4JGIA

1.5 angstrom crystal structure of a novel cobalamin-binding protein from desulfitobacterium hafniense dcb-2
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
211
structure length
205
Chain Sequence
VIDLNASAQAMSDLDEGAINEVVDKVMAKADADAAQELIKAFQQGMTKVGERFDSGEYFIGDLIFAGEILQAAMDKLKPALKRAKIVLATVEGDLHDIGKNIFRTMAEASGFEVFDLGIDVPVKIIVDKVKEVNPEIVGLSGVLTLALDSMRETVDALKAEGLRNDLKVIIGGVPVNENVCQRVGADDFSTNAADGVKICQRWVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Structure of the cobalamin-binding protein of a putative O-demethylase from Desulfitobacterium hafniense DCB-2.
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Protein binding
total genus 76
structure length 205
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02310 B12-binding B12 binding domain
A PF02607 B12-binding_2 B12 binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1240.10 Mainly Alpha Orthogonal Bundle Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1 Methionine synthase domain 4jgiA01
3.40.50.280 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Cobalamin-binding domain 4jgiA02
1REQA 1CB7A 4HH3C 3EZXA 1E1CB 4HH1A 4REQA 3REQA 1K7YA 5REQB 7REQB 3WHPA 3BICA 3KOZA 3IVAA 6REQA 1FMFA 4Q37A 1REQB 1XRSB 5C8DA 4REQB 3REQB 2REQA 2YXBA 1BMTA 3KOXA 1BE1A 1K98A 4HEHA 4JGIA 3KOYA 1CCWA 6REQB 3KP1A 3BULA 3IV9A 2REQB 1ID8A 1E1CA 2XIQA 1Y80A 3KOWA 4R3UC 5REQA 7REQA 4HH0A 1B1AA 2XIJA 2I2XB 1I9CA
chains in the Genus database with same CATH superfamily
1U7ZA 4OI2A 1FFEA 2IW1A 1IJKA 3IV7A 4HDKA 4LWOA 1HETA 4QYWA 5FA5A 4DZTA 2ZRMA 3B1YA 4JK3A 4Y1RA 1D04A 1WX1A 3AQ4A 4GIBA 3LD9A 4GSKA 5A6VA 2GBPA 4FONA 3CZCA 4ZV7A 2POCA 5IWAB 5CVTA 3HXPA 4HTAA 3PITA 3CVXA 1UC9A 1MT3A 1Z6AA 2I6FA 2JFYA 2P4HX 4Y3UA 1Z8NA 3UXMA 2XMGA 2YYYA 5MN5A 1E2NA 1YVDA 3L9WA 5L3SA 3HXLA 2QMYA 3I9LA 1D2CA 3OX2A 1BVRA 1GPLA 4HRYA 3SJ7A 4ARSA 4EUKA 3GOHA 2ONCA 3WLHA 5M29A 3BXHA 2R7AA 4U9UA 1ANKA 1SEPA 2JJ1A 3GL9A 1HRKA 5SZKB 5IWCA 1ZA1A 1YQUA 4ZT4A 1RWKA 3E9ZA 3QXGA 1TAHA 5KYYB 2GDJA 1XCMA 5SY9A 3KYDA 4O4HA 5HBRA 2OPBA 3HRHA 1H2AS 3OP4A 2QBYA 1ZWLA 2E4ZA 1N6HA 3TZ6A 8MHTA 1QYVA 3ESCA 4P86A 5CCBA 2IYNA 1P17A 3C1UA 1DIGA 3DCIA 2PWYA 3MJFA 2IDMA 2HA6A 2AR0A 1LW6E 3IQXA 2J7PD 5DGCA 3TRJA 1YB7A 3CJQA 3HP1A 2IUYA 3UXEA 1Z5VA 2PANA 1W1UA 1D2RA 2RH8A 1KEUA 2XGMA 3BA1A 3M34A 3UQYS 2QMUA 4GKJB 5T6MA 2WKWA 2H08A 5DHTA 4Q3OA 3T7TA 3T3IA 2I22A 4X1KB 5K6AA 2RHJA 3V9PA 3MWEA 1CUUA 2CHQA 1VJ5A 3Q9SA 4YV1A 3RRBA 4OREX 1YSCA 4GI7A 2YFYA 1U31A 2V7QA 2CXNA 5AJHA 2HF2A 4D1YA 4TRJA 1TCCA 2ZVDA 4P34A 4ZJUA 1FUIA 4RPHA 5GV7A 4LGYA 2VP0A 3EXHA 4IP0A 1AK2A 2HYDA 3RNOA 4D3SA 3UPDA 4B3CA 1KEVA 3O03A 1TJYA 3NTQA 3IEMA 1A7UA 4K6MA 2P69A 1QHIA 3MVEA 5EPOA 3N3AC 1NYRA 3LH5A 1DC7A 1VLQA 3Q87B 2DR0A 3QG5A 4YECA 1QV7A 1SUYA 1ZGHA 3SR0A 1WG8A 2WYOA 1ZSVA 3H1AA 2GD1O 3F8WA 3FPAA 4JITA 1D2NA 1SXPA 5JJLA 1VDMA 4UHCA 3A4LA 3CF0A 3QUAA 2RI1A 4L4RA 5BT8A 2D3TA 4PXYA 1G18A 2RCYA 1FIUA 4LNUB 4F4JA 4OGWA 4X85A 3H4TA 5F9HA 2F43B 4LHEA 2CCKA 5LYJA 1FUYB 1QX4A 4OQPA 3AUFA 3FAKA 3VI3B 1G21E 1FSFA 5BOVA 5B2FA 3FIJA 1OHHA 2I5PO 1L5WA 1D1TA 1K3TA 5FR2A 2IZ1A 3R0ZA 1USGA 2GPWA 3TRHA 3ZTYA 1HT1E 4EATA 2O3TA 2PJDA 5ALZA 3MUEA 3RSHA 1XKLA 2Q5EA 3FZEA 5DTQA 3TBHA 3KZCA 3QMMA 3DDWA 4EGAA 4EWLA 2Y99A 5BNWA 3VSBA 1GYQA 2VCEA 3PDIA 3EGXA 1WMAA 3TRKA 1RYNA 2L0XA 2B78A 4C20A 2BGLA 5EUBA 4MV9A 5AM1A 1QPBA 4PSAA 1RYZA 3CX4A 3F7MA 3OA0A 3T54A 1EWVA 1S3SA 4U1RA 3QFHA 4YJHB 1D9XA 3DZ8A 3RS7A 3F49S 1Q2UA 2H06A 3OEED 3QLTA 1RU3A 2YW9A 4B3GA 1B15A 1X1EA 3OU7A 4FEGA 1YMVA 2NADA 1ODJA 5MN6A 3H42B 3V2IA 3EDOA 4E2WA 1NI3A 1FXUA 3PYXA 4ZHQA 2JLXA 2PUFA 3BC1A 1XEXA 4WCFC 2P5YA 1NHWA 2G0AA 1OH7A 4UATA 1N2BA 3MGBA 3JD0A 4RKFA 1VKJA 4UMDA 1ZUWA 4ZARA 5JNUA 2AFHB 3FDIA 4RLFA 3KQVA 1QE5A 4W82A 4GUDA 3EG9A 4NZ9A 5JATA 5CLIA 3SEQA 4ZDKA 2XNDA 1NZDA 1NXQA 3C6ZA 1YQTA 1E7QA 3D6MA 3N8GA 3V8PA 3FOAA 4A3SA 4C07A 2DTXA 2IFTA 4WLUA 4W5NA 2I4TA 3S2ZA 1LBHA 1CUSA 4BNZA 1NSTA 3S70A 1FP4B 1GQOA 1UZLA 3E6AA 3QWHA 4US1R 3WG9A 4QT4A 5LFAA 3CYFA 1R6TA 4BRUA 4AROA 1XHEA 2PVSA 4IF6A 2OGUA 4GYWA 1M6YA 1C7ZA 2O8CB 4LXXA 2GN8A 4TMXA 1Q19A 1E32A 4QOGA 4R7ZA 4CWAA 1JDBB 4KMRA 2HU7A 2RJNA 1FTNA 2XB8A 2CBGA 3FUVA 3K9GA 4FZJA 1VPDA 2R6AA 3WK6A 3HO6A 2IE8A 3F6CA 3K9BA 3KKNA 4PPNA 5JBIA 4RZXA 4OFXA 3PLRA 3DKVA 1M2JA 2AD5A 1AK9A 4ZTZB 2ASVA 2IH2A 1Z3CA 1XYGA 4Q9AA 4ARCA 2J6ZA 3HI6A 4GZ6A 4AS3A 3DM9B 4UM9B 4BQQA 3PPYA 4Y6RA 1UJ2A 1VKZA 1G1MA 1X19A 4GM0A 2JFZA 1JR3E 2RKWA 2XQIA 4GW3A 4LJ4A 4CLOB 1T91A 2GZSA 3KDPA 3ZD8A 2OV2A 4G1CA 1BWQA 4HGRA 3VNVA 5JR3A 3PHBE 4C21A 4G5SA 4DIEA 4AECA 1U6JA 2EJWA 1AGNA 2Z2KA 4YUVA 1V7CA 1YHYA 1Z07A 2NNLD 1JKFA 2XMBA 3ORQA 4IIXA 4MGEA 4YMSA 3S2IA 4MW4A 2PGNA 2HMAA 2ZRIA 4K9LA 4RDXA 3QEOA 4BC1A 2DXIA 3WIDA 2I9KA 4ZO8A 1PUJA 4OYHA 5J58A 3U6KA 1MOSA 3JQGB 3PFNA 4J1QA 4ZO9A 2AR9A 2I4MA 1C0PA 1VZ2A 5H9VA 3DGFC 4I19A 2W70A 1YR1A 3W9UA 1G5RA 4N01A 1P9NA 1UMDB 1OX5A 4UOEA 4FJ2A 2OO7A 2XYGA 3FJ1A 1EJBA 1US8A 1MA0A 1GFIA 1UBNA 2AYYA 1PR2A 2F9FA 4LBZA 3K32A 4XIGS 2ZZKA 3I76A 5IN4A 1ACMA 1QFMA 3JAWA 4HAYA 2VSFA 1P8JA 3NBAA 1LI4A 1PD1A 3MT9A 3RBVA 3V6MA 4COOA 2BMWA 3NVAA 1MW9X 1DKNA 2R3SA 1ST2A 3LQQA 1R8QA 3FNFA 3I83A 3MG9A 1ZCJA 4N54A 3V7WA 3ONVA 3WLPA 3Q5DA 5C7YA 1WETA 3FD8A 1C7IA 2PKCA 4CI9A 3NIWA 4C3ZA 2BBSA 4CF5A 3OZDA 4OHMA 5BWBA 1YZ3A 1QBKC 1HKUA 1SB8A 1PR4A 4J1TA 4A73A 1KZ1A 2KLHA 4C6RA 5LNK6 1XK7A 2OK7A 5ELMA 4LDAA 1RPAA 1RAAA 5FH9A 4LTDA 3UAVA 3FRJA 4CKBB 4JS0A 4EX7A 1S9DA 1Z2DA 4WNIA 3T0IA 3OIWA 1PJBA 4QQFA 3JVIA 1A1SA 3FGNA 4XYEA 4YEDA 5TC4A 1EGQA 2YVQA 4ZQEA 3AIKA 1E2UA 3O93A 4BZWA 1LEHA 1N6IA 2UYYA 1TK9A 2OQ2A 2ZUSA 3FMGA 3IOCA 4L6CA 3S99A 3SYLA 3C3EA 5J2UA 2ZXFA 3ICWA 3TLXA 3U26A 2LNDA 5DBGA 4HDNA 4RTNA 1PR6A 1QZZA 3DP7A 2NTVA 2E21A 3WRVA 4DVJA 4ZICA 4DDVA 3L4SO 3ZIAD 2BHRA 3CE9A 4GX0A 4Z3KA 3F78A 2PUAA 3AR5A 2BBTA 2WTNA 3I2IA 5DCWA 3GGGA 3VPBA 3HVRA 5MFZA 2X3UA 3LZCA 2NU6A 1A9XB 2A7QA 1QIKA 2QZ9A 4FFBA 5DI3B 4BZPA 4DWWA 3LUDA 2NACA 3LFHA 4N8EA 4TKLA 1P19A 4OXNA 4I55B 2A5YB 4NECA 3AERA 5ENVA 2Q4RA 1ZM4A 1RXYA 3M89A 3EK2A 4DDUA 1HV8A 1HWYA 3NBMA 1JIJA 2VK8A 2Q4DA 2B1GA 2JBHA 3L5KA 3MTJA 5DLYA 3KJQA 1I3MA 4XVQA 1MABB 3PC8A 2R84A 1Z88A 4UEOA 1NBAA 4UTPA 4E2ZA 2ZBFA 1JDUA 4AZ3B 2DG2A 3C74A 5SY4A 2FLKA 5IXSA 3IAM1 2DCUA 3EZLA 2YJTD 4LNAA 2XY4A 2AHRA 5G53C 3QKSB 4B2LA 2X42A 3JWHA 2XMRA 4C1BA 1QDEA 3NCHA 4R40A 3H75A 4Q7MB 3OOHA 1V11A 2QX9A 3E23A 1KDTA 4L95C 5I8PA 4IEIA 1ZIPA 3FZNA 5EQTA 5BSKA 4MS4A 5K45A 4IVNA 3U19A 4V0LA 2B8NA 3TLGB 1RXVA 1P7PA 1U7PA 4ZCRA 5CNIA 3TLAA 3H2IA 1DWPA 4OM7A 4HAUA 3VOAA 3GUZA 3RI3A 2ZYAA 2ZIXA 3BD6A 1SVMA 3G49A 2A9PA 4BEBA 3TLZA 2FG5A 3GNTA 4XOUA 5LLTA 2FP4A 2XB2A 3FHTA 1Y9AA 3ELBA 4RXUA 3FWZA 2NVOA 3FRHA 4NF2A 3HL4A 4V0OA 1UC4B 1SBIA 2Z58A 3WRWA 1ZG3A 2W6OA 1V43A 1Q0UA 3OLQA 3DEYX 5ALYA 1WAMA 5A7GA 5L51A 1PNOA 1NLFA 3OD5A 2A5JA 1XEAA 2J0VA 2PSHA 2BTEA 1Z25A 1TC1A 5LUBA 1Y1KE 2HHJA 3VO1A 1AD2A 1VG1A 2BR5A 1JDPA 1KAQA 2IHVA 2VAXA 4JJ4A 3MTAA 4LRTB 1TJPB 2XHEA 4EARA 3UAYA 3LAWA 2Q5HA 2VYCA 5JISA 5JRZA 1DMSA 3DB1A 1YCDA 1SXJD 1KAGA 1QGDA 2GHQA 3GJXC 3GARA 3O31A 1A9SA 4IVPA 1JR6A 4KI7A 3KTAA 3H97A 3I2GA 3LT5A 4ND8B 1X7YA 3D7SA 3QXJA 4H4CA 1RRGA 2LV8A 3KOOA 1YE5A 3LCJA 5AKEA 5BNFA 3ZN2A 1JRLA 1E6WA 1H22A 4I4LA 3THXA 3NP9A 4A23A 2QRQA 4JEIA 1ZISA 4YRQA 1GXSA 2TMKA 3LDAA 2ZUVA 1UEIA 2XYVA 3KT8A 4FBLA 2WU1A 3W4KA 2C1EA 3BK7A 3TKLA 5BURA 1FZTA 2FSVA 3JQAA 5FOWA 4JLJA 2PGOA 4EW1A 1VXOA 3Q4GA 2C8VA 4RIGA 3HA3A 1F9AA 1OBHA 3E7DA 3NTUA 1P0QA 2AKAB 1GAXA 1EJ6A 4NJMB 2FEOA 5I9SA 3DXZA 1VE6A 4IIHA 3UMSA 3KQPA 3V8NA 1KJJA 3H5NA 2AMVA 4KMSA 2H59A 4QUJA 4O2BA 4WJKB 3BG5A 2CJWA 4A5OA 3HTXA 1HDIA 4B6GA 2HZBA 3QNWA 5B4TA 1DDIA 2FOXA 1LLCA 4LJSA 4WAUA 4MVYA 4CQLA 4XLZA 5ELLA 1VKHA 3KOZA 5KJFA 1QYDA 1LCIA 1UPUA 3EUEA 1MZVA 1N25A 2GBLA 2GK7A 2M2IA 4OQEA 4Q05A 4RK5A 4K1XA 3EQ7A 2YHBA 4X5OA 5T67A 3K09C 4TMWA 2XSZA 4V0RA 1S2GA 4YFVA 5DSTA 1CJUC 1OFGA 3NEJA 2AC2A 3JQEA 5IUNC 1QWOA 5T5QA 3AETB 2RI6A 1DFIA 4OQQA 4EVQA 5IM5A 3LCUA 2GF2A 121PA 1NVXQ 2QRVB 3KM0A 5JH7F 1Q0LA 2Z43A 2W0MA 5KDDA 3RSOA 1A7KA 5H4HA 1ZLXA 4LSMA 3U4MA 2X1HA 1RQXA 2H16A 1GA4A 2PG3A 2Y05A 5K0JA 1RRFA 2OM2A 1WKVA 4XGKA 5DHPA 4MR7A 3HXKA 3ORHA 3Q3GE 5CLQA 4CIVA 4LZAA 1DEKA 1ZW1A 4A2WA 1P6XA 2WJ3A 5JW6A 5CEJA 1UBUS 2QDKA 2QM7A 5FLXA 2A58A 1XRLA 3LDUA 4FKZA 3NOQA 4ME6A 1DOHA 4E5UA 1GRVA 1KY2A 4RDCA 2P1DA 4Z4IA 3GQBA 5GP1A 5JIBA 1N2GA 2AMFA 4KC0A 3T1YB 2WABA 3KO8A 1CZKA 2AYZA 4PV7A 4YP6A 4HNUA 1T36B 4J0DA 4CF4A 1N2XA 2JIPA 4LWPA 3ZHXA 3RPEA 2NO6A 2KHZA 1CY1A 4ZAZA 3TZEA 4C7VA 1YVRA 4XWOA 3JYHA 1AU9A 1F4VA 1O0CA 4H3KB 3ZVNA 3FUCA 1GPWB 2AI3A 2ZWAA 2YVLA 4MQ6A 1TD1A 2B9EA 4HZUB 1H2FA 3BX1A 2PFSA 1H1DA 1PG2A 3GUHA 1SVIA 5IJ9A 5KB3A 4MVWA 3G1WA 4RJIA 5BSMA 4GS5A 5AW2A 4JVOA 4WESB 2VAMA 2CDCA 4KQ2A 3I30X 1M34B 4DEYA 1TJ5A 2PMKA 1JILA 1ZNZA 4X8QA 4W7IA 3BT7A 5J47A 1YK0A 3GJ4A 4LZOA 3DR3A 1PNQA 1N2JA 1QFSA 1XAGA 1NXSA 1A5BB 1PSWA 1WXHA 2C3UA 3A06A 1LVHA 3GGSA 4MB2A 4WINA 4BTVA 1JFRA 3FETA 2I34A 1AA6A 3KSUA 4R9RA 4RKQA 3IXMA 1GRRA 2J3HA 1C8BA 4A4DA 1XMJA 2YHSA 3QW2A 4KE8A 5TY0A 1J2RA 1T6BY 3JCZA 3UAXA 3J81A 3DBOB 3RU3A 1KGDA 2JI6A 3HN7A 3OWXA 1HDRA 2JATA 2BEUB 5BMVA 3I39X 4YRIA 1SKQA 4LJYA 3A3NA 3OT1B 1KRWA 3NHYA 2QPLA 1YE8A 4XQCA 1M2OB 3S27A 4J91A 5U4XA 5D51S 2EBFX 4YAUA 4XCQA 1GKYA 1OAKA 1PW5A 3IULA 3NJ8A 2A8YA 3ZG6A 4CN9A 4KYTA 1I4LD 1XGKA 2O3UA 2MYNA 4JGIA 2CF5A 4LDQA 2EF0A 2WG1A 3I6YA 4MUJA 1FRFS 3T7RA 3TEMA 3UY4A 4Y2VA 4MQMA 3HU1A 3BZWA 2Z08A 3I9V1 1NN1A 2V65A 1R0BA 3C3CA 3EC1A 3K8QA 4LF6B 4QICA 4PAQA 4CCYA 5AJZA 2BAGA 4IHJF 1T1GA 5EPEA 2L42A 5AFSA 5J59A 5LD2B 4QXOA 4ZAFA 3KC2A 1XNJA 3A2KA 1A9YA 2YYSA 2G88A 1XTSA 3GR6A 3K0FA 3KAJA 4LDRA 3D54D 4URFA 3JASA 2JJ2A 3CUUA 3K0CA 4I5IA 4MTLA 2HFKA 5AVJA 1G64A 1SUBA 1WU8A 3IHTA 2JD1A 2FTKE 3BJDA 1ZZGA 5EKSA 4CR6A 3LQ2A 4GPBA 4EKGA 4LWZA 4JIGA 3ESDA 3HVKA 1KMHB 2WFLA 2YC4C 1HSOA 5KU1A 1RZUA 3PQDA 2FUNB 4EYKA 2EFDB 4MVJA 4BVGA 4ETMA 1AHHA 2AK2A 4EJSA 1UM9A 3K1YA 2WHPB 3G2QA 3PUHA 4RHCA 4ZVQA 4E5PA 3BWBA 1DQRA 3IX7A 1Z4NA 3M4XA 3ZHVA 4EF6A 3Q3JB 4G4IA 1OBCA 3JVEA 1XRMA 5B7PA 4FMDF 3TQTA 4EY8A 2RBGA 4WKPA 4I4TB 1ESZA 1W73A 1HYQA 4TN5A 3I9MA 2FW0A 1NSYA 3RANA 2REQA 4WZAE 1WQ1R 5WRFA 2QX4A 3E27A 2P4EA 3A25A 4KXMA 1UOQA 2FSIA 4RY0A 3UJ7A 1IWBB 5LL6P 1C0LA 3THYA 2H00A 5JJIA 1GVHA 4DLWA 4GWLA 1UDWA 4KGXA 6YASA 1XXHB 2PDAA 3CH7A 3IE1A 3K8OE 4D6PA 4EB3A 5D1NA 5AOAA 3B8HA 1O95A 3AUYA 3HZOA 1M73E 5LZ8A 3GLIE 2GM4A 1XVVA 1NX6A 3ZLVA 4NAVA 3E5RA 3GLIA 1O87A 4XSHA 1T2CA 3G2PA 4COKA 3INNA 2Y6VA 5LZ5A 5B30A 4G36A 4IQ0A 3R9WA 2OBLA 4I0WB 1QOQB 4AJHA 1QK4A 4B76A 5IUJC 2ZR9A 5CURA 5B2ZA 3F5DA 3PXAA 1E99A 2EBHX 3QU5A 4G1FA 3SCZA 3M6MD 2GK3A 2WUWE 1QQTA 1M34E 2QTVB 4JA0A 4F5WA 4FGSA 3OPXA 2WE8A 4Q39A 1NLZA 5TB5A 1NPDA 1DAPA 1PWHA 3ELYA 3JX9A 1MENA 4DZRA 1YKFA 3D4IA 4ZTBA 3FBTA 3HCDA 4LX8A 3UH0A 5DYNA 1CZHA 2EDCA 2O8DB 2B3DA 3U3DA 3AFMA 3TMAA 3OZ7A 3CZ5A 5FWDA 1CY6A 2W5UA 4RYLA 2DLNA 4B82A 1QYRA 4EYEA 2AG5A 1P0PA 3K7EA 3CF4A 3T4EA 5DM4A 5KVCA 1CJMA 1ECCA 2A9VA 5LCXA 4MV7A 5C5DA 2VZ9A 3NTLA 3FOBA 1Y4DE 4YB8A 1JZQA 4ROTA 3WGTA 1OH8A 4F2HA 4M7RA 2MT9A 1H2BA 3CW8X 5AI9A 2L18A 1J8YF 1YJXA 3KQHA 4RU1A 3DLTA 4CV3A 2H29A 3BIFA 1QM5A 1Z37A 2AR7A 3NT5A 2Z56A 4K9DA 3ZU2A 2O19A 5FA8A 3G9QA 1W36B 2VZ8A 2Z83A 2BF7A 2P41A 2QN1A 3MINA 2Y1FA 3OZRA 5AJTA 2KB0A 1YI8A 1M1XB 1AA9A 1E0KA 2OZLA 4BRWA 1W7AA 2CFIA 2NXJA 5IXJA 3HN2A 3AP1A 1JQJC 1V3TA 2Y1OA 2Y0PA 1J2UA 5BVGB 3LL4A 2VAVA 1RLOA 2R6ZA 5CYPA 1EZ1A 2PLAA 3D9QX 3S7ZA 5BSFA 2FN3A 3IPYA 3HDTA 1B00A 1MEJA 2QTHA 2X5NA 3F2IA 4IICA 4KSBA 4ZQFA 4BNJA 5LYJF 3CRRA 4FDVA 2AXEA 3INGA 4X63A 1WZIA 1EDBA 1PTJC 3X44A 1ATZA 1T1RA 1A97A 1RHRA 2R79A 4YQZA 4F4IA 2I6TA 3RFVA 4GICA 3UTCA 4JKOA 4OQ4A 3KAQA 5AVRA 3M6XA 3TIIA 5GGXA 2JASA 4ZCTA 5BYAA 1M72A 3T3OA 1R6AA 4IJVA 3D2CA 5CVJA 5HQTA 2J0UA 1GQFA 4QBKA 4DLAA 5A62A 3BKXA 4M6WA 5C51B 1JSCA 3H2HA 3EE6A 2RGNA 1XF9A 4LF4B 2QIOA 4XVHA 5H70A 3T7IA 3RROA 1PZMA 3FVTA 3ES9A 2BYTA 1GR1A 4FZ3A 3L1UA 1SRQA 2IY8A 4PBRA 5BP7A 1CUZA 4XXHA 2AX4A 2IF0A 3EY4A 4LISA 4BVBA 1P44A 4RH1A 1F17A 2DUJA 3C85A 1KDOA 3RGGA 1TLLA 2FWIA 2IPNA 3BXEA 3H5RA 3QE4A 3SIWA 1E9AA 5DRYA 3ACBA 2OENG 2GN9A 1W581 4NBLA 4UHDA 1RRCA 3HQ4O 4IO0A 4LTNA 3QYJA 3QQ5A 3DDSA 3ZGXA 3VR6D 3JVUA 3BVPA 4IQGA 3WV5A 2Q46A 3UGJA 3TRFA 5GIPE 2A30A 3N86A 4IH4A 4FNGA 3AOEA 3RWOA 1RXIA 3TSOA 5ILQA 5LXTA 3B1KA 3HP7A 1N0UA 3I2JA 3JQBC 4KACA 1AK1A 1W6UA 2BDTA 2MSCB 2PTGA 3QMWA 3BQNB 3GJZA 2WPNA 1T3SA 2YHUA 1CBUA 3VV2A 4B48A 4YRBA 1NAHA 4UHFA 1XP8A 2XZPA 3ESBA 3IV6A 1LB1B 3K9NA 1AGRA 4F84A 2DFKB 3JYLA 5LMCA 1BRTA 4V38A 3K70B 1EXDA 1K1EA 3B12A 2QN6A 1IVSA 4QM6A 4AQ7A 2CSUA 3EZYA 1QOPB 3MOGA 1SU8A 4RACA 5TDHA 3ZXYA 3UZUA 1G3MA 2O7VA 4UU8A 3VOSA 3I01M 3TLMA 1SAYA 3IHWA 4O8ZA 2CJXA 3E84A 4DR5B 3CNNA 4JI2B 4BGDA 3FSRA 1JV2B 1NR1A 1YOVB 4F5DA 3V2GA 4DTIA 4QDJA 2ICAA 5KYUB 4HTFB 1WBBA 2GCOA 1KXZA 3WLQA 1X70A 1DC5A 3HCAA 4HY3A 3CN7A 4L3WA 3N8DA 4OBBA 1YBFA 2F3UA 1Z4JA 2OOKA 3CURA 4J0IA 4JP2A 4EPYA 1SBYA 2WKPA 5EUCA 1EP3B 2ZIUB 4AMVA 1SOAA 3L77A 4ZT7A 1HQKA 2AOUA 3NDJA 1ORTA 3DZBA 3IBTA 2HQRA 2HN9A 2PMDA 5F1KA 3WLJA 2DT5A 5FQNA 3OPVA 1JFTA 1NVVR 4QO8A 2BFDA 3L8GA 1AXEA 1A8QA 1U5BA 5CB4A 1M2HA 1Q57A 1LTHR 4H6VA 5CFRA 2CZGA 2WSIA 2I2FA 2WWTA 1JPNA 1UF9A 1YFKA 3K53A 5LOVB 2YFQA 2I0FA 2MU1A 3BILA 3GC6A 3LYAA 3M5WA 4HWGA 1FZQA 1Q1BA 3NW9A 3NUGA 4AFNA 3BHNA 5FIUA 1QAOA 3VH4A 2RKOA 3FJYA 3DBRB 4UASA 2HADA 2W2KA 2V98A 5H0IA 5GY7A 4UVHA 1QH8B 2I4RA 1P2BA 1BDMA 1GA1A 1E2HA 4E11A 1C4OA 4KIFA 1LDNA 3O38A 1SHKA 3R6LA 3C3YA 2GEDA 5GZ6A 4YGXB 3ZS9A 3EH1A 2F2TA 5CA1A 3THSA 3DDHA 3UMMA 1QQ6A 3NEYA 4XQGA 4IUYA 3COYA 5COQA 3W2HA 1QMPA 1WIWA 4RA6A 3R7FA 1K7CA 4MJLA 1O57A 3BICA 2LZ0A 2NYAA 2V58A 1JFFA 2ZWVA 3RFCA 2D2VA 4Q6WA 4EMTA 2HWKA 5TPZA 1BE8A 2EG9A 2YXPX 4RIEA 4F92B 5JOQA 5IK2D 1IU9A 5BSRA 2AN5A 4XEHA 2HBRA 4AMZA 3KDSE 4FFWA 1N57A 2VWPA 1SH7A 3CH4B 3T06B 4EO9A 4JYAB 4MEJA 3EEIA 4KWTA 2VUTA 2BSQA 2KI5A 1E2BA 1TU4A 1ZGJA 1JPJA 3DP9A 3H8VA 2NSHA 4RVGA 4BNNA 4NCJA 4JNKA 2Y2VA 4JL5A 2IXGA 2HLHA 3OU6A 1Q77A 3ETGA 1C2YA 3V7YA 4BNGA 1E3LA 2R4QA 3FWHA 4GR5A 4XGIA 1EUCA 1ZONA 2VHUA 2WYIA 5EEGA 5JTTA 1U0HC 1Z7EA 4A8JC 3EPRA 4MVJP 3WNVA 1WVGA 4WEOA 3FKSD 1BEUB 1VJGA 4U7JA 3A26A 4DHEA 2BM8A 4LJ6A 5EE0A 4G81A 3EWSA 3FSGD 2P2SA 3OQIA 1XKXA 4JLKA 2FF7A 3WYGA 3R20A 1QHXA 4UTVA 1Y8QB 1Q21A 1K6EA 1FFHA 2EL9A 2VSYA 3AIMA 4RPKA 2RH5A 2YXLA 2X19A 4XD7D 3GRRA 1YS4A 5AKLA 1WXQA 1N5LA 2HQ1A 3LBAA 2PX5A 3AL2A 4DDKA 4KQ6A 4ISCA 3VHXB 1MJGA 2VUHB 1DEOA 4JP3A 3CPJB 1EHIA 4M1YA 2PR2A 4UAJA 1QS0A 2J30A 3TTSA 1K6MA 4JOSA 4KX3A 4YMIA 3WMRA 2BSAA 3BIWA 4KXVA 2VT3A 4ZTUB 2QTRA 4TXHA 5COBA 3TUJC 1CJVC 5LUAA 1H0RA 4TWZA 2EX1A 1HYHA 4K9SA 2Q5JA 1ZK1A 3T95A 3WYBA 5LP6A 4S0XA 3R0VA 2QRHA 3A2MA 1ZJ6A 1U5AA 5F3RA 1U0RA 4Y6GB 2QRGA 1BXGA 1WCXA 4LYDA 2X7JA 1M3SA 2C98A 2PT7A 4G8CA 1DAMA 5EUQB 3H0CA 1ADYA 2NNWB 2ZAYA 1DQPA 3NHZA 4HZIA 3R0QA 4MR9A 5JQGF 4BRZA 1ZIYA 1FRVA 2P8SA 4MRRA 4R1QA 1JDSA 4NYMR 3S28A 4JDPA 3S1LA 3G0OA 1I3CA 1V3VA 3VPAA 3VRHA 4EITA 3BXOA 1AZLA 4BLRA 2DSNA 2HPHA 4MO9A 2JGLA 5JCOC 4GMXA 5TGTA 1SHZA 2Q2OA 2R7MA 3EXFB 3H18A 3SLRA 4FYPA 1RWPA 1SOVA 2PL1A 1E2JA 4ZVMA 5FX2A 1TIKA 5ALHA 1A71A 3PLAE 1HNNA 2ANCA 2GCEA 1BMFA 2EC5A 5CYOA 1K0FA 4FOLA 1G9TA 4ZQGA 1E61A 1F2VA 1NN5A 4IOLA 5DFAA 4BNWA 4AAYA 3EPLA 1Q3HA 3V42A 1P0MA 1WCYA 2DWPA 2IYOA 4PYNA 3RYIB 1V95A 5DT9A 4B71A 1VJTA 4B09A 2GSDA 3LYHA 1T8WA 4IHAA 2IPLA 3MGAA 3A1DA 2XR1A 3NKLA 1W6RA 3DOOA 1W4RA 2ID9A 3O4FA 4BMOB 1RRMA 2QN2A 1XDWA 2H1VA 3GT7A 1ZHOA 1X8JA 2NN3C 4M0MA 3PNVA 4I2NA 5GONB 3OWOA 4QIHA 3BRWD 1P81A 4UQPA 4ZT3A 3QLEA 2Q5FA 3SY8A 2OO5C 1UC5B 1YB2A 5ALUA 2BFMA 4QDKA 3QXSA 3HCNA 3VR5D 5ECDA 3UCFA 4IR7A 5C1BA 3HWSA 4NABA 3RABA 3AKYA 4UHKA 3JXEA 2OC9A 3N2EA 1R4NA 2BP7B 4GZLA 4F86A 1WABA 1VYTA 3E2MA 3DZJA 1AMOA 1LWOA 1UKZA 2MJLA 1CE8B 2C99A 3TD9A 1M2KA 1TX4B 4KQWA 5AHWA 5GIOE 2PZJA 2UXBB 3U7EB 13PKA 1NXXA 1MIHA 3JAMA 4BV3A 1YH3A 4TXNA 2A5LA 3GP3A 2I62A 2ZRLA 2IYTA 4QEZA 5IW8A 2AQKA 1IUPA 4X00A 3QVGB 3L8ZA 3SS7X 1JYFA 3FPSA 3N0WA 3DZKA 1RI3A 5FADA 1HNWB 1ZA2A 1BAPA 4TZTA 3S7TA 1TMKA 4II7A 3TE7A 3UPUA 3JARB 2FUKA 3L8EA 3D6AA 4CPDA 3UB3A 5ICCA 3A9WA 1Z0UA 2R1TB 4EDHA 2ROQA 3BFKA 1JLLA 1BN6A 1JX6A 3VV3A 3M6LA 1U7OA 1SK8A 2WG2A 4FS8A 2IUFA 1NW6A 3HO1A 4TMTA 4QFDA 1XA4A 2ZEJA 2ZYUX 1AG9A 1O96B 3IOYA 4B3XA 4KWHA 1WMBA 3BJRA 2OQIA 2X3YA 3WGHA 1VLVA 1BSVA 5DHUA 2YWHA 2YVUA 2A88A 4DG9A 1K2WA 4PIVA 3EA0A 3FPHA 3OJWA 1SCAA 2ZWOA 3I5UA 3PUIA 3QHAA 4M1MA 2C61A 3S40A 3S29A 1ZD8A 3AU9A 4NH4A 4DF3A 3EAFA 2X4GA 2YY5A 3TQSA 3RU9A 3ZVLA 1K5GA 4JGGA 4NV0A 2AA3A 4KR9A 3RDPA 4YQYA 2WIJA 1QO0D 1AO3A 1DINA 2WG0A 1Q0QA 1FU7A 2H2DA 4GSLA 1UWKA 2HCBA 4IFTA 4LZZA 1E2LA 3ROMA 3ZZ0A 3D5TA 4TTRA 2I7XA 2Q2WA 2EDAA 2GHRA 4HD8A 2SKEA 3LK7A 5T8KC 3PCRB 3W8NA 4L5JA 1P72A 4QRHA 4EQ6B 3W1WA 4Z54A 4FMCB 4AY4A 4CM4B 3MWFA 3ZCQA 4LCJA 2PFGA 1JBEA 2WP8J 1ESDA 3BDVA 1F0KA 2JKVA 3LBFA 4WVFA 1RZ3A 3OQJA 3JALA 3RVMA 4D45A 1SBTA 1O3YA 3L8YA 1IONA 1NOJA 2XRMA 2YJ5A 3AFHA 4S2UA 2I1QA 2XE6A 4ZOLB 4AKEA 3LWBA 1FXSA 1W5SA 1ZGGA 2GGSA 2FG6C 3FWNA 4LHZA 4BX3A 3W78A 4HOYA 4RJTA 821PA 2FJPA 4NYJQ 1HQYE 1JEYB 2BHNA 4RGQA 4NEHB 3U5TA 1BQEA 2ENUA 2FEMA 3KKKA 4ND5A 1JHVA 3VH1A 3W2TA 1HL7A 1NNEA 3AHJA 3GZJA 4PX3A 5TQJA 1J1ZA 2JFOA 1O54A 3WZLA 4BP9A 2BEJA 4L8WB 4YDHB 5E6UB 1CUIA 2JAOA 2LDXA 1GGKA 4LFAB 1SR8A 2GETA 1R1DA 1H1LA 4Z1MD 1TU0A 1U0FA 2B7BA 2IP2A 3FH0A 4DRYA 1S1CA 4BXOB 4LBVA 3P27A 2DKOA 3KB8A 5HJEA 2HF8A 1W5EA 1YZUA 2UYGA 4RZIA 4U0KA 4Y30A 3MSCA 5A03A 2ILVA 1OW3B 1XMIA 4XJVA 3OPQA 4ND1A 4DR2B 1P6QA 3E9QA 1MVLA 1MX9A 3DWGA 2PZFA 3Q7RA 2WNIA 5HKKD 1YIOA 3KOXA 5IAJA 3RWBA 5BSEA 4UCWA 1TF7A 2IHYA 3U3OA 1TNDA 2W48A 3QV1A 5JNLA 3PQ8A 5K0LA 2VHEA 1OLOA 4NCAA 2GSWA 5EMMA 5KQSA 2WINI 2QJRA 5HIKA 3A6EA 2ZBEA 1I4TD 1L7MA 4YASA 3AU8A 2VP4A 2ISQA 3LPNA 2OXCA 2GCNA 3S2FA 2QR2A 3IBGA 4ZAVA 5CPBA 3OOWA 3NANA 2YJ6A 2ZAGA 4LXUA 4K1LA 1UEXC 1VRCA 4H4DA 1UFOA 3CB4A 4YJ3B 1I2AA 1IHUA 1ZM2A 4G0YA 2CY0A 4DWVA 5AUQA 2BD0A 2FYTA 4YDQA 5FOVA 4Z7OB 2A59A 1RP7A 2P6UA 1AGPA 1KO7A 2OORC 4Q4JA 5FPKA 2W8BA 5EMLA 2QVXX 4DIOA 3ZJ5A 4TROA 3U31A 1ODLA 2R1VB 2WYVA 2HWYA 1LNZA 1QCCA 3FIUA 1NBOA 5F9FA 3RYHA 3H8SA 1E0JA 5E3HA 2C9BA 4CMHA 5A4JA 4AX4A 1VP3A 5JSZA 2WIBA 2WM9B 3DTVB 3KR2A 1PJ4A 3ICOA 2Z30A 1OREA 2WHXA 1PL7A 3VNBA 2OD2A 2FK7A 2NT3A 4DC1A 2J08A 1TT7A 3CF2A 2P3OA 4C4XA 4YRZA 4MQFA 3WTCA 1U3DA 1DI0A 4Q9LA 1DARA 1RM3A 1W4ZA 1V3UA 2DGDA 5T3YA 4Q4CA 1RC0A 1XRSB 3GH1A 2O8FA 4OO3A 3SX0A 1PZXA 1ZHHA 3VGPA 2PKRA 1IAQA 1E66A 5K0ZA 4P0QB 1WHSA 1PJ8A 1LDEA 1SBHA 1OVGA 2QZSA 2X41A 1G7CA 4GVLA 3DC7A 3QLVC 2MR6A 3I9NA 1UBFA 3H17A 1MX3A 3PHHA 4KG7A 5FPHA 4E13A 1SJ9A 2H17A 5MGBA 3TBFA 3RKSA 1J21A 4D43A 2HMSA 2HDNB 4IJQA 4K6CA 4F97A 4XR9A 3ZDRA 1CDZA 5TPWA 3NFRA 1YVPA 1G59A 3GDWA 1V16A 4GC5A 1NJFA 2ZIWB 2PJRA 2ATXA 2Y4OA 3N2GA 4Q1EA 4Q82A 1U63A 4MUBA 4Y0VA 2OXTA 3TSWA 1ULSA 2AE1A 2EGUA 2Q9AA 3E9RA 3N8NA 1BVUA 5CXUA 3ILVA 3GVIA 4UU0A 3GEIA 1QTEA 3G2NA 3N2LA 1JA1A 1TMYA 2X77A 3DAYA 1BE1A 1GL9B 3ZVRA 4FFSA 3NHJA 1M54A 3EVEA 4M1TA 4U39A 2QK4A 3NDPA 4EGCB 1JBKA 2R1UA 3HV0A 3N7UA 3PG5A 3V1KA 9LDTA 3ABZA 1SVNA 4JR2A 4ACBA 4WW0A 1ZC4A 3MPUA 4FOOA 2WAAA 3E3OA 3KEOA 5MDHA 3CR3C 3TD2A 5AHXA 2Q21A 1XLTC 3NP7A 4KOEC 3VVCA 5JZSA 3RIYA 3P9YA 1OF1A 3B3QA 1RHKA 1KNXA 3MWGA 3OY2A 3PQ5A 4FD3A 1TUGA 3VQTA 2GPTA 1MNAA 1QXSA 1WVMA 4IZ6A 5JWHA 4MCIA 1D5CA 1E2MA 1NXWA 1U1DA 1NU6A 1GNQA 1KO5A 2UVPB 3DE5X 2F17A 2C3MA 2NO4A 1R64A 3M9WA 2NQ8A 1K4YA 3MMZA 3KEMA 1FRZA 1XZFA 2I3BA 4MLDA 4TTPA 4XVCA 3PNPA 1AHNA 5FJIA 4JC8A 1HQDA 3COZA 2BCJQ 3UAGA 3GT3A 3HMKA 3N6XA 4RTPA 4H15A 4F72A 2ZJ5A 3ETEA 3GLHB 3WLEA 5JAQA 1R3UA 1UZMA 2AHOA 2PXAA 2WUFA 4TOIA 1DNPA 3BQ9A 1I2MA 4GR9A 1DQNA 1P2GA 3K0AA 3ROGA 3UWOA 4YMLA 2IS2A 1BGWA 4ANFA 1K63A 1KAOA 4YR7A 1ARZA 1NVFA 4G4GA 1EINA 1Z5OA 3R6DA 1E20A 4GT1A 1E3SA 1IXRC 4PY2A 1P9OA 4KQJA 3GVXA 2A9QA 2HGSA 5BUQA 3M4JA 4AP5A 2G5CA 2XVZA 4PG8A 1I2ZA 3SHVA 2XDYA 4C0JA 3KZMA 3PGXA 3PTAA 1M66A 4QJ3A 3GGJA 4YRDA 1VSTA 2NT4A 1E1LA 1IHYA 1WPRA 2B7LA 3MCTA 1Q17A 1VCMA 2PKEA 1ONSA 3LUBA 3T7DA 1PR0A 4ND3A 4GI2A 1M6VA 3STXA 3QTLA 1L5OA 4JC5A 2XNKA 3B3FA 4PQYA 1NRXA 1ZBDA 4KJZA 1JEDA 2XITA 5CA1B 4YJFA 3C3WA 1UT8A 1A69A 5HF9A 2QTWB 5BN4A 3TG2A 1L5QA 1YUNA 3I1JA 3R40A 1EVYA 4MRMA 1N6PA 5FUYA 4S2EA 3FYCA 5COAA 5JYDA 1QZXA 4OB7A 2AX3A 2NUPA 3C3DA 5D3MB 3L7IA 3BRSA 2D0PB 1V37A 3AFOA 4DCMA 4OY3A 3OJCA 2HWXA 2XMSA 3OLCX 2E4XA 4YK7A 2JZOA 3VFDA 5T64A 4CMEC 2IYAA 4M37A 3B6ZA 1X87A 3K72B 2E87A 4WHMA 3F46A 2VH2A 3JYNA 2XZOA 4QWWA 1DFGA 4QFCA 2IZ0A 3NHRA 4DLTA 4KHPB 5IKEA 3MOSA 4Y6PA 3ZY6A 3LYUA 2Q3HA 1AIPA 1KI2A 3H1TA 4FYWA 4YBRA 2UUCB 3FPEA 1O8CA 3QE3A 5CH8A 1DO0A 4OD0A 1YNOA 2W8ZA 2VJQA 4LRWA 2QNIA 2WSBA 4MZDA 4F5EA 1CUYA 3A4VA 3H11B 3VO8A 4KR3A 1VKNA 3HGTA 2BFFB 5ALXA 4MSUA 1NVUQ 2NAFA 5EZ6B 2HJSA 5HTOA 4JQZA 5BV2P 2Q5OA 1KFEB 4KAAA 1YMQA 4DPLA 3KHKA 4AJPA 4CTNA 1OY1A 5JD5A 2H85A 3L05A 3PNLA 4IDQA 2RIPA 4PAMA 2W00A 16PKA 3OMXA 2BOVA 2JL1A 2RHHA 2C7BA 1YGPA 5IHXA 1V5EA 2X8LA 4MCHA 3UOGA 3VU1A 2EKDA 3VO2A 4XFDA 2OB1A 1W2WB 5G40A 2QWXA 4YCDA 4BNDA 4BMDA 4WLEA 2AJTA 4QU8A 4KXQA 4U7GA 1U3CA 3Q5EA 4S1WA 1EK0A 4BKMA 2RHGB 1TYCA 1Z83A 4BMVA 2NSJA 1A8UA 2RK4A 3G2OA 4BBPA 2GAAA 4DUZB 4OXYA 1VJCA 5K0BA 2SHKA 3GPIA 3AESB 5ILOA 4EY6A 5HP4A 3V4SA 3ZY4A 1EUZA 4LJ8A 1X86B 1GNPA 1JU4A 2D0OB 2O0HA 2OCBA 4W5TA 4RKEA 2X0RA 1E3IA 4LXHA 2YOGA 1O5IA 4RH3A 4XGNA 4WDQA 1X8XA 3DE3X 3TPCA 2GJ9A 5CITA 3WRXC 1YJ8A 2RG7A 1C9JA 2FFBA 4AUMA 4F45A 2ZVQX 3W5IA 2G9QA 5HS4A 4KZPA 2AVNA 4Y2HA 2REOA 4Z4HA 3H6GA 5ERGB 3UKOA 1R0ZA 2JFQA 2FU5C 3CUEF 3IAAA 1P1KA 1AVTA 3KUCA 3K9QO 4B35A 2OBBA 3DCYA 5A2GA 2O3SA 2BEVB 3IL2A 1GTG1 2MMGA 4IV0A 5FTNA 4V0QA 3WLMA 3RJZA 3GLHE 5KEIA 1RYBA 1KI9A 2WD9A 1YS9A 2W6PA 4AU1A 1HDEA 3JTMA 5AKZA 2PD4A 2GVZC 1R0LA 5ICMA 2GZMA 3OOSA 5IAOA 3W79A 2DB3A 3IAXA 1FVOA 3NM5A 2ZSKA 5IH3A 4WOPA 1QWSA 3RTGA 3N05A 3M7IA 1UJBA 1EVZA 4PFQA 3VKVA 1D2HA 4YRCA 3CGGA 2JBAA 1PZGA 2WJIA 2ZGVA 4HADA 4HUTA 3W6PA 3OZTA 3UWPA 1HDZA 5AK5A 2XGSA 1F1JA 1I9CA 3ZJTA 2ZS8A 1SQFA 3RK0A 1XJ0A 2F9LA 2DZDA 3FRIA 4DB2A 3R3ZA 3EG5A 4FQ7A 1GZ5A 5IP5A 3TQFA 1B1CA 2NTNA 6GPBA 3FCOA 1IN4A 3MWJA 2JFWA 1B8NA 1KK0A 5L9AA 2NG1A 2VOEA 4KK3A 1JVBA 1UPTA 4ZVLA 2XQJA 1QGAA 1VMDA 2ZKLA 1XPUA 3HCCA 5U9CA 3OM9A 3I1IA 3ZOZA 5JAZA 4TM8A 2V74B 3UMGA 2YFHA 4PTLA 2PKYX 2X22A 2FPXA 3DFUA 4PZLA 3UOWA 3TJZA 1V1RA 4BVKA 4DEVA 5A5VA 2FW7A 2Q1WA 5HCIA 2PGLA 1U94A 3DLPX 2ZI6A 4YT4A 1U0OC 4MR8A 4QEDA 4WEQA 1RWBA 5AHKA 2YICA 3M1AA 1SA0A 2GPSA 4TLEA 3DOFA 3W7VA 4S05A 5HRUA 3QKTA 5BMOA 1WE2A 1PL8A 4QUIA 1XRPA 3LPCA 2W2OA 4CG1A 4D3FA 5JUWA 2E3JA 1IBRA 3GFVA 4MP3A 4WXRA 3V3TA 1F8YA 4G4SP 1HFEL 2ZYDA 3AF3A 1GL6A 1Q22A 3FAZA 3O0DA 3HXQA 1CDDA 4HDMA 4RAQA 1U4OA 3PXGA 1ZH4A 4NLLA 1NMXA 1T9DA 2Z8YA 4HLDA 2W71A 1ZUNB 4IRUB 3KOWA 2XB6A 2M1ZA 4L5AA 4OI4A 4R3UC 4JJKA 2JGEA 1HDGO 3K5HA 2EATA 3OKPA 1DX6A 4JCOA 5DULA 1NGSA 3OIVA 1IMOA 4P38A 4RMNA 1UKYA 3EIFA 4UEJA 5EXDA 4NFHA 1I7QB 1RXEA 4CKZA 4LE1A 1PJQA 1OBFO 3LBYA 2VNSA 3EDMA 5C8YA 3UJAA 4D3YA 1JL3A 1L1FA 1XCGB 3V34A 2YC2C 5JVDA 3TGLA 1E9CA 4HPXB 3T9AA 1DKRA 4REQB 2IF2A 3T7EA 4KPUB 4ETWA 2LTAA 4JLBA 1R10A 2ZIGA 3RAEC 3LHIA 1SY7A 2PVPA 3I5YA 4JJGA 4OHWA 4F3KA 4LDJA 5BQXA 4L07A 3HEMA 4M1KA 4Y0AA 3VR3A 3WTBA 3JYQA 3K71B 2W6JD 4NG4A 4R8VA 5JAUA 5JYBA 3P9IA 4EDFA 4JODA 3CRZA 4BIMA 4BXOA 1L4KA 4EUNA 3A2NA 3AERB 1C7JA 1LDGA 1R27A 2YS6A 2P75A 4ZQIA 4CHTA 1B14A 4EZBA 5IYZB 3TOSA 1UKCA 4EY5A 1Q20A 4R1PA 2Z6AA 4B3MB 1Q1EA 3DEAA 2FUCA 4DILA 1N5JA 2NYUA 4XEUA 1ULUA 3GLGB 1UPBA 1Y6GA 2WYWA 3E3NA 3GYBA 5K4HA 4KH1A 2VHCA 1M8GA 1V7PC 2CXRA 2WV7A 4DMFA 3DAGA 3LRPA 4JYCA 1BW9A 4AO8A 1NFFA 1XPJA 4F38A 3OPNA 2JZCA 2AKYA 3M49A 1RW4A 2DHDA 2PUGA 3HUTA 4JVLA 5HKOA 1XEWX 1FJHA 3U3XA 1KBQA 2ONYA 3P32A 4X7BA 1Y80A 2ZJFA 4RPLA 3AI7A 4ZZ0A 1UBSB 2AOTA 1E2GA 3KFXA 2PSFA 1EE2A 1IHOA 3A9RA 3VDRA 2QL7A 5ELXA 3OAAD 3KZOA 4XWGA 1TZCA 1NBIA 2D00A 2ATCA 3OTHA 4H7HA 1XTKA 3ZCVA 4J6FA 1B3RA 1GKLA 1WSBA 3B6MA 1VPVA 3PNBA 1QORA 3PXUA 2LCQA 1QNLA 3A9UA 3G6KA 2BE9A 2KSQA 4B74A 4W5QA 1TPZA 3GLRA 4KIUA 1V8ZA 2SKDA 1OIVA 3GU3A 1EB9A 3D4LA 1XZHA 2ZUEA 1QH1B 5A4DA 4RPCA 1FDUA 5HK9A 2OUIA 2AJ8A 4QDXA 2PRKA 3IRUA 3RR2A 1T3TA 4YDRA 3VU0A 4Z53A 1QHHB 2B4RO 1UFKA 5G0VA 5ICEA 2BMEA 3QVJA 1XBTA 1Y42X 2BM1A 3CZQA 3TLYA 2UUBB 3HJUA 2OCKA 3K30A 3BSWA 4ZYTA 1BC5A 5C4MA 3BGSA 1LD3A 3BGDA 1IN8A 2XA1A 2GHTA 1AF7A 4WN9B 5C32A 2XT9A 3D0OA 2H0RA 1HE8B 3FWKA 1CFJA 4H2DA 3PC4A 1IZ0A 5HKLA 1JW9B 1N3BA 4PYRA 4D2IA 1Y9EA 5DXAA 2LP4Y 2XI4A 1J90A 4BLQA 4G5RA 1CEEA 5IARA 2O23A 2ZANA 1W52X 3SX2A 1RMTA 4KO3S 2WE7A 4LCEA 5E1BA 1Z2NX 3OUZA 1U8FO 2G0NA 3OKFA 3UJDA 3ZEIA 1F7UA 1Q2XA 2XCRB 2BONA 2BFCA 1M1NB 2QJTA 3HA2A 3WQRA 1ZIOA 4AMGA 2H7VA 1ZOIA 4UPVA 4KNYA 4O2RA 4P3NA 5JASA 1I3OA 3JQAB 4JEMA 3GXOA 3ZGYA 1CR2A 4ABTA 1QR6A 1P91A 1T9BA 3LT4A 3Q9UA 4YMHA 4UD2A 2L17A 1G9XA 2NYVA 3I8SA 3N70A 4N5DA 4RNCA 4DDHA 4NARA 2AT1A 4ENQA 4CHGA 2W6NA 2RGRA 2A3RA 3BL6A 3K1JA 4HDQB 4XQ9A 2DR3A 4BUZA 1N0VC 3H8JA 4AIIA 1FCJA 3LCMA 4ZO4A 1OLSA 1V8FA 1ZGAA 2REBA 1IY9A 2XE4A 2WUDA 4IVRA 3SS8A 4BY9E 2WUVA 3PIIA 1XZDA 4YRGA 3UYLA 4R2MA 5LA6B 1XPOA 2R5FA 4AVYA 2FAXA 1C8VB 2FN8A 2QL9A 4MV0A 5CPFA 2FR1A 1OJ7A 3RREA 4B33A 1CR4A 4ZP1A 4BPRA 2JIQA 1I30A 4MX8A 4MCJA 5FTKA 2QG9A 1NQWA 1EGVB 2IPOA 2ZBRA 4MINA 1HC7A 3HCOA 3L02A 4G0MA 1HEIA 5ALMA 5ADUS 1PR5A 5BSTA 1AKUA 2C4MA 4P0TA 4NZZA 2OYSA 3M4NA 3ENKA 4MV5A 1YZVA 4V02A 5ITWA 4I99A 4LGCA 3E9YA 1T0IA 3FROA 3WKBA 1EX1A 1K6JA 5H68A 4CIXA 1JYSA 1YXMA 4I3HA 3ABSB 3VZBA 2G4VA 2DUNA 3ZX5A 1KZ7B 4YROA 2F1OA 4I5FA 4KQMA 1KO1A 5TARA 4DKXA 3QE9Y 2XCOA 2GKOA 3DG9A 3AEYA 5CIQA 3WWOA 3GLGE 3WLTA 1M8JA 3A04A 5F4ZA 3V33A 1L7EA 1CK4A 3FGOA 3TQOA 3E18A 2XXAB 2OKCA 3VU9A 4EUFA 1JIUA 1S3IA 3OECA 4X20A 1DVRA 2BZ1A 1UFQA 2V7BA 3JTEA 3IP8A 1GRNA 1TB4A 1YTUA 4F2WA 1ZN7A 2NZUG 3KG2A 1SV1A 1FMJA 2VLIA 3E5NA 2B99A 5FXMA 4KBGA 5IZ4A 3N5CA 2WJPA 4HGPA 3UBMA 4OFBA 3STYA 3V5NA 1D8TA 1E1NA 1MORA 3CSUA 4RVUA 4UJ5A 1TEVA 3B5IA 3HUDA 3X2EA 4D0GA 4C4SA 5FJJA 2DPMA 1E1QD 1VJ0A 3PUXA 4ENRA 1GNTA 2BGIA 3TGWA 4Y98A 2OEPA 3IVRA 3NYRA 3R41A 1UCFA 4GPIB 3NWJA 4HN4B 4UM7A 5F76A 4D9NA 1U8EA 5BWOA 1XAHA 4G2NA 2GEJA 2O1WA 2VDQB 3B6KA 2J0QA 3LXMA 1ULHA 4QGGA 2H3HA 5D84A 1RBQA 2C2HA 1ZYUA 1EEHA 1INLA 1D9ZA 2VJCA 3UN1A 2X6RA 1AB5A 2CF6A 1E92A 1RXSA 3AEKA 3BIOA 3HKEA 4JUFA 4TQGA 5C1IA 3PFWO 3WYFA 2DFTA 4B2YA 1O1YA 4RABA 5BMVB 3RVSA 1JFSA 1BA2A 1SUDA 1AXRA 2GK4A 4AKTA 3LX4A 2I66A 4WLOA 2XZDA 1Y6JA 2O0KA 1XQ9A 2XUAA 3B6IA 1FP1D 4GRAA 4A0GA 3Q2IA 1EPUA 4CKCA 1G3UA 2H4JA 1F8GA 1IJFA 3QXXA 2GNOA 2FR8C 4DARA 4QT0A 3X2SA 5JFGA 5F98A 3AUSA 4R6WA 4RTLA 2H1LA 5DPMA 3T7JA 1P45A 1ODKA 1W5TA 5AW7A 2IV2X 4FYHA 5HFNA 1A9TA 3QWBA 3U7QB 3V4PB 5JZ9A 1UBHS 1BKYA 1E62A 3NWPA 2HSDA 3L1JA 1G3RA 2Q8PA 4Z0HO 3GRAA 4P5PA 3F5QA 2D5BA 4RM3A 4V1CA 3EQ9A 2IU0A 2IRWA 1C3XA 3MBIA 2G6TA 4FCCA 5E3JA 1AQNA 5KNLA 2X2FA 3TLBA 5CT8A 1U9IA 1U0NA 4CCYB 4GPEA 3U4QB 4TTVA 4KLCA 3E7FA 4IFEA 2IYQA 2KPOA 1Q0ZA 2G0TA 2OXRA 4IDDA 4WVLA 4IGEA 1XRJA 3FF1A 2HLPA 4MPRA 4BCCA 5BYJA 4G4SO 4YV2A 5E9WA 3QXHA 3K0FB 4ZA2A 2DC1A 4ZMSA 5BR8B 4AZ0A 4EHBA 3VAYA 3K2QA 1M1YA 4TS3A 3G85A 4PLTA 2PA3A 2AFIB 1ID1A 1O03A 1X7GA 3L7DA 3MLBA 4ODIA 4W6ZA 4RS4A 5HZGA 4FIDA 4EA7A 2ZROA 1OV6A 4RW0A 2I2XB 2YXEA 3P9CA 1EWRA 4FHFA 4K86A 2IYWA 3ETCA 2QTNA 4C4AA 4ZRNA 3WMEA 4QSHA 4PQRA 1ECBA 4N6NA 4FXPA 4QASA 4F71A 1FNCA 2PX0A 2QTLA 2OT3B 3BFVA 4Q4AA 2CD9A 3HB9A 4G09A 4XD2A 1VB3A 2VHYA 2O7NA 5EZ5A 5LOVF 4RTMA 2V0CA 3O1JC 2JLZA 1Z56C 5IZCC 2IK8A 2QTBA 1FMLA 2W6IA 4JU8A 4X44A 1W1WA 4W5RA 2BBOA 2F90A 1B41A 1PVDA 4U5XA 2FPGB 2QB5A 2C5GA 1LPBB 4KQHA 2Y68A 4OGFA 4X64B 1KP2A 3EOBI 1IY1A 4YAKA 4E46A 3MMSA 1OI7A 1X6VA 4FSDA 4J7CA 1GZDA 4D8YA 5MGNA 3ND8A 5GJWC 3D6TB 5ER9A 4UXIA 3I61A 2OV3A 1A9QA 1L1EA 3PDCA 4IGKA 4WL0A 5AW9A 1JKMA 3TXXA 2D7DA 1QHNA 4L2IA 4E09A 4ZT6A 2UYQA 4KUHA 4ZANA 2HBYA 3EAQA 5KWIA 3L4KA 4U8GA 1IC6A 2J9FB 2OLJA 3WGQA 5H82A 1FFDA 3LO5A 2ZBDA 4IEFB 1PKEA 1NKSA 1PVVA 2BL4A 4A9AA 1EFAA 4DCVA 1RYDA 3TLEA 1C2TA 3CLTD 1JTFA 1T8PA 4V24A 1RWOA 5BV0A 2AB0A 4L9AA 3M6AA 1C7QA 3CBGA 3I04M 4EFNA 3KXLA 1XB2A 5B7GA 4Q3EA 3L0ZA 4MQ4A 4GZMA 1TUBB 3DWEX 3PJRA 3OT4A 3F1LA 4NS1A 2CHVA 2H57A 3CKLA 3EJWA 3KELA 3G02A 2KLBA 3KPVA 2C84A 4L76A 1GD1O 1IJEA 2V9PA 5JPCA 4ER0A 5JMWA 5JS1A 1WBDA 1BXRA 3IOBA 4R84A 1ZH2A 2DBVO 3PK0A 4DSOA 5KNBD 1Y3AA 3CNLA 2PZGA 1U2DA 3R9XA 3SJUA 3UKDA 1SUPA 2P9BA 4B3FX 2J41A 5DLPA 3TFOA 3K0BA 1FP7A 3KEGA 4HDRA 1KTIA 4W5OA 4KH0A 1DBIA 3AF6A 5CH3A 3T3GA 4JJAA 3UK6A 2P9TA 5ED0A 1WF3A 3MYYA 3UWSA 1VXRA 1UTUA 1IPHA 4MYCA 1N4DA 3JD3A 1CJCA 2D1YA 3TB4A 2GM9A 2P9JA 2P6OA 3B3GA 3ELUA 2A0YA 2FWPA 4KB5A 3SHWA 3CSSA 4E07A 4O1MA 3W05A 3NHSA 3SEAA 2X76A 4MI3A 2IGTA 4Z51A 1U1GA 4EFLA 3GEEA 3HGQA 4B3RB 3IXLA 3UT5B 1A3CA 2ISCA 3BREA 4MKGA 3MERA 3GVPA 2FMUA 3HB1A 4Q9JA 2JJ1D 5FORA 4F6RA 3HJBA 1PYDA 3AVQA 1B6GA 4HXEB 1SU4A 3DKPA 4BUJA 4AUKA 1RRPA 1Y3CE 1YL7A 3W1EA 4I9FA 2RBEA 2AH5A 3UJNA 2VAPA 4I1OA 2P0EA 4YO7A 1VSUA 4LMBA 2IW3A 4KNVA 4XSVA 3GF4A 4HAVA 1ZIXA 4O5AA 3LY9A 3B8EA 4LK3A 5CIWA 4BO4A 3KYCB 3T7KA 1ZKDA 4BO2A 2R2AA 1VIAA 4E5DA 4GPZA 4B4DA 1GPDG 3CEAA 4R81A 1KZ9A 4TYQA 1HLDA 1XR3A 3C7DB 1KYWA 1Z5UA 4WK2B 1JHUA 4OI1A 4Z0PA 3DMFA 1SN7A 4LQ4A 1WTAA 1P29A 2V7QD 2OFWA 3O3OB 4M9CA 2ZFUA 3HBAA 4QPCA 3IAFA 2G28A 3CUVA 1P18A 2D59A 3NS7A 2IEZA 3QQPA 4PNZA 2V96A 4O2AA 3FDXA 1CQIA 3GUYA 1RPZA 2B20A 1NM5C 4JASB 1RWXA 2KQUA 3O0TA 1F0PA 4K87A 4D98A 2DH6A 4BKPA 1QGYA 5IHPA 3FNGA 1R8YA 1V4NA 3OJEA 5I7OA 1JQDA 2P35A 2HJWA 2AQ8A 2OMKA 3JATA 4JJEA 4MLPA 4OB6A 4IXMA 3SC2A 1V5WA 1J8VA 3U09A 5FWYB 2YW2A 3UYKA 5GADl 1EGAA 1P60A 1ACJA 1IXZA 3KUDA 1PLLA 2NXEA 2YMQA 2YWDA 2EFEB 1E1KA 2PMCA 5KKNB 3EC2A 3FYDA 1R7RA 4M7PA 3ZKAA 1QONA 1K8XB 3LT0A 3T41A 4A8TA 1DB3A 2IWRA 3U9SA 1N5DA 1M6EX 1OHHD 1IEQA 2IBTA 3GUVA 2V3WA 3VYSB 2XOEA 5KKCA 2P9HA 8ATCA 3HB4X 5CGZA 1C8KA 4BMPB 2ZOSA 4AK9A 4Z4CA 1P0IA 1R5OA 4KFUA 1TZMA 5CHYA 2E5LB 4QYMA 3UG7A 2QTCA 4UOZA 4BKUA 5NLLA 1QRUA 2FPOA 1F4LA 2YHIA 3DZGA 4J0KA 3W4IA 5LZ9A 4DR1B 2E7ZA 5KKAA 1E3WA 1ZBQA 3DLAA 3H2YA 1AUXA 5TMEA 3S4YA 1CS4C 5F2KA 5K03A 2GJAA 3P9QA 4ENVA 1PK8A 1VE7A 4LXYA 2R00A 2VK4A 1J9ZA 4G4JA 4IDPA 3T3MB 3WS7A 2C59A 4W63A 4DR6B 4ZKEA 5HDQA 4LF5B 4QQNA 4AG6A 4NV1A 4KE6A 1NJ5A 1NY5A 1YZYA 4O6VA 3ZWDA 3GRZA 2VNAA 4NXNB 1R37A 2FNAA 4M54A 3ANMA 3O8NA 3WY9A 5KYTA 4X95A 4UFPA 3TW0A 3IB6A 5KYXA 1X1RA 3DCNA 3ONFA 2WOJA 2EHJA 2WEKA 2ZJBA 1B16A 3I62A 3MWLA 1AMUA 1P1HA 1RI5A 5IT9A 2PBLA 3ZGLA 2WJYA 2WU3A 2QAGB 1J8DA 3QFFA 1THZA 3DOUA 2P7IA 4GBMA 2ZDHA 3F9IA 1XD2A 2DP4E 3BMCB 2ENWA 4HP8A 4I36A 4J76A 1WLSA 4A8JA 4LFBB 3QY9A 4ENWA 2OFFA 1UQTA 3CEHA 4F3TA 1Z36A 3EGIA 3IJEB 1UXGA 3K35A 3KQSA 1NQOA 5FBKA 2EWWA 5U1PA 1RM0A 4DMGA 1DEAA 1OX4A 2XNDD 2QR5A 3JZDA 3NOVA 2L19A 4Q16A 4P7GA 1IRXA 2H07A 2PU7A 3H04A 4FMCF 3SI7A 3SLKA 3PQ6A 3TK1A 4HLQB 5AKGA 1MV8A 4CQMA 4IKEA 3JQFA 1Y7PA 2VJMB 4DGSA 1IWPB 3UO8B 2NP6A 3TB6A 3NG1A 4GLJA 2ZM6B 5K2MA 1N92A 1VA4A 1RKXA 2QDXA 1XHFA 3KLNA 3G2KA 1RJ9A 1F6DA 1NE2A 3CXRA 4ZI7B 1AKNA 1ADJA 1YB6A 4LZJA 2YIDA 5BOSA 3OIYA 3GPCA 5CBPB 1DJNA 1H9BA 1QFJA 4U6NA 3UEOA 2I2WA 1FX1A 3B5JA 2AMLA 1F8FA 2AD1A 2Z5LA 2Q2VA 3L0DA 3QBEA 3IUPA 2B37A 4D5GA 3KT6A 4RMGA 3K92A 4MDHA 2HPVA 5ECWA 3UAZA 2I6QA 3QYPA 1HBJA 3MCZA 3OQHA 1E7SA 5K2OA 2ZB8A 1L5HA 1W88A 3ILYA 3DVLA 4XCVA 2AV6A 2EWMA 3A14A 3E9DA 1TKCA 4CUKA 5F23A 2HEGA 2YN0A 4C4OA 1NJ2A 2XYRA 1LBEA 2WSLA 1C14A 2ETXA 4G65A 1KDPA 2BGTA 4P2BA 3KX2A 2R6GA 4MKHA 2PGIA 4WDRA 3WGVA 1EI9A 1VJ1A 1WDTA 1YO6A 4M2LA 3WKCA 4HNAA 2O1SA 2VIIA 4W5WA 3K5PA 5EXPA 2A94A 3KSZO 1JHMA 4DNXA 3WRYA 4JT8A 3ZY3A 1K6XA 1SVSA 4X1OA 3WIUA 4B7ZA 2W58A 2EZ8A 2WIKA 3DE1X 2OB2A 1V7QA 5DISB 3PUVA 2G1UA 3B38A 4I81A 1KE1A 1M2GA 1YTLA 4DSTA 3O1LA 4RH0A 4HSGA 3WBJA 4B31A 2F4VB 4KKXB 3N8IA 2DF8A 1JEEA 2R6FA 1J4AA 4RNDB 5KYNA 2IIPA 2ZT8A 1KI1A 1W9HA 3I9OA 3LT1A 1WVIA 3PTZA 1EUYA 2F9MA 2CUTA 1TK2A 4RMIA 4D8TA 3P97A 1GFSA 1YS7A 2VH1A 3OPMA 2UZ1A 1DBPA 5TIIA 3FCCA 2H5IA 1GCIA 2NU8B 3WP0A 4RLQA 1DT3A 4RPIA 2OBXA 3KKOA 3C45A 1ZN9A 4NVRA 3R3SA 1YU6A 1A27A 5B12A 2Q0HA 2AQHA 2GASA 1GCAA 4MLZA 1EU1A 1SHLA 4HK4A 1DKLA 2CVPA 2HHAA 3SIXA 3UICA 1RRKA 5B64A 4NE9A 5LP6B 1Z3IX 2JGKA 3HR7A 2X9VA 4LQDA 4XLLA 3ZNPA 4E5NA 3R5XA 3RIXA 4E22A 3IUYA 2V6JA 2RAFA 1G20E 3N9IA 4IUBS 4KPGA 4P4GA 1YL6A 4RK6A 5E38A 4FSXA 3P4XA 1C9YA 4NCKA 4KSCA 1OAOA 2HHHB 4BE9A 1G20A 4KU4A 4MYTA 3SNHA 3HZRA 2OZKA 3GFFA 2QVGA 5AK4A 3FPGA 4H7JA 1XZ8A 3M1YA 3MQ2A 4Q7KA 3ZVKA 4MPTA 2NZ2A 3IH5A 4ZO7A 3NBKA 3STUA 1TYEB 3SC4A 1E5TA 4JXJA 4FT4A 5IJ0A 1ID8A 2VCHA 4X60A 2ZTUA 3A6DA 3LKBA 2ZT7A 1X1CA 1E5XA 3BB3A 4WRRA 2PRJA 1CEQA 3WJ2A 4HUQB 3WQBA 4JOBA 1IAVA 1ONPA 3IAEA 1VE5A 3KKZA 1JKIA 2H18A 4QQRA 1NR5A 2QJFA 3SM3A 4HLCA 1IUKA 4II3A 2QMEA 6REQA 1OLUA 4XM1A 4HNSA 2H92A 3BCHA 5E0KB 3HG7A 3TTUA 4HRXA 1XZLA 1PT8A 3K4HA 3B2EA 2EJVA 4Q3KA 1PS9A 1WW8A 1UQRA 4N5IX 5JJCA 3NVDA 4O4JB 3S6JA 5JDCA 4DGQA 3MRTA 1K89A 1MEOA 3HV2A 4ND4A 2ZM5A 4KRYA 3U44A 4HNVA 1ZI9A 5IKMA 1EDZA 2WVAA 4FEAA 4U3JB 1PGNA 1GKKA 3K0HA 4C4YA 1DBSA 2GK6A 1GZVA 3SEZA 4DWOA 1DZIA 3F47A 1W5AA 2J9XB 5KS2A 5BW4A 2EX0A 2N75A 4HH1A 1QFZA 3KJHA 1DRJA 1FYWA 1EIZA 1VCHA 3BJEA 4GHWA 1V9SA 3LA6A 1GQ2A 1UOPA 2ATIA 4HXGA 3K9HA 5T8KA 4BOYA 5KC9A 3A1CA 4TQUS 2A9JA 2AN4A 5FHRA 2PHZA 3EFHA 4N5LA 3T61A 2I3AA 4YCMA 3FYUA 2BTQA 2C83A 1MP0A 2OHXA 3EVTA 2Y9MB 2ZZMA 1TCBA 3O8OB 3NJ4A 3M3HA 1VFNA 5E6RB 4DV4B 1C3VA 3O3CA 5TQ0A 2R8PA 2V7VA 3T9CA 4FQ8A 2CE2X 1OLXA 3EIXA 4KUGA 4WKCA 3FBGA 2G71A 4LHSA 1UUFA 4GBJA 4OLFA 1W35A 2ZRCA 4LKOA 4Q1BA 5I3CA 2J31A 4LC1A 3VPSA 1JLLB 1XYYA 4B73A 2FMTA 3C16C 3THWB 3T3HA 1UPCA 2WFAA 2FW9A 2GEKA 4N0DA 5FLKA 4CTMA 3P52A 2Z0MA 4EKYA 4CLRA 1ECLA 1ZRHA 4JJ8A 2W4MA 1NI4A 4H18A 4R2XA 3CUYA 1JEQB 1B8PA 2IYXA 3E58A 4J16C 5BQPA 2WFZA 3NKFA 4REMA 4PCVA 4CDGA 4UDOA 3D59A 4MI9A 4FBGA 1Y8ZA 4BFVA 4IIBA 3A1EA 2WQ6A 3Q41A 4CJXA 1Q0HA 2BH9A 1QRTA 2WJWA 3SF8A 2VJLA 2DPLA 4MWCA 1LGYA 2JARA 4K9MA 3VR0A 1X7DA 4Z2YA 3ORYA 3DHWC 3O8LA 4BE4A 4DT1A 2IEIA 2ZUCA 4I50A 2WWWA 5DXFA 3SZ3A 1W0JA 2RAVA 2HB6A 3DS8A 4YP9A 4GKAA 3CM0A 5B7QA 4CXMA 3IQGX 2A0UA 5DBIA 5TQ2A 4YJ2A 5JCPA 2O0LA 3IP6A 1VG9B 5AKJA 2JLRA 4NPCA 4KO2S 2G72A 3ITDA 2WVHA 4EHKA 3WK9A 1G291 1GZSA 1XPRA 3O91A 1K7YA 5YASA 5F78A 3CLTC 3JAKA 5EIXA 2PL5A 5KQLA 1HT3A 4OGLA 2ID7A 1J33A 1JLSA 1KY5A 5CX1A 1NC1A 4Z5XA 3BMQB 2C42A 2ZJYA 3OFNA 4FLFA 3AHGA 4MARA 1Y5MA 3N28A 4UU7A 1ETHA 2H0AA 1GPAA 1U2TA 3ZJVA 3OEWA 5BVHA 4S1NA 4BJ6A 4G1UC 1E4OA 1ZMXA 4MRPA 4GDFA 2BKXA 1DSSG 4WZ6A 3AKDA 5AVTA 3IBSA 2J70A 3O1HB 3LY8A 3HCBA 5HTKA 4IAOA 3JQAD 1PDOA 2OECA 2XJ9A 3GELA 4K9PA 2C2MA 3LOUA 3QG1A 5B1DA 3SU8A 4ZGGA 5FOTA 3N2ZB 4NJEB 1FYDA 1IVNA 2FZGA 5A6SA 4D0NA 4AMUA 4MXDA 4OA8A 1H1LB 4QTXA 4WXPA 1O5TA 3AUXA 3KJZA 3EQZA 3UANA 1ULAA 4BO3A 9ABPA 3M6FA 3DDCA 3FW1A 3I3SR 3TO5A 1JJIA 3NC4A 6ABPA 4W7SA 5C4GB 3AYXB 1TKAA 3MCAA 4IMRA 2XUHA 3AZQA 2GM5A 4ARZA 3EIUA 4I2VA 1FYEA 2V7XA 2FX3A 5K01A 2CE7A 2XSZD 2GHIA 3F4KA 4MYHA 5TT0A 3Q7QA 3EXIB 3KP1A 4RELA 1E4YA 3GO4A 1JXAA 4C14A 2PE5A 3NORA 5HFAA 1TAGA 3U3KA 4JFRA 1Q14A 3ZBUA 4I66A 3CG0A 3WK7A 4ZHQF 2QSUA 3FSEA 4MKIA 5BV7A 5CX4A 3FHLA 4KGZA 4MJ7A 4MNTA 4DV6B 3C3MA 4IGFA 3LUJA 2QYOA 2JGDA 5HVNA 2XMZA 3RT1A 4BO1A 3UJ6A 2NWQA 2HTFA 3P20A 3SXUA 3KOMA 1DE0A 4GKVA 5HMLA 1U02A 3U16A 3KAKA 3NBQA 3FOWA 3C43A 4Q19A 3B20A 3C6BA 1L8OA 5E4FA 3VKUA 1R00A 2YJNA 5I5EA 1EP9A 1YB5A 2GCGA 2HZ7A 3B9QA 5A9SA 3WHKA 4AF7A 5K99A 4IIYA 1CZLA 4JLDA 4S12A 4ESEA 1UR5A 4YP7A 2E82A 4RULA 4LJRA 4K3UA 4YJKA 1SC3A 2R6JA 4RQBA 3ETLA 5K0CA 3DMTA 3R3VA 3MJRA 4ZOEA 5HF8A 4D6XA 1OYVA 5K6AC 2XQKA 3OCJA 1JS1X 2YXNA 3GA5A 1FF9A 1KI7A 1XLUA 3GP8A 3MMPA 2Z9CA 4X84A 3KUXA 3LBHA 5CLHA 1N2CB 2FEPA 2J9GA 2DQKA 5I9TA 4JI1B 2PMFA 2Q28A 3EXHC 4JEHA 5B53A 1CFZA 1P4RA 1X2BA 2P62A 3IRVA 3PF9A 3HZHA 5D6OA 3W9BA 3WDLA 2ACKA 1T8SA 1GLNA 2ZE6A 8ABPA 1G5HA 3KU4A 2QP9X 2I76A 3N0RA 4RORA 1F38A 3KQLA 4NZOA 4AY3A 1SKBA 2CYAA 2OLEA 2B82A 1Z5ZA 2GXSA 2AQIA 2R8BA 4FX5A 2GS9A 4XFJA 3U7IA 4FYJA 3MAAC 2VDVE 3SPXA 4JLUA 3WO1A 1Y3HA 1VHJA 2BBWA 2ZJ7A 2Q41A 5IG2A 1V39A 1E3TA 1G3QA 1GRQA 1OC2A 2C4UA 2ZYVX 3LLCA 4OJNA 2WJGA 3SBXA 4CMIA 4YNBA 1TTHA 4FNAA 1P9RA 2C4VA 2ZUDA 3ZU3A 3OICA 1RFLA 2FOIA 1ZGBA 1QSGA 1BKSB 1XZNA 4JI3B 3SQMA 4ESHA 2D8AA 3EXEB 1S4QA 3GJ7A 1KMIY 3C15C 2HIMA 4ER5A 4TS4A 3FFTA 3IALA 3UUGA 4RA9B 1R4AA 4WZBB 3GAAA 1FUKA 4C0XA 4KQFA 3EF1A 4LFCB 1AKMA 1PGOA 2X5XA 4I3GA 1QVWA 2ALJA 1JIQA 1AV7A 4L4UA 1GM5A 5T4HA 2PQ0A 1ISIA 1VKRA 4FEYA 1EA7A 4PM4A 5DGHA 5FNVA 3ZPXA 4C6SA 4C76A 1VBKA 1ADGA 2VATA 4GPAA 5DGIA 3ZQJA 6NULA 2JFXA 4N5NA 1UBGA 4DAEA 4YGYA 5CLJA 2RGAA 2FEXA 3GJTA 4KE7A 4DRZA 4WJZA 5FPQA 5AVWA 2NTJA 4HRAA 4LDZA 3RH0A 4YP5A 3MCWA 4R51A 4MIKA 4KQKA 2GB4A 2F3QA 5K8TA 1GTJ1 3NATA 2NP7A 3NHKA 2CFTA 2QG6A 4YIHA 2Q1SA 2SKCA 5FULA 4BO6A 3MD0A 1XVUA 2I65A 2JJ2D 4JP5A 4HGOA 5EKXA 1MOQA 1T9GR 3EQ8A 3P96A 4XKJA 1CXZA 2CNWD 4RM2A 3DA8A 3IV9A 1M75A 3LWNA 4N7RA 4Y1EA 5DTRA 5M2QA 2ZTMA 1JWAB 4FMPA 5ALWA 1SVOA 4MWGA 5E4JA 3TINA 3CKMA 4MVJD 1DX9A 1W46A 3HS3A 1TM3E 1U8YA 5B55A 4XYGA 2G7MC 3K6JA 4CV1A 3IPXA 2B3TA 4NEGA 3W8DA 3BMOB 3RVLA 5A3SA 1F0NA 3R6TA 2JGNA 2AWNA 2OV1A 5CFOA 4QWMA 1KRXA 4FYVA 2EKBA 1QIGA 4QRIA 3NDIA 1EFPA 2XVAA 3NB0A 4YAFA 2C58A 3SDSA 4HDSB 4CG2A 4RGBA 2UUOA 5LIPA 4CKWA 2J6YA 1X7WA 2FRDA 2IOQA 5JAHA 4E3ZA 5C1DA 4DB4A 4QELA 3AY0A 2HUPA 3A1TA 3MWDB 4W6QA 4EI9A 2E6UX 5K3AA 4B0OA 2Q1XA 3AJAA 2I2CA 4ZOLA 5CYGA 2YIVX 4P93A 2PSDA 3E1KA 4UNIA 3OP1A 3CZPA 3DDNA 1P2FA 3GGCA 3QBVA 4N12A 4NV3A 4PO8A 4Z9AA 5EXEA 5IYZF 4BJHB 2BFNA 4J0GA 3AHFA 1N7HA 1DWUA 1G16A 1YR9A 2CZQA 1O95D 1XTJA 1FLDA 3BZUA 3AF2A 3HDVA 3IPCA 4KQCA 4OLJA 4R83A 4WCFB 2ORED 3EZGA 3F9RA 1C1DB 3PD0A 2QOEA 3K9LA 2VSNA 4KO4S 4JWKA 3UJ3X 4XWKA 2XXBA 3VOBA 4AN1A 3VR2A 3NAQA 3AHCA 4D81A 2KMLA 4H1WA 2LXNA 3JYOA 5B6IA 3TVTA 3UFBA 1N2CE 2Q99A 4ZT2A 1A9PA 3ZH9B 2O7QA 4M46A 4P7BA 5LBUA 3EGOA 1J97A 4TLDA 3IDFA 5GAJA 4TGLA 2F67A 4E2YA 2NLOA 2RBKA 1L7DA 3B1FA 3I72A 4PIMA 3PQ7A 4DC0A 3DYVA 2DUMA 2HO4A 3PNOA 4US0R 4BVHA 4ZYZA 5J4VA 1SLYA 5DOZA 4BU1A 1ZO8A 4N03A 1RT9A 4MAAA 4DG8A 3QPBA 1Z08A 5GGYA 4OHYA 3IP7A 4TTAA 5B4VA 2VJPA 4G24A 4QUGA 4NQZA 4C0LA 1MD9A 3H9QA 1UJ5A 1YB4A 4PZYA 5KNDH 4DJEC 3WL7A 4D79A 5TLSA 3MTGA 5BR7A 2OFXA 2K4MA 5BR4A 5GV8A 3DTTA 5I7FA 4D26A 2WJ4A 3CVOA 4TXJA 2BJVA 2FMIA 4IM7A 2ZBUA 4G1BA 3L0IB 1CUWA 2QMHA 2WJAA 4TKUA 4JZKA 3L7LA 3QHQA 4B2IA 3UGQA 1SXGA 4TLAA 4IDGA 3U48A 3G9ZA 4A5SA 5EL0A 3QENA 3F9CA 2GX6A 4B79A 1PQWA 1DWQA 4GXQA 4X1YA 4MV4A 4M7OA 3IDAA 3S68A 3WE7A 5CFMA 4I1PA 4J1TC 5JXWA 1A5SB 1DELA 3ZIDA 3IMCA 5FLEX 1OIXA 2EJTA 1R0YA 1DKMA 1Y1RA 2ANBA 2OBFA 3LX8A 2EHDA 1O94A 3D8SA 1E6EA 4ITVA 3TR0A 4V1CI 4YBZA 2PX2A 2F1RA 4B3BA 1FQOA 4PANA 5TT1A 1JKJA 2I6XA 1OX6A 3E4DA 3HACA 3K73O 4MAMA 1LPNA 1DQSA 2RFLA 1JT2A 2NO7A 4G0ZA 4KO1S 5E1MA 4D9CA 3CHYA 5K09A 4RSRA 4R71A 2GN4A 1MB0A 5KNCA 2BMDA 2JHPA 1EBUA 2PZLA 2ZJ3A 2FWRA 2H65A 3SN6A 1QRRA 3QK7A 4J07A 5EP2A 2O8EB 1OILA 1CNEA 4PU0A 2PUVA 2JFHA 5B3KA 4TT3A 2J6BA 1GT6A 4QUAA 1X9GA 1HSZA 2H9YA 3ML1A 1J7KA 1JP7A 4DRXA 1DCMA 4YRSA 1PNVA 5IF3A 3FI9A 3OIUA 3GUUA 4UTNA 4KV7A 4MQEB 3AI2A 3HLKA 4R1NA 4FFPA 1OD6A 4NDNE 1N77A 1LJ8A 2DWOA 2HLNA 2HXGA 4O25A 2NUTA 1NMEA 3UAOA 1CP2A 2XQGA 2V7WA 2WDZA 5LA6F 2V55B 2H5JA 3DGEC 3BE5A 5E1OA 1AS3A 1XD8A 3FVQA 3STHA 5ITZA 4C05A 1VMAA 4IIEA 1YFLA 4URXR 1BWPA 3VNSA 1MZPA 4XB2A 4MUKA 1Q7BA 2OHVA 1JAYA 1VGVA 1VIDA 1TXGA 3PC8C 5G0SA 3C6KA 1LW7A 2J6HA 4R0VA 3KU1A 3NH9A 3O2SB 1GSIA 2W9XA 1MFPA 3FCSB 3HRIA 4HEA1 1MQ9A 3OQVA 4XIJA 2ZJ4A 4E0BA 2I3GA 4YCJA 2EJCA 3AP2A 3D8TA 1L4LA 4ZAYA 1DBRA 2NSYA 3WOHA 3RT7A 2FPPA 4J75A 5CW1A 5EFOA 1JA0A 3QKUA 3SM9A 2MSKA 4WX2B 3C24A 3ZY2A 4DCTA 5GZ3A 5ALFA 1QK5A 2OHHA 4Q4HB 1H9AA 1NATA 5EMJA 2Q3JA 3RK1A 4ESOA 2Z57A 2QMOA 2Y3IA 1L5ZA 1HLGA 1O7JA 2FDRA 4HRVA 4ERXA 1AQYA 2ZRJA 3A4MA 3I01A 1II9A 3JWIA 2GBFA 2YBDA 4HNQA 4MR8B 1KEZA 3UV3A 2PJUA 3T0GA 5EWJB 3CF6R 4L8FA 2XF8A 3VR4H 4ACAA 5J2TB 1Z7BA 2J32A 4JC0A 4CR7A 1Q6ZA 1SA0B 4EM6A 2ZI7A 3KHUA 1FX0B 1I1OA 3RARA 2CN1A 3O2QB 4JP1A 4TRMA 1ZPDA 1L1RA 4UKDA 1UBRS 3G0HA 2JIZA 5DYIA 2A4KA 3C4JA 3GPLA 4R2LA 3F6BX 1CS0A 3OEHA 2J4DA 1MR3F 4NICA 4PZZA 3HGMA 3ZZUA 3LFTA 4MRAA 1G6OA 4GNRA 3T4XA 4OHOA 3NLLA 1TEZA 5CXSA 4LGMA 5CG2A 1WXWA 4M49A 1DQYA 1YWGO 3AUJB 5GJVC 2PH7A 4EB6B 5JZOA 3ZLBA 1CV2A 1KQ3A 1OI2A 3CWZA 2I87A 1KMMA 1X74A 5BMVF 3I37X 5KSYA 3HBLA 4ZCIA 1H66A 3OTIA 1KPHA 3ZHQA 4HNGA 2VDJA 5JC8A 1WSDA 4A36A 2H63A 4GYJA 1U0EA 1H5QA 1XHLA 1P4JA 1ZH6A 2PL3A 1O58A 5DDIP 3V32A 4N76A 4EG8A 1W5BA 3FKJA 5AWFC 2IU3A 1BCSB 3GV0A 5LC1A 4FR2A 1V35A 5FBLB 3BE8A 3KKPA 4D3XA 3RYCA 4P83A 1KS9A 1V6CA 3Q8WA 3EZNA 4QUEA 1UMCA 4B8WA 3HXOA 3AI1A 1VBNA 2FSVC 2Q6VA 5C3MA 3WLLA 5K8IA 5CCDA 5E9AA 1L7RA 1J20A 3SNKA 3E4CA 1E8DA 1ZJJA 3UGKA 5TPZD 1HM5A 3R3XA 3ZHUA 2PH5A 1CVIA 3U62A 1YQQA 2EERA 3P0EA 5JE8A 4HCJA 4N9WA 3T3PB 3E3AA 1KJ9A 2VJDA 3ZI7A 3NBXX 2OV6A 4RHXA 4XSGA 5SICE 2GBLC 4C5BA 3LQ4A 4BZXA 2C7PA 4QGBA 4TN1A 1A96A 3OTWA 4QJ5A 1GGMA 3WB0A 2JAQA 2YZ2A 4KDEA 4CBVA 3WA7A 5E7IA 1GR0A 1U1IA 1YI1A 3NPAA 3CZ9A 4DZZA 2V7TA 1GZ3A 2QAJA 4ZYXA 2P5UA 2E5WA 4Q4DA 4BQRA 4E7OA 1I3KA 2GUGA 2WZDA 1T0UA 1A8HA 4LUCA 4RDIA