4JFZH

Structure of phosphoserine (psab) scaffold bound to pser peptide
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
223
structure length
223
Chain Sequence
b'EVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMSWVRQAPGKGLEWVASIATGGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRGYSSTSYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab light chain
publication title Nature-inspired design of motif-specific antibody scaffolds.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 40
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 2013-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jfzH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jfzH01
5GGQH 4XGZB 1IC4L 5C0AA 2OCFD 3RNKB 1NEZA 1C7SA 5MEQA 4KVNH 4FFZL 1F4WL 1WVZA 5DRXA 5E5UB 5IM7B 1FYTA 3VXSE 4HZAA 4G9FA 2GEEA 5F9JB 2CRIA 3I9GL 2K1MA 3DGGA 4S1SL 3BWAB 4X4YA 3CDFA 5J0BA 3ZE1F 5BV7H 1OP3H 3DMMA 4MAYB 2NZ9D 2BOBA 1J0HA 4Y19E 3OGOE 1B6DA 1J0ZA 3WJLA 4QF1A 4XCYA 4Y16C 4UDTB 2QV2A 2RB8A 4K71B 1RUAL 1IAMA 4QRPA 2QSCL 4MNHA 1H5BA 5HHOA 5GSVB 3ARZA 4XP6H 1S7QA 3ARGD 4NC1C 3SGKC 1I8IB 2ZUWA 4KTDL 5H2BA 5C0CB 4N1HB 2MQ0A 3C5ZC 4CVXB 4PY7B 1HKLH 1R3IL 4DKAA 2V17L 4QRRE 1FNGB 4XCEA 3D3VE 4E5XA 5AD0B 4M03A 2ZWLT 1MJ8H 1TZHB 5E8PB 4OCYH 4OQTA 1T2QH 4NO0B 1EFQA 5IIEB 1YYMH 4HWBL 2UY7A 5JXAH 1I3VA 1R5WA 3RAJH 3KNBB 3NCCB 4MXVE 5HYJD 1MHPH 5CFHA 4YDIL 1JPTH 1S7VA 5I18H 4RMVA 1HWGB 2EDFA 3FFCB 4X6FB 2V6HA 3K81A 4M7JH 4MGXA 4TN9A 4H26A 2V2WA 4CMMA 1CLYL 5L9DH 4NUGL 3NA9H 1FGNH 4ZUVA 4XPTL 4AH2B 4KUZH 2ARWA 4PRPD 1CGTA 1CGSH 4MD4A 3JV6B 1PY9A 4UDUA 3DMMC 1HXYA 4RGMB 4YO0A 5C0JA 1DVFC 4XB8A 2RIKA 1S9XB 4HXAL 1FZOA 2W9DL 3ZTNH 5D72L 4KKBD 3SHSA 5JQ6H 3B6SB 2X4SB 3MACH 3RPIA 3TFKC 5EU5B 4BSWB 3TZVD 1IGFL 4JPKH 1OAQL 1I1AD 1T66C 1SJEA 2GTWB 5E9DE 4Y1AB 4PJ9D 3RBGA 1H5BC 2BRRH 2H9GA 3GMRA 3VCLB 1NGYB 2UYLB 4NN7B 4JY6B 1QO3A 1I8LA 2IAMC 3OJ2C 2WMPA 2IFGA 2IH3B 4XPGL 3O6MH 5KSBE 5LVEA 3S96B 1EEQA 2ICWB 1RD6A 3SKUD 2UUDK 5I8OH 3CFEB 5EIIB 3Q48A 3VXNB 3RA7H 4UB0L 4YPGB 1UH4A 3EJYD 1L7IH 1KFAH 3ZDXE 4LSSL 2QADC 3FHQA 1RK0B 5EOTB 4LEOA 5FUOL 5D2LB 1EMTH 5D7IE 4OZIF 5T1KB 4U1LB 3E6HA 3SJVD 1Z9OA 5J13C 4DOHE 1FG2A 4H20L 4JAMB 4YNYA 3I2CH 3RI5F 1YEEL 1W72L 3MO1B 1NPUA 3OGCA 4L8BA 2F8VA 5J12C 3KPMA 1UM6L 3OKLA 2VDOH 2R29L 1C5BL 4P2QA 1AHWB 3EYOA 2AV1A 1K8IB 1A6WL 3DNKA 1U8NA 1V3KA 4HKXA 4I18C 5KBNC 5HDOA 2APWA 2NZ9C 2LU3A 5I76B 1PKQB 3R1GH 2OTWA 3CVIH 3PWPD 2ZZUT 3C5SA 4TQEL 3QQ3B 5HVHC 3NFNB 4UUJB 4KVCH 4XVSH 1ZT1A 1HH9A 1ZA6B 5KJRH 4PY8I 2YS4A 2F5AL 1Y6NR 1TPXB 5L88L 3FRPG 2JJUA 2V5RA 2IALB 4LSPL 1NCDL 1I8LC 2CMRL 3B9KA 3ARGC 3QRGH 2XZAL 1MWAL 4Q0XL 3A0OA 1MFBL 1CD8A 1AI1H 2QQKH 3ZMRA 4D9QE 4MB3A 3CNKA 3OKOA 2R2BA 1FBIL 3QUKA 4C4KO 3FQRA 3KJ6L 3UJIL 5IFHL 1I8KA 3GI8H 4C54A 5E08H 1EFXA 1HHJA 3FJTA 4H0GA 5L7XL 2GQHA 1E4KC 4NN6B 3EOAB 5EOCL 4YWGH 2R2EA 3OQ3B 12E8L 2ZG2A 5D1ZB 5MEPB 2ADFH 4UIKH 3BPCB 1XGYH 1NLDH 5F21B 1NGQL 3IDYC 5GS0C 1DQDH 1MHEB 3VA2C 3BUTA 1G9MC 2FH8A 2VLLB 3MFFA 3Q6FA 5GRXG 4CVWA 4Z7QE 4UNVA 1UCBL 3IDNA 3LV3B 3NZHL 3MNWB 2J6EL 2UWEE 3HUJB 4OIAA 4X6DE 4LLWB 4O51A 4XMKH 5DJ6A 4PBXA 5D6CB 2PCPA 5GJSL 1ZGLA 4KK8C 4BQBA 3QIWD 2O93L 3QWRA 1D5BB 5DEGA 1ZK9A 4KKBC 4QTHA 2P5EB 1CBVH 3RQ3A 5I8CA 1A21A 3TO2B 5EBMA 2IGFH 5I1JL 1A4KA 2D03H 1MHHA 1REIA 2J8UB 5IVZA 2FGZA 1GSMA 4U6VL 3VFOA 5HVWA 4PG2A 4TSBL 5T3XL 5E4IA 3NFPB 3WIFA 2YPLA 3S36H 5I1HH 2KUTA 4PJ9C 3H9HB 3QDME 4FA8A 5DMGD 3FFDB 1QBAA 4NJ9L 1SJXA 1RJLB 4OLWL 3BRFA 1AE6L 2NY0B 4JRXA 4EUPB 2FJGA 2W60B 1RIVH 4NHCH 4NQXB 3QEGH 5C0CE 2Q8AL 3CMGA 4LK4A 1KEGL 2CD0A 1S7RA 2F53B 2VXSL 4L3CA 1J7VR 5L0QC 2PO6A 3TBTA 5GZND 5F88B 1RI8A 3HI1B 4RQQB 2LAGB 3KLSA 3FOMA 3U4AA 1DP0A 1SVCP 2YD3A 2VLJA 3EJYC 5DGRA 5DJDB 3WO4B 3D85D 5MERA 5T1DH 5JMRA 2FLRT 3VXUA 3CVHL 2Q6WB 2VLMD 2V9RA 3DUUA 2FWOA 3MCLH 5D93C 5DHVA 1W0VB 4Z7VA 1QSEA 2Q3AA 3PGDA 2HLAA 1D6VL 3FFCE 1UYWL 4WTZA 2DBLH 3IFPB 3T3MF 2W38A 4JPIB 3ROOA 3MLYH 3LSOA 5AAWA 5I1IH 4ODHL 1UQSB 3KYOB 2BRQA 5KSUB 4MJ4A 3S34H 5C0DA 4UV7L 3EFFB 3OR7A 2VDLL 1U8JA 1WIPA 5BV7C 3V9FA 3QUZD 1TVBB 2YK1H 4HJGB 4DEPC 2R1WA 2WUCH 1FC1A 4APQA 4BK5A 3V6OA 3BSZH 1PX4A 2DYPB 1LVEA 3GM8A 1XAUA 1VEPA 1KN4L 3LEVL 3CXDL 2C1OA 2CDFA 1JFQL 3FQNA 4Y1AE 4P3DA 4JHWH 1HDMB 3MRFB 1NC4A 2X4QA 1FFNA 4UIMA 4U7MA 5LGHL 3CFBA 1KENL 5E4EB 4HC1L 4WHTA 3LKOA 2CLVA 2JK5B 1T89C 2PTTA 3HFMH 4PGJA 5GSRB 3C60B 3FT4B 4NYLA 2B4CL 1E4XI 1I1FB 3G6JE 1K6QH 2VITB 4MZ2A 1FJ1B 4GAJH 1F90H 4U1JB 4NOFA 2IPKB 5JPMA 5D2LE 3C8HA 3LN9A 3FQTB 1AJ7H 4KY1H 1QACA 3EDJA 1ZWIB 5ISZA 4KC3B 5I71C 2CLRB 1RZJC 4P46B 3FMGH 3OXRB 4G3YH 3PQYD 5DD5L 2NLJB 1A7RH 5GRJH 1I3RA 4M62L 3FRUB 4QXGL 3QIWC 3QWOB 2AQ2A 5DQJA 4F7MB 4GAYA 1VFAA 3HKFA 2ARJA 1PKQE 1QP1A 4RMSA 5A2FA 1GOGA 4APQC 3H7BB 3V6OC 2G5RA 4MDIA 3TNNB 3FONB 2HKHL 1YJDL 3TVMA 4KHXL 1LO2L 3WHXA 4YC2C 5DYOB 5ID1A 3DWTA 1HHKB 1CDGA 1JUFB 1P53A 2XI9A 3VXSA 4LLDB 3D39B 1QKZH 4DWHA 2D7TL 1U3ZA 2OLDA 3T09A 5J4MA 3PIQA 3VFGH 1T83A 3U46A 2F54B 2X1PA 2BNQA 3OAUH 1JNHA 4JRWA 1CFQB 2BY3A 4QRQB 1E28A 2HJFB 5GZNC 4QXUL 1JHTA 2YPKB 2HVJA 2IC2A 3OKKA 4MVBD 4Y19A 4OT1L 3QQ9C 4WHYG 2I60H 1FO0H 2BDNH 5E2VH 5I66B 4M8VA 1IGMH 4KJQC 3HMWH 3VE0B 4QO1A 5INDA 2OL3L 4BELD 3BH8B 4IRSD 3MV7A 3NPZB 1F00I 2X4RB 3GDBA 4XXDA 1GPOL 5DD6A 4LGSB 3VGAB 3VGEA 5DMIH 5SV3A 1N5AA 3IT8D 4QRRA 3D3VA 3GSRA 3VMOA 3QIUA 1EO8H 2P5EE 3MRDB 1QNZL 4JANB 2EDTA 4Z95H 1CXKA 3HTLX 1Q0XH 3O0RL 7CGTA 1UVQA 2J8UE 1U3YA 3U2SB 2X4NA 3LN4A 2D9QB 4X80H 3KPRD 1IC5L 2D4FA 4KKCD 1A0QL 4JN1H 4XP1L 1P4BH 2DDQH 2ILLA 4HF5L 3CFDA 1RUPL 3NTCL 1A6TB 1TJHL 4OTXH 1T83C 1SMOA 1UM4H 4MJIB 3BP6B 5DRWA 3MRCA 3OB0K 1U8QA 2YD5A 2Y1VA 1NCWL 1T1YB 3G04B 1KG0B 3A6CH 1TQCC 5IQ7L 4U0RB 3O45B 2DQHH 2GSIA 3HE6B 1TNMA 1RPQA 4MQ7B 5IFJA 3PP4L 1G7IB 4ZFOB 1PX3A 3ESUF 4ZUWA 5LG1A 2DS4A 4MJ5B 3HRZB 4OI8A 3V4PL 5KSVA 2GT9B 1WFOA 3BMVA 4LASH 1OP9A 3LPGA 3S37L 2DLFH 4CAGA 5GRYA 3IJYB 1JZ8A 1QYGH 2DBJA 5FCSH 1CD0A 2BK8A 4JB9L 3P0YH 4FHBD 1JPGA 5E9DA 5B3NA 3DXAE 4ETQA 2VDQL 1BFVH 4ELKA 1ZLWK 5ALCH 4JO1H 2OR9L 1T2XA 1LE9B 3VI3E 3G6AA 1T0NA 25C8L 3H3BC 4WW1B 3ZYIA 5FCUL 3GSXB 2ESVE 4NBZB 5KSBA 1KULA 2YZ8A 4C83A 2HH0L 4Q9RH 3J8F7 1QSVA 1NLBH 3KDMA 1SYVA 2UZIL 2X41A 5FKAB 1V8HA 4XMPL 1OAZH 5ITBH 3OKEA 3AGVA 2GSGA 1UA6L 3MV9D 4IIQB 2WUBH 1QFUL 4NGHL 4XNYL 5D7IA 4OLVH 5DHYB 3WKMH 4DKFH 1SEBB 2CKNA 4XVTH 2AKRB 1LEKA 4LCWB 5CEXA 3X12A 5IB1B 4M93B 4EI5A 4XPBH 3H8NA 3QUML 5GS3A 1VGKA 4O2CB 4DTGH 4M1GH 3B3IB 4Z7VF 3U9PL 5FF6A 2AGJH 2FD6L 1AKJB 1T80A 4HPOL 5C9JB 4HWZA 1CR9H 2AK4D 4R7NA 4G8GB 4NNPL 2R0ZH 4R0LB 3K74B 4MVBC 3RVTD 3HG1B 5K9KB 4ONHA 4XCFH 3EOTL 1RUMH 3SDXA 3U9UB 1SY6L 2C4XA 2YKLH 3MV8E 4EN3B 1B6UA 1BEYH 5GIRA 1XZ0B 3AU1A 3DRQB 5T5NF 3GMLB 4YUEH 2C4FU 3KR3H 5IB5A 4PRDB 2OTPA 5FO8B 1PBYA 1W72B 4IRSC 2VYRE 3WNLA 4UNUA 1FL5B 1EBAA 2N4IA 5C0CD 4HG4K 4GMSH 4NQDE 1A6AA 1UJTA 4WUKH 3MCKB 5JHLL 3ULUL 2WBWB 3M45A 4CN6A 1GGCL 2P42B 4YBQD 1T04A 5JDJA 2C3HA 3IXTA 4NO0D 2ZUQC 1N0XL 1R6VA 3P73A 3T3PF 5GGUA 3V7AG 3EW3B 2CUMA 4XGZA 3P0VH 1WAAE 3KYNB 5HYFA 2XZQL 4NNXB 5IM7A 1INQB 3D39E 3LKRA 3DI3B 1Z0MA 4PRIB 2OR8A 1DQML 5F96H 4JZNA 4DN3H 2BVOB 2WWKT 5DJ8A 4QRTA 5F1NB 5JIHA 4EI5C 1MWAB 2E3VA 5ENWB 2UWEA 5C0FA 4M61A 3WS3B 4Y4FA 4X6DA 1LD9A 4BM7A 1FG9C 1D9KB 1ACYH 3MXWL 4J3SA 2CIIA 5I8EA 1IFHH 3EUUA 4PYGA 5DC9B 5EC2A 3MMEA 4G43B 3ARBB 3U7YL 4MAYA 3SKOA 3FB7A 3MR9A 4KROB 4BZYA 4PJDB 3RGHA 5INCB 5CBEB 2R0WL 4OCSH 5T1LB 1WJ3A 3I50H 3UTSD 5A16A 4XNQB 1LNUB 4LKXB 1J86A 4LSVL 4M6OL 5FO9B 2K7PA 2PKDA 3VH8G 4EUPH 1O7VA 2DTMH 2WQRA 4BFBD 3QDMA 3UYOD 1AD9A 2Z35B 3SKJL 3RUGF 3VDBA 4K7PL 8FABB 1IE5A 1AXSB 1RHHB 5ID0B 4OD2B 1DBMH 4XZUB 4QHNB 2D9CA 5DD3L 2AAVA 2PYEB 3W82A 1DTUA 2RBLA 2HJLA 1WEJL 5FUZL 4M5ZL 4NO2B 1CFTB 1DQQB 3QXDB 5LGJA 3CSYA 3ARUA 3REVB 3MJ9A 4OSUL 4X98B 4ZOAA 5IIEA 3HAEA 2BSTB 5GGVL 7FABL 2I07B 3DROB 4DKEH 1KBGH 2Q87A 4X4ME 4RMUA 1SJVA 1WK0A 4JEGB 4GW5A 5T1KD 2A2QT 3UTTA 2CIKB 1BOGA 3FFCA 1FVEA 5E2WH 2Q7YB 5ETUA 1CN4A 5C08D 4X9IA 3ECBB 2VL4A 4LNRA 1G7MB 4LVOB 2VDKH 1IGIH 3SDDB 2MQ3A 4P2OB 1VDGA 4Y4FC 1YQVH 1KCUL 5JTWA 4Z76B 3J7HA 5BRZD 2F58H 2CLZB 1T6VN 4JRYB 4PGDB 4ZPVB 2DM7A 1JHKH 4XPHL 3JV6A 4LLQB 1FV1B 1JGUH 3TM6A 5HI5D 4MAYC 4GJTB 5C07E 2YWZA 1FNAA 4S1DC 2OZ4A 3IB4A 4XAWH 3B6SA 3IGAB 2X4SA 4NO5B 5FOJA 5FGCB 4RISH 1K8DA 5EU5A 4AJ0A 4FZEL 1NANI 1ZXQA 4ODXA 4BSWA 1NBYB 2X1OA 4K71C 4NQVA 5C6TH 1V5JA 2C3VB 3BPOB 5C0GA 4Y1AA 4YHNA 5A1AA 5KW9L 1CLOH 4D0DB 5IHUH 1ZVHA 5C2BH 3BX7C 1YECL 4NZUH 4MXVF 3RHWF 2F19H 5DJXA 1G6RA 1EGJA 3MYJA 5FK9B 1VB9A 3S96A 2YEZB 3HC4H 1UWEL 3NCJL 4YBQC 4Q6YA 3QNZA 3R06A 4HUWA 5JOFB 1NH6A 3G6JA 4YPGA 2HVKA 5TDPB 1G84A 3PNWB 2SEBB 1RK0A 4QHKI 1MAKA 3NCYP 5HI4D 4QWWD 4MD5B 5FIEA 1GXEA 3M8OL 2MOVA 2Y36H 4U1LA 1B0WA 4NO3B 1DL7H 3NH7H 3EFDL 2BVEA 3KJ4B 4JAMA 1UJ3B 3V0AC 4LCWE 1SYSA 5FKPB 5IGXH 2MHAA 3S5LB 4KRNA 2NNAB 2NY2B 3NACH 1MRCL 3CK0H 3C6SA 3H3PH 3MOBH 3LS4H 5D9SB 3HPJB 4LMQI 1ES0A 2G2RB 4Q9CA 4FMKA 2P5ED 1L0YA 4NWTH 2IWGA 2ZOKA 5GZOC 3HG1E 3LEXA 3QQ3A 4MQSB 4KQ4H 2C1PB 5KSBF 3NFNA 1PZUB 1IL1B 3LQMA 3BIBX 4NM8L 2BVPB 3K0WA 3AAZB 4ZO8A 1Q1JL 2B2XH 3BYTA 3RIFF 4L4JA 3SQBA 1NBQA 3TH2T 4NN7C 1VKXB 5EIQA 3ZDXF 4W6YB 4JFEB 5J6HB 3LD8B 1S9VB 5BXFA 1FZKA 2Y06H 3IU4L 5D7IF 5FO7A 1MCPL 5E94A 5CUSH 4Y2DB 5DHXB 4KJYB 2EDYA 2F53D 2R4SH 3GM0A 4D8PA 1IT9L 3TJHD 2J88L 3MRPA 4PTTA 1XF3A 2VABB 4WFGE 1IC4H 5JW5B 3EOAA 3MREA 4HGMA 5DO2D 4FFZH 1DLFH 4FG6C 1F4WH 4NM4H 5KSAD 1GVIA 2ED8A 2J8HA 5TQ2H 1M71A 3CAFA 3SCMB 1MHEA 4HMDA 5ICZA 4F8QA 1KB9J 3I9GH 3TT3L 4PRIE 4YHPB 4CNIA 5A3ID 3E2HB 3LV3A 2AXGA 1TENA 2FIRT 4U2ZA 5D6CA 1T0PB 2B0SL 4M3JA 1AHWC 5IJVB 3QDJE 1IQWL 1NAMA 1WV7T 2W0FB 2BJML 3LKNA 4PJDE 4J2XA 2ZCLH 3QH3A 4U7KA 1KTLB 1WQVT 1F11A 2J8UA 2ICES 5F7DB 1RUAH 4ODSL 3MNVB 1DQJA 1YEDA 2FO4A 2X4OA 2DYPD 2XKSA 1F4HA 2QSCH 5I9QB 3IXAA 4KV5E 2AABL 1TPXC 3LHPL 2W59A 2BSSA 4ODBD 4LF3A 3FFDA 4KTDH 3OBAA 4NQTA 1NSNH 2OL3B 1L6ZA 1LO3L 4WRLA 2BVUA 3NIFE 4EUPA 2V17H 1PQZB 2MWCA 5KOVC 1EUUA 3MXVH 5CZVL 2W60A 4FOMA 3O11A 1WTLA 3TLRA 1WFTA 2BXYA 3UTPD 1CDJA 4LLMB 4HWBH 4Z7QF 3C60D 1LE5A 4NN6C 2R1XA 1FNEA 2BERA 5DFTA 2UWEF 4YDIH 3IJSA 4X6DF 3RTQA 3U6RB 3TBYA 1K3IA 5D1ZC 1GJIA 2R2HB 3NCYS 5HSFA 2GHWB 4QWWC 2Q6WA 3VFMB 5T3XE 4NBYB 4OJFL 1CLYH 4O2FA 4XRCB 4WFHE 5F3HA 5FGBC 2EO9A 2HFEA 4NUGH 1D5MB 2YA2A 3DXAA 4XPTH 4EDWL 4RAVB 3BO8A 4WI4A 2LFGA 2OBGA 4JZJB 4P46D 4XCNA 3MA7B 4JRYE 5IEHA 4HXAH 2ESVA 1A7BA 2W9DH 4OAWA 5D72H 5LWYH 2EYTB 5CINL 4P57B 2XZCL 1IAKB 4P23B 4JFPB 3TIEA 3W11C 1JZ6A 1BX2B 2ICEB 3CDYA 4HJGA 4DZ8B 5JXED 4NT6B 5IG7B 1OAQH 1XGPA 5L2KE 3Q5YA 5KVGL 5CMAB 5J3HD 3P9WB 1CLZL 1Q9OA 5A2JH 4XPGH 4Y5VB 4OGAD 5GRVL 2X89D 1QD0A 2NY0C 2F54D 1ZV5A 3PWLA 5E70A 4GKNA 5LCVL 5ACZA 1I9EA 3BQUD 3BVNA 3ZYZA 2KKQA 4UB0H 3DRTA 4QNPE 3TJHC 4LSSH 3WL9B 4BYHA 3ET9F 2FEDC 5FUOH 1D5XB 5DO2C 3WO4C 4Z7UB 4WNQB 1FJ1A 3MNZA 2Q1EA 2V2TB 1A3LL 2A6IB 2IPKA 3VG9B 5KANI 4P9HC 4HH9A 1WC7B 4X7FC 3MV8A 4H20H 1Q72H 4K7FB 4X9GA 1YEEH 1W72H 2PW2A 3TO4A 1UKTA 1H0DB 3TIDB 5B21A 1UM6H 3IDUA 5A3IC 1MCQA 1RU9L 2R29H 3P30L 1C5BH 2H2SD 1IAIL 1A6WH 1IM9B 4ODTL 5B22A 1Q94B 3PDGA 3QUMB 1MRFL 3P11L 4LFHG 3FRUA 1TVHB 3WN5A 4NQDA 4F7MA 2I5YL 3EGSB 4F2MB 2NY6D 3O3DA 1FFRA 1JZ5A 3WE6B 1YNKL 3H7BA 3VWKB 2F5AH 4K8RL 5FAAA 3OX8B 5D6DA 1CG9B 4WV1B 4OLUL 2APBA 4ZXBB 1GHFL 5L88H 3W2DL 1HHKA 1WAAA 4LSPH 2JELL 4PJHB 1NCDH 2CMRH 2XZAH 1MWAH 4Q0XH 4LLDA 3WHE0 1MFBH 1W8OA 5DMJB 4YIQB 3G6JF 4CL7A 2H6PB 4KPHL 1JF6A 4X5XB 1DUZA 3O41A 4MJID 5TDOA 3KJ6H 1G0YR 1S9YA 2X7LB 5E4EC 3L5HA 4PRNA 4PR5A 5DK3A 3UJIH 5D2LF 1MF2L 5EUOB 3DHMA 4U49A 3IDXL 2DI8A 4U1MA 3UZEA 4XAKD 5L7XH 1MLCB 2A73B 3KWWA 3PV7A 3BAEL 4OM0L 1A22B 4LCCA 5I74B 12E8H 3HE6D 4MWFB 1B0GB 3UYPA 2CDGA 3WIIL 1KLGB 1RVFL 2X9YA 4KTEL 1PG7L 4XHJD 3CSGA 3GSVB 3S4SA 5I1LA 4N8VG 1UCBH 3NZHH 3GSWA 3TYFB 2BXZA 1U92B 2V5MA 5ESQB 5GJSH 3BH8A 2DMKA 4P46C 4X0KB 2W07A 1ZT4B 4P4RA 3CZFB 4X83A 4YEEA 1EA9C 2A9NL 5I1JH 1DE4B 2QHRL 5E8NA 4JANA 4U6VH 1PYWA 5JXEC 5IR1B 3LDBB 5T3XH 1VFMA 1RZIA 2X42A 1WCQA 4X4MA 2F15A 3W9DB 4K2UL 4OLWH 1OPGL 4F80A 1AE6H 3KPNA 4FQHB 5J3HC 1N3NA 1B9ZA 1J8HD 5IROC 1A6TA 1CT8A 4OGAC 3TCLB 4FFYL 2Q8AH 1QQDB 1UXSB 4I2XE 1KEGH 2VXSH 3C8DA 3WLBA 1HEZA 2AEQL 4N68A 3DLQR 2XV6B 1KG0A 1AKJD 4HZLA 3B2VL 3O45A 4L29A 4G8GD 5C07A 4I3SL 1GZPA 3GMNA 3DBXB 1EEUA 5FB8A 2EDJA 2DLEA 4ZFOA 2FZ3A 4OV5A 5KN5B 3VXTA 3ARRA 4V2CB 4LP5A 4ODVL 1D6VH 1UYWH 3IJYA 3QCTL 1JRHL 5DJ2B 3WNMA 3HI5L 2QSVA 4POUB 4ODHH 4FXKA 5HHMB 3WUWA 1TIUA 4QYOB 2AP2A 4PTUB 2J8UF 4FQXB 4UV7H 4PV9A 2VDLH 3OKMB 3VGAC 1NFIB 5J1AB 2X70A 1N6UA 3KAAA 1EEYA 3JV4A 1I7TA 4JFQA 4GRLA 1ZANL 4HPYL 2JLLA 5EU4A 4R4BA 2IAND 5EZLB 1BQHA 3LEVH 4BSJA 3CXDH 2Y07L 5IK3A 1IKFL 1JFQH 4OLYL 2CXKA 3TA3B 5DHYA 5LGHH 2R56H 1KENH 4HC1H 1JGDA 1YY9D 1EXUA 3FO1A 4RWYH 3P4OA 3MRLA 1I7ZB 5HYSA 3NFSH 4BSVB 2AKRA 3LN5A 4LCWA 5D7KE 1D9KD 5CJ5A 1XH3A 2B4CH 2BY1A 4PGCA 1MCNA 3I75B 5GGTA 5C9JA 4U0RC 4LPWA 4PRAB 2EKSA 3ARBD 3FT3B 3HE6C 4X8JB 5AZ2L 3OPZL 5JDSB 4KROD 3VI3F 4O00A 3MOAL 3MLWL 1F8TL 1KELL 4Z7UE 3O6KL 2FYYB 3HG1A 5T1LD 3ABZA 3VXMB 3KLDA 4MJ2A 4YAQB 4JQXC 3C09B 3U9UA 5KS9A 5B39A 4EN3A 3W5NA 2CJUH 3QIBB 1PEZA 5DD5H 3MROB 4NQUA 5CEZE 4QXGH 1OTSD 3ES6A 3F7YA 4YHYB 4U3HA 1AO7D 2VH5L 4ZNEE 3STBA 2B20A 1A14L 1FL5A 2BP3A 2PYED 4OF7A 1JL8A 4H1LB 3LH2L 4KRLB 1M7DB 2VLRB 1G7HB 1UENA 3JWOL 2HKHH 1YJDH 1LK2A 1OF2A 1JF5A 3ARFA 4KHXH 2PXYB 1LO2H 3WKNA 3HS0B 4HUNB 1TFHA 3JVGC 1A7NL 4HS3B 1YMHA 4TOYL 3WFBL 2D7TH 3BD4A 4IIQC 4X7EC 5T3XD 5B8CA 4FXGB 4E41E 3B5HA 3S97C 1WWWX 4PJGB 4PRIA 1U95B 5HGHB 4EI6A 3MUGA 5JW4R 1JRHI 3F6IA 3TN0A 2EC9T 4M93C 4RA3A 3GI9L 4P2OD 5EO1B 4E0RB 2DQUL 4QCIB 4JRYD 4QXUH 1CDIA 3QDJA 2W0PA 3WMSA 3ULUE 4OT1H 3EO0B 4YDLB 4N0CD 4R0LC 1UFUA 4JVWA 4PJDA 5JPNB 3GB7A 4WHYH 3D87B 5K9OB 5EBWB 5TE6L 4KUCF 4I0KA 2P5WB 3MRRB 1YNLL 1LNUA 2W65B 3QCVH 1VPOL 4EN3C 2OL3H 2R1YB 2PR4L 3L7FA 1JJUA 3KPLA 1KPUA 3AXLA 1HINL 3BKYL 2ID5A 1WAAF 3RWDA 1R24A 1QNZH 3BH9A 3TCXA 4XH2A 3BKCL 2J8OA 1CGYA 3CFCL 2I9LA 3O6LL 2APXA 4NO2A 3QR2A 2Z93B 2QBWA 3RJDA 1CFTA 3FB5B 3JSSA 2JJVA 4JKPL 4U6YB 3RVUD 1A3QA 4JR9L 43C9B 1CVRA 1IC5H 3CUPB 2FL5A 4U05A 1A0QH 4HF5H 3VXOB 4X7TB 2HG5B 1AD0B 1RUPH 2H32B 3NTCH 4HS6A 1TJHH 4YR6B 4DN4L 4G8IA 2VKWA 1UM5L 4XNXL 2QQLL 5IMMA 2QSQA 4MCZA 4FMFA 4JGMA 1X44A 2YD9A 1NCWH 3ZYOA 5BVPL 1BJ1H 3SDDA 4LMQE 4W68A 5LQBL 2DKUA 5B38G 5IQ7H 3MRIB 2VB5A 1D9KC 2CLZA 2NY2D 1YQ2A 4PGDA 1X5YA 1A1NB 3RX8A 5D7JD 1FV1A 3ARBC 2M8XA 2OJZL 3V4PH 4KROC 5SX5H 3S37H 5T5FL 2J3SA 1JK8B 3FZUD 1T21B 4JB9H 4PJXB 2HJKB 4Z7WE 1JZ4A 2GJ6E 2A6JB 2VDRL 3GJFB 1DR9A 1QRNB 2H41A 5L2KA 2OR9H 5IHZA 2C3VA 2B5IC 1NDMA 25C8H 4HK0A 1OGAB 5DF0A 1OTSC 4KI5F 3ULSB 4JFED 3PWVB 2HH0H 5E8DL 3EYSL 3V5KA 4LIQL 4B53A 2IEPA 4BZ2L 2UZIH 2YEZA 1E27A 4AG4L 4U0QB 4XMPH 2E7LC 4GAGL 2R2CA 4NRXB 3QZWB 3BKJL 1J11A 5DK2B 4F3FB 4JFYB 2DQDL 5TDPA 1QFUH 4NGHH 4XNYH 3U82B 3PNWA 4L9LA 2UVFA 3QSKB 4L3EB 1X5AA 1PZ5B 1KJ2A 5CEZH 3SCMD 3BZEA 4OLEA 5E56A 3I6LD 2VZTA 2A74B 3QUMH 3SDDC 4LVOC 3U9PH 3Q5TA 4P2OC 2FD6H 4HPOH 5FA3A 4PD4K 2DJUA 4RDQG 4HLZH 1BFOB 4Z7NE 4P3CL 1OAYL 3RVWD 5D9SA 4RBPK 1UB5B 1CI5A 2NTSP 4HUUB 4IEFB 1H3GA 4XP5L 5F6HJ 1SY6H 2WK2A 1FZJA 3VXME 2CO7B 1A9BB 5DJYA 4YXKL 1ZSDB 6FABH 3M07A 3SPVA 2PYFA 4L9DA 5D7LE 3BPOC 3IRZA 1I3GL 4I0PA 3HCVB 1F5WA 1RZGB 1K3ZA 3T0XA 3U1SL 1VKXA 4J1UB 3TC9A 5J6HA 1S9VA 2FH6A 5JHLH 3QNYA 3ULUH 3QA3A 1M6OA 5BS0E 1GGCH 2Z91B 4Y2DA 4ISVB 2ZUUA 1CQYA 1N0XH 4R96A 3RDTB 1NCTA 1XCTB 3MPCA 4JDVB 4Y4HA 1CFNB 5DA0B 4MNQD 4XMLL 2LABA 1ZHKB 2XZQH 5IOPA 4GUPB 5TF0A 3RGVB 2MTPA 1DQMH 1F3JB 2XICA 1OP3K 2LVEA 3MXWH 3CC5A 3ZE0E 4YHPA 1XCQB 3KJ4C 1UJ3C 5JW3L 4PJ5E 2EIZB 3F5WA 4GBXA 3PHOB 2NY2C 4HIHB 3RWEA 3QO0A 3LKPB 2MSPA 4N0YL 2LVCA 5TF1L 4QT5B 5TE4L 2F74A 4P23D 1AP2A 1Q9LB 1QLEL 4U6HB 2B4CC 2W0FA 5I16B 2GTZB 3FZUC 4LSVH 4M6OH 1URLA 4NKDB 3N0PB 1HQ4B 2P5WE 1KNOA 3D18A 1AGBA 3BIKB 3SKJH 3KLHD 4GMTL 4K7PH 2VISB 3GUTB 3ZT7A 2GJZB 2X9WA 5DD3H 2VQ1B 1RUQL 5GS2H 1WEJH 4I2XA 3LD8C 5FUZH 3STZB 4OCRL 4M5ZH 1FORL 2FX9L 4M3KB 1UWXH 1YPZB 3V52H 4Y2DC 4CMHB 4LLMA 4OSUH 4JFZL 2JIXB 5GGVH 7FABH 1AGFB 2DWEA 1TDQA 1VACA 5E8OA 5DJ0B 1YJDC 5HD8D 1NGXA 3FCTA 4N0RA 4I9WE 2Y6SD 2R2HA 3I6KB 4G80B 3N1GC 1JF1A 3SCMC 2A83B 4QHLA 3T77B 5GGRB 1ERNA 1OB1A 2DM3A 1AIFB 1KCUH 4HDIA 4PJDF 2PTUA 1Q38A 4WJ5A 3ZTJH 3E2HC 4RAVA 4XPHH 1IM9D 3Q1SL 1IGCL 3L5JA 1IGYA 2H1PH 3MA7A 5HHNB 1S9KC 4OFKA 4L5FL 5H37G 1NGZA 1NUNB 4YXLL 4KV5F 2EYTA 3BD5A 4WTXA 3RVWC 4P57A 4Z78B 1JTTA 1KPRA 4NPYB 3DETD 1IAKA 3CIQA 5HGAB 4LCIL 5DEFA 1BX2A 4FZEH 3O8XA 4CBPA 5JLZA 3NIFF 4MDJA 3F6LA 3VWKD 5EPMB 4KZEL 1ONQB 1MJJB 4PJXE 2LAAA 3MLSL 4LLVB 4OQTL 3T65B 3VD5A 1PJ9A 4EQ3A 5I9QC 1U8KA 5KW9H 1U8OB 4KXZI 1QRNE 2YSSA 3OWEA 5B4MC 1AR1D 1YECH 5KTEL 4LPXA 1H8OA 4HXBL 2GCYB 1OGTB 4CRPA 1OGAE 1S7SA 4PYHA 4YEFA 5F6IC 3QG6B 4TVPE 5AG9A 2FCBA 3PJSA 4IRJD 3E3QC 1XF4B 1UWEH 5I1EL 3NCJH 4ZYKA 2VO5A 2Z8RA 3BGMB 2HTKD 1MVUA 3VRJA 3ULUD 3U7WL 4MSWB 5HXMA 4RCAA 3STLA 5EBLB 4Z7UA 4A6YA 3M8OH 4L3EE 4W4NA 2A6IA 5IVNA 3T4AB 5J57B 3W5MA 3EFDH 3HC0A 5ADPL 2C3WA 5D2NB 1DQTA 1H0DA 3H42L 3TIDA 1MRCH 1FE8L 4H1LH 5HHQB 3O2VL 4JZJC 1Q94A 4JFDB 4BA8A 2HT3D 4QHMB 2ZUSA 3MRHB 2P43B 3RWFA 1C8PA 3RL2A 1LO0L 4UAOB 5IEKA 3OTTA 4P23C 5FYLE 4KI1A 4F2MA 3MX0A 3QDGD 3L9RA 4WI7A 5EN2B 5HY9B 4JKKA 4NM8H 3OX8A 1HWHB 4WV1A 2AJVL 4ZXBA 1Q1JH 5J06A 4QNPF 3KLHC 1F42A 2EE3A 5KVDL 3X13B 4E41A 2EXWD 4XP9L 3VXRB 3AREA 4GG8B 4TULL 4Y5VC 2AK4A 3IU4H 5BMFH 1MCPH 4OLXH 1HIMH 2H26B 1X5JA 2BMKB 1G9ML 1JCKA 2X7LA 2EE2A 4Q2ZB 3UBXG 3ZDYE 3AS2A 5GS2D 2Y25A 1VERA 2A73A 3AY4C 2AJ3A 3MLRL 3C6LB 3OAYH 3DOSA 1KIQA 4DCQB 2R9HD 2FX8L 3BHBB 4JZOA 1EHLH 4EKXA 3VG9C 1U42A 3CD4A 3OXSA 4LLYB 5LAXB 3TT3H 1Q9KA 4XTRD 3CDGA 2PF6A 3HNVL 1JGLL 1ED3A 5HHMD 4XT1C 1WBZB 1CFVL 4CADB 1UCTA 1U92A 3HZVB 4S10A 2B0SH 2DIJA 5ESQA 2P8PA 4WUUB 2KL6A 4FQXD 1S7TB 3VMPA 2YD2A 4F37K 2V5TA 4GW1B 4X0KA 2E6QA 1IQWH 4JN2A 4WWKD 1LK3L 1ZHNA 2A0LD 5DVLA 2DQCL 4QGTA 2BJMH 3DETC 4JCLA 4ZUUB 2X1QA 1U6AL 4ODSH 4EOWL 2NW3A 3SDYL 1BVLB 2H32H 4L1HA 3VWKC 1K4CB 3DTXB 4NOBA 4YDVA 3GSQB 4WV1C 3K1DA 1ROWA 2AABH 4ZXBC 3LHPH 3G6DH 3L3IB 2HT2D 3EYFA 3TA3D 1DUYA 5JHDB 1AR1C 4OI7A 3MJ8A 1KLUA 1U8MA 1AGDB 3T0WA 3BP5A 4ZFFB 5HHPB 4UT6L 3TPUB 1PDKA 3TCLA 4JFXB 1RK1B 3F7PC 2JJTA 4PPTA 3ZE2E 1HCFX 1AY1L 5J7CC 2HTKC 3IU3B 4IOFD 1BP3B 1ZTXL 3ULUC 5I74C 3QEQB 5D1QD 4HKJB 5SWSB 3R4DA 1MI5B 5C0IB 2D7PA 1IVLA 1WGOA 3SDCA 3GJFH 4LBEA 2DQIH 1I9JL 1Q9WB 2KZWA 5KN5A 3QEHA 5BV7L 4OJFH 3VXMD 5KVEL 4Z7WA 3K3QA 1T2JA 2GJ6A 4OF0A 4IHOB 5IB2B 4X4XB 2XXMB 3PXJA 1MQ8A 2QR0B 4EDWH 4G8FA 4RMRA 3IVKB 4ONOA 3NN8B 3QIBD 4OZFB 4QYOA 3BPLB 5HJ3B 4PTUA 3V5HB 5CJXA 4QGYA 3MC0A 5CINH 1OQXA 1YN7B 2BHUA 2HT3C 2XZCH 3MLZL 3BGFB 3CPLA 5J8OA 1LEGA 5ESVA 2RCSL 2VLRD 3K1KC 2ZUXA 3LY6A 5GRWA 4F57H 3JBG7 1XF1A 2PXYD 1W0WB 5GRUL 5IMKA 5JIIA 3LDBC 4XBEL 1PGRB 4J8RA 2WIMA 4POYA 4BQ9A 5CAYB 2EDKA 5TPWL 5KVGH 1CICB 4ZFZB 1CLZH 3O3BA 1INEH 2GFBA 2Y5TB 3NCMA 5FDYA 4KKNA 1UZ8A 2EXWC 1FSKB 4JLRA 3SDAD 3GBML 2EIDA 4ZOBA 1T2QL 1J0IA 3RX7A 1R3JA 4WTZG 3RAJL 3DX6B 1MFAL 3M17A 3KYAA 4KK5D 4P2RB 2FJHB 3I3DA 2E7BA 1JPTL 3ULVE 5FYLH 5I17A 1OSZA 3GGWB 3CFKB 3F7VB 3HLAA 4K3GA 4NQEB 1RZJL 1IM3B 2C9AA 4PRAA 4X8JA 4ZQKA 3BDYL 1IZKA 2R9HC 1A3LH 3RWIA 4PP1D 4K3EL 4OZIB 4G6AD 4TPRL 5T5NG 4G6KL 2O5ZL 3AMKA 3VJ6B 1CGSL 3U36A 2CDEA 4WGVB 4PJIB 5GGSB 1G7JB 1OAXL 1RU9H 2EYSB 3P30H 5D7LA 3DYOA 4ODTH 5JQ6L 1RV6X 1ZVYA 1A9EA 1DCLA 5JOEA 1MRFH 2VTFA 3P11H 3MACL 5AYQA 4F7TA 4FQXC 3UJTH 1MFCL 4PG9B 3W9EA 3PP3K 4JFDE 2I5YH 4HX1B 2P8LA 4Q7DA 3T2OA 1BBDL 5BS0A 2NQCA 5EBGA 3O3AA 5CSZB 1DLHA 1X6NA 4K8RH 2UVEA 4ODWB 2OR7A 4LHUB 4OLUH 5IW6B 1GHFH 3FOLA 4PGBB 1C5CL 2JELH 2X05A 3S35L 4JVUA 3PL6A 3RIAF 2HT2C 4XC1L 3TA3C 4KPHH 1BREA 4UV4L 4KDVA 4LPVA 1MF2H 3D69A 3IDXH 4NJAL 4Z7UF 1C08B 1JGEA 4PJ5A 3SGDI 4LLUA 2ADGA 3Q3GB 3BAEH 1WLHA 4OM0H 5DJZB 4IOFC 3JZ7A 5E2JA 4JFFE 2V2XA 3WIIH 4MX7B 1RVFH 4LSQL 1MH5A 3GSUB 5F93C 3DUHA 3AM8A 4KTEH 1PG7H 1MOEA 5GJTL 3EZJB 5F7MC 4JQVA 1RJYA 4KDTA 5ERWB 5K9OA 1X5FA 3BN9C 2DLHA 2P5WA 3MRRA 2BZDA 3C09C 2FECL 2R1YA 3TEUA 1MCIA 3QIBC 1QFWI 5JOPE 2X2YA 3PV6B 3DURA 3F12A 4WUUE 4WFFD 2XWJA 2A9NH 2QHRH 3WJJA 3H0TB 4PY8J 4EIGB 5KSAA 2WV3A 3ESVF 2W92A 3KPSE 4S2SA 4HAFA 5F1IB 3SBWC 2PXYC 1VENA 4NCC1 4TVSa 43C9A 4J3UA 4ZS6C 4TNVF 4K2UH 1BZQK 1OPGH 1PEWA 4L3ED 4FTVD 3VXOA 4X7TA 2HG5A 1AD0A 1D5ZB 4M6NL 5JHDE 3ULUF 4FFYH 4FQLL 4YR6A 3VRIA 4MMXC 3F7RA 2CQVA 4OFYA 2IMMA 4OCMC 5C0AB 3T0EE 1NEZB 4JM2A 5MEQB 2AEQH 2EYRA 1NGWB 5F3BA 4HJ0C 5DRXB 1FYTB 3NCEB 2ADFL 4G9FB 4LSUH 1M7IA 3MRIA 3S88L 3B2VH 2OQJA 4I3SH 5F8RC 3DGGB 4Y8DC 3DECA 4X4YB 3WNPA 4YDLC 3MLVL 3QEQE 3DO7A 4EBQL 4ODVH 4WW2B 4PP1C 4KKAC 4G6AC 1JRHH 1ZGLP 3HI5H 3C9NA 4YH6A 2BOBB 4MLSA 1IEAA 5L8JB 1QRNA 5I1KL 3O4OB 4QF1B 3UYRH 2OP4L 4OD1L 1OGAA 4LOUC 3BXNA 2NY4B 5ABDE 4QOKB 5IBLD 4JHZA 2MCG1 4X9BA 1LO4L 3PWVA 3GRWA 4QRPB 4JFHE 5HHOB 1VFUA 2GIYA 1ZANH 2UZYB 3IETA 4RAHA 4HPYH 3PG2A 3CH1A 1X3DA 1S7QB 2O26U 3DV4B 5H2BB 1X4ZA 4HAGA 3RDTD 1CTNA 1IKFH 4JDZA 4OLYH 4JFYA 5J1SC 1ZT7A 4L4VE 3OB8A 4K8RD 4E5XB 4UT9L 4JQIL 3Q5OA 4WO4D 1QEWA 2DQGH 1D5IL 1HSAB 2NYYD 3DSFL 1KXVC 4HEPG 1I7UA 1R5WB 4WFEE 4YLQT 5IMOB 2Y5EA 4RNRB 1S7VB 1UGNA 4RRPA 3IDGA 4Z7WF 1DN2A 2FECI 2WW8A 4P2RE 5J13B 3UDWA 3MCLL 1JYVA 4H26B 4CMMB 5AZ2H 3OPZH 1TQBB 1BFOA 3MOAH 2R8SH 3MLWH 1F8TH 1KELH 5DSCA 3ZSTA 4ZUVB 1UB5A 3O6KH 1S78D 2GY5A 3MLYL 2DD8H 4MD4B 5AWNL 3D6GA 1FZOB 3BPNB 3MOQA 4GT7A 3S34L 4M7KH 2GYSA 2BVQA 4FN0A 4BZ1L 1TCRA 4PJIE 5MEND 3V8CA 2BX5A 3WNOA 1EUTA 4YJZL 2VH5H 3VG0L 4YGVA 1A14H 4LDOB 3BSZL 1SJEB 1QSFD 3LH2H 3QUXA 2H9GB 3GMRB 3JWOH 1F3DH 1Y18A 4E42B 1BVZA 1QO3B 1UC6A 4B0MM 2FATL 4KGJA 3GMPA 2YN3A 5EO0A 4HK3J 3VXQB 3AS0A 1A7NH 2PN5A 2P8MB 3V4VL 4BH7B 4TOYH 3WFBH 4NUJA 4S0SD 5EU6D 1ZHKA 1RURL 1J0KA 4Z7NF 1WZLA 3HFML 1F3JA 4MA7H 4NCC2 4LEOB 3MBEA 3GI9H 3WXVL 2DQUH 1RZ8B 4HIEB 1F90L 1BIIA 1XCQA 3C08L 3E6HB 3V2AR 3DI2B 4LEXL 1YC7A 2EIZA 3H9ZA 3QQ4A 3UDWC 2FNBA 4RFOL 1FG2B 3MRBA 4YNYB 3LZFH 3OGCB 3LKPA 4L8BB 3S35X 3OKLB 3WV0A 1CS6A 1N6QH 1OCWL 5TE6H 4P2QB 2ORBL 5BOZG 1U8NB 4HKXB 1EDQA 1YNLH 5I16A 2GTZA 2NX5B 1JYWA 1GIGH 3KXFE 1HQ4A 2PR4H 2OTWB 1ZS8A 3C5SB 3KLAB 3N1PC 5DJAA 5TGBA 4I8DA 3GUTA 1HINH 1ZT1B 1HH9B 3BKYH 4FXLA 5IBLC 5JR1L 3BKCH 1GZQA 3CFCH 3O6LH 2ZCHL 4HS8L 3MUHL 3B9KB 4JKPH 5HGBA 4JR9H 2VN4A 2A77L 2P47B 3OKOB 2JIXA 3VFGL 3ZE0F 1YZZA 2R2BB 3MRNA 3RDTC 1TVDA 3QUKB 5GS1A 1JNLL 2XN9B 4DGVL 5DJ0A 1T7WA 4K8RC 2RAMA 1EFXB 1HHJB 2IBGA 4DN4H 1UM5H 3PWJA 4F33A 3RGVC 4F9PA 2R2EB 2QQLH 1WCBA 4XNXH 2WNGA 4G80A 4RWHA 4OZFH 4X7SH 2HT4D 5BVPH 5IFHH 4UTBL 5LQBH 1N64H 1AIFA 1WUNT 5E1HB 2W9EH 3TBSA 1CIUA 5IHLB 3MFFB 3P4MB 3GMMB 5HHNA 3OAZK 4UQ2A 2OJZH 4AMKL 4C56D 1ACZA 4ZUTB 5T5FH 4AIOA 2EDOA 3ZHDA 4O51B 5DJ6B 3IFOA 2PCPB 1G0XA 2FX7L 3MA9L 1JTPA 4ZMAT 1ZGLB 4QTHB 3IAGC 1YEJL 5DFWH 3MJ9L 5I8CB 5EBMB 4LSTL 1A4KB 3SGJC 4POZD 1XGRA 1MHHB 5DTFB 3SY0A 3W0WE 5IVZB 2V5SA 4FQ1L 2K3TA 5E8DH 3EYSH 3LPWA 2GCYA 4LIQH 4PV8A 3VXRD 3WIFB 2YPLB 4QOKE 1IMHC 4BZ2H 4RX4D 1EVTC 3QG6A 3ARXA 4AG4H 2WM0A 3LKSA 3SE3A 4GAGH 3MJ6A 3BKJH 5C1MB 5BVJA 2DDQL 3BGMA 4JRXB 5E00A 4CMHC 2FJGB 1KOAA 4JM2F 3QG7L 3C6LD 3S3PA 1W2KT 4L3CB 2JTDA 1OSPL 2PO6B 3VFPA 3TBTB 3CU7A 3RVXD 2OZ4L 3T0VA 1MPAL 2VLJB 5A40E 3HE7A 1KT2A 5MERB 3L5WA 1IKNA 4DAGL 3VXUB 3V5DA 4LPTA 5BZDA 2FWOB 3RVVD 1KGCE 3LRHA 5DHVB 1QSEB 4PJXF 5FDWA 3W39A 4P3CH 1OAYH 1ZHBA 4JFDA 5A2KH 3EOBA 4L3AA 1LO5A 1DANU 3P0YL 4EXKA 1D6EA 4IMKA 4XP5H 1G6RL 4AM0A 1EGJL 4GOSA 3E8UH 5C0DB 3NGBB 4YXKH 3OR7B 3EYQD 4GLRI 1U8JB 4LP4A 2UUDH 1I1RA 1CL7I 2VXUL 3HPLB 4I4WA 4NKOA 1J1XH 3FRPA 4LCYA 1I3GH 1MSPA 4LGPB 3IF1A 3U1SH 2IQAA 4JKLA 1BD2E 2EE9A 2CDFB 3FQNB 3L6FB 2BMKA 5F8QC 1X5KA 2AXHA 4OCNC 4Q2ZA 1NC4B 2X4QB 1HHHA 4UIMB 3DVGA 2J2ZA 4KXZH 3CFBB 4JFFA 2Y23A 4LRNL 3NBNA 1N6VA 4P59L 4XMLH 3P0GB 5SWSD 3V7AE 5JZ7C 1MI5D 3T04D 2PTTB 1RMFH 4DTGL 2E7CA 4KWUA 1VA9A 4QXTA 3UJJL 1QFHA 5LAXA 3F65A 2IJ0C 5JMOC 4M48L 3VRLE 2VSCA 2HLFD 1MCSA 5JW3H 2WBJA 2VQTA 2A6KA 4CVUA 3L3HA 3T2PA 4WUUA 4N0YH 5TF1H 5TE4H 2QQQA 1BWWA 4KH2A 1B88A 4UAOC 4L8SA 3SGEH 2VLKA 4DUXA 3KPSA 2XQYK 4YUEL 4CU6A 5BCAA 1ORQB 1R3HA 5DQJB 4EXPX 1CE6A 1VFAB 1UH3A 2NX5E 2Q8BL 3S3JA 3VW3L 3ZDYF 1EAJA 1WZMA 4GMTH 3ARPA 4GMSL 4DVBB 4CN4A 4POZC 3TVMB 5JHDA 5A43C 1RUQH 5F1SA 3WHXB 4EVNA 3U0WL 3X17A 3PF2A 5HYQB 4OCRH 3NABL 5ID1B 5BQ7B 3T0EA 1FORH 2FX9H 3BZFA 1BJ1J 4JFXA 4JGJA 4CU8A 3GO1L 2OK0L 4M8QA 4MD0A 4JFZH 5BJTA 3U46B 2AXFA 3G5YA 3BT2L 3T2QA 2DI7A 4NQED 2BNQB 3JWOC 1N4XL 1JNHB 2LU4A 3O6FB 3SQOL 3C6LC 4HEME 3QPXL 1U8LB 1BJ8A 1MLBA 3QEQA 4K3DL 1XF5B 1E28B 4X9FA 5FUCE 2XN9E 3RVXC 1NAML 1Q9WA 2F9BT 2HVJB 3OKKB 5JUEL 4JM4L 4DGIL 3DYPA 1DEDA 1OW0A 4WHCA 3Q1SH 3D2UD 1IGCH 3RVVC 5TH2A 4OZFA 4L5FH 4YXLH 4LAQL 1YN7A 4XBGA 4Y5XA 4EUPG 3QHTC 5INDB 4LCIH 3MV7B 4ZFGL 3MRMA 1WZKA 3C8KB 4XXDB 5IB4A 4KZEH 32C2A 3MLSH 1YMME 1A6UL 1KIPA 1KTDA 4OQTH 2KPNA 5LXGL 3D3VB 3GSRB 4L4VA 3ZE2F 3QIUB 4J3WA 4J7RA 3G5XA 2XIDA 4HWNA 5KTEH 1CICA 4X7CC 4ZFZA 4ZO9A 1YEFL 4HXBH 1UVQB 1BPVA 2Y5TA 2X4NB 3LN4B 5J6GA 1T7YA 1VSCA 4P9HL 3ARWA 1EZVX 5EA0L 3DX6A 4DKEL 1CD1A 3U7WH 2YUXA 5J9PA 1CTOA 3N85L 4QRUB 3MRCB 1U8QB 4IS6A 3P9LB 5DJCA 3SE8L 4LARL 1M1SA 1UT9A 1EV2E 4NFCA 1QLRB 3GMOA 5IFJB 1X5LA 1U58B 4H25A 1S7WA 5ADPH 3H42H 4PJIA 4DKDC 2HLFC 3UPCA 4V1DE 2EYSA 5E1AB 1FE8H 3VXUE 5HYIA 5KSVB 1VESA 3O2VH 4Y16D 4I1NB 3BPLC 3C2SA 1LO0H 3DHJA 1T7ZA 1JPGB 1AQDB 3IFLL 4HT1L 5E9DB 4FQCL 4ETQB 1XR9B 4ELKB 4G5ZL 3BGFC 1CGXA 3G6AB 1T0NB 1T5XA 1F6AB 5M7QA 4U6TA 5KAQG 1GCFA 5KSBB 5C2BL 2HFFA 5IWLA 4LHUA 2NXYB 3LAFA 2MCPH 4DJMA 2WP3T 1SHMA 3ULVF 1EJOL 4F15B 1IILE 5KVDH 3KDMB 1CICC 1SYVB 3BYYA 1EIBA 1A1MA 4XP9H 2G75A 1OP5H 3E6FA 5CJBA 4NHUA 4ZSOA 4TULH 3OKEB 1PG7W 1FSKC 2GSGB 1G9MH 3HMXA 5C0AD 2DQEL 4RFEB 4R26L 4X6BA 3FN0L 3EHBD 4MNGE 1C08A 1FYTD 3WS6A 1GOFA 4G9FD 1E4WL 4QHKJ 4DOHB 3MLRH 4GRWE 1LEKB 1N26A 1GAFL 3X12B 4EI5B 4FRWA 2FX8H 3C2AL 4MX7A 4EDXA 5MP6L 2VXVL 3TH4T 2A6DA 3FO9B 3V0WL 3BW9B 3DMMD 1CGVA 4HWZB 1CYGA 3MRJB 4R7NB 3KXFA 3MYZA 3HNVH 3T8XA 1JGLH 2C4FT 2YD4A 4TYUA 5DZOA 5T33H 1CFVH 3R0MA 4ONHB 4PRHB 2P7TA 3SDXB 2IFFH 4P5TA 1LHZA 1ZLVH 3TFKD 1M05B 4QRSA 4PJ7E 5JW4M 4LLAA 3ETBF 4GH7B 5GIRB 2CRZA 2NY4D 4HQQL 1LK3H 3VDCA 2DQCH 1T66D 4QRPD 5HHOD 2VERN 1U6AH 5IB5B 5BW7A 4EOWH 4W81A 3SDYH 1Z6JT 3VWJB 1ND0A 5BZWA 1OHQA 1CDHA 1JTOA 4JPWH 5IWLC 5CP3A 1OY3B 1A6AB 1RSFA 4RSVA 2VAJA 4M7LL 5DUML 5A2IH 1R5IA 4BJLA 4OKVA 4K9EH 1SVZA 4UT6H 4Y4KB 1D5ZA 3IXTB 4W70A 5GGUB 1H15A 1T1XA 4OUOA 5DI8A 2XTLA 1CXLA 3NOIA 5J11B 3K4AA 1DLFL 1JPFA 1AY1H 1NGWA 3FB6A 4NM4L 1BWMA 5TQ2L 4OF8A 1ZTXH 3LKRB 4JZNB 4ZO7A 4UOW0 3VFNA 4NC0B 4HGWA 5DJ8B 3L3DA 4QRTB 5ITFA 4HFUL 5CLTA 2UWEB 4JCMA 4M61B 2BNQE 2MNUA 4AK1A 5C0FB 4Y4FB 1E6JL 1LD9B 4M7LT 4X6DB 5EOQL 4O58L 1I9JH 2CIIB 3RJQB 5I8EB 5KVEH 3X11B 5CGMA 4WW2A 3UC0L 5EC2B 3MMEB 2DMBA 3SKOB 3FB7B 3MR9B 5EWIL 2Z31B 3ZDZE 2YUWA 3EYVB 4PGEB 2QKIA 4NKMA 3W0WA 4GXVL 5A16B 2ZCLL 2FBJL 3MLZH 2XQYG 4Q6IA 4YHMH 4QOKA 4N90D 1X7QA 1BF8A 5FYKE 3BDXA 2RCSH 3RY6C 3QDMB 1AD9B 5BW7C 2EZ0C 5JO5A 1J8KA 1EX0A 4Y89A 5GRUH 3MV7E 4XBEH 2ARJQ 3DV4A 4NDMB 5FYKU 1NSNL 2HJLB 3HZKA 3MLUL 3QISA 2HKFL 5DQ9A 5TPWH 3UROR 2CR3A 1AQKL 2CPCA 3MXVL 1XGQA 5LGJB 3CSYB 2H2PD 2KDGA 5FM5M 4ZFOL 3GBMH 1VEOA 2VZ1A 4O2EA 1HSAA 4L4TA 1G7PA 3HAEB 5DHVH 5C0BA 5FM5O 2WQ8A 4D9RD 1MFAH 5CZXD 4WEBL 3HI6L 5IMOA 3GJEA 3K8MA 4GW5B 4RNRA 3EHBC 1N2RB 1I4FA 5GS0D 1QTYT 2R0KL 1I9RL 5F7HA 4HUXA 1G9NL 3UTTB 1BOGB 1RZJH 5BO1H 3UP1A 4NFBA 5ILTL 1UXWA 1FVEB 2HMID 5ETUB 4Q97A 4LNRB 3U4EA 3BDYH 2ZSWA 1QFPA 4K3EH 4TPRH 4G6KH 2O5ZH 4IOSD 4P2QD 5CD3A 4WW2C 4KK8D 2VWEE 3HZMA 1OAXH 3WSQL 5LWYL 2BC4A 4RMQA 3TBWA 4GQ9L 5DWUL 3KPOA 3WJLC 2Q7NA 2G5BA 3O4OC 1MFCH 1K8DB 1CCZA 1BD2A 4ODXB 4P9ML 1I9IL 2NY4C 4NQVB 1BBDH 3JWDH 3PXHA 3ISWA 4XPFL 2EH7L 5C0GB 4YHNB 1OQOA 4E42A 3B9KD 4WDIA 3OJDA 5DJXB 1G6RB 3QXWA 3MYJB 3G9AB 1C5CH 4JVPA 1NFDA 3VXQA 2BCKA 2IQ9L 2P8MA 1B0RA 3AROA 3S35H 4BH7A 5GGTL 4XC1H 5TQ0L 3B4NA 4RAUA 4R2GB 5EU7E 1EFXD 3QNZB 3NA4A 4F9LA 4UV4H 3R06B 4HUWB 4HGKC 3G6JB 2HVKB 1A7OL 3EJZD 3IKCB 1ODAA 4NJAH 2HA1A 4PUBL 1R5VA 2HTLC 3MV11 1P7HL 1RULH 2Y9RT 2EEBA 3WIHA 1Z2KA 4M6ML 2EIEA 1N59A 2IBZX 3CSPA 1RZ8A 4HIEA 4EEEA 1S9WA 3QDGA 4BQCA 4Z9KB 4LSQH 4PJBE 2AJSL 4PJIF 1U3HA 1Q72L 1TQBC 1SYSB 1MUJB 4HW6A 1ETZB 1IC7L 5GJTH 2MHAB 2J7LA 1I85A 1FFOA 3C6SB 1ZHLA 4HUKB 3QWRD 1ES0B 2NX5A 3BPNC 1WTGT 3QXAA 3VH8A 2ADJA 4KJWD 2ZOKB 3WFHA 4GXUM 2CXGA 2GUOA 3KLAA 3LEXB 4PRHE 1JV5A 3SDXE 4HKBA 2Z8VC 4YHKL 1N7MH 3C5JA 4M4PA 2VE6A 3RWGA 5CD5D 2YPLD 4P99A 4WI9A 4JRXD 5BXFB 1HE7A 1NKRA 1OM3H 1FZKB 5EUKA 1NCBL 2G9HA 4L8DA 5FO7B 5E94B 3JWNC 3OKNA 3QFJB 4ZPTB 2VMFA 1P9MA 5CHNA 4D8PB 2XN9A 2PO6D 4M6NH 4FQLH 3MRPB 4PTTB 1XF3B 2H2PC 4F9LC 1T5WA 5FECB 2VLJD 5ANMA 3MREB 3QHFL 3VXUD 1GRWA 5CZXC 2LV4A 1M71B 3S88H 1BHGA 1GH7A 4RGNB 5T1MA 4G42B 1G7LA 5ICZB 1QSED 5SX5K 3PWNA 3P9MA 3K7UA 2HMIC 3P4MA 4LQFL 3GMMA 1U3HC 2JJSA 1FGVL 3MLVH 4CNIB 1BLNA 2AXGB 4ZUTA 4EBQH 3UBXI 3L3OA 3FQUA 1E4XL 1EHXA 1P69B 1J1PL 3Q0HA 1YMMA 2FHFA 4HUVA 5D5MB 4LRIA 2AJUL 1NAMB 5I1KH 3FQXA 3EZ8A 3LKNB 1W0YT 3QH3B 1ZA3A 4APQD 2OP4H 3AVEA 4OD1H 5FYJE 1F11B 5DTFA 3PE9A 4PB0L 1DQJB 1BFSA 1LO4H 1YEDB 2FO4B 2X4OB 1BIHA 3O3EB 1AH1A 3GFUA 3IXAB 4HWUA 4PS4L 5FYJU 4YQXL 5I8KL 1MCEA 2BSSB 4U2YA 4LF3B 1NC4D 4KQ3L 5E95B 3B9KC 4DQOH 3PHSA 4URTB 5C09E 2W91A 3H9SE 4HMEA 3ARDB 3O11B 4UT9H 4JQIH 4ZAKA 3LS5L 1NC2A 5CSGA 5FUCC 1D5IH 2JB6A 1A6PA 5JNYA 3DSFH 3IS1X 2EEDA 3BN3B 4I13B 3AUVA 1LE5B 5EB9A 2R1XB 1FNEB 2AJYL 2AQ1A 3EJZC 1C16B 3IJSB 3RTQB 3TBYB 4V1DA 1T1ZA 3MUZ1 3QQ9D 4Z0XA 4K9EC 4XWGL 4WW2F 3CMOL 1KJVA 3VFWA 4O2FB 3TNMB 5F3HB 4KRPB 3UTTE 1TITA 2HFEB 5ISZD 3DXAB 4M9PA 3B5TA 4KJQD 2JJSC 2Y7QA 1HILB 3BO8B 4HV8B 4BKLB 2R23A 2E9BA 4XCNB 5AWNH 3LQAL 5IEHB 1P7QA 2ESVB 3P3YA 4OAWB 4UU9A 1CXIA 2PTVA 2VIRA 4BZ1H 3WNNA 3CCHA 3TGXA 3TIEB 5DMYA 3HPLA 4KJWC 3UPRA 3VG0H 1GGBH 2OXHA 4NRYA 2XG5A 1BZ9A 3TVMD 1U2CA 5EU3A 3S3SA 1I1YA 1FVDA 1XGPB 1QLFA 4PG2C 4XNMB 5C0EA 1MFDL 3G08A 1KJ2L 4K3JH 5CD5C 1ZEAL 3ILPA 4MNGA 3VXSD 3L6FA 2FATH 1Q9OB 3ZHLA 3S5LG 4ORZC 3PWLB 3V4VH 4GKNB 3ALWA 2R56L 4RWYL 5ACZB 1FN4B 3H6JA 2BFVL 3NFSL 3BVNB 1RURH 2E5EA 1EHAA 3DRTB 2ZNXA 4JFOA 2PO6C 2XPGA 3VFVB 3GHEL 2IADA 1BF2A 2IPUG 1QPPA 4TNWK 3WXVH 3GEWB 4Y19D 4O4YL 2UZXB 3C08H 3MNZB 2C3XA 4LEXH 3EDEA 4ONFL 4HH9B 4PJ7A 1GGTA 3S7GA 3MV8B 4RFOH 5D1XA 1P84J 1X5IA 2O61B 4LU5L 2PW2B 3TO4B 1E6OL 3MUY1 5M94B 1OCWH 4MCYA 2CJUL 4CDHA 2AJXL 2ORBH 2N7AA 5E6ZA 3MV7D 3T4YA 1CDYA 4JPVL 3D5OF 3WN5B 1ORQA 3NGBC 4NQDB 4NQCE 3RL1A 3QHZL 4QRRD 2XY1A 3D3VD 5JIKA 3O3DB 2BNRE 2NXZC 4DVBA 2JCCE 2J1KA 1QOKA 5SWZE 3A67L 1NFDF 4Y8AA 3LB6D 1UWXK 5JR1H 5HYQA 3DO3A 1IQDA 2WINA 1J5OL 5BQ7A 2ZCHH 4GLRH 4HS8H 5I73B 4H88L 1WF5A 5E6IA 3H2WA 3WFCL 2GK2A 2A77H 3TF7C 1DUZB 2HN7B 2HWZL 3O41B 3VRLF 3SOBH 1ZGLM 3JWDC 5TDOB 1S9YB 2IF7A 4PR5B 4PRNB 1JNLH 4DGVH 5ADOL 3O6FA 2X1XR 3RZCA 1MCBA 1SEQL 4IDLA 4U1MB 1U8LA 3L5IA 3QFJE 1XF5A 5HPMA 5IJKA 3KWWB 3PGCA 3L7EB 4LCCB 3PDDA 5IKCB 4UTBH 2CDGB 3R8QA 1K5NA 1YY8A 3LRSB 4HIJB 1FCCA 4J4PA 3O4LA 3QJFB 3S4SB 5I1LB 4AYFA 4RGNE 1YEIL 2XTJE 4AMKH 3F58L 3GSWB 5CJ8A 1U8IA 2YWYA 5E9DD 3RY4A 4D0CA 3L3KA 3BKML 3QCVL 5KOMC 3FN9A 2FX7H 3MA9H 3DPBA 2E27H 1XIWB 1OAKL 1S7XA 3BEWB 3QUYA 4P4RB 5C86A 1EAPB 3C8KA 3WXWH 1QFWM 1YEJH 3EOYG 3MJ9H 2NXYD 3N1MC 1A2YA 5D5ME 1QG3A 2DWDA 4LSTH 4Q74A 3HAEH 3CX5J 5E8NB 1R3KB 3KHQA 4FQ1H 1PYWB 1OARL 4U1SB 3TVMC 1RZIB 4CGTA 2ED7A 4OCXH 1LQSR 4BK4A 3KPNB 4RMWA 1N3NB 1U0QA 5F72S 1CT8B 4HWEL 1MHCB 3QG7H 4JY5L 1KCSL 4JE4B 4QRUA 4EI5D 1R0AL 1OSPH 3WLBB 1HEZB 3O6FC 2QLVB 2D31B 4XPAL 3P9LA 5EULV 1LP9B 4S11A 3RWHA 2GITA 2OZ4H 5IJKC 1MPAH 4HZLB 4P5MA 4L29B 4FQ2L 1QLRA 5C07B 4DAGH 3GMNB 1GZPB 3X14B 4ELMA 5FB8B 1U58A 2FZ3B 4OV5B 4J4PC 3VXTB 3P4LA 5C9KA 5E1AA 3RP1A 5DZLA 3CLEH 4NN5B 4RIRB 1AQDA 4FXKB 2CKBA 3WUWB 1F3DJ 2WSKA 1G6RH 1EGJH 1XR9A 3MJGX 1VADA 3P4NA 4S0TD 2E9WA 2CO6B 1N8ZA 1OTTD 4PV9B 5IQ9A 2R69H 1F6AA 4D9QD 4OUUA 3I3BA 2E9JA 1MNUL 1SJHA 3D25B 5F7EL 1JWUA 4JO2L 2O5YL 2VXUH 2X70B 1EEYB 5D71L 3JV4B 5C8JB 1I7TB 2C5DC 4JFQB 4GRLB 3QIUC 1CFSA 3DX8A 4RFNB 5EU4B 4R4BB 4GSDH 1CD9B 5F1OB 1BQHB 4A6YL 1GGYA 2AXJA 3LB6C 1NQBA 2DQTH 5IK3B 3DVNA 3W81A 3V6ZB 2C3GA 4RFEA 4CJ1A 1NKOA 4PRPB 3OAYK 4HD9A 3L95A 1JGDB 1EXUB 1H3PL 3FO1B 2R0LL 4LRNH 3P4OB 4P59H 3O2DA 4PJBA 3MRLB 5HYSB 5CEZL 3LN5B 4JY4A 4Q9QH 4DK3A 5CSBA 4QY8B 4Y4FD 1PVHA 2YN5A 1XH3B 1H9VA 3FO9A 4PGCB 3BW9A 4HLZG 3UJJH 3MRJA 2EKSB 4M48H 3TZVB 4N8VA 4D0BA 4MAYD 1I1AB 3OR6B 4S1DD 1A3RL 4WEMB 4PRHA 1U3JA 1R3LA 4LHQB 1M05A 5KS9B 1WT5A 5B39B 4UBDC 3UZVB 1RAMA 6FABL 4U1GB 3OKYA 3QDMD 5EZOH 4NRZA 4YE4H 3ES6B 5I19L 3F7YB 4H0HB 3VWJA 3SE4A 2Q8BH 3VW3H 2ITCB 2NXYC 2D0GA 4W4OA 1LK2B 1OF2B 3ARFB 4F15C 4GRWF 1TTGA 4BFIA 4FZ8L 3OL2A 1S8DA 3U0WH 1P4LA 4ZG1A 2YOCA 1BVKA 3B8SA 3NABH 4Y4KA 2Q20A 1YMHB 1VHPA 3GO1H 2OK0H 3MBXL 5B8CB 5EC1A 1DSFL 4Z7OE 2DL2A 2JB5L 3BT2H 1KIRA 3UTTD 5HDQL 3FFCD 1N4XH 1QR1A 8CGTA 2FJFA 3SQOH 3QPXH 3GJFK 4EI6B 3MUGB 4K3DH 3TN0B 3OF6A 1T6WA 3RWJA 4PJ7F 1NAMH 5TFSH 3BOVA 4KK6D 4TTDD 3X11A 4PJEE 5JUEH 3NPSB 3QDJB 4FFWD 4JM4H 3QI9A 1WBYA 4DGIH 1ITBB 2Z31A 4GKOA 1MFEL 5EH1A 4X9HA 3EYVA 3GB7B 3CLFL 4PGEA 5GZOD 1FNHA 2GK0A 1T3FA 4LAQH 1BJMA 3VXPA 1WT5C 4KZDL 3DUSA 3V79C 1KXTB 5E7BA 2JE8A 4DW2L 2B5IB 3L7FB 4Y1AD 4ZFGH 4OZ4A 1U93A 5IVXE 2VXTH 1OTTC 1RIUL 1KPUB 2XRAL 2LU7A 3KPLB 3AXLB 5C09A 3VWJC 1A6UH 3THML 3KPQA 3ROLA 4TUJA 5LXGH 4NDMA 3BEVA 3H9SA 5AAMA 4C59B 3RWDB 1R24B 1T22A 4Y7MA 5GRVK 1T20A 3BH9B 4XH2B 1YEFH 2I9LB 1HI6A 4R2GD 5TE7L 3V52L 4P9HH 4Y4KC 4OIIL 4X6CA 5H35A 4KI5E 2FL5B 4FG6D 1MAML 5EA0H 4HS6B 3KG5A 5ESAA 5J11C 5IT2L 4M1DL 4I3GA 4PJ8A 1N2RA 4G8IB 4MXQD 1L6XA 3N85H 3ZDZF 1FDLH 2L4OA 4BH8B 5IMMB 4MCZB 1WSST 3FAXA 3SE8H 1CLCA 1KCRL 3ZTJG 1G9EA 3EBAA 2D7MA 4LARH 5I6XB 3O9WA 1NCUA 4IJ3B 3JTSB 4DUWA 4PP2A 3TYGL 1LP9E 1K4DA 3GHBL 1A02N 3BUYA 3HNSL 4DZBA 2DM4A 2H1PL 5JIPA 3JTTB 4LCUA 4WI5A 2Z31C 2ENSA 4BUHA 4OM1L 2ADIB 2W1NA 4FS0A 5IHBA 5IB3A 3IFLH 4HT1H 1OL0A 4FQCH 5L2KB 4G5ZH 1Z5LA 5IHZB 3VFUA 2CH8A 1NDMB 1RJCA 4NKQB 1A7QL 4HK0B 1EBPA 1U8PB 5IMLA 1F2XK 3GBLA 3VGGA 4S1QL 4N9GA 3V5KB 3MFGB 3D85B 1UEMA 1EJOH 5EZIL 1OD9A 4X7DC 5LBSL 2IG2L 1E27B 1IC1A 5HYJE 3S37X 4N0UE 3QJHA 3RKPA 3MZTA 5TJWK 4AQ1B 1OT1A 2DQEH 3G9VA 3IKCA 3JV0A 1HOCA 4R26H 4PLJD 2X4PA 3FN0H 4L9LB 5D1ZD 2AI0L 4MA3A 1NBZB 2Q86A 4R6UA 1E4WH 4EIZC 1KJ2B 4OBSA 3NIGE 1LMKA 3BZEB 1G1CA 4PRPE 2XG4A 4G6ML 1GAFH 2VDML 5K59E 3B9VA 3C2AH 1WICA 5MP6H 3HNTL 2VXVH 1O7SA 2I27N 4MB4A 3QUZB 3V0WH 4AY0A 1MUJA 3QFDB 1ETZA 3LKQB 4H1LG 5FA3B 1AC6A 4TUOA 2R4RL 4KK6C 4AENA 2BNUA 4HFWA 4TTDC 1INDL 1QHOA 4FFWC 5F9AC 3ZT5A 4NQCA 5IV2A 3WNKA 1DDHA 3W11D 5CIPA 2BNRA 1Z3GL 3ARSA 1P84K 2JCCA 1FZJB 5ICXA 5SWZA 3P77A 5DC0A 4N5UA 2X9XA 4HQQH 3WEXA 1IJ9A 5DJYB 5GRZA 1FHGA 3SPVB 2PYFB 5KS9E 4XP4L 1Z9SA 3GSNB 1I8MA 1KYOJ 1ORSA 3C87A 4I0PB 2RHEA 2YD1A 5AZEH 4OZGE 1X5GA 4XI5C 2NY0D 3QNYB 1IEBA 1YDPA 5L2JB 3QA3B 1M6OB 5BMFL 4M7LH 2ICWI 4OLXL 1HIML 5DUMH 3IS0X 3QFJA 4ZPTA 4JJHA 4Y5YB 4PJBF 4R96B 4R2GC 4U1IA 4FABL 4Y4HB 3SJVE 2FEDD 5FECA 3RTQD 2OXGA 4P4KA 5DURB 2M2DA 1UKQA 5IOPB 2FLBT 2OSLA 1ADQA 3PGFL 5GXBB 3FTGA 3E1F1 1EHLL 4G42A 5EO9B 4MXQC 2JJWA 4HFUH 4KRPD 2MPAH 2NY7L 2NMSA 1E6JH 4JHAL 3DXAD 5EOQH 3CC5B 4O58H 4TSAL 1CQKA 4B7LA 3K4ZA 1PD6A 3F5WB 3SDXF 3UC0H 4AL8L 4GBXB 1EZVY 2FIKA 5DVMA 3PWPE 3QO0B 3RWEB 2ESVD 3AMLA 5CBAA 5EWIH 3K80A 2BSED 1JBJA 4PREA 1OTUC 4PJAE 1NMAL 5D5MA 1DQLL 2F74B 5DRZB 2ZG1A 1T1WA 1AP2B 3NCBB 1J88A 4GXVH 1NUGA 3OKDA 5K9QI 4NQSA 2CK0L 2FBJH 4X5WA 4QEGA 2QHLA 1KNOB 4FQQA 3O3EA 3D18B 1AGBB 2H3NA 5GQBA 3G6DL 4OZHB 4PLOB 3MLUH 5F6IB 4I2XB 2HKFH 4ZOCA 5E5MA 1AQKH 1UEYA 3ARDA 1B4JH 1HQRA 2YA0A 2CR6A 3D2UA 1OD7A 1UB6B 1C1EL 2DWEB 1VACB 5E8OB 4WEBH 3HI6H 1C16A 4J3VA 3D9AL 4PLJC 1NGXB 3FCTB 4U1HB 1TTFA 2R0KH 1I9RH 1G9NH 4L8CA 5AUMA 2DQFA 4J3OC 4K7PX 1VFBA 1X5XA 5ILTH 2DQIL 4RGNC 1JF1B 3PABA 3MRKA 3MV8D 1P1ZA 4X6EA 5SWQB 4QHLB 3MLXL 3TNMA 4KRMB 1OB1B 3QXUA 3TO4D 4HDIB 3CSBA 4YHIA 2IBBA 1O5DT 4WJ5B 5ICYA 1HILA 3DIFA 4IMLA 4HV8A 3GRWL 1H3XA 4TVPL 4BKLA 1IGYB 2DIAA 2VAAA 4KUCD 1NGZB 3WSQH 3QZWG 4MLIA 3SO3B 4NQDD 2YXMA 1KPRB 4GQ9H 1KCKA 5DWUH 5DLML 5DEFB 4PJFE 4M7ZB 3O8XB 5JLZB 1D7FA 4MDJB 4P9MH 1I9IH 4F57L 1CDUA 1HNFA 2P1YA 3U0TA 2YHGA 4ETYA 4XPFH 2EH7H 3M1BA 4XNMA 1U8KB 5ALBH 4N8PA 2YSSB 2O5XL 5FHAL 4J12A 4WI6A 2YC1A 3D39D 1INEL 1S7SB 2IQ9H 4I5BA 4NIKB 2DB8A 3WDIA 5I75B 5F97E 5GGTH 4S1RL 3PJSB 5TQ0H 1II4E 1FN4A 3ARDC 4ZYKB 3D0VB 1FLRL 4H5SA 1MVUB 1A7OH 3RWCB 2VLME 3VFVA 3VRJB 5FYLL 5F89A 4PUBH 1I3UA 3WD5L 2FHCA 3STLB 3EIFA 3RTQC 4M6MH 1U36A 1XFPA 4K3HA 3RKDD 1FCGA 4A6YB 2CK2A 3AFLA 2J12B 3HC0B 2AJSH 3SGKA 1IZJA 2O61A 4KRPC 1IC7H 3SKNA 3I02A 2GI7A 3C5ZA 3CFIC 4F8TA 3SO5A 1J10A 2VDNL 3RWFB 5I15H 1EPFA 5HHVL 3RL2B 2VZVA 4ZO6A 4LVHB 3UJTL 2CSPA 4P2YA 5IEKB 1KCVL 3MV9B 1QR4A 2VN7A 4B7IA 3L9RB 4DUVA 4YHKH 4HBCL 4KI5D 3K46A 1DEEB 4KMLB 4RMTA 5F9DC 4E41B 1OVZA 1HNGA 4O5LL 3AREB 1TJIL 2AK4B 1NCBH 4HK3N 1Z9LA 1DVFA 2HN7A 1CK0L 2AW2A 5CZKA 3G5VA 1G0DA 2WLZA 4RZCA 4I3RL 4PJEA 4CW1B 2ZSVB 3L7EA 2AJ3B 3QHFH 5C07D 1LDPL 5IKCA 1KIQB 3LRSA 4HIJA 4JZOB 1FO0B 3DVIA 5I30L 1BOYA 3F8UB 3OXSB 2IAMA 3ARVA 3QJFA 4CJ0A 3PQYE 1J1OL 4LQFH 1Q9KB 3CFJA 1FGVH 3CDGB 3QO1A 4G8EA 1ED3B 3TO4C 1QVOA 5CGYD 4XNZB 1E4XH 5IVXA 2JCCF 2P8PB 1TETL 1A5FL 1FVCA 1XIWA 1J1PH 4O9HL 4QKXB 1CZ8L 3BEWA 2AJUH 2DKMA 1EAPA 4JN2B 3KS0H 1T03L 1ZHNB 3WN5C 2C7UA 4OFDA 1QPXA 5C0RL 3BP7A 4GRLD 1R3KA 4HIIA 2NW3B 4PB0H 2V7NA 4NNYA 4U1SA 2CRYA 4YDVB 5D6DC 4PS4H 4TSCL 2XT1B 1VCAA 3ALPA 4YQXH 5I8KH 1MEXL 3EYFB 1DUYB 4HCRA 1C12A 4KQ3H 5I73C 3MJ8B 1KLUB 1U8MB 4ZDHA 3UTZB 3BP5B 1AXIB 4OZHE 3DARA 4I18A 1MHCA 5EZJA 3LS5H 2F8XC 4XXCA 3ZZ1A 4LCWD 3RI5K 5C92A 2EICA 4G6JL 2D31A 1H3UA 5LJYH 4A2MA 1LP9A 1HHIA 3UTSB 2AJYH 4LSUL 2PW1A 1H8NA 4DGYL 2EDQA 1PY4A 4LCCC 3VD9A 1FRGL 5L8KB 3X14A 4XX1E 4XWGH 1EERB 1NAKL 3SDCB 4LBEB 3X3FL 3CMOH 3RKDC 2APVA 3HG1D 3QEHB 1MY7A 4Z7WB 2I26N 2GJ6B 3ARGA 5D5MF 1HYSD 4EN3D 4G8FB 3KYKL 4RIRA 1SBBA 1MJ7L 3O81A 5D96B 3V8OA 3LQAH 5CLWA 3V6FB 1XIWC 5AG8A 3UYRL 4JKMA 3WUZA 4AEFA 4F58L 2IBZY 1E4KA 3ULVL 3CPLB 3D25A 1LEGB 2VSDA 5HYJA 5ESVB 3KPRE 5C8JA 4N0UA 3ARFD 4OBRA 1EK3A 4WFGD 5IMKB 2V7HA 4J8RB 1ZLUH 1MFDH 5E99L 2XWBB 1KJ2H 4KI5C 5F7NC 1ZEAH 5C08B 3D0LA 2BHZA 2Q76A 3TESA 3O3BB 2GFBB 4X99A 3V6ZA 3UBXA 4ENED 5BRZB 1UZ8B 2VJXA 4PRPA 4JLRB 2A38A 2DQGL 4ODUA 1NMBL 1R3JB 4PRID 2BFVH 1J12A 3U83A 4XXCC 3M17B 3TN0D 1B3JA 1MCWM 1S7UA 1G7QA 3IYLW 4QY8A 2ERJB 5I17B 4HG4J 1OSZB 4JREB 3GHEH 4RDQF 3HLAB 1NDGA 2K9UA 2MFNA 3QDJD 5CP7B 4TRPL 3TZVA 4O4YH 4KAQL 4ZQKB 1VEMA 3TPKA 3RWIB 2A9ML 1I1AA 3OR6A 2R8SL 4ONFH 1OAUL 2OJEA 4PJ9A 5DRNA 3GSNH 2ZUTA 2DD8L 2MQCA 3U36B 1DBJL 2CDEB 4KJPD 4LU5H 4R3SA 1E6OH 3VGFA 3SKMA 3BRGC 4NN5C 2AJXH 5D7LB 4M7KL 1G9NC 1EH9A 5CGYC 1A9EB 1TZGH 5MEOA 4F7TB 4JPVH 2GW5A 2EDXA 3W9EB 4OZGA 1YEGL 3QHZH 2DQJL 1KB5A 2P8LB 4LKCB 5BS0B 2ITCA 3DV6B 3N1QC 1Y6KR 1JWSA 2BY0A 4NSKA 3O3AB 3MV9E 5FXCH 3WFEL 3ZSSA 1DLHB 4GRLC 1GC1L 3A67H 4RFNC 4I0CC 5FV1L 3SJVA 1UG9A 4OI9A 1J5OH 3FOLB 1KYOK 4HSQA 4LPYA 2NTFB 2EDDA 4H88H 3WFCH 3PL6B 4F7EA 1DZBA 2HWZH 2VL5B 4WFHD 1P4IL 5ADOH 3WFDL 5F7UA 2AK4E 3D69B 3HR5A 1SEQH 4MA7L 5KZCB 1JGEB 4PJ5B 2DM2A 3SDDD 4LLUB 2ADGB 3I85A 4QLRA 3PWPA 4QHUA 2RR3A 2BOCA 2V2XB 2VUOA 1HZHL 2GKIA 1KJMB 1MH5B 4PJAA 3T0AA 3X3GL 2CUHA 3TZVC 4YDKL 1IGJA 3LZFL 1I1AC 2NY3B 2VXQH 1NGPL 1KB9K 1RJYB 5IW1B 1N6QL 5J1TC 1YEIH 3F58H 4LVNB 4U7SA 4YBLC 3BKMH 3I6GA 1HYSC 2MMXA 3KYMA 1J05A 1GIGL 5L2KD 4PJCB 5CWSB 1OAKH 5D7SL 5JORB 1HH6A 4U1GC 3BZ4A 5DMKB 1T89A 1TZIA 3DURB 1IAOA 3F12B 3BZDA 3FB8B 2XWJB 4EJ1C 3DX7B 2X6MA 1KN2L 4LQ1A 5KSAB 4Z7OF 3IDIA 1OARH 1PG7X 3FO2A 1JZ3A 4S2SB 3ARFC 1B90A 3L5XL 4GO6B 1YNTB 2FSEA 4K94L 4XVJL 3SE9L 5D4QA 4PJEF 4ENEC 4HWEH 5B8CC 3TV3H 3VRIB 4JY5H 1KCSH 4OZFG 2W0KA 1JI1A 3QIWA 1R0AH 4JM2B 4BH8A 4MZ3A 2EYRB 4XPAH 4X7SL 5F3BB 3TN0C 1N64L 1M7IB 5B3JE 4FQ2H 2OQJB 3JTSA 2W9EL 3UTSE 3NPSC 3VFTB 3KPPA 2VC2L 1MCKA 5IVXF 3JTTA 4HMCA 3DO7B 1RY7B 4PJFA 1N0LA 4IOIA 2RFXB 3KGRA 2ADIA 3C9NB 4KJPC 1IEAB 43CAA 3U30B 3WHE1 1WWCA 2AEPL 1S3KL 4GKZA 3NMEA 1U2HA 2ZUVA 5IBUB 2AK1L 1H3TA 2BHYA 4I0PD 3BXNB 1MNUH 1U8PA 5F7EH 4JO2H 2O5YH 1TTUA 1GGUA 5D71H 4AIZA 1OP5K 5DUPH 3IETB 3D85A 4AEIH 4N5ED 3CH1B 4FP8L 4OB5L 3ZKXB 4ZD3L 4LGRB 2XA8L 4Y2DD 5DS8A 3UTQB 5IVOA 1I1CA 4A6YH 3UX9B 4GG6B 1MCWW 4JDZB 4Y4HD 3L3GA 4WHDA 1ZT7B 1FH5L 4ZS7H 5C08E 1LP9F 1QEWB 5DURD 4YFLI 3RNQB 1I7RA 4CU7A 4Z6AT 1RUKH 1NBZA 1H3PH 2R0LH 1QBLL 1V7ML 3ARTA 5BRZE 1I7UB 1A6VL 2IH1A 2A1WL 2R39A 3G5ZA 3PWUA 5DUBB 2V9QA 4OFIA 3IDGB 1ZVSA 4G9DA 1ZLSL 3QUZA 3PP3H 1ZAGA 2NR6D 3QFDA 2XWTB 3V0VB 3LKQA 5I6XC 4GBXD 1HSBA 4B50A 4IJ3C 4JG1L 4A2LA 4UT7L 3RUGA 2XQBL 3HZYA 5F70A 4LHUG 1A3RH 5DSCB 5HDBE 1JZ7A