4JFZH

Structure of phosphoserine (psab) scaffold bound to pser peptide
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
223
structure length
223
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMSWVRQAPGKGLEWVASIATGGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRGYSSTSYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nature-inspired design of motif-specific antibody scaffolds.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Fab light chain
total genus 40
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 2013-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jfzH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jfzH01
5B38G 4RNRB 3ULVF 4NFDA 4Y88A 1WZKA 2VDLH 2Z8RA 2HT3C 3TN0A 4FRWA 4UILL 4QCIA 4WW2B 3OAZK 2OMBA 2DKUA 1VFOA 5JHDD 4M7ZB 5GGQH 3ARDD 4XNZB 3BKML 1GSMA 4TULH 1SJHB 1LEIA 4A6YL 2HWZH 4MA7H 1IQWL 3G5ZB 2HFGL 5IR1B 3MNVB 1LEKB 4KDTA 1X5GA 4EQ2A 1DBKL 3GDBA 1P5VA 1ZA3A 3P9MA 2VRAA 4J1UB 1OSZB 2Z4QA 1QFHA 4HWBA 2L7JA 4FQHA 4LRNH 1ORQB 5FYKD 3RWEB 1RFDH 43CAB 1UXSA 5FHAL 2Y07H 3ARDB 3MRPA 4BZYA 3P40A 3SDXE 5GS2H 1W72B 3EHBD 2OR9L 4UUJA 3PWVB 2XXMB 1QHOA 2HVJA 2X40A 4X98B 5LXGH 3P9LA 5CZXD 1QR4A 3GMOA 2P42B 2JJTA 2CK2A 1FL5A 3B5TA 4RISH 2ADGB 1KIPA 4P23D 3IRZA 1BAFL 2BOBA 3QDGA 4RAVB 3CUPA 4NN7C 5JQ6H 3BD4A 4NUGH 1H3PH 4PJ7A 4L4TA 4IRJA 4GG8B 1FP5A 4MDJA 3ULVL 4OFKA 4XB7A 4LLWB 2FSEB 4YXHL 3SE4A 3GI8L 2WNGA 1LK2A 1QKZL 3K81A 3LY6A 3TIDB 4IRSB 3MRIA 1KTLB 3G6DH 3LN5B 2NZ9D 3TJHD 4V2BA 3GI8H 4Y19D 4JFDD 2DBLH 5D1ZD 5I1LB 5DJXB 2NY6C 4JREC 1IKFL 3X3GL 1EDQA 4KROB 2YD8A 4G6FB 5EU4A 1Z0NA 2HKHL 2YA1A 5FFLA 1PAMA 3T65B 3RGVD 2HKHH 1ZMYA 2VXQH 2DN7A 2UZIL 2X1QA 3WL9B 1OPGL 4AMKL 4DAGH 5L2KA 4YHML 4S10A 1QPPA 1Q0XH 3L3OB 3MRBA 4ETQB 3BKCL 5DRXB 1UKQA 5JNYA 2J8UF 2UY6A 4X6FA 4JFOB 4Z0XA 2AJUL 2DQGH 1SYVB 2XN9D 3QUZC 5GGSY 1EHNA 3HHRB 1E4XL 5EBWA 3TBWB 4OQTL 1WWBX 1ZK9A 1FNGA 2WIIB 4LVNB 4MNGA 2AXGB 3C6LD 4FFWC 1CBVL 3KPRE 4PJ5E 3V4VL 4R2GD 3MRRA 4L8SA 2DWDA 4F7MB 1XT5A 1FH5L 3P4NB 5I18H 4FQQB 4MDIB 4D0BA 4FNLL 1BVLA 1BFVH 5E2VL 4LAQH 1FV1A 2KKQA 4XCNA 3V5HA 1FO0A 2NW2A 3BDBA 3UZVB 4AM0B 1A4JB 1A7NH 3HUJA 2Z91B 3GHEL 1AC6A 2H3NA 5F88A 4ONFL 5DK0A 2XQBL 3EOBB 5BJTB 4OF3A 3UTTE 1C16A 2V2TA 2P45B 1BBJB 4G6MH 4ALAH 5F7EL 1UWGH 1I9JH 3V0VB 3QO1B 5F89A 5T1DL 1UG9A 2YK1L 1NLBH 5GISH 3DVNB 4FG6C 3UYRH 3BZDA 4GXVL 1ZVSA 4YUEH 3Q3GB 1IBGH 1WWAX 1AGCB 3SE9L 4GMSH 3O3BA 1JI2A 4V1DE 2QQLL 5F96L 5EDXA 1ZS8A 1P7KB 1Y18B 1D5BB 2B20A 4P2OB 2YC1A 4LP5A 4EOWH 4R4BB 2IPUK 4M02A 3VD9A 3CMOL 1OF2B 5T1LA 2X41A 2AJXH 4OAWA 4RIRB 2BK8A 3OR6A 3GI9H 4NGHL 3ZE0E 4Z78B 4ELMF 4HV8A 1UENA 2Y06L 1WZ1H 4LMQI 4QKXB 5FB8A 1ES0B 5IJVB 1JNHA 4P5TB 3NIDE 1YPZB 3MSPA 4ZFOA 1RIUL 1HCFX 1WZLA 1AI1H 4OLYL 5DJ8A 4ZAKC 4PRID 3VXOA 4DFIA 2A6JA 2CDEA 5D7JC 2E9WA 2LFGA 5I1HL 1CS6A 4HFUL 1KCSH 3QEQD 4F58H 3BHBB 3FL7A 3PV7A 4D9RE 5KG9B 2WINA 4WI2A 1B0RB 2DBJA 1DVFC 4B7IA 4KWUA 3CXDL 4GBXC 1H15B 4G7YL 4EBQH 1SEQL 3VFVB 5FGBA 3WDJA 3BDXA 3EO0A 1ORSB 4WW1B 3WIHA 4J4PD 5GSVB 4P4KD 1YYLH 1B88A 4FFZL 1S78C 3QDJE 2D7QA 4UQ3A 4C4KT 4OGAC 2YS4A 3UDWC 4MQTB 4LPCA 4A2LA 5CCKH 3SKMA 3CFEA 1OD9A 3G5VA 2D03H 5IF0A 5CCKL 2BERA 1RULH 5FXCH 3SCMD 1N4XH 2VLLB 4FQJL 4PJCA 2YD9A 3ARSA 5CUSH 1E28A 3FFDB 4HAFA 1SY6H 4IOSD 4PD4J 5D6CA 1CLOH 4MJ5A 2VXQL 1WQVT 5KZCB 5GS0C 3VFTA 2FGZA 4JO1L 3E6FA 3EYVB 4OIBA 4NZUL 2J4WL 1SM3H 1I1YB 3QNYA 3VXTA 3JV4A 2DQEH 2A73B 5GGSA 3IU4H 2JIXA 4L8BB 4Y1AB 2AJ3A 2HJKA 2W91A 1FFPA 3HI5H 1OD7A 5C0CE 4OQTA 3EO9L 5B4MD 2B1HL 4MQ7B 3ARPA 3OXSA 3DRTA 1YNKL 1XF4A 1GL4B 1TDQA 1YUHB 4OZ4A 1IM3A 1A14L 4OCRL 3VWKB 2R4SH 4HQQL 4PJAF 3SPVB 1RVFL 1T83A 2VTFA 4L8DB 1RVFH 2GJ6E 5D1QB 4Y1AD 5MENB 3GMNB 4XNMB 2X89A 5IP4A 2VXSL 2R1WB 1BECA 1XH3B 4R96A 2XPGA 2RCSH 2DDQL 3GSQA 2W65B 3GRWH 4LHJB 3PGDB 4Z77B 1YQ2A 3GRWA 2P5WA 4GS7B 3ZDZF 4I0PD 5KTEH 5HYQB 1A7NL 1SBBA 4JY5H 3ZT6A 2VDPL 4QRPE 1BQLL 5KSUA 2MCG1 5JW5B 2BC4B 4S1RL 1MFEL 1GGUA 1KXQE 1MFEH 4C56A 3REVB 4LSVH 5ADPL 3DXAA 1IM9A 3RIAK 3QA3B 3O3DA 4QY8A 1A6UH 2FZ3B 2EICA 1OP9A 5FKAA 1IGYA 3VXMA 3CX2A 4HWBL 1CICB 3BSZH 1D7FA 1G7MB 3VI4F 4UAOB 2OTWA 4OCMC 4P4KB 4U1KA 4QHNA 4QXWA 1T2QL 1IEHA 2ZUYA 3S4SG 4NQEB 3S3JA 2FJGA 4BQCA 3IKKA 5HHOA 3B83A 5I1EL 4XNQA 2EIZB 2R0KL 4HJJL 3VCLB 3VH8B 3ULUF 1JWUB 3BRDA 4OKVB 4P9HH 3O3UN 4HCRA 5F3BB 4TUKL 1FORH 5DI8B 4MA8H 4WEBL 1BIHA 3BT2L 1R3HA 3C8HA 1G0DA 3X3FL 5C1MB 1CDJA 3PP3K 3WEXB 1KJ2A 4JFFA 3MA9H 4GW4A 3PHOB 4PRIA 3RP1A 3BPCB 4P23C 1N64H 5C0JA 2R0LL 3SGJA 1LHZA 4XP9L 4GAGL 1LO5A 4R4NC 1U8PA 3STZB 5MENE 1MFDH 4CGTA 5C0GB 4E42A 4L3CB 4ZUWA 4APQA 3FB7A 1CQKA 4H20H 2VZ3A 4FTVB 4YDJB 2DIBA 5EU3B 4KJYB 3QG6A 5E8NB 5HYFA 5HYJD 2HTKD 1RZJL 1DQJA 1NSNH 2FX9L 4Z8FH 3L3GB 4AG4H 2ZUSA 5HI3D 4MJID 5IB2B 4Y4KD 4ISVA 4MAYA 5I6XB 3BWAA 5GGUB 5DMGD 1OAXH 1A7RH 3CSGA 1EFXB 1KGCD 2BXYA 2BVUA 1ZHNB 4HKZB 3WO4C 1NCAL 3B9AA 3T0EA 4HK3J 4ZMAT 4HUXA 5LVEA 4YDLC 2AEQH 2MHAB 5DJYA 5IHZB 4RFOH 2ZUXA 5DUPL 1CK0L 3HZMB 1S7QB 3CC5A 3N1MC 5DD1L 4MX7A 4E41E 2EDLA 1KGCE 2D2OA 5HD8C 5J12C 1UH2A 3CDFA 3ZO0A 2XFXB 4FQJH 4HJGA 3EJYC 3OAYK 1TQBB 2CK0H 3QXUA 5CUSL 3O9WC 3TZVD 4QOKD 4JZOB 2EE2A 4QTIH 5C86A 3GK8H 1CI5A 4F9PA 5D93B 5JTWA 4P2QD 3LB6C 1MIEL 3MODH 4PJXB 3GSNA 4KJQC 1CF8H 3U36A 1AH1A 2ZNXA 4UT9L 4L3EA 1DE4A 4JQXC 2MJWA 2ZPKH 4KK9D 4PRDB 5CZVH 5DJ0A 4XNXL 3C6LC 1LVEA 2NY6B 2FHFA 3HE6A 3KS0H 3NACL 3MLVH 4ODVL 3VGAB 1EZVY 1LMKA 1HHGA 3IDUA 4ODVH 3L5XH 1DZBA 3SKNB 3SKJH 4PRBB 4YHNB 5A40E 1UYWL 4H0IA 5SV3A 3BEWA 3JZ7A 4X9IA 2Y7QA 4H25B 4G80B 3KNBB 3HI6H 2V17H 4JZNA 5JO5B 1ZSDA 2Z8SA 5E4EB 1VHPA 2NY1D 3EKCA 4J12A 4PJXE 5DJCA 5FECB 4NO5B 4OLYH 5TQ2H 1IAKA 4I77L 5EO9A 3O3EA 5T1KB 5I15L 4Z7UB 4KXZI 4AEHL 1F2XK 1U58A 2ZCKL 4LHUD 3U9PH 1QBML 1VCAA 1W0WB 2QQKH 4I3SH 3B9KC 2MWCA 3R1GL 3IFPB 1CGVA 1S7XB 4NDMB 2LAAA 4GSDL 1IAIM 5MP6L 1KTKE 4I8DA 1KT2A 3L3KA 3SBWC 4LIQE 3ROLA 3ZTJG 1IGCH 4IDJL 1WWWX 4WI3A 1RHFA 4Q0XL 1G6RL 2FGWL 1FVCA 1E4WL 5EPMA 1YY9D 2MNUA 1H3PL 4YPJA 4MA1B 4CW1B 3V8CA 1CR9H 2OTUB 1OQOA 1DANT 3PWJB 1UWXH 3MUY1 4JFZL 4WU7B 5E9DA 1CR9L 4NUJB 2VAJA 4N0CC 1JYWA 5CJOH 5E4EC 3KYKL 4XPAH 5DJAA 2IAMD 2IPKA 3QI9A 1U91B 5EN2A 3JWDL 1XCQA 1NKRA 4M43L 3LQAH 3WNLA 3LVEA 3CFIC 4TUJB 5E2WH 2OXGA 5IHUL 2GTZA 3RX8A 5I66A 1T66D 2D0GA 3I50H 4XBPB 2P8MB 1MFNA 3UTTB 3RTQA 5F1IB 1QNZH 4PIRF 1PSKH 1QQDA 4P23B 4YDKH 1P69B 3P73B 4JM4L 1HNGA 4FQ2L 3F58H 3MV7D 3OKKB 5JOPE 5KSBB 4LLUA 2NY4B 2NXZC 2AV1B 2GK0A 2HA1A 3MLXH 3GSXA 2V7HA 1JHLL 4FQLH 5EC2B 3RPIA 1UB6B 3BKJH 1N0LA 1P4LB 2HRLA 3TBVA 1HHIB 2GFBA 2F8VA 4X6DF 3BUYB 2VDLL 4PJBA 1YJDL 4X6DB 4WRLA 1IFHH 3GMPB 3HPLA 1CBVH 1MOEA 2I5YH 1G0XA 3BH9B 4ZDHA 1YEFL 3I02B 3VRLF 4X99B 2J2ZA 4UBDC 3ARBC 4YPGB 1KULA 5DSCA 1U3HA 15C8H 4P46A 3O81A 2Q3ZA 4OQ1A 1L9NA 1QFWL 4JGJA 4YK4C 5DD0H 2V9QA 2WANA 2ITDB 3T0ED 1XIWC 3P77A 3V79C 4KKCD 5IKCB 1P1ZA 2E8YA 1Y6KR 4NC1C 4W68A 5FA3A 1CGXA 2F58H 4Y2OA 1LE5A 3M17B 1ZHLA 4ZS7H 3BZ4B 1EO8H 1FE8H 5SWZD 4XNUL 2ITCB 1QLFA 3ZHLA 1UZ8A 3DXAE 4JM2D 4GAJL 4G9FA 4KRMB 3X14B 4QHKI 4WWKD 5ESAB 3MROA 4HIEA 4Z7VB 1KYOK 4JB9L 3D3VD 2D3VA 3EJZD 5INDA 4AT6A 1TIUA 1M7XA 3MUGA 5EC1A 1BVKA 5FM8A 4C83B 1MHPH 4FXLA 4YQXL 3LEXB 1T22B 4Q2ZB 1KELL 4LBEB 4KVCL 5BZDB 5SWQA 1T7XA 3VGAC 4X4YB 3M1BB 4X80H 2LAGB 1FCCA 4X80L 4I4WA 4HWEL 1FFRA 1UCBH 5LJYH 1KCVH 3EO1B 5FK9B 4HKBB 3TH3T 1GZPA 1FBIH 5H35A 5FCUH 1FBIL 3RWCA 2BVYA 4CAGA 4S1SL 5DK2A 2PYEA 1GGCL 3QG7H 3RL1B 3O9WB 4TUKH 2VMFA 1V05A 2AK4B 4PJ8C 3QUMH 4NKQB 2A6DA 2DKMA 3PQYD 3T2PA 4WGWB 1MJ8L 3OV6A 4YR6B 3KAAA 1HHHB 3MOQA 5B22A 2N7AA 1TPXB 3V6FB 4ZFGH 3MRHB 1RUQH 1LDPL 4I0PC 4N8PA 4WDIA 3WHXA 5B39G 4HUWB 2XWJB 4IMKC 4JFDA 1FQ9C 2Z0BA 4ZUUA 1CFTA 2VXVH 1E6OH 2X10A 4KRLB 2WP3T 1D9KD 2HWZL 3LS5H 5TFSH 1KCSL 1IJ9A 7FABH 2VLMD 1QG3A 1D5MA 1DL7H 1KPUA 3SHSA 4M48L 6FABL 3HPJB 3H7BB 3LN9A 1XF3B 4FXGB 5TF1H 3EJJX 4AJ0A 4PJIB 1YMHA 4O00A 4O2CB 1I4FB 5D70H 3DO3A 4Q0XH 2D9CA 5MEOB 2JJVA 1U42A 3MACL 4P3CL 3AU1A 2CIKA 2O5ZL 2B4CL 4Q58C 4JZJA 4KJWD 4Y5XB 5I8KH 3MFFA 1K8IA 1CXEA 1WK0A 1HN1A 2YBRB 4D8PB 2AS5M 3K80A 4BSWA 4PJAA 2C9AA 2QSCH 4KI5E 2NY7L 4TPRH 2HN7B 4LIQL 5HPOA 1X5IA 3OQ3B 5D7SL 3NIFF 2AAVA 4JFEB 4J3VA 1F13A 5A43C 1JMZA 4TSBL 4Q9CA 1UA6L 5GS0L 3NCYP 5E9DE 3KJ6L 1CF8L 2XRAH 4BH7B 1M05B 4G8GD 4OZGF 4OCWH 1J87A 4NPYB 4H1LB 5T1MB 5L0QC 3I6KB 1CLYL 2LE9A 4R4ND 2E9IA 3ARRA 3IFNL 1JGVL 4LGPB 3T4AB 1JPSL 3ARDA 1FNLA 3INUL 1TNNA 2IALB 4OZHF 4G6KH 2YXMA 1RZIB 2YPLE 4CU7A 1V8HA 4K07A 4FABL 1N5AB 3Q6FA 4P59H 3GJFB 5EIIB 2DWEA 1F6AA 4L29A 4JG0L 4AL8L 5D96B 4D0CB 3QCUL 3ZKNC 1EVTC 4HIXL 1YNKH 2DJ4A 1WFTA 2NY5C 2UYLB 2AJSL 2B5IC 4R4FH 1WISA 3CUPB 1F11B 4NO3A 3HZYB 4XXCA 3HNSL 4WVRA 5BZWA 1M4KA 3AGVA 4PJ7B 3GMMB 2ZCHL 1CICC 5DUBA 1P2CA 1HZHH 3CFBA 3FRPG 3H9SA 3PP4L 3QH3A 5IFAL 4OV6F 5J3HC 3T04D 5AG8A 3QIWC 4F9LA 5E0QA 2X4UA 4NQUA 4D9LH 4LSQL 1S8DA 2EDFA 4I48A 4JFQB 4YBHA 1N0XH 3WNPA 5FHBH 1LDSA 4PP2A 4U1SA 3TZVC 4Y2DD 4NN5C 1VFAB 4JHAH 4I0KA 4L8CB 3O4OB 3TNMA 1FPTL 4PJEE 5EU4B 1INEL 2X4TB 1CLZH 4KV5F 4XTRD 3OHXB 3TH4T 4AH2B 2WLZA 4LSSL 1AE6H 2FL5B 5IJKA 4FFWD 3ZDYE 3S8WA 4LMQE 2XZAL 4DUXA 3BZFB 4L9DA 1UWXK 2O61A 2ICWI 5GZOD 4ETQA 5F1OB 1L7IL 2CRMA 2IFFH 5JNYB 5E6IA 1D5XA 2YSSA 1QD0A 3MRKA 8FABB 4PRAA 3HB3D 2WUCH 3VFGL 3T3PF 5J4MA 1AD0A 5IBLD 1JPFB 3ZSSA 1XEDA 4WJ5A 1UXWA 2D4FA 1A22B 5EO1A 3JTTB 2P43B 2WIIA 4HLZH 5GGRY 1XGTB 3MLRL 2DJUA 5KS9A 1NC4B 5EUKA 2DWDB 1QRNA 4OZHB 1BX2A 5DYOB 1U8NB 1MNUL 3U1SL 1HDMB 1Y6NR 4QRSA 4MDIA 4D0BB 2E8ZA 1BWWA 4AEEA 1NGYB 4Q7DA 4OCXH 4JQIH 5EO0A 2IBGA 4UT7L 3RY6A 1CXIA 4MYWB 3Q5TA 1OP3H 1UACL 4A6YH 4YX2L 1P84K 1MJ7H 1F3JB 2W0PA 5C7XH 2ID5A 4NT6B 4TVPL 4P3WA 5IEHB 4HX1A 2XNAA 5EZIH 4I3GA 3DTXB 4YAQB 4UT6H 3QNZB 1LQSR 5BV7C 3EDJA 5F88B 3MCLL 4J3XA 3ILPA 3HNVH 1J8HB 4Y5XC 2X4NA 2A6KA 3BMVA 4FHBD 1F6LL 4FQ1H 2J8OA 5DGRA 5DVMA 1RJLB 3PHQA 1GRWA 3LEVL 4QRUA 5GIRB 4JFHE 4OD2B 3RZWA 1FAIH 3W81A 1S5HB 1RK0B 4S2SA 2IAMC 1WVZA 5I8KL 5L7XH 1ZVSB 1CD0A 5DUML 1OY3B 4FZ8H 4U6VL 4JRXD 5IMMB 2NZIA 1QSFE 4H0GA 3QFJE 3VG0H 4GXUM 4KRPB 2EZ0C 2FO4B 3RA7L 1S9KC 1NMCB 2HKFL 3TBSA 3CIQA 4ZAKD 5FYKH 1DP0A 3KHOA 5L6YH 4K8RC 5T1LB 5D7IB 2QKIA 1E4JA 2NXZD 4J3WA 3DHJA 3T2OA 3MBEC 2C4FT 3NIDF 5AZEL 4OD1L 1HOCA 1GC1H 4HV8B 3MUZ1 3PWLB 3X13B 2Q3AA 1MCNA 2PYED 4JO3L 3QPQD 1TVBB 4JGMA 2I60L 1M6OB 1KJ3L 2NNAA 5FB8B 1UFUA 5HYJB 1QSVA 1UKSA 2PW2B 4Y4FA 5IJVA 3DYPA 4MNHA 5DRNA 4HGKC 1YPZA 2CIIB 1AR2A 4LCYB 1S78D 2C1PB 5GRZA 4HW6A 5GHWL 1P53A 3C08H 9CGTA 4ONGL 2QSVA 5LKNA 3AREB 5DJ8B 2PN5A 1DBJL 1CFVL 4X7EC 4M1CD 3OKYA 4P3DB 4UMGA 3MOAH 4NKIL 4MD5B 5I8OL 4J6RH 1HCVA 1NGZB 2GQHA 1B0RA 2NLJA 4ZUVA 4XCEA 3SDAC 4GG6F 4G43B 4OKDA 3E8UL 4YHKL 5IM7B 1VADA 3VFVA 1T0NA 2I24N 2VUYA 1C5DA 4PRHA 5DFWH 2G2RB 1OPGH 1P4BL 3BRGC 1Q9KA 4U1GC 3QR2A 2HH0H 3CFJA 1N3NB 2NY2D 4M8VA 4TN9A 4H8WC 1BLNB 4UQ3B 3L3IB 2I9TA 4PV8B 4DOHE 1EGJA 1EEZA 4X0KA 2QJDA 4G6FD 4H8WH 1G84A 5J6GA 2AEPH 3QEQA 4PUBH 1EXUB 3VG9B 3HE7B 3DROB 3FB6B 3O2VH 1PVHA 1INEH 4M6NH 1IZJA 1N2RB 3FFDA 2VZ1A 4NHCH 3PDOA 4M6NL 2NXZB 4L5FH 4PLJC 3FAXA 1S5IL 2BVQB 3QIWB 2NCMA 4CVXA 4TULL 4DFHA 5JUEH 3BESR 4M7KH 1T0PB 2D31A 5JUEL 3VI3F 5CP3H 1N6UA 1MFBL 4OIIH 3CFCH 4KKBC 3JTSB 1FZKB 3BJ91 1KJVA 2DS4A 3WXWL 5I8EA 5D1XD 2J6EL 4XCCL 4QCIB 4JRXB 5E2VH 3KJ4C 5AUMA 2SEBA 1Y0LB 3OBAA 4L8BA 3RWJB 4O58H 1AR1D 1UWEL 1LEIB 3PUCA 1ZOXA 3AAZB 2LQRA 4WW2F 3L5HA 2DM4A 1EO8L 3STLA 4Z5RA 5F1NB 4AQOA 3WNMA 3DRTB 3IJYA 1A6TB 1OTSD 3I75A 3LH2H 4ERSL 3OKLA 2XA8L 3UTSB 3P9MB 2IQAA 2ZKHL 5EOCH 5TDOA 5EBMB 5T1DH 1VFBB 1I7TA 4UI2A 1J86A 1LE9B 2WBWB 1X5HA 5E5MA 5DMJB 4ALAL 5LXGL 1J8KA 1RZFH 2CJUL 2Z4QB 1QYGH 2Y9RT 2Z31A 4FQHB 1YNLL 1HHKB 2LVCA 1SMOA 3MREB 1TZIB 3RUGF 3UBXA 1B4RA 4L8DA 43CAA 4Q9RH 4JANB 3TP4A 4GUPA 3GSQB 4TNWF 1IFHL 1REIA 5HDOA 2VDQL 4GG6B 4PJGF 4PJCF 5AEAA 2XG4A 2I5YL 2P5WB 4HSQA 3PGFL 2P7TB 1T2QH 2QADC 1MCOH 4DGYL 5HXMA 1NEUA 4PRPD 2OL3H 2Q1EA 2IG2H 4E41D 5KSUB 3QJHB 1DBKH 2H2SD 5HHXH 1O0VA 1CG9A 5HHOE 5KS9E 4NQCA 4NQDD 5K59E 3QIBC 2GAZA 2AJYL 2CH8A 4RZCA 5E8OA 4ZOEA 5TE7H 1J9CT 2FZ3A 3V6BR 4KXZH 3H42H 2J8UB 1YZZA 2C26A 1DEEB 1G7IA 4LLQB 4YNYA 5CEXB 5F9WC 3MRIB 2VXTL 4JPVH 1SYSB 3RDTD 5I1LA 1I8IB 5DJXA 5CP3A 2FBJH 2FEEL 3N85L 3B43A 3DSFH 3HR5A 2HP4A 3REWA 1JYVA 3GGWB 5EULV 1XIWA 1DQDH 4RQQA 5DJ2B 3VRIB 1HILB 3RNKA 1DQDL 4OKVA 1PZ5A 3TYGH 1EO5A 5DVKA 3IDXL 1SEBB 5HI3C 4QRRE 3I6LE 2UWEB 5DD3L 3QPXL 5IMKB 1KJ2B 4Q74A 4JFFB 4GW4B 1MHEA 2O26U 4DKFL 1IGML 3KYAA 5I17A 3D39A 2AJVH 1LO5B 1EPFA 2AEQL 4U6XB 4R97B 4QRRD 5FYKU 2NY7H 4WENB 4IOIB 4N1CA 5EBWB 4LIQH 2BVPA 4XP1L 5GJSL 3QUYC 3FB7B 3QDJD 2ATPA 2C4XA 1FNGB 1H3VA 4MNGB 3KYNB 1XCTB 4PJEF 4FFVC 4U1HA 3BJLA 1WCQA 3L3GA 4UILH 5CZXC 3LQMA 5IB2A 3LB6D 5D7JA 2Q86B 3GMRB 3MYZA 3ILQD 5ALCH 4Z7WF 4HG4J 2V7NA 3CXHK 2H2PC 4PJFE 3DGCR 3MRLA 1NDGA 4ZFOL 1LEGB 3F7QA 4JPKH 4CJ1A 4P4RA 5DF0A 1S9WB 1AIFB 4XCFH 5AWNL 1S7QA 4P2RB 3LN4A 4MX7B 1C1EL 4JE4B 1WC7A 2VNCA 3KLAB 5FGCE 3BRFA 4GBXA 5DMIH 4HHAA 4M5ZH 3WUWA 2V9TA 1PG7H 3MV7A 3PV6B 5DD5L 4PTTA 5BVPL 2R4SL 3LSOA 2JB6B 3MQIA 3Q48A 1KCUH 4K8RH 5FYLE 3UTZB 2AKRA 2NX5B 5C0CD 4YDVB 1VPOL 3ZYIA 4GRWH 3MLSH 3W9EB 4J8RA 2FIKB 3MV8D 4LLDB 1EUTA 3B6SA 4L3EB 5E5RB 1WICA 2OSLA 3NFNB 3H0TB 5JR1L 1RK1B 3ARFD 4MMZC 2B1AH 1S7UA 3HE6B 3CDYA 4O51A 1AXIB 2PXYD 4PJAE 2CLZB 1S9YA 1OGAD 1JUFA 2IQ9L 3ZE0F 5CBEB 4JM2F 1DN0B 5HDQH 2EDDA 3MLWL 1T83C 4M4RA 3BIBX 4JZNB 3FO9A 5JO5A 1ZSDB 4YEFA 2F15A 2ZUQC 4YXHH 5IG7A 3QIUA 4NZRH 4XBEL 4NO5A 3UTQB 1HXMA 1ZLUK 4C59B 4AEIL 1IAKB 1ES0A 1OAQH 4A6YA 2PCPA 1ZT7B 5E2TL 1W0WA 1JPTL 3FT4B 4ZFOB 2W0KA 3H3KA 2C5DC 3MZGB 4OUUA 4XH2B 3RWFA 3OB8A 5E6IC 4OFDA 4HS6A 1MCPH 4HKJA 4JG0H 4NDMA 4Y5VA 3SDXA 3VXOB 3IU3A 5IHBA 5EZOH 2RIKA 2UUDK 3D2UD 3IF1B 3EYSL 3OPZL 4TSAH 1KPVB 1MWAB 3S96B 1R3LB 2WINB 3MR9B 4EXPX 2VDML 4WI6A 5C2UB 4HWUA 4NQED 3ROOB 3RWDA 5H2BB 3PWPB 1JVKA 4LASL 1TETL 4JKPL 3F7VB 4XAKE 5DVNA 5I9QB 5DURB 3UJJH 5M7QA 1CN4A 2HLAB 2VB5A 3VW3H 1N64L 2MPAL 3RL2B 1C7SA 5CIPH 1T1WA 5E2JA 4Y5VC 3QI9B 2RFXB 3UC0L 1OGAB 1QRKA 2V5MA 3FOMB 4XB8A 3UC0H 1INDH 4TUJA 5I1GL 5DEGA 2UVEA 4XBPA 1JBJA 3QISA 3VGHA 2PKDA 5D6CB 5JW3H 4JFHD 3RTQB 3F6LA 3FONA 4MJ5B 3D5OF 4P23A 5T5NG 1S7TB 5IFHH 5I74C 4RMWA 4P9MH 2DQJL 1OVZA 4OLUH 2X9XA 3JV4B 4P49A 1MCSA 3D3VB 2A73A 4FOMA 5DFTA 2CDFA 4K3JH 3LMJL 4X6DA 4PLOB 5D5MF 1DDHA 1FRGH 4WW2C 4JVUA 2G5BB 1A6PA 3HPLB 1F58L 3P2TA 1J1OH 2ENYA 2VXSH 1A1NB 1UEMA 4TNVF 5ACMA 1MY5A 3L3HB 4EI6A 4YPGA 4JRYB 2VC2H 2HVKA 4KK5D 1TXKA 1UA6H 4GKSB 1D5IL 5D6DA 5IEKA 3U4EB 5GQBA 1INQA 1AP2A 4UT9H 1WZMA 2NPLX 1ACYH 3P77B 4NQSA 4HUKB 1T89A 2XWBB 4RBPK 5FA3B 1I7ZA 4JKKA 1PKOA 1W0VA 4LCWD 5DQDH 5I19L 4R96B 3AS2A 1HKLL 4Z77A 4XHJD 2Y4SA 3HZKB 1NCUA 4P4KC 1UZ8B 3LPWA 4WUUE 1BBDH 4UAOC 1N59A 4LSPL 5HYQA 4JPIA 4U1GB 4CJ0A 4YDLB 1BD2D 1C7TA 2YOCA 2OMNA 2FECL 1U8OB 5INDB 3NFPA 5J6HB 2VZTA 1T5WB 5E1AA 4PGEB 4C83A 4Q2ZA 4U2ZA 4UOW1 5IV2A 5J13B 1QACA 4BSVA 1KC5L 3X11A 3VG9C 3KPMB 3U9PL 4WNQB 3MLSL 3EUUA 2FCBA 4M6OH 4QY8B 3BDYH 3BP7A 4OBRA 3A6BH 3LHPL 2VXVL 5DZOA 4OCSL 2XQYK 5D2NA 2N4IA 1KUMA 4P2OC 5JXEC 3C2SA 1FORL 1XZ0A 4LSQH 4P4KA 3TPUB 4QHNB 2OP4L 1SVCP 3O9WA 3HG1B 2CKNA 1SEQH 3JUYA 1ACZA 3NCMA 4KZEH 2OP4H 5GRVL 1CDIA 1NFIA 5CJBA 3CVHA 5HHOB 2A1WL 4JQXA 4PJ5B 1FPTH 2OK0H 3B9KA 3OMZA 2R1XA 2GCYB 5ILTL 2BNUA 3ARYA 5IGXL 2OZ4A 2OQJB 4WDIB 3WHXB 4OT1L 5L88L 4HUWA 2MKWA 3GO1H 1OLLA 2P5WE 3QULB 4PRIB 4ZUUB 1JZ8A 4U6YA 2VL4A 3A67H 5GPRA 4H1LH 3S35L 1DQML 2CUIA 2Q8BL 5DJDB 2BOCB 5DXWA 2ESVB 3C9NA 5ACLA 2AABH 4UB0L 1F3RB 2LU3A 3SCMC 3E2HB 1G7LA 2P5WD 4DN4H 4LU5H 3T77A 4EN3A 2XY1A 4FTVA 4LU5L 4Z0BH 4PRNA 4HPOL 1T1ZB 3K2UL 4LHUB 1FNHA 1F4XH 1GZQA 2IH1B 1WITA 4LDEB 5T5NF 4U2YA 3HNTL 3MCKA 2CIKB 1EGJL 1H3WM 5LCVL 1EFXA 3QCVH 2XZCH 2Y36H 3S5LA 1BOGB 4YUEL 1A2YA 1MCKA 1K2DA 5BOPA 2EYRA 4HUXB 4DGVL 4XCYB 2MHAA 1YC8A 3ZE1E 3QNXB 3CC5B 25C8H 1MCJA 5SX5H 3DPBA 5C7XL 4BFIB 4X4ZA 3QWOA 1EIBA 3MXWH 4JFED 4W4NA 2XG5A 5I1GH 1BIIB 5LGKA 2BY3A 2K1MA 1PBYA 1ADQH 1BGXL 1JHKL 4PGBB 3ZTNL 2BSRB 3DX8B 1NBYB 4PV9A 3IDNB 1XGQA 1ZHKA 1NC2B 4BH8B 5D8JL 3T4AA 2M1KA 5HJ3B 5ACZB 3QIWD 3EYOA 1MREH 4GKNB 3GFUA 5E99H 2WQ8A 2AEWA 3RY5A 1C5BH 1HHGB 3VXSD 4ZPTA 1G9NL 4WI8A 1C5BL 3T2NH 4X7CC 1YEIL 2VLKA 1IL1A 1RAMA 1NGXA 1KCRL 2H32A 4LKCA 5I1HH 5L8JB 2WWMD 3U0TA 1YY8A 5HHNA 3SDXF 1DBAH 3R0MA 5IWLA 1E4KA 5F7EH 4UIKH 4UV7H 1BWMA 1M7IB 1FIEA 3MRMB 4H25A 4NO3B 4O02L 4M3JA 2N7BA 5SWZE 4EVNB 4YZFF 5A16B 5IQ7L 1FNAA 3H9SB 3MODL 3VXRD 3O3EB 4OD3L 3VFWA 2GITA 1CE1L 4LDLB 1VEPA 2EC9T 5FYKE 1U8IB 2ADIA 4FFZH 1NUDA 4YJZL 3KR3L 4TSCH 1ZLVK 1FLTX 1T03L 1NL0L 4KDWA 1JF1A 3KXFE 1U8HB 5L2JB 2NY2B 3RVUC 1MF2L 1Z3GL 3TN0B 1W72H 4AH2A 4P46C 2VDRL 5C09D 3MRDB 3TFKD 4DN3H 3G5YB 4YFEA 3EGSB 3TF7C 3QO0B 1MLCA 1GGIH 1FVCB 1GPOH 4HF5H 2NYYD 2D9QB 5CD5D 4G5ZH 4HXAL 3MNVA 3UBXG 3CH1B 4W6XB 2X1PA 1NFDB 2UZYB 3I2CL 4G9DA 3VXRB 1NFKA 1AI1L 1ODAA 3MJ7B 3O0RH 5EZLA 5HGHA 3O9WD 5D2LA 3MRKB 4I13B 3DI2B 4YX2H 1CVRA 4JFPA 1C8PA 1JGLL 4FQXA 4MXVF 3C8DA 3JSSA 2GJZB 4OCYH 5BS0A 5JMRA 3V0WL 1OHQA 1XCQB 4ZAKB 5EU6B 1DFBH 3V2AR 4KRPD 2AEPL 1NC4A 4DKEH 5DRZB 1KCLA 3BZEA 4IRZH 4OCNC 1LK3L 5SWSA 1I9RH 4X98A 4PGJA 5DYOA 5J06A 3ZT7A 2R4RH 3C60B 1U8NA 1U92A 3P73A 3HC4H 1RV6X 3U7WL 1RZ7H 2LU7A 2AV1A 1NGYA 4K55A 3RAJH 3CLFL 3DVIA 3RPIB 4QHUB 3WHE0 2D03L 4JM2B 4WIQA 1AO7B 4NZJA 3FRPA 4L4TB 1O5DT 4E0RA 4K8RD 4GG8A 3NTCL 1OM3H 4M5YH 4WCYL 2YUZA 4OJFH 1J8HA 4JZJC 3DBXB 4X99A 4EJ1C 2CXGA 1YEEL 5DRWA 5TPWL 3VXNA 4U05A 1CLYH 3RVVD 3KPRA 3H9HA 5DZNA 4WUUA 4OCWL 3FT2A 1JZ4A 2DAVA 2IADA 1UM6L 5E9DD 4YE4H 4RMSA 5KOVC 2DLIA 1AGDB 3QBTB 1IC1A 1A6WH 3QCTH 5IKCA 4ONGH 1AGEB 2YK1H 3NZ8B 1J8HE 3O4OC 1C1EH 3M17A 3S97C 4PY8J 5L2KB 1ZLUH 3HZVB 3UTPE 3HI6L 3OXRA 4LEXH 4OLWL 1UJ3C 5D5ME 4GFTB 4JFOA 3ULSA 4HIEB 1CXFA 4GS7C 1N5YH 3TJHC 2ZOKB 2YN3A 1HOCB 1HQ4B 4MAUL 2NQCA 2BDNH 2E7LC 1JHKH 5C0RL 4NQTA 1M6OA 4LVOC 4YWGH 4DKAA 5HYJA 3QEHB 5C08E 4QLRA 3M1BA 4OI9A 1BJ1H 2C1PA 4PJFF 3OSKA 2AJUH 4XMKL 4ELMB 5JPMA 3QJFB 5KJRH 3B9EA 4B53A 4LASH 3B9KD 5I75C 2P5EA 4HIHA 4ZO9A 5D7KE 3RZCD 2XOTA 1LP9E 1NPUA 2XKUA 2OXHA 3RKPA 4DZ8B 1FNSH 4FQQA 1BZ7A 4PJ7E 1I8KB 1NGZA 4L4VB 4R0LA 2VXTH 4JFZH 1BVLB 4XP9H 1KEGL 5DD6A 3DYMA 5C0BD 5SV4A 5E08H 2AK4A 4FZEH 2EDBA 2VE6A 3VFPB 4E9LA 5J7CC 1RURL 1YY9C 4HKXA 2FH6A 3KYOB 1EHXA 3CFCL 4QXUH 4AM0A 3UDWA 1G7HB 3HUJB 1U8JB 3A67L 3S35H 4ZNCD 4KVCH 2Z91A 4ZPVA 5I76A 3QEGL 2E27H 1DCLA 1MQKL 4OM1L 5D7LD 1N8ZA 2V2WB 4HEPG 5DK0B 3T4YB 1BLNA 3WJLC 4KY1H 1T2JA 3AM8C 5HI4C 4HG4K 1CFTB 4N9GB 1UT9A 4XI5D 2W1NA 4FA8A 4Z7OE 3QEQB 1RZGA 1RSFA 4ZFFB 5D7LE 1F90H 4NQDB 3FB6A 3QQ9C 3R8BB 5GRWA 3J8F7 3MLRH 4ONFH 4S11A 3TIEA 3TV3L 3F7PC 4FQ2H 3LKNB 3KPQB 1ZS8B 4MA3A 5ICXB 5E2UL 4KC3B 1NGWA 4LSUH 2IH3B 3MNZA 3SE3A 3P11H 4P2OD 1OF2A 4KRNA 5I8EB 4C4KO 4P5MA 4XP4H 2X4PA 1AD9A 2APXA 1HHJA 4NO2B 1YPZE 1RY7B 4MSWA 5BS0D 3NIGE 2B4CC 5LAXA 4JO4L 1J1PH 4X83A 3AAZA 5T3ZH 4JJ5A 1MCBA 3LEYL 5IMOB 1A7QL 1C5CH 1KNOA 3KVQA 3RIFK 4RBPH 3IJYB 1GAFL 3UTSA 5JZ7C 3HCVA 1M05A 5TDOB 2AV7A 1I7TB 4G3YH 2C3VA 4PJIE 5IMLA 3LD8C 5C8JB 1IKFH 3X3GH 3OB0H 1T7WA 3MBXL 4FP8L 4K2UH 2Y07L 4HC1H 1JF6A 1IEBB 3SGJC 1A21A 1NCAH 4JANA 3T0EC 4NM8L 3C09B 2IALA 4LSTL 3KPNB 3QUKB 3SKOB 4IIQB 4N0FB 4GG6A 5DHXB 3QQNA 5CGTA 4UDTA 5L6YL 3L3DA 1DR9A 3Q6FB 2RHEA 3VMOA 1J0ZA 2ZCKH 3IXAB 1NH6A 4OZGA 4L29B 4HGWB 1CL7H 3VD3A 2YMXL 2YRPA 3J7HA 4LSDA 3BD3A 5KANG 3ET9F 3QI9D 3QXDB 2BNRA 4HXBH 3CFEB 3PXJA 1LP9F 2OJZH 1NQBA 3C5JB 3HZYA 1IEAB 3O41A 1NCNA 1AHWC 1JGVH 3HE6C 4XNYL 4Y8AA 4ZSOA 3RNQB 1W8OA 2AJVL 5ESQB 1B6UA 5F7DA 1UJ3B 4CVZA 5EU5B 3AS1A 1U93A 4LPXA 5F97E 2BY2A 4M7LL 5IJKC 5ENWA 4CRPA 3E6FB 3EYVA 4NFCA 1I1YA 4LFHG 1GPOL 4HF5L 3WHE1 5L2KE 3MXVL 3HR5B 5EOCJ 3OHXA 3RGVB 2Q6WB 5FDYA 2H8PA 1A47A 5GGSB 4J4PA 4NBXB 1JYNA 1HILA 3DX6B 3RNKB 3UJIL 3QAZC 3MRJB 1D9KA 1FGNH 1HSBB 1B3JA 2O61B 3C87A 3GMLB 3KJ4B 3BDYL 4LLYB 2GTWA 3OXSB 1H0DA 5TE6L 1BHGA 1IAII 2BY1A 4HWZA 4I9WD 2YD2A 1D5XB 2YSSB 4MA8L 4ODTH 5FYLL 4PRAB 1W2KT 4U6XA 2DQCL 3C8KA 3GUTA 2Z9TA 4HWNA 3FQXA 3FT3A 1MCDA 1AD0B 2F9BT 5TDNB 5CKAA 4H88H 5CILL 3GMNA 1QSEE 4HT1L 3K46A 1G6RB 1XH3A 1CGTA 3MO1A 5F93C 1CDHA 3PGDA 5T1LD 4OFYA 2PXYB 4G9FE 1YN6A 1QBLL 3P4OB 1FH5H 4Z76A 4XWGH 3T0EE 3CMOH 3FAWA 4TVPH 1HDMA 4PJXF 4RGND 1X4YA 5K93A 4RGMC 3CPLA 1J8HD 4KJWC 3RVUD 1MCWM 3GI9L 4NRZB 3X12B 3IDYB 4G8GA 1EO7A 3EDFA 1YEJH 2YKLH 3UZQA 5T33H 4Z7VE 3DUSA 5JDSB 2XQYG 2KH2B 4M5YL 4WCYH 5DC9B 5JA8B 4NO0D 1FZOB 5EU6E 2OM5A 3VD4A 4RGNE 4NT6A 1QSZA 1N7MH 4LRIA 1AXTH 4TTDC 3DXAB 3CLEL 3QA3A 1ZLSL 5KSBE 2A6IA 4H26A 5ELIA 1NBQA 3G08A 5TGBA 3QEUB 1Q9WB 1BM3H 2XQBH 4LLMB 4MHHI 3LQZA 2OI9C 4N0YL 2A6KB 5KVMC 5J56B 4NZRL 2QQQA 4PG2A 3DJ9A 1K4DB 3DI3B 4OD2A 2FH8A 1A3LL 1NBVL 5DTFA 1KELH 5F9WB 4NQEA 5F7NC 5BQ7A 2G75A 1VEOA 2OSLB 5CSBA 1F00I 4F80A 2C7UA 2BNRE 4MJ2A 4O51B 1KN2L 3OZ9L 3BSZL 1FFOB 3MJ9H 1V3LA 3TO2B 2ARWA 1VEMA 1OGTA 5FKPB 1R3HB 2H1PH 2OR8A 2ZUVA 5T3ZL 1ZVHA 4JAMA 4QNPF 2AJXL 3TCXA 4HS8H 4MCYB 2R9HC 5DQJB 1KB5B 1T04A 5KSBF 1GAFH 1MHCA 4Z7WA 5DHYB 1IGTB 5IG7B 1OAUL 2KQNA 3OX8A 3X13A 4W6WB 1OWWA 3UTQA 5C0GA 3ALXA 5F9DC 4X9GA 4TQEL 2J8UE 5HHMB 2HMID 2PW2A 1IC4L 2EIDA 5C0BA 4A6YB 4X7TB 5DRNB 3RDTB 3WFDL 5L7XL 1XAUA 3AFLA 3QG6B 2DQUL 4JFYA 5HHOD 3Q0HA 1G9ML 3WFDH 3RWFB 4XPFL 3B9VA 4HIJA 4YGVA 3DHMA 1F8TL 5I0ZA 5MEPB 4U1LA 4Z7UE 4BUGA 1UH4A 2P8PA 3IF1A 1DBAL 5B38A 1KPVA 3S96A 3WUZA 4X5WA 4MD5A 3WSQL 1IQWH 5A3IC 4XCEB 1NEZB 5JW3L 2DQGL 3DV6A 3NABH 5KVFH 3GM0A 5K9KB 4I18C 3PWPA 1IGMH 1V3JA 4HJGB 5D70L 2EDYA 1ZT1A 3FQNA 5FDWA 2E9BA 3K4AA 5FCUL 2HLAA 5EB9A 1FG9C 3CX5J 4PV8A 3LD8B 2YN5A 2J7LA 4XPTL 2DIAA 5DA0B 1T1WB 4X6EA 1FG2B 1UC6A 5J6GB 2RFXA 4J23A 4NKOB 3QIBA 4JN2A 3HE7A 4KZDL 3WO4B 2AXFB 1DE4B 1GGIL 5I1IH 2DDQH 4N8VA 4ZXBC 4PJIF 1VFUA 5I71B 2VDNH 1W0YT 4CVXB 4N5UA 3LQAL 4P48A 5AYUH 4MNQD 2X9WA 1YDPA 1S7TA 4DEPC 1JWMB 4P2QB 4PD4K 2DM3A 4UIMA 1KJVB 5TQ0H 3QXAB 4NIKB 3ZKSD 5FOBB 3PHSA 3FQTB 5AUMB 4NQXB 3BP4B 4EKXA 43C9A 3QPQC 5JXAL 4XVJL 1DDHB 5FECA 2VN7A 1YEHL 3BQUA 5EUOA 4LDOB 2CDGB 1NAKH 2O5YL 4Z7UA 2HRPL 2ESVE 4K3HA 3STLB 5F1NA 3WFEH 3U9UA 5ADOL 2X4SB 3GBNL 3SDYH 3I75B 1I1AD 3L3HA 2IQAB 5LGHL 1KIRB 4JREB 4J3TA 1EFXD 2IBZY 1LE9A 1YEFH 5IEKB 1WAAF 4XWGL 2Z31B 4WU5B 3HRPA 3S3PA 5D1XB 3ZHDA 5MERA 3MV7E 5CSZA 2KPNA 1HZHL 4GUPB 2IGFL 4HCRH 3T2QA 5BMFH 3WN5C 1H3UA 1R3JB 3B8YA 5DVLA 4DQOH 4XC3L 4PJ8A 4BQ6A 2P7TA 4YBLB 3NAAL 1EAJA 4KZEL 1CLCA 2QEJA 1KSRA 5B21A 2HJFA 1QLEL 4K71B 2MQ3A 1OLZA 1CG9B 5E8EA 5JOFB 1AQDB 2W9LA 3QXWA 4N1EA 3NA4A 1JGUH 4QT5A 4F2MB 2O93L 3UAJD 2O5XH 1YNLH 4WNQA 2A0LC 1XGRA 3GKZA 3BN3B 3GBMH 3NN8B 2JKXA 1GC1C 2GTZB 1XGYH 1MQKH 5CBAA 1OAZH 4XT1C 4YHOL 1QQDB 1BF8A 2P49B 1G7JB 2R23A 2YUXA 1T3FB 1CTNA 5HSFA 3PF2A 3Q1SL 5KAQG 3OKEB 2GK0B 5D1XC 1IILE 2XN9B 5DO2C 3HG1A 4YXKH 3PQYB 5EZOL 5GRUH 2OI9B 5EC2A 1F90L 2ADFL 2XTJE 3REWB 4U1MB 1ZEAL 3H3PL 1ZA6A 2OL3L 1TCRA 4WEMB 3AB0C 4MD0A 4RFOL 3UPRB 1JF5A 5DD1H 3ARED 3VXME 3BE1H 1PLGH 3F58L 2AI0L 3H7LA 2DQTL 5F9OH 3FO2A 2CUMA 1J11A 4O2EB 3IETB 2PTVA 4PY7B 3NOIA 4IRJD 1L0XA 2VWEE 3AVEA 4JRYE 5T3ZE 3RJQB 4EUPB 1MRCH 5I17B 5CD3A 2GEEA 3GSVA 4PJ9A 2KZ1B 3VXRE 1CLOL 5DGQA 2VITB 1EMTL 4M7JL 1I1CA 2R0LH 4P46B 4IOIA 4M7JH 2BVPB 1H9VA 2CMRL 4XZUA 2ZG1A 4WV1A 1IGJB 3SDDC 3NCJH 4IM8A 4PRNB 1S7VB 1R3KB 3HE6D 3VMPA 3V8OA 1J5OH 3KYNA 3DVGB 3TT1H 3WKMH 1YPZF 4XVTH 1CVSC 3NIGF 4YIQA 4O5LL 5HDBF 4NGHH 3WBDA 2M2DA 3WJJC 1QSFD 4UNTA 4X8XA 5F1SA 1IQDB 2DQJH 2H6PB 1N7ML 2J1KA 1PFCA 5FO7A 4S1QL 3IDMA 3QIBD 3EYFB 3H9SE 4P4RB 4XCYA 1T22A 3E2HC 3O2WH 2ORBL 3TVMC 4M00A 5MI0C 5FHAH 2C1OB 5SWQB 1KCUL 1TENA 3KXFA 2V5TA 1JNLH 2FJHA 1OW0C 1MRDH 4TUOB 4HMCA 3NA9H 4P99A 3WDIA 1K5NB 5D7SH 1GZPB 2DLTA 1CTOA 5CIPB 3MTRA 3MV7B 4ODUB 5IBUB 4EXKA 2EH7H 1A8JH 4JM2C 5B39B 2J8HA 1DJSA 2XWTA 4HWEH 5SWZA 1KJ3H 1A0QL 3NFNA 1YYML 1S7UB 3WUWG 2IAMB 4HZLB 1HHHA 4ZPTB 4QHKJ 4PJDB 3OR7B 2A2QT 5CBEA 1NGXB 4LKCB 2DL9A 1NAKL 2O5YH 3H9ZA 4XXCC 2Q8AH 4CNIB 4YXLL 3MRMA 5ID1B 3U2SB 3V5DB 1KENH 2DQHL 1G0YR 1HQRB 4HIXH 3VXQA 3QIUB 3KS0J 4NSKB 4L4VD 1HYSC 2Z8VC 1HXMB 1BD2E 3H7BA 4GW1A 2X1OA 3V7AE 4YFDB 3O0RL 1KOAA 2GITB 2UZIH 2Z92A 4Y2DB 1FN4A 3FT4A 4KI5C 2F74A 3N9GH 3WLBB 2VIRB 2NY5H 3ARVA 1VA9A 3AU1B 3ULVD 4JZJB 4Y5XA 2DIJA 5E7BA 1K8IB 2E3VA 5IQ9B 3G5YA 4PJAB 4Y4FC 2OJZL 4IRZL 3RX5A 3E6HB 2YPLB 3EFDL 3ZL4H 5IGXH 2HFFB 1A6ZB 1FNEA 4GRMB 5C9KA 3OKOA 1M71A 3O4LD 1FDLH 3ROOA 5IW1B 2EH8L 4NC2B 3U79A 3I6GA 3NGBC 5JW4N 3MJ7A 1AHWA 4K3EH 1MFCL 3JWOH 4GRLD 4JFPB 5F72S 4KZDH 5T1KD 4NPYA 5F7MC 4PRPB 5T1MA 2AK1H 3EFFA 5IIEA 1RU9H 4ACPA 1C08A 1D6EB 3FQWA 5T5FH 4XVSH 5CJ5A 4ZUSA 4ZS6D 2FHBA 4ZQKB 1OGAA 1S9VA 4KTDH 4ENEC 5GRUL 5DEGB 5DRZA 2Y23A 3BZEB 4GKZB 1RZIA 2N56A 1BFTA 2IC2A 2XT1B 1BQLH 3VXUA 1EGJH 5DUPH 5HHME 3NCBB 1AY1L 5CGMA 4ELKA 3LH2L 4ERSH 3ILQC 4BYHA 1GGBL 3GEWB 3MLYL 4GAYA 3TT3H 3SO3C 1YJDH 2CK0L 3I85A 5FO9A 5CJXA 2HRPH 1QYGL 5A3ID 3D0VA 5C0EB 5DMIL 4R2GC 5JOPD 4PJGA 4C56E 1EHAA 3GMMA 4OV5B 2EECA 2VLJD 1KN4H 1R24B 2ZOLB 3MXWL 4QOKB 1Q1JH 3BWUC 2NMSA 2X4UB 3DBXA 1QSFA 3DV4A 5DRWB 5SWSD 5JIPA 5T3XL 4KH2A 4OIIL 4DEPB 3TT1L 3WKML 3R8QA 3KPRB 3HNSH 4EI6B 4JRYA 4WUUB 3WNOA 3NPSB 1U0QA 5LQBL 3K1KC 2HJLB 4HAGA 1SQ2N 3ZKXC 4M03A 1ZGLB 1EZVX 2X70A 2NXYD 1RIVL 1KF9B 2F58L 3HZVA 1ZLSH 3MRFB 4NKDB 4KKNA 3ES6B 4GRLB 3RKDD 1T6WA 3ZSTA 3V6ZB 2FYYA 5E6IB 4Z9KB 4IOFD 4FG6D 2YUWA 2ZOKA 5EA0H 3WSQH 1MAKA 2DM7A 2BZDA 4JB9H 3GKWL 5F44A 2ED8A 4HLJA 4PGEA 2ZSVB 5TDPA 4N8CL 3QEHA 5T3ZD 5C0AA 3PNWA 1WT5A 1UM5H 4FMFA 2YPKA 1XGTA 1OTTD 1J7VR 3D3VE 3UO1H 3JVGC 4U0RB 4H1LG 5JPMB 1IARB 3BP7B 1DUYA 3N0PB 3UYOD 3P0YL 3SDCC 2P5EB 4HIHB 3C6SA 1T03H 4P3CH 4IJ3B 5CMAA 4QRSB 2W9EH 5HI5C 5KAQF 2CGRH 2IG2L 3QQ9D 3SE4C 4OF6A 1BZ7B 4F37F 3OKNA 4L4VA 5F7FA 5HGAA 3PGCB 4AZ8A 1NFIB 4NNYA 2BSED 3X3FH 1I3GH 3D18A 1C12A 2DJSA 3B9KB 2XNAB 4G8FB 1IAMA 5B8CB 3QNZA 2XACC 3KPLB 2AW2A 1MJJB 3T4YA 3TH2T 1BEYH 3VWJC 3JVGA 4FS0A 4LCIH 3PHQB 3QFJD 4EI5D 4I0PB 3N9GL 3MRCB 5DJDA 1GJIA 1RZGB 3D2UA 2E5EA 1S5HA 1RZJH 1DQLH 5C07D 2FWOB 3BQUC 3ARBA 1DL7L 2X89D 5TE4H 4JCMA 3T77B 3UAJC 4M93B 2YWYA 3MV8B 1K3IA 2GYSA 4MA3B 2FO4A 5JZ7D 2VXUL 3HA0A 3SBWA 3G6AB 5KVEH 3HI5L 4XMLH 1ZWIA 1Z6JT 4NN6B 3SGEI 1KV3A 1B6DA 2QBWA 2XIDA 1AC0A 1GH7A 2QSCL 3GSNH 4PGZA 4LAJH 2PO6C 1HHJB 1L7TH 3RAJL 3VXPB 1UADC 2EC8A 5E1HB 4MXWH 1A2YB 4KMLB 3NCCB 4JJ5B 1CGYA 1E27A 2BMKB 1HEZB 1ZE3C 3GB7A 4Y4FB 1KNOB 3QUXC 4QO1A 2D7OA 4QTIL 4YHZL 4LCYA 4XC3H 4DN4L 4O58L 5H8DA 3PL6A 1X44A 3TO4D 2BCKA 4LCWA 4HK0B 1LO0H 2C3VB 3ARWA 5I8CA 4ZS7L 2BSRA 1P7QA 3MPCA 4MJ6B 1RHHA 5ISZE 4MS8C 3I9GL 2PO6A 2CKBL 2W60B 2X6MA 1A1OB 1UGNA 2A9MH 2HG5B 3KPNA 3QUKA 3EYOB 4LGSB 4DVBA 4IIQA 4N0FA 3VI4E 5IM7A 1PGRB 4GKNA 4UDTB 1DSFL 4PRHB 5JHDA 3F8UB 4XHJC 1FL6A 1E6JL 3FCTB 1G1CA 3ZE2F 4J6RL 2YRZA 3W11D 1FVEB 4PY8I 2D7NA 5DD5H 1F4WL 2VR9A 2F54A 1U6AL 2QSQA 5EOQH 3WIIH 1NCBL 3IVKB 2WUBH 4NCC1 1DUZB 1MCFA 2B5IB 3S37X 1EXUA 3DROA 3SGKA 3ECBA 2MCPL 1QUNA 4FN0A 5LQBH 2MCPH 3VFWB 1VGEH 4NC0B 3QXVA 1UJ3A 4Z7WE 5FHBL 1ZT4B 5EU5A 3MA9L 4TQEH 1F97A 3BO8B 1MJ8H 5L2JA 1KB9J 1T5XA 3JV6A 3RU8H 5ESVA 3RWGA 4HT1H 3VFRA 3RGVA 1EJ6A 3MRDA 4QWWC 3HC3L 4YHYC 2CMRH 3DX6A 2VZSA 4ORGA 3RWJA 1LO4L 4N90D 4ESKA 5A1AA 2BSSA 2FX8L 3GMLA 3GJEA 4X8JA 3JWOL 3SJVE 1OL0A 2V6HA 1J05B 2AK1L 3NH7H 1WAAA 4LP4A 5CJ8A 2JK5B 1JRHH 3TZVA 3CCHB 5FGBC 5CS7A 4Q97A 2VSDA 5EH1A 5HGBA 5CKGA 2ZUQB 4Q9BA 2QHRL 1MLBB 1R5WA 1R6VA 1OOAA 4KKBD 5IHUH 4CN4A 3FO0L 3DX9B 2B8OT 1NL0H 2WUCL 3KLHC 3O6MH 3WFCL 5BV7H 2DLFH 4ZAKA 2QV2A 1TPXC 5EU6A 1G9EA 5HYSB 3RWHA 4NM4H 1AR1C 1XGUB 3K4ZA 2Q7YA 1YN6B 4V2CB 1GGBH 4M9OA 5SWSB 3TBTB 4DGIL 3QRFM 1UVQB 5IB1A 5I1CL 1U92B 4RISL 1J0IA 5GRJH 3CPLB 1FVDB 5AAMA 4LCUA 5JIKA 4Z7NF 4OZHE 1A9BB 1MAML 2AERT 3OAUH 5GS0H 4AIXA 4G8GB 3V7MA 4J3UA 3Q6GH 5JDSA 3S34L 2I60H 3BVNA 3FB5B 1A7QH 5D5MB 2EO1A 3KPSB 1QEWA 1B2WH 3MZTA 1S3KH 3KPSD 5HGDB 5F6HI 3BKYL 2A6IB 1KLGA 4OLXH 3GIZH 3QRGH 3BKYH 1ZHBB 1PQZB 1QA9A 1AXSA 3VXNB 2EYSB 3FN0H 1QFUL 1AGBB 3H9HB 3BH8B 1MRFH 3HAEB 3KDMA 2Q20A 1CIDA 3HG1E 2DTSA 2FD6H 1YEKH 1UM4L 4NQCE 1A1MB 1D5ZA 3HAEG 3T2NL 4RQQB 3VRIA 4O4YL 2BNQA 1AGEA 3CXHJ 4Z7NE 3BP6B 4FZ8L 4I2XB 4F33B 5J57B 1SEBA 3KPOB 4K7PY 1OAKH 1OGTB 1HWGB 3BP5B 3EDEA 4PJEB 4Q6IC 1TNMA 4R90L 5IT2H 3HFML 3OXRB 1MHEB 3HUJF 1CL7L 5ICYA 4JLRA 3ULSB 1IZKA 1PG7W 4M48H 3MMEA 3M8OH 4Z7WB 1HQ4A 4NZTL 1YEEH 5ICZB 4NZTH 2BHUA 3V6OA 5EBLB 1JNJA 5IBUG 5C09A 4MNQA 1CLZL 3RDTA 3WMSA 4EDWH 3OJDB 1KEGH 4DTGH 3QJFA 4X4XA 4U1HB 1U8KB 3U0PB 1QFOA 4HFWA 5MEPA 4PTUB 5D1ZC 3GMRA 5JMOC 4K94H 3R06A 4Q6IA 2DKSA 3O45A 3VFOA 4OI8A 2NY4C 3FZUD 4KDVA 3TFKC 1KENL 3PDGA 3MRLB 5GRVK 5DD6B 4HDIB 2EDNA 2DYPD 2VE6B 3VFPA 1S9WA 4HLZG 5E2WL 2Q76A 3FRUB 4R97C 4U6HA 4M43H 4F7EA 5F7YC 2YEZB 3VE0B 3KLAA 4YHLH 1I7RA 3RVXC 5IESH 2R1YA 2IPTH 4ORZC 2ZKHH 2J6EA 5EOCL 3RVVC 4N0RA 1UCTA 3BT2H 1XFPA 1FG2A 4WY7L 4ZOBA 1EA9C 4F9LC 3GJFK 5GGRB 2ICEA 4JN2B 1DQQB 5D1ZA 5KVGH 4LLDA 1V3KA 2H2PD 5C0CB 4KFZC 1AQKL 1RK1A 3RPKA 4QRPD 3K4DA 3MRNA 4FQCH 1VGKA 3TO4B 2NW3B 2P4AB 3U6RB 5ICXA 4NJ9L 4ODXB 2CLZA 4JRWA 1CT8A 2IH3A 3W82A 5C0IB 4RNRA 3L6FA 1JWMA 1LO3H 4UIMB 4P5MB 15C8L 3V52H 3BAEH 5L8LB 3IJSA 2ZWLT 4PGDA 4NQXA 1EJOL 5D72L 4WTXA 4ZTPH 43C9B 2WW8A 2H26B 3OG4B 3DIFA 3R4DA 5LAXB 5F9JA 5FAAA 4RFNC 5ISZB 3FN9A 1RI8A 4IBLT 2WV3A 1ITBB 5DJ6B 5IB4B 3RHWK 3D25A 3HMXL 3O6LH 5D7IF 3SY0A 4HUVA 4JHAL 2VL5A 2ZG3A 1U3HD 4OUUB 1KCRH 5J0BA 1KIRA 4HS6B 4APQC 3QFDB 2VLRD 5AZ2L 2M8XA 4MGXA 5DFVC 1MY7A 4EZMA 3UBXI 4F58L 5IVOA 4K7FA 1TQCC 4LOUC 3T0AA 4Q9RL 5JXEA 4M6MH 4NWTL 1ORQA 4UV7L 3U46A 1A5FL 1A6VL 1NCTA 1XF5A 4X6CA 4TTGA 3D0LA 3MRQA 3OAUL 1BP3B 1E0OB 1MAMH 3L7EA 4NP4L 3MLUH 4YHPB 3SKOA 1W72A 2GY5A 1Q9OA 3ZDXE 1RQ5A 4R4FL 3L3DB 1N5YL 4OD3H 3RWDB 4PLKD 5C0BE 4JN1L 5H2BA 1CE6A 3IXAA 2VABB 5DO2D 2YZ8A 1HYRC 2ADGA 2P1YA 3UPAA 5CINL 2IF7A 4EI5B 2P5EE 4NHUB 2R0ZH 1PEZA 1BPVA 2W0LA 3W0WB 4YFLI 1H8NA 2VISB 3O41B 4QT5B 1RUKL 3BPOC 2VZVA 2D4DA 2ZSWB 1DQTA 1XGRB 3QUXD 4IRJB 3EOAA 1KBGL 1MRCL 4MDJB 4LLWA 4MZ2A 5E99L 1MJUL 4NM8H 5JW4M 1G7JA 1T3FA 1T0MB 1I3UA 2F54D 3ZZ1A 3W5NA 1WUNT 1LO4H 4I3SL 4LEOA 3PQYA 1CD1B 5HVHC 4K71C 2DL2A 1S7WB 1TCRB 4MD0B 4CKVX 4PRIE 4G6AC 2X4OB 5F9AC 3RUGB 3NABL 4JFDE 3MRJA 4GBXD 2G5BA 5BOZG 1A7PH 1ADQA 4UQ2B 4Y89A 3RBSA 3UMTA 1MQ8A 5D9SA 1QRNE 1MWAL 1N6VA 1YMMA 3QQ4A 4X6FB 4HWZB 1A1NA 3C5SB 5HI4D 2Z93B 3C5ZD 5MEQB 4UV4L 4O9HL 4P5TC 2HVKB 3GUTB 1KB9K 2OX5A 2Y72A 2RB8A 3N1PC 5C71A 5I16B 4OF8A 3ULVE 1GOHA 1RZKL 1G6RA 3NTCH 5CP7A 3MO1B 1T4KA 1PX3A 4KTDL 3P4OA 2PW1A 1NC2D 3DSNA 2F19L 1QFWI 3ARFB 2FB4H 3EDKA 2B0SH 1IQDA 4AY0A 2OCFD 1FSKB 5IESL 4R26H 5HHVH 3X12A 1LD9A 5I19H 5E1AB 4KAQL 5IW6B 5IK3A 5A2LH 1IAOB 4QRPA 2A9ML 4ZUTA 4NNXA 5GHWH 3LPGA 5A2FA 4G7VH 2BXZA 3SDAB 5KW9H 1A3LH 3G6JF 3LQAC 3QDGE 5KW9L 5FYJD 2UY7A 2GT9B 5TGBB 4LARL 4OSUL 3QEUA 4ODUA 1EEUA 4LLMA 3LQZB 3CZFA 4AL8H 3PIQB 3QO1A 3UROR 1BOYA 2OLDA 2XWTB 5JPNB 3W9DA 2NTFA 5F1KC 3MLZL 4MJIA 3VI3E 5BQ7B 1ZANL 4OLZL 3NZHH 2FJFB 5C6WH 5IVZA 3O3BB 4PJ5A 3ARGD 2YHGA 3AY4A 1YEJL 1P7KA 2BNUB 3PXHA 3TO2A 3ZKQD 1N26A 3OR7A 5FKPA 4R4BA 3UCRA 5CEZL 1EUUA 4JAMB 3CSPA 3QULA 1QLEH 1KJMB 4F7CA 4OAWB 5E94B 1EEYB 4IEFB 5GJTH 3T1FA 1G9MH 1B4JL 3DECA 5IOPA 2QL1A 3NPSC 2BOCA 3ETBF 4JFEE 3VXQB 1JGUL 3LV3A 3C08L 5LBSL 3V95A 4CU8A 3BGAA 4PGCA 4BZ1H 2PR4L 4EN3B 1JNHB 5C0BB 4K3EL 1OWRM 2Z92B 4N1HB 2O5XL 4Y2DA 3ZKND 4OCLC 1DSFH 3RUGE 2BRRH 1LO2H 5KSAB 4GG6E 2B2XL 2Y25A 2ARJA 3LIZL 4XCCH 7CGTA 3DMMB 3IKCB 1QR1A 1CFSB 3CFDA 4BSJA 2ED9A 1B0GA 4U1JA 3VXSE 1P6FA 5DLMH 4J2XA 1BOGA 2XY2A 3I50L 3VFGH 3BN9C 4DKFH 2BX5A 3WNKA 5J3HD 3DV6B 1K2DB 3E6HA 4RFNB 5FV1L 3QDMA 3UTSE 4IRSD 1BZ9B 2HFFA 4TTDD 1A6ZA 3QNXA 4GRMA 3OKOB 4ODTL 4YH6A 4WFFE 5K9KA 3N1QC 1RUPH 1I3GL 2XZCL 4JY6A 4H8WL 1YC7A 1AHWB 5BS0E 1YNTA 4N0UA 5BRZA 3ZE1F 5K9OB 1HXYB 3FQRB 1BREA 4OCXL 4ZUSB 3IDNA 25C8L 1FL3A 5KOMC 2YA2A 2HT2D 5HJ3A 3WS6A 5ACZA 1C5CL 4WFHD 4Y16D 1VENA 4EOWL 3MV9A 4N8VB 4GKZA 1FGVH 2F53D 4KROC 3V52L 4DWHA 1KYOJ 2VLKD 1Z5LA 4ZO6A 3RX7A 5JXAH 1FGVL 3SE8L 1OAYL 1YDPB 1T6VN 1IL1B 2EXWC 2R69L 2VLKB 3VFTB 3ZDYF 2BNRD 2DQIH 3LEVH 3U0TB 2ZUTA 4FP8H 3QXAA 1A7RL 2CSPA 4GAYB 3IDJA 2QHRH 2X2YA 4KMTH 1OARH 1M7IA 4XHQA 1F2QA 3FO0H 4U4BA 4MJIE 1HI6B 4PYHA 4ZODA 2CLRA 2MKLC 5A16A 2X5PA 4C58B 1U3JA 3GZKA 5EUOB 3MX0A 1MRDL 2EKSB 4K9EH 3LDBB 3U0WH 4OM0L 4QOKA 2DLHA 3T3PE 1TJGH 3U9UB 1U8IA 2ADIB 2X4SA 1NBVH 1XF4B 1Q94A 1MHPL 4YQXH 5FM4A 4YHZH 5FUCE 2FX7L 4PBWD 2WWMC 3P0VH 4LNVA 1ZLVH 1I9IH 5D1XA 5D1QA 1ZGLA 3QO0A 1RZ8A 3EDDA 4JO4H 5CJQH 4P9HC 4KAQH 5I1DB 5HBBA 4NKDA 1BQHG 4NNPL 4G9DB 3VXRA 1OAUH 5DWUH 4Y5YC 4DN3L 4NNPH 3V6ZA 1RULL 1BBDL 5D2LB 1PG7X 2ZCLH 3IYLW 3MOAL 4HC1A 1QFUH 5H37G 1IKNA 3GJFH 1LGVA 4F57H 5LWYH 5DT1L 1SMAA 2GJZA 1OP5K 3VFSA 1FLRH 4EDXB 5TDPB 5JA9A 1AQDA 2DQHH 3VU2A 5GS1C 1ZXQA 5C0AB 4I9WE 1T7VA 35C8L 2V5SA 4AYFA 1BJMA 1KXTB 2PF6A 3MLZH 3WIHH 5FKAB 1YMME 3C6SB 1CFQA 3LPFA 4JKMA 3A6BL 3LHPH 3C60C 4HUNB 4MNGE 1CICA 5IFAH 3O6KL 5CD5C 3C60A 3HFMH 3SN6N 4NFBA 4MD4A 2NY0D 4DQOL 5INCA 3DNKA 2OTWB 4LNRB 1BMGA 1FSKC 2DTML 5CFHA 4M61B 5FYLH 1CXLA 4PUBL 4PJBE 1A7PL 2FJGB 4QHUA 4WHCA 4JM2A 3FFCE 5JDJA 2D7TL 5HYEA 4XNQB 4LLVA 2VDKH 1C12B 2MPAH 1AO7A 2VJXA 2XN9E 1HNFA 4JFFE 1S5IH 5F3BA 4G8FA 4E0RB 3MJGX 4FZEL 4NZDA 3KPLA 2WBKA 2A9NL 2EYTA 2PO6D 2J5LB 5CD3B 4WFED 4F9PC 1JK8A 3WDHA 3SDAD 1L0QA 2E27L 4OM1H 5C0DA 3QZWB 2Z31D 3S36H 4KHTH 2F5AL 2NY6D 2IANA 4APQB 5AYUL 2YKLL 2VAAB 4JHZA 4XAWH 3RI5F 5ITFA 4WI7A 2X7LB 3NZ8A 3IFOB 4EUPG 1ZEAH 1S7VA 3K0WA 1Q0YL 2BFVL 1DQJB 5D7JD 4Z7QF 1NDMB 5CLWA 5HHQB 3LS4L 4YIQB 3C2AL 4HEME 1QZ1A 3A6CH 4K23H 4YE4L 3BWAB 3FHQA 5GGUA 5IVXB 1RUPL 2APTA 1AY1H 3Q5OA 3D85B 1DVFD 2Z35B 3OF6D 3VXPA 1I9JL 4KK6D 3WS3B 1A6UL 3ALWA 5IHZA 1EMTH 2CUHA 5I2IB 1E27B 1KN2H 3B3IA 1OTUC 4RA3A 3WE6B 3H2WA 2FJHB 4P2RD 4F8TA 1GVIA 3G6JA 2A77H 2XFXA 4TUOA 1I85C 2VDQH 2OYPA 5GRYA 1VPOH 3T0BA 2AGJL 4HK0A 4JPWH 5JIIA 3L3JB 4Y7MA 2YPVL 4DZ8A 3E3QC 3VA2C 4OLXL 4F15C 5B39A 5TH2A 2PO6B 2IMNA 4P57A 1XIWD 4ZTPL 1MEXH 4DKDC 4Z7UF 3SJVA 3O4LB 3AREC 3RVWC 1HKFA 1NANI 4HKXB 1OTSC 2APVA 1WAAE 4P2QE 3UJJL 5I76B 4ZPVB 5DC0A 5L9DL 5EBGA 2V2WA 5C6TL 3G9AB 3QHZH 1U3ZA 3LKQB 3SO5A 2ATKB 1F8TH 4N9GA 3DSFL 3IVKA 2YMXH 2FBJL 4ZFFA 1HQRA 3MNWB 2H45A 5J11C 3W0WD 2VQUA 1EV2E 3SDDD 1P9MA 3MBEA 1DFBL 4GW1B 3HN3A 2IJ0C 4KY1L 3I3DA 4DKEL 4G7YH 3RTQC 4OLEA 3DRQB 4BKLB 4N0UE 5BRZE 1FNFA 3T09A 2F74B 1NGWB 4LSRL 2VIRA 3ULVH 3MUHL 2DI9A 4HS8L 3KLHD 2AP2A 2GSIA 1MF2H 1Z3GH 1AD9B 1RMFH 4XP1H 2DBLL 5GJSH 2APWA 2YD3A 1N4XL 3B5HA 1SJHA 1BFOB 4V1DB 3TA3B 3KYKH 5EPMB 4Q9QL 3ARGC 3QIUD 3PWUA 1FLRL 5IMOA 4WU7A 2HAZA 5IR1A 4WWKB 3MLPA 3I84A 1IC5L 4YHKH 1G1YA 3I2CH 3PWNA 4R3SB 2ENSA 3CCHA 5HGBB 3QUYB 4EIZC 5IMLB 5C8JA 5DJAB 3LEYH 5IIEB 2IPKB 1U91A 5EN2B 2R2HB 2X9YA 4UDUA 3HMXA 3SE8H 4XP5L 4O5LH 5HYSA 1JJUA 1CGSL 4PG2C 2ERJB 1UYWH 5C0FB 1OP5H 3O6FA 4PJFA 2HVJB 1O7VA 5F1IA 1SJEB 1M7DB 2Y5TB 3MV8E 3GMOB 3K8LA 6CGTA 1RZ7L 4HGWA 1FL5B 5C2BL 1IMHC 5KSBA 4OF7A 1FDLL 2MQCA 3ZHKA 1KLUA 3TNNA 2V7HB 4UV4H 1KTDA 1XR8A 1ZKAA 3QXDA 2BNRB 3VG0L 2OTPA 1HHIA 4MLSA 3PJSB 3BVNB 1D3CA 3MJ8B 4F7TA 4PJGB 4MQXD 4GQ9L 4OV5A 1JI1A 1NMAL 1CD9B 4ZDHB 5ESQA 3I02A 5DZLA 3JXAA 1PYWB 3QFJB 1QSFB 1VKXA 4CVZB 1LK2B 3DV4B 1AXSB 5KTEL 2B0SL 3ULVC 3BH8A 5DSCB 1B4JH 4BELD 5GS0D 4RGNB 4RDQF 5DDHB 3A6CL 4K23L 1JZ5A 1PW3A 3F7RA 4XGZB 3CDGB 1YECL 4BM7A 1A1MA 2IBZX 4U49A 4MAYD 4NN5B 3T65A 2BNQB 4CUCA 2CJUH 2VZUA 5E8DH 2X70B 3WL9A 4Y4KC 3MYJB 2IANE 3MRFA 2ITCA 3L3OA 3MRBB 2GTWB 4XPAL 3TWCH 1FZJA 4G9FB 4GRLA 3X14A 4ZNEE 5C08A 4GRLC 4Z0XB 2FYYB 4WO4C 4YHIB 1EX0A 3DYOA 1MVUA 3FT3B 4DCQA 5TDNA 5EBLA 3WLWD 5C09B 5HHXL 1F4XL 3O6KH 3CVHH 3MUJA 2YPKB 4FQXC 1JGEA 3EJYD 2YD1A 3SQOL 1T2XA 2E7CA 5FK9A 1PY9A 2EO9A 4L8SB 1NGPL 1X9QA 5AD0A 1JHLH 1T21A 3U1SH 2VKXA 2LU4A 4H88L 3GIVB 4Y5YB 3KYMA 4KKAC 3O45B 3VFOB 2WMPA 4L9LB 4JQVC 3VJ6B 3RU8L 4U1NB 1GXEA 5HDBE 2VDOL 3JV5A 2EIEA 2W38A 1E6OL 4XCNB 1R5IA 3V5HB 3AMKA 3FRUA 4KKLD 5LBSH 3AY4C 4F7EB 1IT9L 1J1XL 2GI7A 5E6ID 2YEZA 3VE0A 4HMDA 1I7RB 5B8CA 1YEDB 2J6EH 2H3NB 4YZFE 4UTAH 4WUKL 2DM2A 3H9SD 5BJTA 4C56D 1Q9WA 4Z95L 3OG6B 1Z9LA 2UWEF 4NCC2 1S9XA 1A9EA 1IM9D 3MBXH 2NY1C 5F89B 2JELL 3D39E 1K4DA 2BY0A 2ICEB 1I1AB 5DTFB 2G75B 2FWOA 1S7SB 4FXGA 2C7UB 3D87B 2F54E 4L3ED 5E2UH 2NW3A 4PJIA 5JLZA 5FYJL 2EKJA 5KANI 4ODXA 2QLVB 3G6AA 3O2DL 1JL8A 4Q9QH 4XXDA 1MCIA 1KB5L 3L6FB 5ABDE 5FIEA 4XP4L 4NO0A 4KUCD 2YBRA 3S34H 1MHCB 4JO3H 3OX8B 1LO0L 2L7UA 2HN7A 4P2YA 5F9JB 2WBJA 1OB1B 1X5LA 1Q9LB 4JFEA 5ID0B 1B90A 1B2WL 1FIGL 1NMBH 3QEQE 4X7TA 1T1XB 5GGVH 3KPPB 3SY0B 1HINL 1FIGH 2PETA 2BCKB 4HIJB 2G9HA 2VYRE 5D8JH 3JUZA 4Y4HC 4YGVB 4BH7A 1CYGA 2Y06H 2A6JB 2CDEB 5J12B 1JTOA 4U1LB 4FQ1L 4FABH 1WTGT 4I3RH 4XMLL 5I8CB 5GGTH 1PG7L 3QHFH 4KMTL 4J3SA 3BFOA 3U46B 3WXVL 3QWRD 1UKTA 4PYGA 4G42B 1KC5H 3L7EB 4M3KB 2MFNA 1A1OA 1Q38A 3RGVC 3ZYJA 1IGIL 1HSAA 4YHPA 3P4LA 5KSVA 1TVHB 2EZ0D 1IGIH 4G8IB 2WUBL 3EO0B 1N5AA 2CKBA 1NANH 5BXFA 2VR4A 3GJFA 2IWGA 5EIIA 2DWEB 1CE6B 3FFCD 2B1AL 3F12A 1ZT1B 4R90H 5IT2L 4EI5A 4Y4HA 1QHPA 4NHUA 2F54B 4W4OC 3O4LE 1TQCB 2DMCA 2I26N 5IF0B 1MCQA 4NKOA 5L8KB 3EFDH 3TGXA 2E6QA 4NBZB 3RZCB 3V4VH 5JHLH 3OKDB 3SDCB 1AE6L 1KLFA 4XBEH 4OT1H 4QF1A 3X17A 3SDCD 1ZT4A 4JFQA 5LG1A 1RURH 5HPMA 4QXGH 4BZ1L 4U1SB 3VXSA 5GXBB 5C08D 1AGFA 2Q8BH 4TPRL 1MPAL 1U95A 3JV6B 4ODSH 1CD1A 4X9HA 4DVRH 4KKCC 5FOBA 4PJHA 3BP4A 4XAWL 2FEDC 3JWDH 3DUHA 4W4OA 3RVWD 2BSSB 2CDGA 5CEYB 2FB4L 4X8JB 3OTTA 1BD2B 3D48R 5EWIH 4JHWL 4E41B 1ED3B 5ANMA 4XPHL 2A38A 1UM6H 1JPSH 3N06B 1Z2KA 1IM3B 4NOFA 1WFNA 3DO7B 4WU5A 3DX9A 5I1CH 1UXWB 2XA3A 1CDCA 4M62L 5MENA 4FQCL 5ADOH 2D7TH 5CSZB 5I16A 2FR4B 4JQIL 4LARH 5GS3A 1AQKH 3RWHB 4DGVH 4OLWH 4QEGA 1XGUA 5ISZD 1T4KB 3THMH 1BX2B 32C2B 5IB1B 4POYA 1ONQB 3O3AA 5E24E 4XVTL 3IXTB 1EFQA 2GY7B 1I1AC 3NIFE 4IHOB 1P4IL 4N0CD 3QAZB 5IK3B 2FATH 4ZUTB 4NNXB 4G3YL 5F8QC 3ABZA 1QEWB 3BIKB 4UOW0 3FHAA 3O3DB 3MFGB 4K7PL 3NN8A 1UB5A 1GIGH 4D9RD 2XTJC 4TVSa 5E8PA 1NKOA 2GT9A 4POZD 3VXMB 5D71L 4LSTH 2R23B 5CZKA 1E4XI 2X4NB 1U41A 2EYSA 1RJLA 2YD7A 3NA9L 4JDVA 4PJGE 2DICA 1GOFA 1RK0A 3TN0C 1NLBL 4U1MA 5EIVA 5HDLA 3V5KA 4QXTA 2VH5L 1NCWH 2BHYA 5IMMA 3VH8A 4RMQA 1YA5A 5F96H 2I9LA 4MCZA 3KPOA 4KMQA 3TBSB 3EYQD 1F4WH 3FO2B 4TSCL 4J4PC 5CZVL 3PWPD 4PY7A 5J8OA 2H1PL 3SOBL 4XBGB 1RPQA 5ICYB 4OGAD 5IB5A 3U4BL 1EEYA 4RRPG 5GS2D 4URTB 4N9OB 4LSPH 3STZA 2GJJA 3PWLA 5ICZA 3LV3B 4F3FA 4UNVA 1KACB 4L3CA 1MEXL 5DHVH 5KN5B 2NNAB 3WD5H 1IGJA 2DQUH 4YDJA 2P5ED 1X3DA 1R3KA 3CVIH 4KJYA 5E8NA 3GM8A 3A6OA 3DVGA 5C3LD 2ARJB 4HXAH 1MJUH 1U8KA 3AREA 3FFCA 3U0PA 4KVNH 1JWSB 3DMMA 3ARXA 4PTUA 2A83B 2GJ6B 1P4BH 2JJTC 3KWWB 1B0GB 2HT2C 3RGHA 4XP6L 1K4CB 1P5UA 4ZUVB 4YDIH 3HI1A 4GH7B 7FABL 3QDMB 4CADA 4G43A 1BZ9A 3IRPX 3BOVA 1OQXA 4U6HB 1T0NB 1ZVYA 3KXFB 5KVEL 2EXWD 2XXCB 4R8WL 5EFIA 4QYOB 2VLME 3CFJB 4TYUA 1K5NA 4EN3C 3UEZA 4N0UB 5BRZB 2ICWJ 5DJZA 3SGEH 4X7DC 4NC1E 4UU9A 2AQ1A 2VLJB 2RAMA 5B3NA 3L7FB 4X0KB 3VMNA 1WFUA 3ESUF 1CU4L 3GSNB 3U36B 2OR9H 5GGRA 2NYYC 5SWZB 5FUZL 3VRJB 1HK6A 1WCBB 3LKOB 5M95B 4LPVA 4HCRL 4PRDA 4WTZG 3NCYS 3F62A 4PJ8D 1XGPA 2C3HA 2NY3B 2A74A 5F7KC 5I1IL 4N8VG 4PG9A 1Z5LB 4GRWF 2D31B 5MI0B 1YEGL 3JTSA 4HPOH 2JCCB 3D69A 3FQUB 5DEZA 2P44B 1JPST 4G80A 3KNBA 2P47B 1K85A 3IGAB 4MNQE 2VUOA 3OJVC 5AZ2H 5DEFB 3DIFB 4MJ4A 5ISZA 2RGSA 3D25B 1T1YA 3WFEL 5JIHA 1KG0A 5C92A 1U58B 2JB5H 4M8QB 2ZCLL 1FN4B 3LKPA 2VL5B 4ZOCA 3BGMB 1P84J 1S7XA 5C2BH 3QFDA 1VFBA 5I73B 1RIHH 3PGFH 4UNUA 1A14H 2NY4D 4K7FB 2ESVD 3WFZA 3LKSB 2VSCA 4F8QA 1HHKA 3WN5B 3MREA 5T3XH 1XF5B 1ADQL 4X6CB 4K3DH 4HH9B 2ZNWA 3MRQB 3ARFC 4Y4KA 3PL6C 5I1DA 3O11A 5E5UB 5IVXE 3VDBA 1HYSD 4R9HA 5CWSB 1FNEB 1F3DJ 5CEZH 3O8XB 4HGMA 3B2VH 2VABA 2DQDH 5F7UA 5BV7B 1BFSA 3NBNA 3QJHA 4XNUH 5CILH 2VLJE 3CAFA 5GJTL 1FJ1B 1ND0A 3TBYA 1C08B 1D6EA 1FC2D 4W70A 1X6NA 2DQFA 2GAZB 2R29L 2EH8H 5HHMD 4KJPD 4OF5A 4UIKL 1S9VB 2A9NH 2XTLA 2J8UA 3VH8G 1VDGA 2YWZA 2CO6B 2FX8H 3QDME 4AG4L 3UTTA 1DQMH 1VACB 3Q1SH 3VXUB 2CPCA 3QEGH 1L4IA 1XMWA 5T5FL 1L7IH 3IDXH 2Z31C 1UH3A 4LLUB 5HHPB 4M61A 4KI1A 3V7AG 1WEJL 3GGWA 5FO9B 1LWRA 1PKQA 3CGTA 4PJBB 4LLVB 3O2WL 4WHYH 1W72L 5C0EA 2X4OA 1MCWW 3RUGA 3GBLA 4MB5A 3BYTA 4ZS6C 4YBLC 4KQ3H 3RZCC 1E4KC 3BW9B 1R24A 2ZOLA 4UQ2A 1U3HC 1X5KA 4HUMB 4OZIA 1JV5A 2AQ3A 2GUOB 2VLRA 1DANU 1YMMB 2I07A 1RZKH 3C5SA 3D39B 5GISL 5M94B 3V4UL 1JZ6A 2MOVA 4YO0B 3QUZA 1U3HB 3QZWA 4HBQA 4NQEE 3I6LD 1JNNH 3QWQB 3U30C 3DXAD 2YRLA 1UQSA 4YC2B 2VAAA 1QFWM 2ATPB 5EZIL 2X7LA 2QR0B 3K8KA 2ZG2A 3FTGA 4MA7L 3GIZL 5CP7B 1AO7D 4JPKL 1MUJA 1NDMA 6FABH 4XCFL 1EERB 3GSRB 4ODWB 4LVEA 2FATL 5I1AA 1HIMH 3KPTA 1NUGA 4WI5A 4Z7VA 3I3EA 2VN4A 1YEKL 2V7NB 3ZYZA 3GBNH 3SDYL 4GJTB 2ICES 1NDGB 2ZSVA 1IAOA 4QRPB 3LEXA 4AIOA 4PJHE 1G9NH 2FEDD 4ZFZA 3RA7H 3HAEH 4HQQH 4U6VH 4MXWL 1QSEA 4JFXB 4I4WB 2CLVB 1ZLWH 3B4NA 1DUYB 3EO1A 5ERWB 3QHTC 4HHAB 5D96C 5GS1B 1KJ2H 2NY5L 1JCKA </