2BNQD 4OCXL 4WI2A 4L4TA 1NC2D 4P59L 4K2UH 3ZHDA 5EBLB 2NY1D 4TQEL 3ARTA 4OZFH 3QPQC 5J11C 3MOAH 3WFEL 3PWJB 3UTQA 4ZS7L 5EIIB 4Y5XA 1FNHA 5IEHB 4U1LB 3KXFB 4LIQE 4PUBL 5JIKA 5LXGL 3UTSE 1KYOK 4B7IA 1ND0B 4HDIA 1OT1A 5CP3H 2A6DB 4RGNB 1KYOJ 5H8DA 4K8RL 4OZ4B 2QTEA 2EIBA 4U1HA 5ADOL 3RKPA 5EA0L 3SQOL 2AGJH 5I19H 2Y06L 4OLVL 5EBLA 4X4YB 3L5XH 4OD1L 4NN5B 3PWJA 2C7UB 4OGXL 2D9CA 3CSYB 4YHYC 1LK3H 2ERJC 4K07A 43C9B 5EIIA 4YHLH 5EU6E 1MCPH 5AEAA 5IEHA 4U1LA 3ULVH 3P40A 5GJSL 5BV7B 1F00I 4A6YB 3KXFA 4ZNCD 1CDCA 1FIGH 1MCKA 3C87A 3K7UA 2BNRD 4OBSA 1BFVL 2LAGB 3EOTH 4S11A 1MJ8H 4POUB 5EO0B 5DHVH 1ND0A 3MCG1 4J8RB 3UXFA 2A6DA 2ADFH 4LDLB 3FT2B 3WUWG 1XH3B 3G5XB 4OZ4A 4P9MH 5K9JH 5IJKA 5TE7L 1PQZB 1I7RA 4X4YA 4Y4FC 4IDJH 3CD4A 1IGTB 4HWZB 1JCKA 4LCCC 2C7UA 3PF2A 1YEJH 2Q6WB 3VXPA 3CSYA 43C9A 5DURB 4IBLT 4RSVA 3VGAB 1C7SA 4M62H 1F4YL 2WANA 4A6YA 1KB9K 3EYSL 3VGGA 4PYGA 3U1SL 3VXOB 2H3NB 1X5IA 4XC3L 4IMKA 4NPYB 1LP9A 1FZOB 4GQ9L 5E24E 5EO0A 1KB9J 5KOVC 1QSFD 4J8RA 4DFIA 5KVEH 4JLRB 3FT2A 1XH3A 3WS3B 3G5XA 3O3AB 4IRZL 1A47A 1QLRB 4KY1H 4U1GC 1BM3H 1I85C 1FSKB 2DL2A 1PQZA 1NLDL 3QIUD 1HOCB 5DJ8B 1IGTA 1NCWH 1S3KH 4ENEC 4YZFF 4HWZA 2Q6WA 4P2OD 4UT6L 3WJLC 3BKMH 4S0TD 4UILH 4YXHH 2DI7A 3LS5H 1G9MH 4F7EB 3WL9B 4Z95L 5CJQH 3ZKXB 3VWKB 2XZCL 5E99L 3GI9L 3VXOA 4JR9H 2H3NA 3MBED 4NPYA 1SY6L 1FZOA 4MA8L 2VQ1B 1AKJD 3EJYD 4OLXL 4G9FE 1AC0A 2CXKA 3HE7B 3V0WH 4JLRA 4ESKA 2PXYD 3WS3A 3O3AA 3VI3F 3KYKH 3F58H 1QLRA 2P49B 5LGHL 1QNZL 3HE6C 4R8WH 1K6QH 1IC7H 3BJLA 1HOCA 5DJ8A 3GHEL 1JHTA 3Q0HA 5SV4A 4WFEE 1NFDB 4ZFFB 4G5ZL 2I9TB 1KG0B 2X4UB 3O6ML 3ZZ1A 1A7NH 4F7EA 3BD3A 3WL9A 5D1XC 2IQ9L 3VWKA 3TYFB 4RBPK 3RWIB 5KW9H 1KEGH 1G7MB 1BQSA 4KAQL 2WWKO 2VQ1A 5KS9F 1MOEA 3KJ6L 3DMMB 4I9WD 3HE7A 4KVNL 4HCRL 3QI9B 4NN7C 5FYJH 2X9WA 3OAYH 4QHMB 3GO1L 3I6KA 3P2TA 4NP4H 2JF1A 4YFDB 4DVRH 2NR6D 5I74B 4FS0A 1KB5B 1NFDA 4ZFFA 2I9TA 1KG0A 2X4UA 2XQYG 4H1LB 3T8XB 4LAQH 2DTSA 3CSGA 4ODBD 4H20L 1Q72L 4YHIB 3ZYZA 1OAUH 2L0DA 5C0CE 3TYFA 3OAUH 5EU6A 3RWIA 4M7LH 1KXTB 5IB3B 4LLVB 1G7MA 1H8NA 4YXKH 3Q5YA 2NY2D 3DMMA 3IRPX 2FEDD 4DQOL 3NIFE 1KFAH 4EN3D 1O7SA 5MI0B 3QI9A 3MCKB 4H8WL 4CVWA 5ICZB 1RUAL 2O5ZL 2MNUA 2X89A 3S96B 3ULUE 2EC9T 4QHMA 3E3QC 1K3IA 4NHCH 4M1CD 4NQEE 1LO2L 4WFFD 3E8UL 3S4SB 2N56A 4H1LA 3T8XA 2ZUQB 4UTAH 1VHPA 5I1EH 4ODTL 2ZG3A 2D7PA 2YA0A 4YHIA 4YJZL 5SX4H 5IB3A 1Q9WB 4LLVA 2IALA 3ARRA 5K59E 1G9EA 5DZOA 1RZIB 5FCSH 2H32B 4OZGF 3WO3B 2Q8AH 1M1SA 1GGIH 2DQHH 3MCKA 5ICZA 2KUTA 1SEQL 3S96A 5DLML 1J05A 4OD3L 4K3EH 4KI5C 4W81A 1MJ7L 3I50L 2DF3A 3LAFA 1QFWH 4YHOL 1FNLA 3S4SA 5JXAL 2UZXB 3HG1D 3TZVC 4GLRH 3PL6D 4UTBL 5DC0A 5ALBH 2ADIB 4BFEA 1NC4B 3MXVH 1LDPH 1Q9WA 4AL8H 1RZIA 2H32A 1HE7A 2AEQH 5DZNA 3IDMB 4YC2B 1Z0MA 1U8OB 1VFBA 1ZLUH 4XHJD 4GSDH 1AFVH 1WUNT 4KTEH 5CUSH 1URLA 4I0PA 3KDMB 4DGVH 3DYMA 3PP4H 3QHTC 5I17B 2XT1B 2XWBB 2GKIA 3S34H 2HH0L 2EEBA 2ADIA 3H3PH 4U6YA 5ANME 5SX5H 1NC4A 4MJID 3OTTA 1CDBA 1OAZH 2WBJB 4KK9D 2R0KH 5E8DL 4RFOL 5ETUB 1U93B 3IDMA 1U8OA 4Q6YA 3BDBA 3GEWB 4OI8A 2EXWD 2JELL 4R4NC 4YWGL 4MD0B 2VAJA 1NCCH 3GIZL 2V5SA 4P2RE 2Y07H 1GZQB 3C8HA 4KGLA 3KDMA 5JNYB 2VSDA 3TH3T 3NCEB 5I17A 1F45A 2XWBA 4FXGB 4Z7NF 4LSSL 5CCKL 3SBWC 2CKBB 3MUJA 5F93C 5F7HA 1TPXC 1UJTA 3HZVB 4HK0B 1DBJL 3ZTJH 2QLVB 3TCXA 2WBJA 5IMOB 3NCJH 1WWBX 1CU4H 3LEXB 4LLUB 5ETUA 1U93A 2XA8H 2ZZUT 4AENB 1FIEA 1QVOB 2I25N 4MD0A 5FKPB 2IGFL 4LHQB 2J12B 5SWSE 4N8VG 3U4AA 1J88A 3O2DL 4Y8AA 1OAYL 1N5YL 3BRFA 5JNYA 3QEGL 3GIVB 1SJHA 2HA1A 5JHLH 3MRPB 3BP5B 5KSBE 4FXGA 4UQ3B 2PYEE 3CZFB 1CYGA 2CKBA 1A6VL 5I8OL 1NFIB 4TULL 3HZVA 4HK0A 2ORBL 3ZKMC 4NFCA 2QSCL 1NEZG 5IMOA 5JUEL 1YUHB 5JQHC 3LEXA 4LLUA 1M7XA 4BKLB 1V7MH 4I5BB 2DOCA 3ORJA 4F15C 5D1ZC 5LG1A 4AENA 2E7CA 1QVOA 3LZFL 2EZ0C 3C5JB 1IEHA 5FKPA 3IFNL 4ZUTB 2VL5B 4XNZC 2NW3B 4LSTH 1D5MB 1IGYB 1JRHL 4X6FB 3GIVA 3RVVD 3MSPA 4S1QH 3MRPA 3PGCB 3BP5A 1FVCB 4UQ3A 4PRPD 3CZFA 1LK2B 2R2HB 3AREC 5TPWH 1NFIA 4MNQE 4YBQD 1CN4A 1JGUH 5CJXC 1FQ9C 4JPVL 2ZCLH 4WV1C 3OKEB 1YUHA 5ANMB 4BKLA 4I5BA 3ETBF 4Y4KB 3C5JA 1EZVX 4NM4H 4ZUTA 2VL5A 2NW3A 4HK3N 1D5MA 5CEZH 4KJPC 5IBLD 1IGYA 4X6FA 5H37H 5IT2H 1TJGH 1N6UA 3PGCA 4XVSL 3TEUA 2GJZB 1FVCA 4MAYD 3IJSB 1LK2A 2R2HA 1CFBA 3D0VA 3GDBA 2DTML 3QCVH 3F7PC 4FXKB 2C4FT 5DVMA 1KN4H 5DGQA 1GGBL 3T4YB 3OKEA 5ANMA 3FFDB 3O9WC 4CU6A 3N85H 3R8QA 1MFBL 3LSOB 4JO2L 1TTUA 4P59H 4Y4KA 1K4CB 3RWJB 5JIIA 3CMOL 4XH2B 2BNUB 3LCYA 4IM8A 3BSZL 1PY4A 4JVWA 2E27H 5T1DH 2GJZA 1X5FA 3IJSA 4NGHL 3QRGL 1HHKB 2VWEE 5LXGH 3QG6B 1QRNE 4P2QE 4MAUH 2X44D 1W72L 4FXKA 5L7XL 4WJ5B 5EB9A 4NQVB 1A1MB 4BM7A 3T4YA 2GIYA 4LP4A 1X4ZA 4ORGB 3FFDA 1FJ1B 4DAGL 2ZJSL 1XIWC 1JPSL 1IAII 3RTQB 1QYGH 3LSOA 1IC4H 3SQOH 5B4MC 2CDGB 3C2AL 3RWJA 1K4CA 1B90A 3HAEB 4XH2A 4Z5RB 1X5ZA 5DD3H 2BNUA 1B2WH 4HW6A 3H7LA 2EDQA 1VFMA 1QKZL 3RIAF 3TO4C 4JO1H 1X44A 1HHKA 1FRGL 4HUNB 3QG6A 5IP4A 4NQXB 3V6OE 1TTFA 5KSBA 4HIXH 5C0BD 4D3CL 3JWDH 4WJ5A 4NQVA 2JJWA 1CGUA 5IMKB 1A1MA 1DQML 3G5VB 3CLFL 2NX5B 2B5IB 3FQRB 4ORGA 1I1AB 1FJ1A 4MB4A 1NEUA 3RTQA 3VD4A 2RCSL 4EKXA 2NY6D 4NQDB 4LOUC 2CDGA 3GRWL 2EO9A 1MPAL 1LQSR 4J3TA 3HAEA 1EHAA 2QJDA 2NXYC 1RHHB 1PEZA 1U8PB 4Z5RA 5D71H 3VJ6B 1S8DA 4HEPG 4LSUL 1KTDB 4TOYH 4RFNB 5BOZG 5D7JC 4ZXBD 4P5MB 3MLYH 4PJGB 5F21B 1T0NB 2HJLB 3WD5H 4UIKL 1IGFL 2QQKL 3CFKB 2XQBH 4NQXA 4XC3H 2DL9A 4PJAF 1RZKH 3G5VA 3D2UD 2NX5A 1I1AA 4KJYB 2X1XR 3QISA 1QFUL 4CU8A 1G84A 4PTUB 4GRLC 4NQDA 5F7DB 1RD6A 3VG9C 5HHNA 1H3GA 1NLDH 4Q58C 2G5RA 1RHHA 1U8PA 3MLVL 1IM3B 2HTKC 2NXZC 3VJ6A 1J1PL 3B3IB 1KTDA 4WUUD 3AVEA 4U1JB 2JCCE 5BMFL 5DF0A 4P5MA 1T83C 4Z95H 2CR3A 4PJGA 1T0NA 2HJLA 2XPGB 3CFKA 3VGFA 4UINL 1CGVA 4DKEH 1SY6H 3F12B 4KVCL 5IBUB 5K9KB 1Q0XH 2D0FA 1QRNB 3PGFL 5FCUL 1YEFH 4BFGA 4KJYA 1MFCH 1NBQA 2HLFC 3W9EB 4QT5B 2AJVL 5C0AB 3ULVE 4LDEB 1F4HA 5DA0B 1CFSB 5DMIL 2HT4D 3GK8L 4PTUA 5D8JL 5F7DA 3MX0A 2PETA 3FRPG 4DUVA 4OF0A 5HYFA 1X5AA 1WFNA 5MHSE 4DJMA 1IM3A 4EI5C 1KIQB 1CI5A 3MREA 4G5ZH 3W82A 3WHE1 4Z76B 2DLFL 3B3IA 4HX1B 4YGAB 5BRZD 4U1JA 4OV5B 2CMRH 2DWDB 2XPGA 3FB8B 3CK0H 3QG7H 3GM0A 4P0DA 4K55A 3F12A 3FQUB 3NPSC 1TQBC 5K9KA 3B9DA 3KJ6H 3ULSB 1U8QB 1CDJA 1QRNA 5IROA 1IKNC 5L8JB 1G6VK 2R23A 3PXHA 4HCRH 1KSRA 3W9EA 2EIDA 4QT5A 5C0AA 2PO6C 1AXTL 1CFSA 3BKCH 1FC2D 5C0CD 3IJYB 3TPUB 1KIQA 4D9RD 3QXDB 2UWEB 4S1DD 4Z76A 2QSQA 4S2SB 4HX1A 3RWFB 4QRTB 4MQSB 3BPOC 4G8IB 1YNLH 4OV5A 3P0VH 4OKVB 2DWDA 2EDLA 3FB8A 1LO0L 3NFSL 4NO0D 4PB9H 5JXEC 2C4XA 3WKNA 4M7LT 4MX7B 3Q6GL 3TJEL 3QCUH 4I4WB 3MGTB 3JBG7 1U8QA 1DUZB 4RAVB 3ULSA 5DO2C 3V6OA 4DKFL 2R9HD 3QXVA 1WJ3A 2FATL 4P9HC 4PS4H 1D9KD 1HXMB 4M7KH 3VXRD 4LLQB 1I9JL 1ONQB 3KS0J 3LPGA 3QUYA 1J1XL 3IJYA 3TPUA 1F13A 1IFHH 3CXDH 1WAAE 3OPZL 2VLJB 2UWEA 3QXDA 5LQBH 4S2SA 3BESR 3RWFA 3T0VA 4QRTA 4OCMC 3UC0H 4G8IA 3CDFA 3DXAE 3I9GL 1EPFA 1MHHA 4OKVA 5KZCB 3SE4A 5DR5L 5AZ2H 1YA5A 3TBYB 4KGJA 4JPKH 4MX7A 3WO4B 4WU7B 1J0ZA 4I4WA 3MGTA 2QSTA 3QDME 1DUZA 4RAVA 4XPAH 3QXTA 4XAWH 2EE6A 4P9HL 5C07E 4OLZH 1HXMA 5F70A 5GRJL 1SEQH 4LLQA 1ONQA 4MA3B 1D3CA 1QFHA 3I50H 2GYSA 3SOBL 3VXNA 5FDWB 2DD8L 2VLJA 4QXGH 5ELIA 1OGAD 4TRPL 4LSDA 1V3MA 5DHVB 4MLSA 2BRRL 1G0YR 3W11C 1UKSA 1OLLA 5TDNB 5FYJE 5JW5B 1KCUH 5DRNB 3TBYA 4OM0L 2MPAH 5JMRA 3JZ7A 4WU7A 4JQXC 3VFWA 1A6WL 2XZQL 4G3YH 1IRAY 1MRFH 1UM6H 7FABL 3TESA 3T0BA 4M5ZL 1LMKA 5ENWB 1MCBA 2YWYA 1HSBB 1IGIL 3DYOA 3HZYB 4MA3A 5HHPB 5A3ID 5FDWA 1NPUA 3MLUH 1T04B 3RL1B 3MLSH 2WW8A 4HHAB 4UU9B 2X2YA 4FN0A 4KMQA 2PTUA 5C09B 4ZFGH 1FL6B 4J4PA 4M1GH 4XNXL 2R4RH 5DHVA 3V5DB 2IMNA 2DLGA 1PG7W 1SBSH 4CDGC 3BGFB 5TDNA 4GMTL 5JW5A 5DRNA 2VXTL 2VDPH 3UJJH 1NKRA 2YA1A 1JGVH 3QQ9D 4LU5H 4RFOH 4P2RD 4HMDA 1HKLH 2V7NB 2NY5L 5HPOA 3A6BH 3MLRL 3TFKC 4P5TC 1Y18B 3MV8B 1MEXL 3TV3H 2XICA 5ENWA 2V2TB 2ZUUA 1HSBA 2XXCB 4ZAKC 3HZYA 5HHPA 5IHLB 5TE4L 3GIZH 5E6ID 5E5UB 5A2FA 1T04A 4H5SB 5C71A 3RL1A 5LGKA 4HHAA 3LDBC 4UU9A 5C09A 1OW0A 4HBCH 1EMTH 1NQBA 1FL6A 2C4FU 1Z9OA 4Y16B 3T08A 3V5DA 5MENE 3F62A 4JKLA 2X1PA 2OK0L 2X4SB 3DXAB 3I2CL 4ODXB 3MLPA 1F6FB 2JTDA 1T80A 4NKMB 4X9IA 4HWEL 3LB6D 5SWSD 4FA8A 2V7NA 1KTLB 1WEJH 5FHBL 4R0LC 1Y18A 25C8L 3MV8A 3RWCB 35C8H 3O6LH 3Q3GB 2V2TA 2VXQL 1I9RH 5GJTH 4QOKD 1VGKB 1CK0L 5J13B 1I9IL 1H3XA 4H5SA 1EEUA 5HHOB 4MYWB 2MTPA 3QEGH 1FN4B 4B41A 4M93C 2R39A 1WAAA 4L8DB 5A1AA 4Y16A 1CFQB 4N0UE 1KJ3L 4HT1L 5EPMB 2X4SA 3F7VB 2QSCH 1T89C 3DXAA 4UV4L 4ODXA 4HS8H 3CXHK 4NKMA 5CMAB 2W0KA 1JPTL 1KTLA 1X5XA 4CVUA 4LCIL 5D2LB 1CGXA 3CXHJ 4WEUD 3RWCA 5IG7B 4QRPD 3Q3GA 3LZFH 4ZUUB 1PZUB 5L88H 1VGKA 4RISL 1I1YB 5JDJA 4MNQD 5I18L 1MI5D 3IDXH 5HHOA 3TWCH 1JRHH 4TUKL 3SE3A 2CRIA 1FN4A 3VD7A 1NANH 2BSED 2X4QB 3CVHB 3IRZA 3MCLL 3ZL4H 2Q3ZA 4O2CB 4L8DA 2XKNB 2Y5TB 1P2CB 1CFQA 4URTB 1T2QL 3W0WE 3WBDA 5EFIB 1T2JA 5E1AB 5EPMA 2E7MA 3F7VA 5HVHB 4KK8C 1SJVA 4OFYD 5CMAA 1H3PH 5ISZD 2VLRE 1DBKH 5FGBC 1UM5H 4JHWH 3SJVE 5D2LA 4YZFE 4P2CG 3BKJH 2O26U 4RA0C 3OR7B 5IG7A 4ZUUA 4KKAC 3TT3L 4WW1B 2R69L 4B0MM 3GSRB 1I1YA 2Z8SA 1WITA 4V1DB 4QF1B 1D6VH 4U1IB 4WCYL 1DJSA 3V6FB 3U0PB 4G6JH 5CIPB 4O2CA 3SDCD 2XKNA 2Y5TA 1P2CA 3DVIA 2QV2A 2LU7A 2DJSA 4GS7B 5EFIA 5E1AA 2F53B 4NRXB 5GGRY 5E6YA 4NNPL 3AMKA 4YDIL 4JFHE 3VGEA 3OR7A 5HI5C 4AJ0A 1SMOA 4WW1A 1DR9A 3B4NA 4E41D 3I85A 3GSRA 3L3HB 5IIEB 3D39B 4CMHB 2YPKB 4V1DA 4QF1A 4EI6B 4U1IA 3HPLB 1OTUD 1YQVL 3BPLC 3V6FA 5C0GB 3U0PA 5CIPA 1UT9A 5KS9E 2ZCHH 3B6SB 1VPOL 2VABB 3QDJB 5J6HB 3SGJC 2F53A 2LTQC 3MUZ1 4NRXA 4TTDD 5D1QB 5ITFB 4N0UB 5F1IB 2VDRL 1D5BB 4XP9L 3FHQA 2K1MA 1YEIL 2FLRT 5J3HD 5SWZD 1ZLWH 1DCLA 3L3HA 1T20B 1E4KA 3MLZH 5IIEA 3D39A 2YPKA 3V7MA 4IRSB 4NKIH 4EI6A 3HPLA 4PJ9D 4WW2B 1JK8B 4ZTPH 5C0GA 3RGVC 3FN0L 3QNYB 3MLXL 3B6SA 2VABA 4R90H 5J6HA 3F8UB 1N2RB 1A3RH 4DKAA 3M07A 1OAQL 4PJIB 5D1QA 5F7MC 5ITFA 4N0UA 5F1IA 3GJEB 3W0WB 1D5BA 5DUPL 4PJBB 5CEZE 1ZOXA 1JHKL 3AM8A 5JIHA 1SM3H 4PJFF 1XR9B 3RVTC 3EHBD 2QSVA 1BJ1J 1WF5A 1RY7B 3SJVB 1BPVA 3INUH 4R26H 1FCGA 2YR3A 1T20A 2OJZH 2P42B 4IRSA 1DQLL 1J1OL 3FO9B 4WW2A 1INEL 1JK8A 5KVDL 4M8QB 5I15H 3QNYA 4N90E 1N2RA 3DSFH 2BVQB 4AMKL 4PJIA 2VZUA 1OARH 1E4JA 1UB5B 1ZHBB 4UAOB 4JJHA 4HG4K 5F9JB 1BZ7B 1ZS8B 3GJEA 3T0EC 3W0WA 2DWEB 4PJBA 2EC8A 3QUZD 4RCAA 4ZD3L 3L95B 3SDAB 1XR9A 4HG4J 3AB0C 3O45B 4WHCA 3QDAA 5MP6H 2JB5H 4LL9A 4R2GC 3AC0A 3QWOB 3SJVA 2V9RA 3VXSE 4OF5A 1MWAH 1J1PH 4UV7H 4JG1H 3FO9A 2ZUYA 4M8QA 3MJ9A 2YPLE 3BFOA 4X83A 4CAGA 1O5DT 1HXYB 2BVQA 3D9AH 1KUMA 4OCWL 3E6HB 5GPRA 4KVCH 1UB5A 1UG9A 1ZHBA 4U1SB 4LPYA 5F9JA 1BZ7A 1ZS8A 3C5SB 4G8GD 2K7QA 2DWEA 5CAYB 1R3HB 3L95A 3O6KL 3SDAA 4YXLL 3GK8H 3O45A 1UKQA 1MIEL 3QWOA 1OWRM 5D96B 2GQHA 3VXMD 2Q86B 4D8PB 1BQHG 1GHFH 4X7SH 4ZUWB 1ACYL 1PG7H 2D03H 4MB5A 3HHRB 5IGXL 1CF8L 5C9JB 1MJUL 3HUJB 1BGXH 1HXYA 3GKZA 3BWAB 2YD7A 3KNBB 3E6HA 1H15B 2WMPA 5JMOC 4U1SA 2CDFB 3C5SA 2MOVA 2ZUWA 1KJ2L 1RU9H 1U8MB 1R3HA 4EEEA 2FWOB 3B9KC 1KENL 3CFCL 3NCCB 4K7PL 4MXWL 3LEVL 3T1WA 1JMZA 3QYCA 3MNVB 3I02B 3WS6C 4Z7NE 1T6VN 2NYYC 3CIQA 1QR4A 2Q86A 4P46B 3WIHA 4D8PA 3WJJA 1PJ9A 2F8OA 1NLBL 4P4KC 1KC5L 2EYSB 2Y72A 5HHMD 2I60H 5C9JA 3HUJA 2Q1EA 1CFTB 4JVUA 2FD6H 3G04B 3BWAA 5EZOH 3KNBA 2B2XL 1H15A 3H9SE 4CDHA 2CDFA 1QLEL 4MZ2A 1MFDL 4XNQB 4AK1A 5F7EL 4QHUB 1U8MA 1RIUL 2FWOA 3V8CA 5FYKD 2OZ4L 3AAZB 5D7KE 5FV1L 3TLRA 3MNVA 3I02A 1NBZB 4H26B 3LMJL 1ZLVH 4EQ3A 1K8DB 3OPZH 3B9AA 4P46A 3RDTC 4OZHB 3BZ4B 4FTVB 3CLEL 3RZCD 1OPGL 5GGVL 4GKOA 5C7XH 2EYSA 4JREB 3RVWD 3IJHB 4I0KA 5K9QG 1CFTA 5JIPA 1DBML 4YDKL 3G04A 3NFPB 2W9DH 4LPTA 4PJHF 3VH8B 2YPLB 1V05A 2QBWA 5T1LD 1PKQB 1R24B 5FUOH 4GBXA 4XNQA 1LO3H 4QHUA 5F71A 4PGJA 5J11B 5HSFA 4KC3B 2OBGA 5JW3H 1CLYL 2BOCB 3AAZA 3LHPH 4HMCA 1ITBB 1NBZA 5EIQA 1AD0B 4H26A 1K8DA 5C0FB 5B21A 15C8H 4MA1C 3DTXB 4OZHA 3BZ4A 3FB5B 4FTVA 1F3JB 4BQ9A 4X8XA 3B8YA 1YYLL 4U2YA 2MSPA 4GOSA 2EDBA 4TVPL 3IJHA 1CR9L 5BVJB 4JCLA 3NFPA 1J11A 3VH8A 2YPLA 4YNYB 1PKQA 1R24A 3HMWL 5BCAA 1MAMH 1FYTE 3IETB 2HT2D 3DX7B 1VADB 3BMWA 4KHXH 2LQRA 4NOBA 3O8XA 1AHWC 1MAJA 4JO4L 1UVQB 5D6DC 1WCQA 2BOCA 4YHYB 2ERJB 5JQ6L 5IFHL 1AD0A 1U8KB 1FFNB 3U4EB 5DMGC 1N64L 2XOTA 4ZO6A 4YR6B 5D5MF 3DTXA 4QRRB 3FB5A 1F3JA 1R3KB 2YMXH 4MNHB 2NY1C 1OB1B 2AK1L 1U6AH 1S7WB 1EZVY 3OL2A 2ZG2A 1CGWA 4NN6B 2VH5L 4FQIL 4YNYA 1NDMB 1I8MB 3IETA 4HC1H 3SPVB 3DX7A 1VADA 3D3VB 2VQTA 1N6VA 3VG0L 4Y4FB 4KMTH 1UVQA 3OAZK 5EOCJ 4LCCB 3CH8A 1UH3A 3C5ZD 4KUZH 3U0WL 3VFGL 1G1CA 2AW2A 1U8KA 1FFNA 3U4EA 3E6FB 1AO7B 2L7JA 1RIVL 3WKMH 3T2QA 2H2PC 4YR6A 4QRRA 2YK1H 3O4LB 3P9MB 3C09C 1R3KA 5ITBH 4MNHA 1NH6A 5E2VH 5HGDB 3EDEA 1OB1A 3KG5A 1EJOH 5FFLA 4EBQL 1HILB 4OCLC 1S7WA 5GSRB 1KEMH 5J1TC 2R29H 2DQJH 2IWGA 1MHPH 5HI3D 4X7DC 1NDMA 1I8MA 3TGXA 3SPVA 2E8YA 1FNSL 5FV2A 4JDTL 1SYVB 3D3VA 4JM2F 1IZKA 25C8H 4OFIA 4Y4FA 3SDXB 1G7QB 3REWB 1MQ8A 4LCCA 3H7BA 1PLGH 2C3VB 3GBLA 2DLHA 3L3KB 3E6FA 4I13B 4Y2DD 1BOGB 3OGOE 3MOBL 4MMXC 4FQXC 3TN0A 2A6IB 3O4LA 3P9MA 3UPCA 1WTLA 1XGPB 3UDWC 4Z0BH 2DIAA 5HGDA 1SY6A 3QWRA 1FO0H 3N1FC 1CQYA 1NBVL 3K4ZA 4P23D 5T33H 4ZO7A 1HILA 3WIFB 1F3DJ 5GSRA 1WIPA 4RGMC 1T6WA 1XGUB 2Y9RT 2DBLL 3UTPD 3HE6B 3D5OF 3QH3B 1SYVA 4PG2C 3BGAA 4XTRC 3DBXB 2PCPB 1TJIL 1G7QA 1YYML 3REWA 1U9KA 5GS0D 3WJLA 4N8CL 4U33A 3M1BB 2C3VA 5HGGS 4RISH 1YEKH 4FG6D 3L3KA 4BA8A 5I18H 2N1KA 4LFHD 5D1XB 1DP0A 4FMFA 1BOGA 2A6IA 2B1HL 4HPOH 1XGPA 2VLRD 3QHZH 4Z7WF 1CLCA 4BK4A 3NIGE 1B3JA 1KIPA 3WIFA 3RL2B 3U48A 5T3XD 5EO1B 3IDIB 5DVLA 4HCRA 1XGUA 2FX7H 4ISVB 4NC1E 4NN7B 3PJSB 1RUKL 4NNXB 4QNPF 3LVEA 4HIHB 3HE6A 3QH3A 3EW3B 2APVA 3DBXA 2PCPA 1YECH 3QDGE 4JQIL 2E6PA 1UEMA 3EJYC 4X5XB 3TT3H 4D0DB 2R69H 1ZA3B 4WO4C 3M1BA 1RJYB 2FECI 3K8KA 2CIKB 2PXYC 4X4ME 3T3MF 2LU3A 5INCB 5D1XA 1GYAA 3ILQD 1FAIH 1V7NL 5DS8B 3GJFH 3ZE1F 4AG4L 4PRHE 3P4OB 3RL2A 2UZIL 5EO1A 1SBBA 3IDIA 1E4WH 4ISVA 3KPSB 1TITA 4NNPH 3PJSA 2RB8A 4NNXA 4MQ7B 4HIHA 3JVGC 1XCTA 2IEPA 2WUCH 3SO3C 2HKHH 3C60B 4D0DA 4X5XA 5D9SB 2UVEA 1ZA3A 1RJYA 1CE6B 3NPZB 4WI8A 3TIEB 2CIKA 2AJ3B 4XPHL 3SKMB 1YQVH 3K74B 2HMIC 4KRPD 3QAZC 5DS8A 5CZXD 1PW3A 1MF2L 3P4OA 1VPOH 4XP4L 4QXUH 3T0AA 3BN3B 4KU1A 4YBLC 3KPSA 2ENYA 4MQ7A 1DBAH 1T21B 3U7YL 2D7TL 2BDNH 1UM4H 3KXFD 2DQDH 3C60A 3KYAA 1U8JB 5D9SA 2FEDC 3TZVB 1CE6A 1CXEA 2DQCL 3A6OA 3TIEA 1K3ZA 2AJ3A 1B4JH 3SKMA 1N59B 1UWXK 3STLB 3ARDD 3Q5TA 1A21A 1NGPH 4U6VL 3KLDA 2FEEL 2AJXL 4KDTC 1A7QL 2B8OT 5IQ7L 5L2KE 1BAFL 3EYOB 1T21A 2YUXA 3KVQA 4MQTB 3T2NH 4NFBA 4Y4HC 3KHQA 3FZUC 2FJFB 1U8JA 3AROA 3TZVA 4XC1L 4JKWA 3TA3C 3BRGC 2VLKB 1N59A 1P6FA 5KVDH 4OLYH 3STLA 5GGTH 1JV5B 1KGCE 5IVOA 1E28B 4XVUC 4KTDH 4GG6B 3GSWB 4AMKH 3ROLB 1J18A 3PL6C 3QNZB 4NCDA 3VFSB 3OKLB 1UB6B 1I3UA 1T5XB 3CZJA 3EYOA 4RGOH 3W39B 1JI1A 4K23L 4O02H 5GGQL 3NCYP 2FJFA 3QUXC 3M8OH 1Z9SA 1I1RA 4UZGA 2VLKA 1TPXB 5B38B 3L1OH 4MHHG 4F9LC 1VERA 4LCYB 3L7EB 1JV5A 4ONOA 5CP7B 1E28A 2H1PH 2Y4SA 3WIIL 4GG6A 3GSWA 5JW4N 4JDZB 4LSPH 1MHEB 3ROLA 3JWOH 3QNZA 2VSCA 5C0JB 2EKJA 3VFSA 3OKLA 1UB6A 1T5XA 3W39A 1CD9B 3IU4L 2RIKA 3CJJA 4Y5XC 4DN3H 2Q7NA 4HGKC 3P11H 1MIEH 3EDFA 2NY4C 2OMBA 2EDHA 1F11B 1ZANH 5KTEH 2VDQH 5ERWB 3GSXA 3SBWA 5CD3B 3LEYH 5D72L 3HE7D 5B38A 5L9DH 1ACYH 5CSGA 5DFVC 4KKBD 4LCYA 3L7EA 2DQFB 4NZTH 1CF8H 1WZLA 5CP7A 3BEVB 4JDZA 2L4OA 5AWNL 1MHEA 3IFLH 1M7IB 4Y89A 1HIMH 3UYOD 4C57C 4F15B 5C0JA 5CKGA 5D1ZB 1CL7L 3SKUD 4HZAA 2WIMA 4GXUM 2AQ1A 4XNZB 3KWWB 4ODSL 2CLZB 2W38A 3TO2A 1P4BH 1FLRL 1F11A 1FDLL 4NFDA 2MQCA 5T3ZL 1QZ1A 5EOCH 5ERWA 5ILTL 5CD3A 3AREB 2R0ZH 1QG3A 3M45A 2IADB 2EDYA 4WI3A 2V5YA 2DQFA 4KKLC 2OM5A 2DLEA 4WV1B 5E70A 4JY5H 3BEVA 3WUWB 4NUGL 1M7IA 2ADJB 3QA3B 2FIRT 1MFDH 5D1ZA 2C3WA 2NLJB 1EH9A 1HH9B 3OJVC 4HQQL 5F7EH 1TZGL 2IQAB 1I3RB 4NJ9H 3H3KA 3HR5B 1P4IL 3KWWA 1X5JA 2CLZA 5GIRA 5BV7C 1WQVT 2G2RB 3OXRB 4QHKJ 3AREA 2XKSA 2IADA 4X99B 4YDVB 1PY9A 3HNSL 5CJXA 4U2ZA 4WV1A 3D18B 3O9WB 2GK0B 3WUWA 4N1EA 4K3DL 2ADJA 3QA3A 1U0QA 4P4RB 2VDLH 2CJUH 2NLJA 1HH9A 4AEIL 4G6AD 2IQAA 4YBQC 1I3RA 4XPGL 1XR8B 4K9EL 3HR5A 5I0ZA 2E8ZA 4ZFZB 5BV7L 2VB5A 1C08B 4G8EB 3WCYA 1OP3H 4DW2L 2DQTH 2G2RA 3OXRA 1WZMA 4P57B 5ID0A 1KJMB 2BZDA 3DHMA 4H88L 2YXMA 1EHNA 4X99A 1FYTD 4YDVA 4JRXE 1WWAX 1MCQA 1T7WA 3D18A 3O9WA 2GK0A 4FQQB 1MFAH 1XIWB 1LEKB 4PRBB 4GMSH 1RURL 4P4RA 3G5ZB 2F9BT 1NMBL 3MJ6A 3U2SB 1XR8A 2FX9L 5BO1H 4RMRA 2F5BL 4ZFZA 3F7QA 4Q0XH 1Z3GH 4OV6F 4WY7L 4FQPA 1U92B 1C08A 4WEBH 4G8EA 3TO4B 1UWEH 4P57A 4HLJA 3JXAA 1Y6KR 1KJMA 5HYJB 1MVUB 3KGRA 2IG2L 1A7OH 1B0RB 1CS6A 2IH1B 4OCSL 3NCFB 2YUZA 1WBZB 2HFGL 1U8NB 4FQQA 4XB8A 1CLZL 4BQ6A 3HMXL 1XIWA 3VMNA 4PRBA 1LEKA 4DEPC 5CGTA 3G5ZA 3GRWA 1NCAL 4JJ5B 1J8HE 3U2SA 2NXYB 2XZAL 1OTSD 4ZPTB 2KZ1B 1YJDH 1CGSH 2HFTA 4YFLF 1U92A 3U0WH 1ZEAL 3RI5K 4KFZC 2F54E 5D7JB 1RZ7H 3TO4A 5ECJE 2GJ6B 5IESH 5HYJA 1MVUA 1A64A 1DQDL 5J1SC 1JGDB 4LIQL 4PJCB 1B0RA 1NSNH 4NUJB 2IH1A 2VERN 3QFJD 4WIQA 3ARGC 3WN5C 1B9ZA 1WBZA 3VRJB 3QI9C 1U8NA 4EIGB 3FO1B 5EULV 2VUYA 2VRAA 2OR8A 2Y36H 3OJDB 1ZLSH 1F97A 4GRLB 5I75C 3VG9B 3C08H 1EIBA 3BP6B 3C8KB 4JJ5A 3S36X 3UZQA 2YUVA 3ARYA 2NXZB 4ZPTA 4RZCB 5T1KD 1NAMH 3U7WH 5D7JA 1HKFA 4LHUB 1EO8L 1E4XH 2GJ6A 2NY6C 3ZSSA 4IIQC 2DDQL 1JGDA 5FM5M 4ETYA 4PJCA 2YA2A 4NUJA 5DJ2B 1SVCP 1TNNA 5KG9B 4PREB 2FX8H 1AE6L 1EXUB 1A6UH 3BQUC 4XPTH 3VRJA 3X11B 1PDKA 1OQOA 3DHJA 3DUUB 5EOQH 5DRXB 2DBLH 4ZXBC 3FO1A 4YAQB 5AG8A 1D5XB 4LMQE 4XMPH 1F02I 1WV7T 3OJDA 4GRLA 2K7PA 4WFHE 1UWXH 3BP6A 3C8KA 4WFGE 4CKVX 2IANE 1MCHA 4EI5B 2IFFL 4YO0B 5D7SL 3VDAA 1F8TH 4FZ8L 4RZCA 2ICWJ 3RIFK 1E27B 1W0VB 4OLWH 4LHUA 1T83A 2O5XH 5DJ2A 1GIGH 5KG9A 3BD4A 4PREA 1EXUA 3QPXL 3NPSB 1TQBB 3UAJD 1K8IB 2BC4B 1D7FA 3DUUA 2EICA 2FLBT 3L9RB 5DRXA 1X6LA 3NABH 4YAQA 1D5XA 3KYNB 5CJOL 2PO6B 5IVZB 1N7ML 4XNYL 4U49A 7CGTA 4I0PC 3MODL 3GNML 5I1KL 2IJ0C 4EI5A 4YO0A 3V5HB 1U41A 3AS3A 3BPOB 1E27A 5JHDB 2AJUH 5C6PB 2VR4A 4AG4H 1FH5L 3RAJH 1KBGH 2Y6SD 2IAMA 2UZIH 1VESA 3RGHA 3OKNB 2EDTA 1K8IA 2BC4A 1IKNA 3L9RA 4E5XB 5E1HB 1JNHB 1ROWA 2VISB 3KYNA 4OCNC 2PO6A 5IVZA 3KPRD 2HRLA 2Y7QB 5CGYD 3BDYH 4QYOB 2I26N 5IK3B 2OP4H 5AAMA 4XCNB 5EBGA 3V5HA 2BVOB 3CDCA 3J8F7 5JHDA 3V9FA 1TETL 2DI8A 2V5RA 1TZHB 4Z7UB 4BH7B 3BUTA 4G42B 3D69A 2V2WB 5C6TL 1UCBL 3F7RA 3S37X 4POZD 2XNAB 3WFCL 2FBOJ 3OKNA 5GGSB 4YHZH 2ZWLT 3UTOA 1JF1B 1EAPB 3RNKB 4E5XA 1JNHA 2IPTL 2BOBB 2VISA 2Y7QA 4WUKL 3ULUC 4QYOA 5IK3A 4ODUB 2XFXB 4XCNA 3SY0B 2BY2A 3TNNB 3RU8H 4DKDC 2BVOA 4OT1H 3H42L 1D9KC 3LS4L 1JZ4A 2CRYA 1TZHA 4Z7UA 5GRYA 4BH7A 4X6DB 2R8SH 4G42A 2V2WA 1ZTXH 1AQKL 3HFMH 4HFUL 2JJVA 1BBJB 2QHRL 5E5MB 3RIFF 5J56B 2XNAA 2EIZB 1LDSA 1DL7H 5GGSA 3MV9E 1F3RB 2E7LC 1JF1A 1EAPA 2BOBA 3DWTA 2EDJA 2B39A 3VGHA 4XVJL 1HNGA 4N8VA 3ULUL 3MRKB 4ODUA 1GOGA 2J8HA 2XFXA 3SY0A 3BZEA 3TNNA 5IHZB 3P30H 1KGCD 3FAWA 5ALCL 2EDRA 2GAZB 4XC1H 3R0MA 4DK6A 2BJML 4FFZL 4C56B 3E0GA 3DLQR 3RHWK 1I1AD 1BD2B 3WEXB 1YPZB 2DN7A 4PJHE 4X6DA 1M6OB 1KF9B 4NO2B 1UENA 1TVBB 1BBJA 4LEOB 5E5MA 4JQXA 2EIZA 3ZHLA 4HC1A 3TBWB 4QXWA 4P5TB 2P8MB 2UUDH 3PWNB 4M7JL 4S1SL 4UIMB 4PJ8A 5JA9A 4ZAKB 5EOTB 3MRKA 5I66B 3X13B 5C86A 1P4LB 2W0LA 5IHZA 4U0RC 3PDDA 4PY8J 5KVGH 3LDBB 1XT5A 2QADC 2GAZA 4AEHL 1CDUA 1RZJH 1YMMD 4C56A 5EUOF 2Z9TA 2COQA 1FO0B 4Y1AB 1BD2A 2ZKHL 3WEXA 3W81A 1YPZA 1U2CA 3D6GA 1JF6A 1UYWL 4RA3A 5A3IC 1M6OA 5E08H 4NO2A 2A9NH 1TVBA 1AR1C 4U7KA 5DYOB 4LEOA 2OI9C 2NY7H 5F6HI 3ARZA 1LE9B 3TBWA 4R0LB 3CH1B 4P5TA 5ICYB 2P8MA 4Y4KC 4OGYH 3PWNA 4UIMA 1JZ7A 3DVNB 1CDHA 3EJZD 1QSEB 4OGAD 4ZAKA 4DN4H 3P0YL 4PRNB 5EOTA 5JLZB 5I66A 3OHXB 1G6RH 4LKXB 5D5ME 3QQ9C 1P4LA 1OAKL 3X13A 2P4AB 2X1QA 5I1JH 4QCIB 1A7RH 1A0QH 2GY5A 4BELD 2SEBB 1FO0A 1MCLA 4Y1AA 1A3LL 5D72H 4JAMB 1RK0B 2R4SH 4I3RH 4LF3A 4PFEA 4KQ3H 4JRYB 1DBBH 5EUKB 5DYOA 5I16B 4YLQT 1LO4H 5AWNH 2QQNH 1LE9A 1KULA 5DT1H 1EK3A 4R0LA 3CH1A 4XMKH 1Z2KA 5ICYA 2ARWA 5J6GB 1IT9L 4ELMB 5DD5L 3DVNA 1QSEA 4PRNA 5JLZA 1U95B 2X4RB 3KR3L 3HI5H 3OHXA 3ZDYF 4LKXA 1EFQA 4WEMB 1MQKL 3K4DA 2IBGA 4QCIA 2BXYA 3GJFB 1FE8H 4FFYH 2SEBA 5ILTH 2MMXA 4JAMA 3MRFB 1RK0A 1ZK9A 2VO5A 1UA6H 1T89A 2V5TA 4Q9QL 4JRYA 5EUKA 2XWJB 1A6TB 5I16A 1QBMH 2J8OA 2XTJD 4D2NA 3HC4H 3VMPA 1CICD 5J6GA 4JM4H 4ELMA 1M4KA 1N4XL 5FXCH 1U95A 2X4RA 1OP5H 2BMKB 1P4IH 1X5LA 3BVNB 3UJTL 1FP5A 3ARXA 4F57H 3VDBA 3GJFA 4M3JA 2CUHA 3Q48A 3MRFA 3GSQB 5TDOB 1S9WB 3I3BA 4U1MB 4Q9RL 4CBPA 3BT2H 4MB3A 2XWJA 2AK4E 1A6TA 4PRIE 4D9QE 4UNTA 5FGBA 4TSBH 2ZPKH 5E2TL 2VLJD 1ETZB 2YBRB 4JGUA 3H8NA 2M1KA 5JR1H 4HWBH 4OZIF 2BMKA 4XP6L 3QIBD 5EORL 2YC1B 3EBAA 4JZNB 1TDQA 3BPLB 1L7IH 5J1AB 3S35X 3O6FB 4HFWB 5C0RL 1MREL 2P5EE