4JG1H

Structure of phosphoserine/threonine (pstab) scaffold bound to pthr peptide
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
225
structure length
225
Chain Sequence
SEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMSWVRQAPGKGLEWVASISTPRGSTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRGYSSTSYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab light chain
publication title Nature-inspired design of motif-specific antibody scaffolds.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 42
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 2013-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jg1H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jg1H01
5F96H 3FTGA 3GMQA 1AO7B 4OFVA 4MA3A 1P5UA 4NN6B 4AEFA 3CJJA 3SDDD 2HT3C 3MRKB 5FF6A 1DQJB 2AI0H 3RIAK 3QCVH 1A7RL 4G80B 1GXEA 3UJJL 3ME0A 1ZK9A 3CLEH 3GMPA 1KPVA 2UY6A 5FYJD 4UV4L 3U7YH 5EO9B 4XGZA 5D70H 3IAQA 4X80H 1J12A 4UOW1 1B0GA 3MODL 5M7QA 3MO1B 1S5IH 3QUML 3EO0B 2Q76B 1T0MB 4ZUUB 4JHZA 4MAYC 4NJAL 1M7XA 3SO3C 1L0XA 3TO4B 2YWYA 3ECBA 3MRDA 1QSEB 4KJPD 4R2GC 4ZPTB 3CFEB 4EI5D 1YMHB 3MBEA 2BZDA 5IVXB 3BKJL 2VUYA 1D7FA 3DUUB 5E2JA 3V4VL 3GI8H 1YY8A 1F3DH 3NFPB 3VXTB 5GRUL 4LHUA 1MJ7H 5FYJU 4QTHB 1RZIB 3RWJB 1PVHA 2AJXL 3EO9L 3U4BL 1BGXH 3VFPB 2ICWI 4UQ2B 1SJEA 1UM5H 5ITBH 3QEQB 3GGWA 2MCG1 2R2BB 3TZVB 5DK3A 2CJUL 4XCYB 3ZT6A 5I16A 1FVEB 1ZHLA 4JG1L 3BRDA 4M6OL 5IHBA 4U6VL 5C70A 2R4SH 1YEIL 2HJKB 2D0HA 1EGJL 4JFOB 5GS0H 2F74B 4AIZA 1M05B 1AY1H 2O93L 2QADB 3C5ZD 3MYJA 3B2VH 2FIKA 1MWAB 2D9CA 4NM8H 4IOSD 1GCFA 4G42B 4JREC 5I6XC 4F80A 5HYQA 1SQ2N 4PV9A 1VGKB 4FFWC 2VXVL 4IJ3B 1U8OB 2ZG2A 4GKSA 4MVBD 4PJ8A 5HY9A 4I5BB 3VFUB 2EDXA 1QR1A 3O3BB 4LNRA 5CBEB 2IANB 1KFAL 1WAAE 3HE6D 3TEUA 3KPQA 5DJ0B 4S1SL 4TOYL 2FEEI 3QG7L 4J3WA 4Z7UE 1V3JA 4OKVB 5EU6D 4KDTC 1OF2B 3RWFA 4C54A 4PGCB 3ILPB 2G5BA 1IKNC 2XQYG 1CL7I 1KB5H 1WWBX 2YA1A 2XY2A 4HX1A 4Y16D 2CMRL 2PO6C 1X5KA 3BAEH 2C3GA 4QNPE 3LQAC 3LMJL 4KQ3H 4NQDB 3AS1A 5CINL 4Y4FD 4QGTA 2LAAA 4UILH 3GJFH 3PL6B 4MNGE 1FO0B 4LK4A 1NEZA 1IFHL 1F3DJ 4NSKA 4XP9H 5IW6B 4R3SA 1DN2A 3GJFK 1FNEA 4PRAA 5TH2B 4JRWA 3SDDC 1WZKA 1ZA6B 3WLWD 5I1GL 4YWGL 1OQOA 5DJAA 3PWLB 1I3VA 3DV4B 4PJBA 4IRZL 5HYSB 2V5MA 4QXTB 5EIQA 4DQOL 3EOTH 1OGAD 2Y6SC 4O9HH 5KS9E 2D31B 5A16A 4G8IB 1ZAGA 4UOJA 3ROLA 1RJLA 2V7NA 4Q9QL 5EDXA 4KJPC 1A02N 3HA0A 2DAVA 4BYHA 1YA5A 3H9ZA 5C0CB 3KPPB 4PJCB 4P5TA 5D72L 3DX7A 1UH4A 4WEBL 4M48H 4I2XB 2DF3A 1H3PH 2Y5EA 1HCFX 3KPMA 1DQLH 4UIKL 2AGJH 2PCPA 1UVQB 1Q9WB 2Q1EA 3A67L 3WHXB 1MQKL 3DO7A 4PJBF 4GRWH 2AK1H 4IM8A 2JELH 3C6LA 3MNVB 4GG6A 1I7RA 1QFPA 4ISVB 3QWOB 1YEGL 1T0NB 5DVNA 3UZEA 5T1KD 3HN3A 4U6YB 3TBWB 3ZTNH 4Q9RH 4JKMA 3C5ZC 2C3VB 3IYLW 4IHOB 1CVRA 4UIMB 1DQTA 1QQDB 3PGFL 1QOKA 1K8DA 3Q2CA 4G43B 4A6YL 4HIIB 4XPGL 1R5VA 4UAOB 4WCYL 4MVBC 3EW3B 4PTTB 5CP3H 2YEZB 3ISWA 2CDEB 4BSWA 3HRPA 1OP5H 4QRQA 2XTJD 1H3UA 1P6AB 2GITB 1OGAE 2ID5A 4ZTPH 3LEXA 4J12A 3QPXH 1I7ZB 4J6RL 3A6BL 3STZA 3UPCA 4GKNB 5I1JH 5IM7B 3BZEB 5FM8A 1T04A 4N9GB 4WWKB 3HE7A 4RMVA 1EA9C 4KVCL 5E2VH 4MD4B 1OP5K 1CXKA 4BKLA 4CVXB 4UUJA 4GG6F 4Y16C 5D2LB 1CU4L 4BELD 4U6XA 3LS5H 1O7SA 3ARDA 5EFIA 3O8XA 3OGOE 1A5FL 4Y4FC 3QEHB 4OF8A 4JVWA 1KJ2B 1XF2B 4HAGA 1U6AH 1BZQK 4KK8C 3LN4B 1TTFA 4I0CC 5DMJB 2ZSVB 4FFYL 3MX0A 3WFDH 4JPKL 3WLWC 3OAYH 1F13A 1QSFD 1UKSA 3BGMB 3IJSB 5DJ6A 3G08A 1P4IH 1LK3H 3WXVL 2WWKT 1CE1L 3UTSA 2NX5D 5GRVL 5I18H 3OAYK 1A3LL 2A83B 2WBWB 3HAEA 4PJIB 4U7MA 3CVHB 3MRJA 5GSVB 3FQRB 1RZKH 2DBJA 1B0RA 4LARL 1PBYA 1QFWM 2EE9A 2F53B 5CWSA 3IDUA 4GXUN 2DLEA 1RU9L 2OTPA 5ID0A 5DRNB 2Z9TA 5FA4A 2GK0B 3U0PB 3W9EA 5KW9L 2VIRA 1MNUH 1MCOH 3FFDA 1V5JA 1J0YA 2ZCKH 1T22A 1DEDA 3BP6B 1EFXD 1MFNA 1NFIB 3FZUC 1MFEL 3FO1A 4QKXB 4NQVB 2WWMD 3H9SD 4EVNA 1HXMA 1J8HA 3THMH 4QT5A 3OGCA 1QKZL 4RAVB 3VXRA 4OZHA 3KPOA 2EZ0D 4JFED 2EXWD 2FHBA 3RHWF 4F57H 4Z0BL 5BZWA 1T2QH 4NDMA 1U58B 3DLQR 1RJZB 5IFAH 4HKZB 2HFEB 3CMOH 4PJGA 1JPSL 5DS8A 3SJVB 1KLUB 4DKEL 4QRSB 1CF8H 5T3XH 3FMGL 4A6YB 1BFOB 4LSPL 2EEAA 4BSJA 4NGHH 3WFCL 1MCPH 4NNYB 5HYIA 2GTWB 2PYEB 2RQ8A 1CG9A 1QSFE 5F72S 3T0VA 5JXED 4Z7NF 4P23D 1XGYH 5HHXL 1F02I 1XCQA 4OZFG 1QHPA 2XTJC 4BH8B 3S6CA 4BQBA 4HCRH 3S3JA 4X7DC 2WSKA 1RUQL 1AXSA 4FN0A 4PRHE 1UWEL 2EIDA 3HG1A 2D03L 3HC3L 3M8OL 1ORSA 3P4MB 4X4MA 5HVGB 3TYFA 4XP1L 2O61A 4OZHF 1RULH 4NO3A 3TO2A 4G6KL 4P5KA 2QQNL 4NC1E 5IJVB 5D1QA 5IGXL 1R5WB 5L7XH 4APQC 4PJGF 4U2ZA 1QRNB 5C0GA 2XFXA 4DFIA 5HSFA 2VL4A 5I1IH 5I19H 1ORQA 3KDMB 1BFVL 4OF5A 1NMAH 5CJBA 2ZUTA 3SGJC 4BFIB 4BZ1L 4NJ9L 1W0WB 2BNUA 5SWQB 3GBNH 2RAMA 1LD9B 5F7DB 3H9SE 1E4XL 4TPRL 5E2TH 1ZLUH 1JHLH 3NPSC 1JI1A 3MUY1 1YNTB 2OR7A 4JKPL 4JFEE 3C2SA 5DQDH 1ZLUK 4Q0XH 1ONQA 3LQZB 4KMTL 3MFGB 1MJJB 4XPFH 4M1DH 1RI8A 3WIFA 5F1OB 2VDQL 5DJDB 2BVOB 3QNXB 3WXWL 3BW9A 5EUOE 5C86A 2IPUG 2QSCH 4FG6D 5DMKA 3HFMH 3WL9B 5IHUL 2X4NA 1YN7A 3BZFB 3UTTE 3INUL 1AP2B 1IL1B 1HCVA 4R4BA 1NMCC 3MOAL 1OPGH 3EYOB 3IFLH 1A9BB 4PBXA 4PGBB 1ZLSL 3RAJL 4Q2ZB 1GRWA 2WWMC 1RK0A 1MJ8L 1OAZL 4XTRC 5F3BB 3LQAH 2DL9A 2EXWC 4I0KA 1DQMH 5EBMB 2ADJB 1IT9L 1N7MH 1XGPB 4NUGH 4NZTH 5IB1A 3RWDB 3AUVA 4IRJD 2IH3B 3MR9A 3JV4B 4Q6YA 4AQ1B 3UC0H 3BPLB 1Y0LB 1QBBA 1QVOA 3O6KH 1JV5B 3BDYH 5DRWA 4X4YB 1ADQA 1UJ3C 3QNZA 4TNWK 1U91A 4P3DB 2DM2A 1VFAB 5JXEC 4RFNC 5C9KA 4MXVE 4P23C 2ICWA 2YN5A 4LAJH 4OCNC 1XF3A 2N7AA 3L3GB 1MY5A 2Z4QA 3BO8A 1JRHL 3U82B 3JV0A 3BUYB 2O5XL 3WV0A 3HCVB 2PETA 5C92A 3BPNC 1G9NC 1N64H 3HMWL 3PHOB 5F7KC 3LPFA 1EAPB 3TVMA 1G7LA 2YRLA 1CN4A 2DQIL 3MROB 4Y5YA 1JF1A 2H32A 4XNZC 4FQIH 4XNMB 1MCCA 3AREB 2BSTA 3SO5A 3FAWA 3QR2A 3RY5A 4YR6B 2XXCB 5GJTH 1IM9B 1J1XL 3CPLA 2A6IA 1RUPH 3AFLA 2E9JA 1OGTA 3B43A 1IZKA 1NMBL 3QPQD 3NIFE 4GW5B 1PQZA 4KTYA 4ZUWA 1NJ9A 2X1PA 3QO0A 4RFEB 2VITA 2PXYB 5ILTH 3MUGB 4DTGL 2IALA 3RVTD 4F15B 3HMXL 1GAFH 5LGKA 1IGFH 3LKOB 2MTPA 3UJTH 4X6CE 3PABB 5J57B 1QFUL 4LSQL 4GMTL 4TSAL 1S7RB 3EYFB 4XNYL 5KBNC 5B39B 1RK1A 4HIJA 3KR3H 5F96L 3KWWA 4EJ1C 4LCUB 3A0OA 1DQQA 3PP3H 2R8SH 2VTFA 3RJQB 4FXLA 4PJ9B 3MOBH 5ANMA 1FP5A 4DKAA 5M95B 4G8GB 4FG6C 4I1NB 3C8KB 5D6DA 3SKNA 2GJ6E 5CLTA 2AI0L 4N0RA 3QCVL 5D7IB 4K9EH 1N6UA 3PP3K 1XF4A 3CLEL 3RTQB 3U7YL 2EO9A 4LVHB 2HLFD 5CILH 2XNAB 4X80L 1NUDA 4UBDD 1QUNA 3O4LB 3TBSB 1S5IL 1FL3B 4G6JH 4WEUD 2DWDB 3RX8A 5HGGS 3S4SB 3L5JA 4XCFH 5ESVB 2MHAB 4JZJB 3V5KA 2XXMB 4PJHA 1TCMA 5I66A 1IGJB 2VLKD 4GBXB 3QUXD 5GHWH 5L2KA 4IRJC 4LCWD 4OM1L 1VPOL 1MH5A 3IFNL 5ETUB 1DUYB 3B3IA 1OW0C 1UH3A 3GI8L 4K23L 2DYPD 2VAAA 3DRTB 1LEKA 2YPLE 1MJ7L 4HK3N 3SDAD 2BNQD 3ARYA 1T1XB 3LEVL 5A3ID 2X4UA 1BGXL 1WWCA 2X4PB 4LU5H 1BF8A 4AH2A 5CD3B 4HFWB 3DRQB 5T33H 1UM5L 3LRSA 3D18B 4K7FA 3VE0A 1NDGA 5TPWH 3VDBA 2J3SA 5IB2B 5MP6H 3MRBA 4EZMA 3SE8L 5MHSE 2R4SL 4ONOA 1NC2A 1UXWA 3V6OC 5GS0L 3I6KB 1A1OB 3GSWB 4P57B 4OIIL 2NY6B 4WV1A 4PJHF 4NUJB 1DZBA 2CRIA 4NM8L 1N26A 2IAMD 4M8QB 5I71B 3RDTB 3VI4E 1PYWA 1FYTD 5CP7A 4QXGH 4XPBH 1PX4A 3T3PF 3AGVA 5FYKE 3CXDH 1EHXA 3QPQC 2E5EA 4HIEA 1RSFA 1MHHB 4MDJB 1M6OB 4Y89A 4X6EA 1LO3L 5IIEA 5EU4A 1KB5L 3RVTC 2EKJA 2ICEA 3CX5K 4LDLB 4PG9A 2VLKE 4R97B 2XWTA 4LCWE 4N68A 4HJJH 4X7SL 1SVZA 5JQ6H 2OX5A 3VU2A 4EEEA 4UILL 2H26A 3JUYA 3JWOC 4K2UH 4MCYB 2ARWA 3O81A 4MNHA 4DN3H 4XP9L 1DANU 1C08A 3DBXA 2BNQE 4G9FA 1XR8B 1ZGLA 1K5NA 4YXLH 3P73A 4Y4HB 4LP4A 4GRMB 4G7YH 2XACC 2VDPH 1S9KC 2HLFC 3QUYD 3EOTL 4I4WB 2FL5A 2Z0BA 4O9HL 4UBDC 4KV5F 3TP4A 4PLJC 4F58H 5DFWH 4X5LA 3U4AA 4Q74A 1AR1D 1CD1B 2H3NA 3TCXA 5DQJA 2BVPB 1NGWB 2FJFB 4OZFH 1UCTA 2MCPL 3GO1H 3L9RA 4ERSL 3EYVA 3BPOC 1DJSA 3FT4B 3TBTB 3L7EB 4XAKD 1RV6X 2JLLA 4M48L 3QFDB 5F97E 4YHYB 1AO7A 3FB6B 1H3PL 1CDHA 1IGTB 5MEND 1P1ZB 4KJYB 4Y19B 3MRKA 3GFUA 1DQJA 3BGAA 2AGJL 4Z7WF 4G80A 5A3IC 5DYOB 2XI9A 5EO9A 2D4DA 3BZDA 5JZ7C 1TETH 4L9DA 4OIBA 3CX5J 3EHBD 3MO1A 2AK1L 4NZRH 3EO0A 2Q76A 1T0MA 4ZUUA 5ISZB 2P8PB 4KUZH 4ELMB 5FGSA 2VDLH 1MELA 3QWRA 3TO4A 1EEUA 1QSEA 4ZPTA 2XG4A 3CFEA 3MGAA 3ZTNL 1YMHA 4L1HA 4Q9RL 1NUFA 1XGUB 5IVXA 3UTQB 4NM4H 3DUUA 5EZLB 1RHHB 3NFPA 3VXTA 3VGEA 4WW2C 4OF0A 3MGOB 2HJLB 4QTHA 1RZIA 1MHEB 3BFOA 2BNRB 3RWJA 3OJVC 4LGRB 3VFPA 4UQ2A 3D6GA 5J7CC 1KIRB 1G0YR 3QEQA 2R2BA 4LF3B 4HS3B 3TZVA 4ZTPL 3QPXL 4XCYA 1FVEA 2DMBA 5I1JL 4P5MB 5J12B 5E2VL 4LL9A 3WUWB 1KB5B 2HJKA 2V7HB 5AG9A 2B1AH 5BS0D 3KJ6H 5K59F 4JFOA 2F74A 1I7UB 1M05A 2IPUK 4U1NB 1MWAA 1DVFD 5J13B 4G42A 4G8FB 5ENWB 3GJFB 1VGKA 4XAKE 1IAOB 2WZPD 3WNLA 5IVXF 3MFFB 1U8OA 3D48R 1U6AL 2NY0D 4I5BA 3U0TB 3VFUA 3MOQA 4YLQT 3O3BA 5CBEA 4XNXH 2FCBA 2IANA 3ZHKA 2C4FT 1RIUH 4QRRD 5I9QC 2OR8A 5DJ0A 5E0QA 1J7VR 5SWSD 5HYFA 1P4IL 4OKVA 2MQ3A 3FQUB 1LK3L 1GGYA 4KPHH 3QUYC 1OF2A 1P53A 1QBLH 4PGCA 5I18L 3ILPA 2NLJB 4JO2H 1GGCL 1G9NH 1NL0H 3PHQB 3IT8D 4HC1A 3IF1B 4YDKH 5CJ8A 1RZKL 4KXZH 1P9MA 4NQDA 3X12B 5B3JF 4L4VE 4JGJA 2EDNA 3GNMH 4RQQB 1AXIB 3MXWH 3PL6A 4JM2C 1FO0A 2P7TB 2YD3A 3GM0A 2OCFD 3T2QA 5IW6A 3P0YL 3RZCB 2P4AB 2BHYA 2NXYB 1GYAA 5HJ3B 4U0RB 5TH2A 1MNUL 1MCOL 1ZA6A 4J3UA 3H9YA 1BQHG 5HGDB 2ZCKL 3PWLA 3DV4A 1FAIH 3QSKB 1BFTA 3QZWG 3MZTA 4C59B 5HYSA 4QXTA 3T4AB 3P4LA 4QLRA 2FGZA 2KKQA 4YHKH 1FAKT 2D31A 2Q20A 4JRYD 4KFZC 3THML 4G8IA 1N4XH 1BECA 3FONB 5F9WB 5BS0E 5TF1H 3AU1B 3TCLB 4WGVB 1XF5B 1HKLH 4F57L 1T2QL 1CDBA 4IRSD 5C0CA 1TZHB 3KPPA 3WKNA 2K9UA 4PJCA 1X5FA 3CMOL 4KY1H 5JW4N 5T1LB 4HWUA 4I2XA 1CF8L 4ZAKD 5T3XL 4L3CB 4EIZC 4NGHL 1MCPL 4QRRE 5E9DB 1EJOH 1UVQA 1Q9WA 4MLSA 5SWSE 3WHXA 5IW1B 3EZ8A 2UVEA 1XGYL 1GOGA 4HCRL 4TSBH 1JRHI 4K3JH 3MNVA 3FL7A 3ARGB 3NVQA 4ISVA 3QWOA 3ARBD 1T0NA 4JO4H 2ZG3A 1MCEA 4JFDB 3IDGB 4U6YA 2Y7QB 4WUUE 1WK0A 3TBWA 2LVCA 2CH8A 1RULL 1FZMB 3U36B 2C3VA 2B4CC 4IHOA 3QDMB 4UIMA 2YZ1A 1QQDA 2Q3ZA 4F33B 4G43A 5L7XL 4HIIA 4PJCF 3MV8B 3EJZD 5BRZE 3LPWA 4YHOL 3MBED 1CS6A 4PTTA 4MA8H 2YEZA 1WFUA 2CDEA 2OMNA 5I19L 1WCBB 2R4RH 1CFNB 5I8KH 1NMAL 4HWNA 2D4FA 2GITA 3VJ6B 5FKPB 5ELIA 2BY0A 1I7ZA 4GKNA 5I75B 2C26A 5IM7A 3BZEA 1WZLA 1JHLL 4JRYE 4WWKA 4N9GA 3FHAA 3L3IB 3V79C 1G7HB 4MD4A 4CVXA 1FLRH 1HINL 4YPGB 5JIHA 3UZVB 4PGJA 4CU7A 4Q6IB 5D2LA 5DQDL 3VRLF 3T3MF 2YD6A 1WBYB 1FHGA 4Q0XL 2A6JB 1IKFH 3EO1B 1UT9A 2OR9H 2B5IC 1FNSH 3QEHA 4M7ZC 4XPFL 1KJ2A 3UPRB 1XF2A 2VDOH 1W8NA 3NTCH 2KUTA 5BW7C 1UCBH 3LN4A 2ZSVA 2MQCA 3VG9C 2EDOA 2QSCL 3MV7B 1H3TA 2ORBL 3BGMA 3IJSA 1JZ5A 1HYRC 4Z95H 4LBEB 3QB7C 3O4OB 1V7NL 1OPGL 4JQXA 5F6HJ 4D94A 1NAKH 3B5TA 1OP9A 2A83A 4PJDB 4CVWA 3LD8C 4PJIA 5GSVA 3CVHA 1MCSA 3O3AB 3FQRA 3LQAL 4YNYB 1DQML 4Y7MA 4NZTL 3NACH 4NQUA 4WTWA 5D2LF 1BQUA 2F53A 4TSCH 5CIPH 3DYOA 4IRSC 3JWOH 2Z35B 3IS0X 4X7FC 3D1MC 4L5FH 1JGVH 5DRNA 3TJHD 3UC0L 2GK0A 1GZQB 4ZAKC 3VXME 3U0PA 3SOBL 1T7WA 5F7EH 1MLCB 1QBMH 3BDYL 2YRPA 1ZANH 3OJ2C 5FYKH 3BP6A 1NFIA 5FYJL 3VXQB 4ZOCA 1YC7A 4NQVA 4KC3B 2IMNA 3N9GH 3T0EB 3G5ZB 2DQEH 2KDGA 3PWPE 1RJYB 1ES0B 4JJHA 3BYYA 1JHKH 1MCBA 5HYJE 4RAVA 5SV3A 2E7LA 5EB9A 4YPJA 3K8KA 4PJIF 4TTDD 1N64L 1FNHA 4LLVB 1U58A 5FXCH 4OFDA 1RJZA 3Q1SL 4HKZA 1T66D 2HFEA 4LHUG 5JLZB 4TVSa 3SJVA 1KLUA 1HKFA 4QRSA 4ZTOH 4A6YA 1BFOA 2CO6B 3EJZC 5HD8D 3MBEC 4NNYA 2E8ZA 1N0XH 2GTWA 2PYEA 3MNWB 4WFED 2BC4B 3S37H 2I25N 5GJTL 4RGMB 1RUPL 4MX7B 4MA7L 5SX4I 4BH8A 3G6DH 1KOAA 3ZDYF 2Z8VC 3CAFA 5L0QC 1TXKA 3CFDB 2NY4B 2H2PD 43C9B 5DUBB 3QHFH 4MD0B 5ILTL 5E2WL 3P4MA 4C58B 1GAFL 3WIHH 1IGFL 3P9WB 3C6LD 1QO3B 3UJTL 2BK8A 1ND0B 3AM8A 4Z7VB 1U8IB 3LKPB 3RKDD 1ZVSB 5IJVA 1NLBH 1Z9SA 4X9BA 1QPXA 1R5WA 3S88H 5DD0L 3CFJB 4FMKA 1QRNA 2FECL 1TVBB 1YNLH 3QXUA 2KL6A 3MOBL 3KPRE 4NIKB 2X5PA 3KDMA 2EYSB 4BFIA 1W0WA 4PJ8C 4M7JH 4K9EL 4DOHB 5SWQA 2BFVH 1LD9A 5F7DA 1EH9A 4HUMB 1ZE3C 4M03A 4PJBE 3LQMA 5DGQA 1YNTA 4P59H 4G6JL 1NEZG 4XCFL 2OI9C 3AS0A 3F5WB 4P2RB 3V4PH 4X98B 1KEGH 3LQZA 1N5YH 2FEDD 4JFQB 3OKLB 4HGMA 1B6UA 1TVHB 1MJJA 3OZ9H 5GRJL 3RVWC 5GHWL 2IJ0C 1A9EB 1U92B 3JTTB 5TE6L 5DJDA 3SGKA 3TJHC 2BVOA 3QNXA 3O8XD 3O6FB 1HNGA 4WRLA 3UTOA 4NRYB 4WFEE 3WL9A 3P0GB 2G2RB 3BZFA 4DZBB 4K3DH 1KIUA 2A9MH 4JDTH 1AP2A 1IL1A 4LU5L 3EYOA 3TNMB 1A9BA 4PGBA 4U7SA 4Z7UB 1WT5A 5T33L 4Q2ZA 1TTGA 3CFIC 4M5ZH 5TPWL 3WSQL 1WFTA 2RR3A 5AAWA 5MP6L 3B2UD 5F3BA 3UTSD 1T80A 5EBMA 2ADJA 4GS7C 1XGPA 4N0FB 4TTDC 4GG6E 2YSSB 3O45B 3RWDA 2I24N 1NKOA 2IH3A 1T66C 2E27H 2VRAA 3JV4A 2W9LA 4MNGB 1Y0LA 2J7LA 4HIHB 1B6DA 3VH8B 5HD8C 1JV5A 4X4YA 5CS7A 4P5TC 3SGEH 4QXGL 4HJ0D 1F11B 4XPBL 4P3DA 3UBXB 1BFSA 1VFAA 1JZ8A 5DFTA 3CXDL 3RI5F 3A6OA 3L3GA 3AB0C 3O41B 3QFJD 5KS9B 5C3TA 2NTSP 2G9HB 3DI3B 3NCEB 3BUYA 3HCVA 3GUTB 3PHOA 1J8HD 1XZ0B 2GY7B 4FXKB 3MLZH 4FABH 1EAPA 3C6LC 3VXRD 3WFBH 4P3WA 3MROA 4RMRA 3RKDC 5H8DA 1MIMH 4HJJL 1A7PL 1AI1H 1MCNA 3FOLB 5JQ6L 4XNMA 1LK2B 2R2CA 1YQVH 3AREA 4AEIH 4K2UL 4DN3L 4MB4A 1EHLH 1G6VK 2WBKA 4YR6A 3ROOB 1HK6A 4XPTL 3HE6B 4GW5A 3F62A 4G7YL 3NOIA 2VDPL 2VE6B 4RFEA 4XWOC 2V2XB 2PXYA 3PP4H 3MUGA 2VDML 3P9LB 1BZ7B 4F58L 1KULA 3LKOA 4LCIH 4K55A 5BXFB 3BEWB 3PABA 3HG1D 5GRZA 3HE7C 1S7RA 2FEDC 3DSFH 3DXAB 3EYFA 3MGTB 4X5WB 5B39A 2FR4B 3GO1L 1R5IB 1HN1A 4NBXB 2DL2A 3MLTB 1CGVA 1YQ2A 3GSQB 4JPIB 2V9QA 4LCUA 3ARDC 1TZIB 3O8XC 3NCCB 4PJ9A 4G8GA 4BFGA 2NXZD 3C8KA 3O11B 1EZVX 3MA9H 3ZE2E 2V5RA 5D7IA 3HAEG 3RTQA 4CDHA 5IEHB 2XNAA 5HHMD 4WU5B 1TETL 3QFJE 2IQ9H 3DWTA 3MMEB 5F21B 1YC8A 3NFNB 3O4LA 3TBSA 1FL3A 3IVKB 3S4SA 2DWDA 4KUZL 4EQ2A 3B2UC 2VDLL 4P9HH 3T4YB 1J8HE 5ESVA 2MHAA 4JZJA 1FZJB 3GSVB 3VXRE 2DQTH 1IGJA 3RPKA 4GBXA 2EICA 4CDGC 3JV5A 1IAMA 1JGLH 5ETUA 1DUYA 1CK0H 1FL5B 3MRGB 3DRTA 1CI5A 3I6LE 2CK0L 1T1XA 4KDVA 4U1IB 2GUOB 1ZGLP 3GZKA 4HJ0C 2X4PA 4OLUH 3J8F7 5CD3A 4HFWA 1H3XA 3DRQA 1KCSH 3D18A 3Q5YA 1JTOA 5D7IF 5H94B 3SE3A 1I9RH 1TMCB 4I77H 5IB2A 3BJLA 4OFKA 4J23A 5F7FA 5C0RH 3KXFD 2QLVB 2B1AL 3KJ6L 3HG1E 2QSQA 1A1OA 3I6KA 4URTB 4X9IA 3GSWA 1OVZA 4P57A 4QRUB 4NQEB 4M4PA 4LHJB 2X4QB 4NUJA 1WVZA 4M8QA 1T7VA 1INQB 3RDTA 3SCMB 5IFHH 2YC1B 4QHKI 4WI4A 1QHOA 3I3BA 2BHUA 4XNXL 5L8JB 2G5RA 1RIUL 1LO2H 3BRFA 1M7IB 4JN2B 5L9DH 1MHHA 4MQXC 3OV6A 4EUPH 5K9OB 1M6OA 3GMRB 4GRLB 5E5MB 1QBLL 5D1ZB 3T08A 4JO2L 1G9NL 1NL0L 2IEPA 3MRMB 1ZLWH 2I27N 3LHPH 3ZSSA 3W9DB 1DLHB 2NY2B 4OSUH 2Z92B 5DZOA 4H8WH 4ZPVB 2D3VA 1TVDA 3MXWL 7FABH 4W4NA 4OIAA 4MCYA 3RGVD 1ZLWK 3GRWH 4A2LA 3T0WA 2VOTA 4KTEL 5D1QC 1JP5A 2NXZC 1XR8A 1QSFB 4Y4HA 1OAQL 2BHZA 4GRMA 1FAIL 2CKBB 3BWUC 3EAKA 4I4WA 1KB9K 5CAYB 2B7DT 4YHKL 4PRHB 4RMTA 4HS8L 1N4XL 3V0WH 1CD1A 3KXFE 4MQTB 4JRXB 5TF1L 1MAMH 1SMAA 4CN6A 4JFZH 2BVPA 4DVBB 1HKLL 2FBJH 1NGWA 2FJFA 1CIUA 1UB6B 3FT4A 3TBTA 1LWRA 3L7EA 3U7WL 4QGYA 4KY1L 2X41A 2XZZA 3QFDA 4ZODA 1CLCA 3LN5B 2XWBB 2I9TB 1IGTA 1P1ZA 3RIAF 4KJYA 4Y19A 5ACLA 5IVOA 3EOBB 3DVNB 1KIPB 1FH5H 4JVUA 1IC7L 2VDKL 4TUJB 1EFXB 5DYOA 1EJOL 5EO1B 1LGVA 1JZ7A 1HILB 4X7EC 4U3CA 1PKOA 4TUOB 2XA8L 2IFGA 1XR9B 2B1HH 3HHRB 4RGNC 2V5YA 5FFLA 5ISZA 2P8PA 1XGRB 4FQLH 4X9HA 4ELMA 1JL8A 4JFEB 4JO4L 5ALBH 3S9DB 1YYMH 1HNFA 4MNQE 2D2OA 3N85H 3WO4C 1RZJC 2BY2A 1QR4A 1Z2KA 2CD0A 1XGUA 3UTQA 4WEMB 5DHYB 5EZLA 1RHHA 2QTEA 3MGOA 5L2KD 2HJLA 5EUOB 4UV7H 1MHEA 4S1RL 2BNRA 4MA8L 4KZDH 2VWEC 1I3GH 2E6QA 1KB9J 3UTTB 4JG0H 1KIRA 3N50A 2FX9H 2R4RL 5I8KL 4PRPD 5CEXB 2XIDA 4LF3A 3ULVE 4HS3A 3BKCH 5F9OH 5IKCB 1OB1B 3SHSA 5IVNA 3UTPD 4P5MA 1G6RH 2EDJA 2JB6B 1VFBB 3WUWA 1KB5A 1FLRL 2V7HA 1FV1B 4ELMF 2XICA 3L5HA 1AQDB 1I7UA 3DVFA 4LSDA 1C5CH 1J11A 2X1WL 4U1NA 3ZZ1A 1AC0A 1IKFL 3VXOB 4OGXH 1NC2D 2OR9L 3CH1B 4G8FA 5ENWA 1VFMA 2EE3A 3GJFA 1IAOA 2FECI 3MFFA 3TVMC 1OAKL 5EOTB 3R06B 3U0TA 1UCBL 4Y5YC 1RUKH 5C0FB 3REWB 2UYLB 1B4RA 4Z95L 3QNYB 4XBPB 3CFBB 4FZ8H 2J5LC 3FQUA 1YEDB 3NABH 4XP6L 1QPPA 4MQ7B 3BISA 1NAKL 2NLJA 3PHQA 1ZGLM 1CGXA 4XCEB 3IF1A 3PXHA 1FNGB 4WHYG 3R1GH 3NACL 3X12A 4YHZL 1JFQL 1OWRM 1HXYB 2XG5A 4RQQA 4TSCL 5CSZB 3JWOL 4E42B 2P7TA 1QG3A 4L5FL 1JGVL 3AMKA 3RZCA 3BGFC 1BOGB 1EHNA 5HJ3A 5DO2C 5F7EL 3TIEB 1QBML 2IWGA 5HGDA 1DBKH 1ZANL 4U1JB 3T3PE 3GEWB 4PRPE 1BBDH 1S7WB 2HN7B 4GQ9H 4MQSB 5E4EB 4EOWH 3T4AA 1L6ZA 3N9GL 4NQCD 4U3XA 4G9FD 4YXKH 2JJTA 2R0LH 2DQEL 4LAQL 5D6DC 1CDJA 5AD0B 2VZOA 3UTPE 3FONA 4N8PA 1JHKL 1K85A 3WYRA 2YD7A 3AU1A 3TCLA 1XF5A 1G0XA 3N0PB 3FRUB 1EUTA 4EI6B 3V7AG 5I15H 1TZHA 3V5HB 5INCB 5T1LA 4G6MH 1WSST 4ZTOL 2R23B 4L3CA 3U48A 2BVQB 1EEYB 1UB5B 1N0XL 5CP3A 5JW5B 5E9DA 2GJ6B 4XX1E 3S37L 4M6NH 4OM0H 4OLVH 5IW1A 3G6DL 2DS4A 5F1NB 2VKWA 5BV7C 1NFDB 3ARGA 4OD1H 3Q6GH 3QHFL 5J06A 5FOBB 1IBGH 4JFDA 1IEBB 3IDGA 4HH8A 4YDVB 4YK4C 1INEL 5DURB 2Y7QA 5LBSH 3HAEH 3WIHL 4WIQA 3QJHB 4WFFD 1FZMA 3U36A 5GIRB 3QDMA 4JFHD 3Q6FB 1NLBL 4F33A 1QSED 4WNQB 5ITFB 3S88L 3MV8A 4ZOBA 4AJ0A 4HMEA 1SYSB 4HT1H 5HI5D 1QLEH 4WV1C 3IAGC 2EH8H 2YPLB 1YNLL 4L3EB 5I1LB 4D3CL 4RNRB 2XKUA 3TBVB 2V2TB 1WCBA 1CFNA 5ALCH 4M7JL 1UQSB 5IHZB 4NQCE 3VJ6A 5FKPA 1NANH 4G9FE 2NW3B 4QWWD 1EZVY 1MEXH 4LSRH 1IGCL 3L3IA 1G7HA 3QEQD 1QACA 3FQXB 3HPLB 4P59L 4UDTB 4N90D 1NBQA 2OP4H 4YPGA 3BVNB 4Q6IA 5LCVH 5IEKB 5DVKA 1WBYA 1NCDH 3V4PL 2A6JA 1HQRB 3EO1A 5F9JB 3NCJH 5I1EH 5DRXB 2NY3B 3OZ9L 5CIPB 3UPRA 1RUAH 4GLRI 2QADD 4B0MM 5F6IC 2QJDA 3MV7A 3WJJA 5HHNB 3QDHA 5I73B 4K3DL 4LBEA 4JDTL 2A9ML 3QQ9D 3KAAA 1G9MC 4WENB 1UC6A 1XF1A 1XGTB 4PJDA 3MLUH 5AAMA 4OCWH 1PG7H 3O3AA 3NA4A 3LIZH 4YNYA 2NYYD 1WIPA 1TENA 1SY6A 4WFFE 2DQHH 2VLKB 4JFHE 3QUXB 5EZJB 4LCWB 2Z35A 3V6FB 2E27L 2J8UB 2CLRB 4NQDD 4WVRA 3IDYC 4LVOC 5IVXE 1MLCA 3PL6D 3SDAB 2BNQB 4XAWH 1B2WH 5F93C 1J05B 4GMSH 4CVUA 3GMOB 3VG0H 1YEFL 3VXQA 4DUWA 4MWFB 4NN6C 3T0EA 3G5ZA 4HCRA 3JV6B 1RJYA 3VGGA 1ES0A 5DSCB 4N90E 2PW1B 4PJDF 1V05A 1F8TH 1YYLH 1WEJH 1KTRL 3X3FL 1LNUB 3MLZL 1KF9B 4FABL 2FDBP 2AEWA 3WFBL 5JLZA 5GGSY 3TO4C 4CN1A 1AI1L 2IAMB 3QIBB 2D0FA 3ZDZF 1YQVL 1NH6A 4WHDA 5C0CD 5HI5C 4Z18A 3MNWA 2BC4A 4MX7A 5GJSH 1NCBH 4KVNH 3OR6B 3CFDA 43C9A 2NZIA 5DUBA 1P2CB 4MD0A 3BP7B 5C07B 4GAGH 3F58H 3D85D 4LSVH 2X89D 4AENB 3TZVC 1LEGB 3HZMB 1QO3A 4LCIL 4Q97A 1DFBH 1ND0A 4Z7VA 1U8IA 3LKPA 3ESUF 1ZVSA 3DSFL 3KG5A 3OF6D 3QJFB 3DI2B 1A6PA 1NBZB 4NQDE 2EE2A 2QADC 2QBWA 1TVBA 3VXUE 5J6GB 3F7QA 3NPZB 1XEDA 4AYFA 4YUEH 3GSXB 3SY0B 3MRQB 4IJ3C 2A9NH 2EYSA 3MA9L 2ITDB 1ADQH 5E03A 1JYWA 3QQ9C 3DURB 2IQ9L 3ZSTA 4K8RC 4ONFL 4X8XA 4Y5VB 2BERA 4P9HL 3F5WA 4P2RA 4QF1B 4X98A 2L7UA 2NYYC 4WWKD 4R7NB 4KJQD 4JFQA 1TJIH 3OKLA 1TVHA 2DQTL 1MCWM 3BD4A 1A9EA 4Z7VF 3VFVB 1U92A 1JGLL 3JTTA 4RMWA 4FMFA 1P9MC 1CK0L 3O6FA 2GT9B 1FC1A 4PJCE 5HYSG 4NRYA 3O2DH 3PL6C 3ULSB 2G2RA 2NW2B 5DUPH 4DZBA 1A47A 1BVLB 5DT1H 3SQBA 5C3LD 1TDQA 4OLUL 3TNMA 1SBBA 4Z7UA 2ADGB 3ULVH 1KCSL 1I9RL 5F6HI 2IQAB 3GHBH 1IC4H 5BMFH 4OB5L 4NKIH 1I3UA 2DTMH 3GMLB 5BJTB 4N0FA 4ODTH 3SE4A 2YSSA 3O45A 5F9AC 5L6YH 4FA8A 4FQHB 3T3ME 4L4VB 1MCKA 5BVJB 1F90L 4MNGA 4J3VA 4NOBA 4HIHA 2F53D 1IC5H 2X05A 4Z7QE 3VH8A 5IFHL 4TNWF 1RHFA 1QFOA 4WTZA 5CJOH 1F11A 4XHQA 1KELH 5D7JD 3UBXA 1F2QA 3TBYB 1IGYB 2I5YH 5GGQH 2MOVA 5AYQA 4L8CB 5L9DL 1LO0L 4Z7UF 3O41A 5KS9A 2G9HA 5IMLB 4M7KH 1VFOA 3GUTA 3H0TB 2VL5B 5BS0B 1U3ZA 4YDIH 2A38A 1XZ0A 4FXKA 3UXFA 1IE5A 4GO6B 1HIMH 3LHPL 4HS6B 4UB0H 5EIVA 4DEPB 2GI7A 1DVFB 4QNPF 3N1QC 5DGRA 1KCLA 4OSUL 5GGSB 4KI5D 3ZT7A 4B7IA 3FOLA 4H8WL 1JYVA 5C2BH 2ESVB 1LK2A 5CBAB 1WICA 7FABL 1G7PB 1I1YB 1R6VA 2IPTH 2NY0B 4L8SB 5J3HD 1CICB 3TA3B 5I0ZA 2DB8A 5HXMA 2BSSB 2AW2A 3SJVD 3ROOA 2Y4SA 3HE6A 4Y8AA 4QRRB 1U3JA 7CGTA 4KI1A 4UAOC 3MTRA 3D25B 1AGBB 3IRPX 2VE6A 3UAJD 2Q8BH 2V2XA 4NWUH 1NUGA 3P9LA 4KKAD 1BZ7A 5KS9F 4EDWH 3V0WL 3BDXA 1ZMYA 4G6FB 1DL7H 5BXFA 3BEWA 1MF2H 1MAML 4FFVD 4WUUB 4WWKC 2FBJL 4KJQC 3DXAA 3MGTA 4X5WA 4PYHA 5DJ8B 2FR4A 1R5IA 4OCSH 3UYOD 1FL6B 4PJXE 3MLTA 5CZVH 4P3CH 3GSQA 4JPIA 3E1F1 5TQ0H 1F4XH 2YZ8A 1TZIA 4YFDB 5BRZB 3RGHA 1IILE 3ES6B 4KHXL 4TVPD 3KYNB 3O11A 5C0DB 1QRND 4G8EB 1CLZH 1FH5L 1NFKA 1UM6L 2DQFB 2XA3A 5TJWK 4BZ2L 5JQHC 5IEHA 1U2HA 2WINB 2DLHA 4WU5A 3ZDYE 2D7TH 4U7KA 5JUEH 3TC9A 2MWCA 2J8HA 2JF1A 3NFNA 2B1HL 3MMEA 1CXLA 4UTAH 3IVKA 3CH8A 5CUSH 5ECJE 4W81A 4OLEA 4FQLL 1OTTD 3T4YA 1J87A 5ALBL 4CRPA 1YYML 4JQXC 1FZJA 1UACH 1MAKA 4DUVA 2FJGB 2WNGA 3GSVA 4UT9H 1BJMA 4R4ND 4KI5E 2LQRA 4UQ3B 3OXSB 3MQIA 1FZOB 1FL5A 3MRGA 1Y6KR 4ZO7A 3SJVE 4UV7L 4XNUH 1LILA 4KMLB 1R3HB 4JHBA 4U1IA 4KZDL 2GUOA 4K71C 1I3GL 2NPLX 2GSGB 5FV2A 2FIRT 2GIYA 1QFHA 2FX9L 5H94A 4R96B 4U33A 5MEPB 3BKCL 5LGHH 4E9LA 4LSSL 4EUPB 2MFNA 3ARBB 3F7PC 1G6RL 5GGTH 4X7CC 1KXVC 3PDGA 5EC2B 4QRUA 4NQEA 5F7LB 1C5CL 5EBGA 2E7LC 2X4QA 4RBPH 2W0LA 4OGXL 5FA3B 3PWNB 5C7XL 1INQA 3EJYD 3SCMA 3X11B 5F7NC 4WHTB 1KNOB 3VXMB 2YC1A 4RBPK 4TVPE 4PP1D 4Z6AT 3MLSH 1BD2E 1RUKL 3D9AH 3VCLB 2AJUH 3FT3B 1PFCA 3RWIB 4XVUC 1P7HL 2NNAB 1H8OA 1M7IA 4FZ8L 1VEOA 4JN2A 2ZCLH 2C1PB 3J7HA 3EDFA 1E4JA 5K9OA 5GZOC 3GMRA 1EO5A 3PWPB 4GRLA 5E5MA 1CDGA 5D1ZA 3T0AA 1LP9E 1CGSL 4OGYH 5HYJB 4XP4H 3MRMA 2W38A 4NHCH 3U0WH 2JE8A 1YNKH 4FFVC 1BP3B 1DLHA 1S9VB 3W9DA 1GC1H 3R1GL 3BPCB 5CSGA 2Z92A 3F7YB 4ZPVA 4C83B 4E0RB 2WQ8A 3AM8C 5SWZB 2UY7A 4MS8D 3K7UA 2WP3T 3ARED 3S7GA 1QSFA 5FUOH 1DBKL 3OKKB 4RWYH 2LU7A 1BBDL 3S35X 2CKBA 1P4BL 4GQ9L 4EOWL 2EH7H 3MJ8B 4YXKL 2R0LL 2LU3A 3U46B 2JIXD 4PRHA 2I07B 2HWZH 4YQXH 1OTTC 4JRXA 5CJQH 2PXYD 4DVBA 1PSKH 1NCAL 1PEWA 1UB6A 4BM7A 4R4NC 5I15L 4JO1H 4JY6B 1N0LA 2VYRE 1MWAH 1NSNH 2X4RB 4G6ML 3LN5A 2XWBA 2I9TA 2BVTA 3SGEI 3OR7B 1HZHL 3IETB 3EOBA 3KPRB 3U79A 3DVNA 4D8PB 3SGKC 1KIPA 3WD5H 2CLZB 4P2QB 4TUJA 1EFXA 1YN6B 2W1NA 5EO1A 4PJ9D 2I9LB 4M6NL 4OLVL 2RBLA 4G8GD 1HILA 4GAJH 4TUOA 3H9HB 1XR9A 1JE6A 2VR4A 3PWVB 1XGRA 4OD1L 4JFFD 4JFPB 3Q6GL 1G6RB 1I8LA 5DRZB 4JFEA 1WT5C 4Y88A 1IBGL 5KAQG 1HEZB 2BVEA 4M4RA 1FCGA 4RA3A 1C8PA 2FHFA 5LBSL 1FBIH 2UV3A 2QV2A 3P9MB 1K3IA 2QR0B 3DECA 1O0VA 4XC1L 4LMQI 5DHYA 1RZ8B 4HBQA 4O2FB 3SPVB 5ADPH 3EJYC 4XZUB 3F12B 4GBXD 2AABL 5EUOA 4HT1L 4KHTH 1QLEL 3EZJB 2EH8L 5C0NC 3BPLC 5FB8B 2YPKB 2P5EE 3UTTA 4DK6A 4C55A 5ALCL 5CEXA 1I9IH 3AS3A 2J6EA 2VLMD 4HHAB 2IFFH 5IKCA 1OB1A 1MEXL 1PY4A 2D7PA 2JB6A 1VFBA 1FV1A 2HVKB 2OP4L 2UUDH 2E9WA 1AQDA 5LCVL 3L5IA 1NCDL 3VXOA 5DFVC 1IC1A 3NCJL 3CH1A 3L1OH 5I1EL 2UUDK 2F58H 2W91A 3IDJB 4L8DB 4JZNB 1FFNB 1RUAL 3OKNB 5EOTA 3MLRH 1SYVB 3R06A 1UWGH 2NY6D 3WE6B 3IAPA 5C0FA 3REWA 2UYLA 5EUOF 1MRCL 3RDTD 3AREC 3T1WA 4KTDL 2GSIB 1IARB 3CFBA 3QNYA 4XBPA 4LLMB 4MMZC 4G8GE 2R2EB 1J8KA 1YEDA 4MQ7A 1VGEH 4J1UB 3WLBA 3KNBB 3MLUL 4JFFE 5B39G 3MRPB 1Z6JT 2D7QA 4OCWL 5EZOH 4XCEA 1YEEH 1PG7L 2QEJA 1TZGH 3TN0D 1FNGA 3LIZL 2PXYC 2YD5A 1H3VA 1JTTA 2BDNH 1HXYA 4TNVF 2DQHL 1A6AB 4F15C 5CSZA 1LE5B 5JMOC 4E42A 2FX8H 1T4KB 1Z9MA 4JQIH 3RWCB 3MZGB 1BOGA 4FS0A 2WK2A 4OD3H 3F6LA 3TIEA 2CUMA 3VDCA 4XAWL 1B2WL 1UZ6E 4U1JA 4GMSL 1D5BB 5DUMH 3VG0L 3S4SG 4OBRA 1S7WA 1GOFA 2HN7A 4PJ9C 2VLME 4JCLA 2D9QB 2XWJB 1A0QL 4CAGA 3MC0A 5LQBH 1CFQB 5AD0A 4Y4HD 4B5EA 5J56B 4MDIB 4O00A 3U4EB 1WITA 3RTQC 3TNNB 4BFEA 4LVHC 4P46B 5ESAB 4HMDA 2Q86B 1F8TL 1YYLL 3O6MH 4PP2B 3LZFL 3FRUA 4OLWL 1WEJL 1A14H 6CGTA 4EI6A 1URLA 3BEVB 3V5HA 5INCA 2ZP0T 2CGRH 4JZJC 2R23A 5I76B 4GBXC 2YPVH 1X4YA 3HR6A 2BVQA 2VO5A 1EEYA 1KJ2H 4S2SB 1UB5A 5EBWB 2E8YA 3B6SB 5JW5A 3UX9B 2GJ6A 1JGDB 4NKOB 1UH2A 2R0ZH 1ROWA 4Y19D 1FDLL 5GJSL 1NCBL 4ZSOB 5F1NA 4KVNL 3NIFF 2IMMA 3FOMB 2R39A 1NFDA 3CDYA 3QFJB 3G5XB 2VSDA 4GAGL 3F58L 5FOBA 1PX3A 3SE3C 1IEBA 4LSVL 4YDVA 1K9TA 1VERA 4LGPB 2PNDA 5T5NF 1X5AA 4HUVB 3QJHA 1DFBL 5GIRA 4X6CF 1NGPL 5E8EB 3Q6FA 1S9XB 3DMMB 1BEYH 2GCYB 1DTUA 4WNQA 5ITFA 3T0XA 1JYXA 1SYSA 3VGAB 1RY7B 3NH7L 2NY6C 2YPLA 1KJVB 4L3EA 4NRZB 4UT7H 5I1LA 1MFAH 5I71C 3DX9B 4RNRA 4YUEL 3RDTC 3STLB 3AY4A 3TBVA 5I1CH 2A9NL 3WUZA 2NY5H 2COQA 4OGZA 1ADQL 1UQSA 5IHZA 1HHHB 4IMLB 2HKHL 2NW3A 4N5EC 4ENED 3BYTA 1KEMH 5F44A 3FQXA 3HPLA 4UDTA 1NFDF 4PJ7E 1G7QB 5E24E 3BD3A 3BVNA 5C09E 5FUZH 4X0KB 5IEKA 1TTUA 5LWYH 1DR9A 1MI5E 1HQRA 5F9JA 1TJIL 3CVIL 5DRXA 4NNXB 5CIPA 5INDB 1KC5H 4RA0C 4KU1A 4R97C 1MFCH 1WISA 3NCYS 1YMMB 4HBCH 1DANT 2FO1A 5DEZA 5FV1L 5DLMH 5HHNA 5DUPL 3OB8A 4TUKH 2CDGB 5JOEA 3QP3A 4OBSA 1FFRA 2IADB 2X4OB 1NBVH 3OSKA 5EULV 2OYPA 3ULVL 1WIUA 1CGTA 4M7LH 1XGTA 1MHPH 3GHBL 1IC4L 4CMHB 5BMFL 4Y4HC 3DIFB 1N6VA 3TFKD 2DTML 4LOUD 1LQSR 4ODTL 2VLKA 1GZPB 1EFQA 5L6YL 3QUXA 2DQGH 5EZJA 3AAZB 4LCWA 5I8EB 3V6FA 2J8UA 2CLRA 1WUNT 1EJ6A 5E6ZA 5F8QC 3M07A 4Y2DB 4S1QH 4TVPH 2Z91B 1IC5L 3SDAA 2BNQA 2H8PB 3VI4F 5FKAB 2BJML 5CJOL 1J05A 1NUNB 1TLKA 3GMOA 5DMYA 3RZCD 4YHYC 4MWFA 4LVEA 3ZLQC 3KLDA 2I5YL 5GGQL 3JV6A 3PV7A 4YXHH 3OL2A 3BH8B 5DSCA 1F5WA 4FP8H 3SKJH 2NQCA 5JIPA 2PW1A 3TH2T 3ARUA 3KXFB 2X9YA 1ED3B 4YDIL 1LNUA 3T04D 4KKCD 1HIML 1MOEA 4LLWB 3SN6N 1MAJA 1T1ZB 3QIBA 2IAMA 2ENSA 5C2BL 3BP5B 3LKRB 2IPTL 3BT2H 1L9NA 1O7VA 3QHTC 1TQBB 5T1LD 2G75B 3RWGB 2M26A 3HI6L 4HUKB 2OJEB 3WUWG 3DSNA 4X7TB 4JDVB 3OR6A 3K80A 5E9DD 2QKIB 4ENEC 1P2CA 2Q8BL 3BP7A 5C07A 4NWUL 4FQCH 1KN2L 1OD7A 4HEME 4BQCA 3C8DA 3GIZH 4AENA 1LEGA 4EDWL 3HZMA 4MNQB 3W0WA 1DL7L 4DWHA 3ARGD 4N1CA 2PW2B 3RNQB 1VESA 5J12C 1U42A 4JFDD 3QJFA 4OCSL 4HXBL 1D9KB 1NBZA 3PWJB 1BWWA 5CZVL 3RGVB 2CQVA 4P3CL 1YEHH 1Z9OA 5T1MB 5HTSA 3TT1H 3C9NB 5LKNA 1QLRB 2VC2H 3QDMD 5J13C 3GKZA 5J6GA 5JORB 1G1YA 1D5MB 3GSXA 3QBTB 3SY0A 3MRQA 5C0BB 2ITDA 1NGXB 1CLZL 3L5XL 4ETQB 1SEBB 5IMOB 3L3KB 4XMLH 3DURA 4O58H 4Z9KB 3DUHA 4RFOL 2D7TL 4POZD 2Q3AA 4UTAL 1I8MB 5CUSL 5KVEL 2LV4A 4Y5VA 3TFKC 5JHDD 4QF1A 1UACL 4R7NA 4UMGA 3GB7B 4UT9L 5E2UL 3WNOA 3WN5B 3VFVA 3ARSA 5BVPH 1MQ8A 2GT9A 4J2XA 4HH9B 3QDGB 3I2CH 1KJMB 4HZLB 3ULSA 3FB7B 2I26N 2NW2A 4XNUL 1BVLA 2VXTH 3LPGA 1FZKB 3RZCC 1DSFH 2NXYC 4QHNB 3S36H 2ADGA 4U0RC 2X9WA 2IQAA 5JOPD 1J5OH 3GMLA 5BJTA 2FZ3B 5GGTL 4YX2H 2JJTC 4NKMB 5HGBB 4R0LB 1BMGA 3ZKND 3U9UB 4FQHA 4LLUB 4XB7A 4L4VA 1BQLH 5F9WC 3NFSL 5BVJA 5GRWA 5D7LB 1BOYA 2F5BH 3MRCB 4IOFD 4LHQB 2EIEA 1X9QA 5A43C 4KROD 5T5FH 3KVQA 2BOCB 2AJVL 3MLSL 3D9AL 1CD0A 2AJUL 3TBYA 1KUMA 1IGYA 3WNPA 4PRPB 1NANI 2EDLA 4L8CA 3DNKA 2ZCLL 1HHIB 2JJSA 1QD0A 1KJ3H 3PG2A 5IMLA 2AQ1A 5B21A 1J1OH 4OGYL 3T0ED 2W9DH 3H0TA 2VL5A 2DJUA 5GGRY 5BS0A 1C12B 5JHDE 4M7LT 4NHCL 3U0WL 1M1SA 4PJAB 3ARGC 4HS6A 5IK3B 1YNKL 2O5YH 5IHLB 1DVFA 1GC1L 1CD9B 1XIWD 1K2DB 5GGSA 3H42H 5A2JH 2EIBA 4QOKB 2ESVA 5KZCD 2GJJA 5CBAA 5IP4A 1G7PA 2GYSA 1KGCD 5GS1B 1I1YA 3WFHB 2V2WB 4L8SA 1CICA 3TA3A 1KN4L 2BSSA 2ZOKB 4CW1B 4ZNCD 1W0YT 4QRRA 1LVEA 1CXHA 3C08H 1J86A 4EDXB 2OXHA 4HUXB 4JN1L 3D25A 1AGBA 3UPAA 3IDIB 35C8H 4HUNB 3QIUB 2EH7L 1FFQA 5A2FA 1F42A 2HWZL 2NY4D 2FLBT 1EX0A 4YQXL 1MJUH 5I75C 5HHOE 4WUUA 3QDJE 1W72H 5CJQL 2VJXA 3MLYH 3MUJA 3HTLX 1PJ9A 1I1AD 5KSVB 5DJ8A 3VMNA 3ELAT 1FL6A 4Q6IC 3DOSA 1MCFA 2LFGA 3UO1H 1OT2A 4JO1L 5BRZA 3ZDZE 1MWAL 1NSNL 2ZSWB 2E7HA 2ATKB 2CSPA 3ES6A 2Y72A 2YUZA 3KYNA 3S36X 2ED9A 5C0DA 3IU4H 3ZO0A 3NZ8B 4NBZB 3VD5A 4G8EA 3WD5L 4Y1AD 4R4FH 2R56H 2DQFA 1VADB 2R15A 4NQCB 4WO4B 3MLXH 2WINA 4GAJL 4FFZH 3WJJC 2V2TA 3QIWD 3O4OC 5J8OA 3T0EE 3PQYD 4LKXB 1VEMA 1UM4H 3MRRB 5KANG 2FJGA 5LGJB 4PRNB 1C5DB 1FBIL 5DZNA 5D96B 4CU6A 4UQ3A 3OXSA 4P2RD 1FZOA 4RMUA 4IOFC 5JOFB 1QYGH 1QA9B 3FCTB 5FO8B 1FO0L 2ILLA 4KHTL 2J4WL 4WTXA 1R3HA 2C9AA 1UWXH 2YD4A 4NZUH 2GSGA 3O6FD 5GZND 1I1RA 2YS4A 3BJ91 2APWA 3EDKA 1MFDH 4RGOH 1CTNA 5CMAB 4R96A 1I9IL 1UWXK 5MEPA 3EBAA 4OLXH 5CD5D 3MRLB 1L7IH 2IFFL 4NO0B 4EUPA 3ZKXB 3ARBA 2AJYH 4HAFA 4KDWA 2A74B 3T0EC 3R8BB 1MVFA 3RL2B 2CIKB 2A6DB 5EC2A 1NKRA 4OD2B 3DPBA 3GMMB 4XXCA 5FA3A 2LAGB 3L1OL 3E2HB 3PWNA 5HHVH 3VWKB 2F58L 4Z7VE 4WFHD 4BH7B 2JJWA 3X11A 3GRWA 3K2UL 4WHTA 1KNOA 2FX7H 3VXMA 3MLRL 1UWGL 4XWGH 3P30H 3U9PH 3VCLA 5I1DB 3FT3A 4Y1AE 3RWIA 3ARFD 2NNAA 1LDPH 3UEZA 4LPWA 2Y23A 2C1PA 4TRPH 2MQ0A 1VGEL 3O3DB 3PWPA 4RGMC 4U05A 4DOHE 1U8NB 3PQYE 5HYJA 1MRFH 1U8PB 5GRYA 5J11B 1AFVH 5GGRB 1E4KA 4X6BB 4PLNC 1BX2B 1YEEL 2NY4C 1LEIB 1VKXB 2GTZB 1TZGL 1S9VA 5I2IB 1DUZB 3WS3B 3SDYH 3IJYB 3BPCA 3S8WA 3H6JA 3F7YA 1A6UH 4XBEH 4P2RE 4F8QA 2BY1A 5HHPB 3ZE1F 4C83A 2FX8L 4E0RA 4JQIL 5SWZA 3K1KC 2PR4H 1WV7T 3KJ4B 2RB8A 4CVZB 4OD3L 1FRGH 4PS4H 2V5SA 1CDUA 2ITCB 2HRLA 3OKKA 5DUML 1DEEB 1EPFA 3MJ8A 3U46A 5LQBL 1YPZE 3K4ZA 3OTTA 2I07A 4N0YH 2HTLD 3B9KD 3E8UH 1JF6A 2XPGB 4GW1B 4R90L 1A14L 5LAXB 4R26H 5I1HH 4ZXBD 1DN0B 4JY6A 4WFHE 2MJWA 2CGRL 5B8CB 4LPVA 2X4RA 1N2RB 3DXAD 2YPVL 1KJ2L 3VXUB 3OR7A 3IETA 4PRDB 3KPRA 4D8PA 3FQWB 4PPTA 2CLZA 4P2QA 1YN6A 1SJXA 3O6FC 2VQUA 3VMPA 1JPGB 2I9LA 2R0ZL 4HIXH 4LEXH 1P7QB 2JJUA 4ZFOB 3H9HA 4QHLB 2Q6WB 3SDCB 3IDXL 3PWVA 1U8QB 1U2CA 4JFPA 5DRZA 1G6RA 3MCKB 3FT2B 3HZKB 1KLFA 3ALPA 2A77H 1HEZA 5EUKA 2DI7A 3H2WA 1H8SA 4AM0B 3CVHL 3V8OA 3BHBB 3FO2B 3VH8G 3P9MA 1JNJA 2QR0A 4RAUB 4WTZG 1RZ8A 1YECL 3QHZL 4O2FA 4RSVA 3SPVA 3SE4C 1BEYL 3IXTB 2F5AH 4YC2B 3LB6D 3UBXG 4XZUA 3F12A 4KDTA 4EI5C 2C4FU 4RDQF 4J8RB 1EERB 2UWEE 5FB8A 4UT7L 2YPKA 1IEHA 1CLOH 4QTIH 4D0CB 1CT8B 5I1CL 15C8H 2R0KH 2NY5L 1I4FB 4HHAA 3RY6A 1JGUL 1KEML 3VXSB 3D85B 3M17B 1H0DB 4ETYA 2HVKA 3O9WB 4PRIB 4F9PA 2Q7YB 4PBVC 1H5BB 3CFCH 2WIMA 3T2PA 2EDEA 4NC2B 1N3NB 3HC0B 3V95A 5E8OB 3IDJA 2GY5A 4KKLD 4L8DA 4JZNA 4IIQB 1FFNA 3OX8B 3DXAE 5IMKB 3OKNA 1SM3H 4NQED 1MY7A 1SYVA 1F97A 3WE6A 5IWLA 4HLZH 5HYEA 5EZIH 1MFCL 2DTSA 4HBCL 3HZVB 4M5YH 4E41B 3SCMD 5DLML 2Z93B 3ILQD 2GSIA 2XN9B 4TUKL 3HPJB 4LLMA 2R2EA 4BUHA 4PBWD 3KHOA 1NBVL 4J1UA 2Z31D 4HGWB 3HE6C 4CU8A 3P40A 4J3XA 1CL7H 2O5ZH 2V9TA 4LSTH 3KNBA 4MA1B 1MHPL 3MRPA 4K9EC 3TH4T 2HTLC 2UZYB 4KK6D 4GRLD 2L0DA 5D1ZD 3CUPB 3L6FB 4R8WH 3S3PA 1A6AA 4L4TE 4PB0H 1LE5A 1K8IB 4IMKA 4PREB 1T4KA 2NY2D 2RCSH 2H1PH 3RWCA 4S1QL 3D39E 1JWUB 4TVPL 2X10A 3H3PH 4NCDA 1I8KB 4DFHA 1MREH 3BIKB 1C1EH 1D5BA 3WFZA 3QISA 3GBLA 1JZ3A 2XWJA 3EFFB 2LTQB 5L88H 2NY1B 2ZNWA 1CFQA 1LMKA 2ZKHH 4M43H 2D7OA 4G5ZH 4YXHL 4MDIA 3U4EA 1AD0B 3TNNA 4MJID 3K4DA 3FB8B 4FP8L 4P46A 5ESAA 1G9EA 3PGDB 1FJ1B 2Q86A 2MMXA 3DGGB 4PP2A 1F4WH 3LH2H 4F8TA 3RX7A 4PRHD 4RRPA 1GGTA 1RVFL 3P11H 3BEVA 4JRXD 4C56E 4PJXB 1CWVA 5D5ME 2AEIT 4DW2H 4NQEE 3NN8B 3LB6C 5I76A 1EHAA 2X42A 4S2SA 5D7KD 2IGFH 5DQ9B 3BT2L 5EBWA 3B6SA 5J1SC 1JGDA 1JWMB 5D7JB 2N1KA 4NKOA 2P1YA 1A1NB 3ZHDA 5JW4Q 3MYZA 5DMGD 4ZSOA 2QHLA 3FOMA 5H2BB 3QFJA 4FRWA 2OJZH 5TE7H 4NZJA 3G5XA 2E6JA 3QXAB 4FQCL 3GIZL 2IF7A 4HUVA 3MV11 1Q38A 4Z7OE 3EYUH 4OCXL 2ZCHH 4M1CD 3QI9D 1RD6A 5E8EA 4OZIB 2EECA 1S9XA 3DMMA 4LLYB 5LJYH 3WJLA 1SY6H 2GCYA 4Y0GA 4KKLC 4YBQD 4PV8B 3I84A 1YEHL 4OV6F 2ZZUT 3TT1L 2VC2L 1KJVA 4NRZA 3ZYZA 4HSQA 4HWZB 4PJFE 3DX9A 1CFBA 3STLA 3SCMC 3ILQC 2XTLA 4P4KB 3ZE2F 1HHHA 4IMLA 3BN3B 1B88A 5DR5H 4X9FA 5GS2D 4XMLL 4O58L 5TFSH 3UTTD 1Z9LA 2CR6A 3H8NA 2EC9U 4K7PH 4MJIE 3RIFK 1G7QA 1MVUB 3AC0A 4X0KA 4GRLC 4F37K 5D1ZC 2L7JA 5C0IB 4JRXE 3NA9H 4NNXA 2HVJB 3PIQB 3GSRB 5INDA 1CQYA 2AS5M 3HNVH 4ZS6D 2FB4H 1U3HB 1A7NH 2NY2C 2RHEA 4Q58C 5BVPL 1YMMA 5D7KE 3OG6B 4U1MB 43CAB 1FE8H 4V1DB 1BD2B 3I2CL 4RX4D 2X09A 2H41A 4L8BB 1Q1JH 2CDGA 1PLGH 1BLNB 1DSFL 2IADA 2X4OA 3BIBX 3S36L 3OKYA 2OL3H 4JPVH 1WQVT 3KYKH 1LP9B 3DIFA 3IXAB 1J5OL 1K4CB 2F54D 3X14B 1T21B 4YX2L 4JPWH 1G7MB 3I02B 2VQTA 1GZPA 4W4OA 5AWNH 3AAZA 5I8EA 4M9OA 1BQLL 2F5BL 4LGSB 5KG9B 2LVEA 4Y2DA 4EN3D 3MCG1 2Z91A 4XMKH 1R3LB 4NC1C 5M94B 2H8PA 1MCRA 4ZYKB 5FKAA 5T5FL 3WKML 5F70A 3NMEA 2DM7A 1IVLA 4J3SA 3IGAB 5DMGC 3P77B 8FABB 1L0QA 4JY5L 4RWHA 4M8VA 4OUOA 4YDLB 3BH8A 1J1OL 3E3QE 2C5DC 3KXFA 2W9DL 1KCVH 1ED3A 2HTKD 5CZXD 3AROA 1X5IA 4M1CC 4Z0XB 1I8LC 4U49A 1U0QA 2EZ0C 4UINH 4LLWA 5GPRA 1T1ZA 1SVCP 3I6GB 3H42L 1S5HB 3BMWA 3IKCB 3LDBB 4AEHH 5DC0A 1B3JA 3BP5A 1HSAB 4YBQC 32C2B 3LKRA 5C0AE 4JKKA 1H9VA 3HKFA 4RIRB 2G75A 3RWGA 5F7UA 1YEJH 4ONHB 2IG2L 1KYOK 3C08L 3LKQB 2OJEA 4U6TA 4YBLB 4X7TA 4JDVA 4OZGE 2GJ6D 3IB4A 35C8L 2QKIA 4OUUB 1II4E 2JKXA 5D8JH 4YJZL 4MZ2A 5FDYA 5FIEA 4M6AA 4GG8B 1L0YA 2F54E 2OK0H 4MNQA 3F6IA 1W72L 4HD9A 2PW2A 3MLYL 3RNQA 3VMOA 5JIKA 1ITBB 4ZQKB 1KENH 1PDKA 5DURD 1D9KA 3PWJA 3K81A 3RGVA 4AIOA 3UO1L 3WIIH 5T1MA 3LEYH 1KIQB 3C9NA 5IV2B 4Y4KB 1QLRA 4ZS6C 2VXUH 4JE4B 4D9LH 4DGYH 1D5MA 5JORA 3O2DA 5IR1B 1FLTX 1TCRB 3IU4L 2RFXB 5C0BA 3HR5B 1W0VB 1NGXA 2OZ4H 5D7SH 2NTFB 2P5EB 2DBLH 4ETQA 4MJ5B 2ERJB 1EXUB 1OARH 4R4FL 2YPLD 1SEBA 2R56L 5IMOA 3L3KA 4L3ED 2ZNXA 1EDQA 1NLDH 4OTXH 5DHXB 4FFZL 2R69H 2JIXB 1OAUH 1I8MA 3DROB 4LSUH 2DQCH 4Z78B 3GHEH 3ARTA 1V7ML 4NN5B 1UM4L 2EDKA 1T5WB 3G6JB 3GB7A 2EDQA 4HLJA 4MJ2A 5MHSD 3WN5A 4W70A 2EYTB 4X99B 4F7EB 4HH9A 4F7MB 1KYOJ 1QYGL 2NY3D 3QDGA 4JQVA 1KJMA 4HZLA 3FB7A 4NQSB 2PN5A 5E94B 4Q7DA 4KGJA 1BPVA 4B41A 2B20A 1FZKA 2GKIA 3GSOB 4NZUL 5ID1B 4QHNA 3QUMH 5T5NG 1BVKB 1MFDL 2VXSH 4RGOL 3ZL4H 4MYWB 3CX2A 3DYPA 5FYKD 2MNUA 3B9EA 4OLXL 3ULVF 3WCYA 1L7IL 4D0BB 4KRPB 1S7VB 2ARJQ 4JFFB 2UZIH 2AJYL 5E4EC 5D70L 2FZ3A 1AHWB 3QRFM 1NFDE 4NKMA 1NAMH 4R0LA 5HGBA 2HTKC 3U9UA 5CZXC 4LLUA 3D3VE 1X3DA 4HF5H 4ALAH 5D7LA 4XXDB 3RVUD 3MRCA 1F2XK 4LRIA 5HHVL 2YHGA 4OQTA 1D5XB 2GJZB 1VB9A 2FX7L 3OAUH 2P47B 1OCWH 5F7HA 2BOCA 4XWGL 3P30L 3U9PL 3ARPA 2YXMA 5FYKU 4PRPA 3S5LB 4L3EE 4XC3H 1LDPL 5GGVH 1HHIA 1MHCB 4TRPL 3PUCA 2APTA 3S98A 3RKPA 5JXAH 1KPUB 5ITBL 3L7FB 1AFVL 1C12A 3LVEA 4PJAA 1J1PH 5IK3A 1W72B 5I74B 3DO3A 3SDYL 2VLJD 1K2DA 4NYLB 5CEYB 1S7UB 2LABA 4QOKA 4HWBA 4ZNEE 5ACZB 5GS1A 1HWGB 3WFHA 1AY1L 2V2WA 3B2VL 4YHMH 4P48A 3WO3B 1ODAA 2ZOKA 4HEPG 3QIBD 1KCRH 4S1SH 5CJXA 1WLHA 4CW1A 2IBZY 2BVYA 1FRGL 4PS4L 3ET9F 4OF6A 1A1MB 4EDXA 4HUXA 1PKQE 1F3JB 1AR2A 3IDIA 5DWUH 3NCFB 3QIUA 1VEPA 3FO9B 3AY4C 4DKFH 4H1LH 5MERB 1S9WB 4N0YL 1NQBA 3E8UL 3TN0B 5C07D 4I18B 2HKFH 5KSVA 4AQOA 1IFHH 4PJAF 4R26L 5I1HL 3PWUB 3BAEL 1BIIB 3W0WD 4Z77B 3STBA 3Q3GB 3MPCA 3JZ7A 4OAWB 4KQ3L 4PJ5D 2ZSWA 5I1GH 2ATKA 2J8UE 2NY3C 1TPXB 3NZ8A 4NT6B 1G1CA 4V2BA 3TGXA 1VADA 3C60D 3G6AB 4HIXL 4NQCA 4WO4A 2DKSA 4I0PD 4LEXL 1CFTB 1H15B 5I73C 4IEFB 5EPMB 4PR5B 1FIEA 4GJTB 4LKXA 4PJ7B 1N8ZB 4XCCH 3DX6B 5GGTA 3MRRA 1XAUA 5C09B 4JO3H 1BHGA 5LGJA 4MLIA 1MI5B 4PRNA 1C5DA 5GSRB 4H26B 2WM0A 3BDBA 5FDWB 2VLJE 3IS1X 4WEBH 1DLFH 1IJ9A 4OF7A 4X6DE 4POUB 4NN7B 1WBXB 3RVUC 3HRZB 5JOFA 2R9HD 5FGCE 2W07A 2F5AL 1QA9A 3FCTA 3QUXC 5FO8A 1Q8MA 1I9EA 4FZEH 1TQCB 2EKSB 1F4AA 5CKGA 1WIOA 3MA7B 2VDNH 1CLOL 4QTIL 1DQLL 1BJ8A 5CMAA 3SDAC 2R0KL 4MSWB 4N8VB 3MRLA 4U1GB 4NO0A 1CXIA 1GL4B 2CKBH 2A74A 4GUPB 5EU7E 4YGVB 4LDOB 4AG4H 3RL2A 2JELL 2CIKA 2A6DA 5C07E 3DHMA 3CFCL 1ZSDB 4OD2A 2Q87A 1FYHB 3GMMA 1J9CT 3W0WE 3VWKA 4BH7A 4PJ5E 1A7BA 2WP3O 4L4VD 1SM3L 5EZIL 3JWDC 4H25B 3T77B 3QIBC 2IAMC 3QXVA 5I1DA 4M5YL 4U3HA 2FEEL 3ZKMD 4U4BA 2PF6A 1UEMA 3VRJB 2R1YB 1CE6B 2VZVA 4N9OB 5HPMB 4KVCH 2W60B 3O3DA 3GMNB 4LPUA 4N5UA 1CL7L 2O5ZL 1U8NA 4LSTL 5KN5B 1U8PA 5GGRA 4M62H 4X6BA 3K3QA 1BX2A 5D1XD 5EU7C 1LEIA 1VKXA 5BQ7B 2GTZA 1KTDB 5I2IA 2XQBH 5CHNB 1DUZA 3WS3A 3IJYA 4R8WL 5J0BA 2B2XH 5DD3H 4PB0L 5HHPA 4AZ8A 3LS5L 5IB3B 2RCSL 2H1PL 3VI3E 3HI5H 3H3PL 4RGNB 4CVZA 1EIBA 2ESVD 5GRXG 3HUJE 3BXNB 3WXVH 1FGNH 2ITCA 3HB3D 5DZLA 1MREL 4DZ8B 1CICD 3EDDA 3TA3D 1Z5LB 2YKLH 1KTLB 1DEEA 5GS2H 3B9AA 3WFDL 4NO2B 4UZGA 3QRGH 4CMMB 3SDXE 2CUHA 3BH9B 2ZKHL 1E4XI 4M43L 5GRVK 2Z8WC 2HA1A 2J6EH 4YAQB 1K3ZA 4WI7A 4NC0B 2XPGA 2YA2A 4GW1A 4DCQB 4RMQA 4FQQB 1F4WL 1KTKE 3LH2L 5LAXA 3RY4A 1AR1C 4Y5VC 5KSBE 4G6FD 1DN0A 1ZXQA 4WUUD 1MRDH 5B8CA 1N2RA 3MRFB 2R9HC 4DW2L 2JJVA 4H0IA 3G9VA 4TNVK 4KZEH 1L9MA 3V6ZB 3VXUA 2IGFL 4PRDA 4F3FB 3FQWA 5DK0B 5BRZD 1JPGA 1QSZA 1FQ9C 4J3OC 1P7QA 5C1MB 4ZFOA 2Q6WA 4QHLA 4ZOEA 8CGTA 3SDCA 4UTBH 1U8QA 2OJZL 3BKMH 5TE7L 1AIFB 3GM8A 3MCKA 3FT2A 4K7PY 3HZKA 2PTTB 3EHBC 4AM0A 2OBGA 4X4ZA 3BHBA 3P3YA 3FO2A 3EYUL 2XKNB 2ZCHL 4LSPH 4RAUA 5HI4D 3CZJA 3WFCH 3OBAA 4FHBD 3IXTA 1SY6L 4BUGA 2VSCA 5IFAL 1U95B 3NBNA 2AP2A 4J8RA 2ESVE 5CEZD 2EEBA 4MMXC 4I13B 1CT8A 4D0CA 3KLHD 4PY8J 1WFOA 5CGYD 4I48B 4D0DB 4OV5B 1UWEH 1I4FA 4P99A 5GISH 4OI7A 2D03H 5DR5L 1X44A 5FCUH 5TFSL 4L9LB 3VXSA 1AGCB 1U8LB 3D85A 5DJZB 2AK4B 3M17A 1V3MA 4K7PL 1H0DA 2X89A 5DA0B 4FQXD 3CSGA 2R0WH 3O9WA 1Q9LB 2I60H 4PRIA 2JJSC 2Q7YA 1H5BA 1N3NA 2B39A 3HC0A 3OF6A 2VABB 5E8OA 5I17B 3NA9L 3C8HA 4QXWA 2PTVA 4IIQA 3OX8A 1AC6A 5IMKA 4XVSH 4HFUH 1A6VH 4DEPC 2FB4L 1BFVH 3G04B 1DVFC 3MCLH 2XRAH 1FE8L 3HZVA 4E41A 2Z93A 3HB3C 3VXMD 2XN9A 2NY0C 3HPJA 4L8SC 3JVGA 1CICC 3TA3C 1ZS8B 1PLGL 1CDCA 1CQKA 1MCWW 5DJXB 5I1IL 3C09B 4HGWA 3W39B 2OL3L 4JPVL 4YZFE 3KYKL 3T1FB 4UDUB 3GBNL 3MNZB 2VAJA 4CN4A 2M8XA 5E2TL 5JHDB 3PWPD 4JPWL 5H37H 1Y6NR 5HYJD 3CUPA 3L6FA 3QEGH 4O4YH 2VDQH 1ULVA 1K8IA 4PREA 4P9HC 5D2NE 1I85A 2X70B 2ZPKH 1JWUA 4XMKL 4PY7B 2YD8A 4M1DL 1I8KA 4WI6A 5CEZE 3BIKA 4Z7QF 5DA4A 5SWZD 4XPHH 1OLLA 3RBSA 1MJ8H 3EFFA 2R1XB 3HFML 5B38B 1OAYH 3SBWA 4DK3A 2OM5A 4JGMA 1AD0A 3DVGB 5JR1H 3IFLL 3FB8A 1A22B 1Y6MR 3PGDA 1FJ1A 5MEQB 3DGGA 1QEWB 1KCVL 1OWWA 5HHOB 3QDJB 3X3GH 1L4IA 3VFSB 1HDMB 4UINL 5HI4C 4PJXA 4NUGL 1N7ML 2Y25A 1JN6B 3NN8A 4AEHL 3ZE1E 2Z8RA 1IZJA 4KROB 5DQ9A 3ARWA 1JWMA 5D7JA 4R9HA 5E95B 4EUPG 1A1NA 1YEJL 4OFPA 2X1OA 3O6KL 1VCAA 3ZDXE 5CGYC 3KPRD 3LKSB 3R8QA 2X7LB 5H2BA 1I8IB 4P2QD 4JY4B 2E7BA 3QXAA 5E7BA 4XMPH 2JK5B 6FABH 4ODWB 3ARBC 1XH3B 4OZIA 2W0FB 1XIWB 2WBJB 3D87B 4LLYA 5BOPA 4L3AA 1KENL 3CDGB 4S10A 5KZCB 4PV8A 4Z7WB 3WIIL 3LEYL 4PJXF 2IH1B 4XXCC 3CSYB 4AEEA 4H8WC 4D9LL 4DGYL 4FQIL 4HWZA 2DJSA 5SWZE 4HPYH 4IDLA 5D7SL 4ODHH 4P4KA 2DBLL 5E08H 1OARL 3H7BB 4IBLT 2BXZA 1NLDL 3MRNB 4ODXB 3WBDA 4OTXL 5JA9A 2OL3B 1OAUL 4P2YA 1T6WA 4GMTH 1MVUA 4LSUL 3DUSB 2DQCL 4NPYB 3KPLB 3GHEL 3S34H 2EDFA 5C0IA 1I1AB 5EU5B 4G9DB 2W65B 1E4KC 1HYSD 2HVJA 3PIQA 1GOHA 3GSRA 4N0UE 3S3SA 4OZIF 1JPST 1BWMA 4KI5F 1U3HA 1R3JB 2OTUB 3JWDH 4MCZB 4U1MA 4TULH 43CAA 4ZS7H 4V1DA 1BD2A 4JAMB 3KR3L 2AQ2A 3HLAB 5AYUH 4L8BA 1I1CA 1X5HA 3ORJA 4Y1AB 2Y6SD 2R8SL 1BLNA 4QXUH 4MB5A 3S97C 4BFBD 2M1KA 2VXSL 4P2QE 3ZL4L 4H20H 1A4JB 5GGVY 2W9EH 3L5WB 1IMHC 3LV3B 3QIWB 3MACH 1LP9A 3IXAA 2NY7H 3PQYB 2DLGA 4HDIB 4IS6B 1GGIH 2UZIL 1K4CA 5CILL 3X14A 1T21A 1J18A 1G7MA 2MKLC 3I02A 4RDQG 3MRHB 1NAML 4OM1H 3WDJA 1VPOH 3IFNH 2R2HB 5C71A 4HF5L 1N5AB 4ODSH 4K23H 2BMKB 4ALAL 3TYGH 5FO9B 5DJYB 5KG9A 4EXKA 1OP3H 3LEVH 4X5XB 1F4HA 1R3LA 3OAUL 1OCWL 4ZYKA 4HK3J 3PDOB 1OP3K 1AQKH 4AL8H 3NIDE 5DTFB 3IGAA 2B8OT 5JW3H 3P77A 1JZ6A 8FABA 4XC3L 2BOBB 3SE8H 5GGVL 3RNKB 5LVEA 2P24B 1YPZB 2WW8A 5JXAL 1HSBB 1LP9F 4OIIH 1RZFH 4EBQH 3QWQB 1J1PL 1R3IH 4Z0XA 4P46D 4FXGB 3HS0B 3K4AA 3TF7C 3P2TA 5EORH 3I6GA 1S5HA 3IKCA 2DLFH 2VZ1A 3ARZA 1HSAA 32C2A 4HUWB 2FATH 3C5SB 4YHML 5ESQB 2C3HA 5FYJE 4RIRA 1KCRL 3S37X 2NCMA 4ONHA 5KVGH 3AVEA 3QCTH 3ULUF 5SX4H 3LKQA 3ARFB 4UNUA 1LO3H 5DHVH 5DWUL 2YRZA 4OUUA 2E9IA 3U1SH 5IMMB 2ZUQB 4GG8A 4DKFL 1FN4B 1S7TB 4X7SH 3RY6C 2H2PC 1UG9A 3ALWA 2DJ4A 4Z76B 5JMRA 2HKFL 4ZQKA 4KK8D 4UOW0 3C87A 2IPKB 2ZWLT 5CGTA 1HYSC 5ICYB 4F9PC 4CADB 1KIQA 5IV2A 3D0LB 4Y4KA 1BZ9B 1S78D 2XY1A 3MSPA 3DMMD 1UGNA 1J0KA 2FHCA 3QO1B 5IR1A 4Y5XB 1TCRA 2UWEB 1H3GA 3GI9H 2RFXA 3HR5A 5B22A 3W11D 1W0VA 5IWLC 5KAQF 2NTFA 2P5EA 4MJ5A 3OXRB 1EXUA 3H3BC 3I6LD 4P2OB 3CFKB 3QUMB 3DYMA 1ZT4B 4YGAB 2CRYA 1GPOH 2DD8H 2JIXA 4M93B 4U1KB 4YXLL 4GQPH 1A3QA 3DROA 4Z78A 4U1LB 3B9KB 2MCPH 2CPCA 4XCCL 1A2YB 4LFHD 4ERSH 1T5WA 3G6JA 4I9WD 1NAMB 1T2XA 3ZTJG 4JO3L 1J10A 4ZXBB 4I3RH 1UFUA 4WI3A 1DLFL 2EYTA 4X99A 3PJSB 4F7EA 4F7MA 3VWJB 4X8JB 3C2AH 3FZUD 4NQSA 4FZEL 1NBYB 4IMKC 5E94A 1Q0XH 2FYYB 1B4JH 5EU6E 3U6RB 3GSOA 1YMMD 5ID1A 2VDNL 1BVKA 4KK9D 2WLZA 4CGTA 3WNKA 4RRPG 2DOCA 4D0BA 1S7VA 4JFFA 5E8PB 4ZSOE 2CKBL 3MV01 1AHWA 5JW4R 4AG4L 4NZRL 4WI9A 3G6JF 2ICCA 4L4TB 1WZ1H 4P46C 4XXDA 5AZEH 1GGUA 1D5XA 2GJZA 3D39B 1T1YB 5KANI 3EKCA 4NM4L 4NOFA 4Y2DD 1CDIA 2AQ3A 1S7SB 3S5LA 3D5OF 3QUKB 5KOVC 1ZHKB 3ARQA 3NGBB 3O2WH 3CD4A 1MHCA 4MXQD 4I8DA 4IDJH 4YFLF 1FSKB 1HWHB 1KPUA 4H1LB 1FC2D 2EXYD 3F8UB 3L7FA 4M62L 4I9WE 3R0MA 2RIKA 5L8LB 2F19H 1W72A 4KJWD 2XQBL 3QQ4B 4APQD 5CEYA 4NYLA 1ACZA 1S7UA 2B2XL 2LU4A 3N1FC 5DD3L 4C56B 5ACZA 1I9JH 5D5MB 3TLRA 1WGOA 1S78C 1DE4B 3DMMC 4GSDH 3WJLC 5CEZH 2FH8A 3HI5L 4LFHG 1DBMH 1D5IH 1YMME 1A1MA 1FGNL 3W11C 4C4KO 4H5SB 3VGAC 3FN0H 5IBUB 2YKLL 1F3JA 1UZ6F 1GGCH 4KKBD 2Z31B 4GH7B 3FO9A 3QRGL 5MERA 1S9WA 2J6EL 3VGHA 3TN0A 4KPHL 1AGEB 3OKOB 3E6FB 4I18A 1U3YA 3MREB 1BBJB 4K71B 4AMKH 3P0YH 3PWUA 4MNQD 4YDKL 1BIIA 4Z77A 3Q3GA 4OAWA 1X5JA 1MRDL 3GBMH 4JVPA 3GNML 1A4KB 4KZEL 2OXGA 1D9KD 3FRPA 2XTJE 4NT6A 1U36A 4PJFB 4KAQH 1MCIA 4M61B 1BQSA 5K33A 3G6AA 3VFTB 4NHUB 4KK9C 4XTRD 3WNNA 1CFTA 1H15A 5C0BD 5EPMA 4PR5A 1I1FB 1KCKA 1AKJB 4J4PA 4UTBL 1M71B 5CKAA 1RAMA 3BKML 2FBOJ 4MJIB 1DBAH 2A6KB 1XFPA 4PJ7A 1N8ZA 4RZCB 3DX6A 5IG7B 3ULVD 5E1AB 5C09A 1NDMB 5IB5B 5DI8B 4CMHC 1MI5A 5GSRA 1UEYA 4H26A 5FDWA 4U1HB 2RJMA 1WBXA 5IVZB 3HRZA 2HYMA 5JO5B 4W4OC 2DLTA 1JNHB 1DQDH 5EH1A 5KSAB 2EKSA 2H9GB 3I50H 3MA7A 4Y2DC 2NX5E 2DMKA 3QDGD 2PKDA 5H35B 1JVKA 3RFZC 4MSWA 3MLWH 5GISL 4N8VA 3UTZB 4MXQC 5FCUL 3KS0H 4JZOB 1JK8B 4GUPA 4YGVA 2EXYC 1T20B 4TSBL 2R0WL 4K3JL 4PJ7F 2I60L 3KYAA 4KJWC 1ZSDA 2X44D 3QI9B 3WS6A 4J7RA 5I8OH 4YHOH 3T8XB 1FG9C 1CFVH 1QRKA 2R1WB 4XVSL 4HFUL 1A6VL 3R4DA 5D7LD 5FUCE 3D69B 4H25A 3T77A 3MCLL 5LG1A 1RMFH 4HJGB 2XRAL 3ALXA 3FHQA 3W2DH 4UU9B 3VRJA 4OLZH 2JCCB 2R1YA 1CE6A 5HPMA 3U2SB 3UBXI 1P84K 1WF5A 2W60A 5GXBB 1TQBC 5C0BE 1HINH 3NCMA 4KKBC 3GMNA 3C6SB 2JB5H 3QYCA 5KN5A 4JR9H 5KVDH 5BQ7A 1KTDA 5DEGB 5CHNA 3P4OB 3QEGL 4O4YL 5C08B 2OTWB 3LOWA 2AXHA 2FSEB 2VMFA 1C7TA 5IB3A 1FNSL 2ZPKL 2ORBH 5C0AB 3K74B 4HQQH 4QOKD 5FUCC 1D9KC 1V7NH 1U8KB 3BXNA 3RGVC 2VDOL 3U30B 3E0GA 2CRMA 4DZ8A 3NTCL 2X6MA 1YZZA