The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
76
|
sequence length |
211
|
structure length |
205
|
Chain Sequence |
VIDLNASAQAMSDLDEGAINEVVDKVMAKADADAAQELIKAFQQGMTKVGERFDSGEYFIGDLIFAGEILQAAMDKLKPALKRAKIVLATVEGDLHDIGKNIFRTMAEASGFEVFDLGIDVPVKIIVDKVKEVNPEIVGLSGVLTLALDSMRETVDALKAEGLRNDLKVIIGGVPVNENVCQRVGADDFSTNAADGVKICQRWVG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule keywords |
Putative uncharacterized protein
|
| publication title |
Structure of the cobalamin-binding protein of a putative O-demethylase from Desulfitobacterium hafniense DCB-2.
pubmed doi rcsb |
| source organism |
Desulfitobacterium hafniense
|
| molecule tags |
Protein binding
|
| total genus |
76
|
| structure length |
205
|
| sequence length |
211
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2013-03-01 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02310 | B12-binding | B12 binding domain |
| A | PF02607 | B12-binding_2 | B12 binding domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1 | Methionine synthase domain | ||
| Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Cobalamin-binding domain |
