4JGNA

Crystal structure of rna silencing suppressor p19 with 1nt-5'-overhanging double-helical rna 20mer puug(cug)5cu
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
125
structure length
125
Chain Sequence
b'HMTSPFKLPDESPSWTEWRLHNDETNSNQDNPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFFGFDQIGCTYSIRFRGVSITVSGGSRTLQHLCEMAIRSKQELLQLAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA silencing suppressor p19
publication title Procrustean bed of RNA silencing suppression
rcsb
source organism Tomato bushy stunt virus
molecule tags Rna binding protein/rna
total genus 39
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2013-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1810 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4jgnA01
4KTGA 1RPUA 4J5VA 4JK0D 4JNXA 4KQ0A 4JGNA 4KNQA 4J39A 1R9FA
chains in the Genus database with same CATH superfamily
1C16B 3D2UB 4ANVA 1SJEB 4JPKL 3AMLA 4PP2A 2HYMA 4LU5L 1A1OA 2ZUTA 3MRIB 4XC1H 5EUOB 4GMSH 2P1YA 2MQ0A 5DK2B 3GKWL 5JR1L 1ZHBA 3VGBA 4BZ2H 2OULB 5B8CA 3CBJB 1KB3A 4Y5VA 2OMVB 4DTGL 4PW4A 3TT3L 1RURH 2HRGA 1NJ9B 1JPST 1KTLB 2WSDA 3JWDC 4YHZH 3ISYA 3S98A 2R59A 1X7TA 1FN4A 2C9SA 3VD9A 4FQHA 2W38A 5FGBA 2H8PB 2Y7LA 1KEGH 4JO3L 3UXFA 5EO0A 5ID1A 1YNTF 3E3QC 2WQ8A 5DVMA 3MRDB 2P8MA 4F2MB 4EBQH 3C60C 3T4YA 3UYOD 3I6GB 3DTDA 3WN6A 1HINL 1YLBB 2FL5A 4ANKA 3C08L 1OWRM 1NOAA 3N43F 4IKLA 2F54A 2XY1A 1QATA 3QORC 2DH3A 5BO1H 1Q9WA 2XV0A 4XN5A 2B4CC 5EEUA 3O9WA 1BZOA 5DLML 5D71H 4AT6A 5ALBL 1DQML 1E9OA 1KGJA 2IG2H 2VMDA 1HL9A 3IJYB 5F0MB 3RA7L 4MFHA 2NY4B 3DIFA 4DP7X 5IB2B 1Z32X 2A6KA 1WZAA 1UB5B 3UIYA 3WUWB 2VXVH 3QWOA 4M1CD 2NY6C 2RQ8A 4X5XB 1GGUA 3L1FA 2OXHB 4HC1H 5T1LB 3INUH 1O7SA 4ENEC 3HTLX 4UYPA 1G87A 2XIBA 4NO5A 2XC8A 3VFNA 1DVUA 1Q38A 2DTML 5I0ZA 3TA3D 4H25B 3LHPL 1P84K 5GSVB 4HPHA 1YSOA 4YHPB 2VE6A 1QFWI 1F4YL 2QSCL 3AXLB 4QXWA 4Y4FA 1H3PH 2DLIA 1OTSC 1PKQA 5IVZA 3V0AC 3VFTB 4YGVB 4YDKL 5TE6H 2WQVA 1AZUA 3TO2A 4AH2A 3QDMD 3FB6B 1I3UA 1AGFA 4N8VG 1ZXKA 1QLRB 5F7UA 1MWAL 3C09B 3GB7B 3I9GL 4U0QB 2WVVB 2EDBA 3IAGC 3V8CA 4QHUA 3H7LA 3Q1EA 1G7HA 3MFFA 2L7QA 1ZA6B 2F7RA 1O7DC 3OMIB 1FORH 1CD8A 1PG7H 3O11A 3BHBB 4ZMLA 4JKPH 4KKLD 1HOCB 3OSKA 4G9FE 2A1WL 1HQRA 1HXMB 1RZKH 3F83A 5FA4B 1F6LL 4NB7A 5J57B 1V3LA 5KVDH 2MH4A 4L3AA 4GG6E 5E6UB 5GIRB 2GUYA 4IM8A 3N1GC 2WSPA 5DD6A 3U2SB 3AG4B 3RX9A 1CICD 2KH2B 1I1AB 1PTZA 4HJEA 1C5CH 3QB7C 1HHGA 1NUNB 1TO5A 3I75A 2LLLA 3T08A 5M7QA 1OOAA 1UKTA 1S7TB 3L3GA 1KZQA 2ATPA 4WO0A 3MGOB 3RU8H 4DVRH 1X7QB 4NQTA 4F7PA 4TQ8A 5GXBB 4NAJA 4I1NB 3GM0A 4JKKA 2HH0L 4HSQA 2WXMA 5KAQF 2E8YA 4UBDC 5IVXA 4HEPG 4NUMA 2NDFA 1BX2B 1G7LB 4D9QD 3QAQA 3K3QA 1RZ8A 4HJ1A 5C0CE 2BSRA 4OF0A 3VTMA 4N2MA 1CR9L 2X2UA 4JVPA 4K9EL 1LGVA 4AJVA 3B83A 3IDYB 4ES8A 3QH3B 1FIGL 3K5SA 1ASQA 1I53A 5L7XL 3OLEA 1Q9KA 4OD3L 3UGUA 5IBUG 1IBGH 5GS3A 1IM3D 3VRLE 5AUMB 4L3EA 1K6QH 2ILLA 3MV7E 1GYCA 1WEJH 3FB8A 5A2AA 3B8SA 1A02N 1A7QL 5AOJA 5C1MB 1HIMH 3CHRA 3A4AA 3CHXA 2EKJA 4O4YH 5DMGC 5E56A 1QX1A 1KEMH 3CPLB 1BGXL 1I7UB 3JVFC 3TWCL 4CMHB 4JRYE 3G04B 1AD9A 1MFNA 2QHRL 3R1GH 4DQOL 2HMIC 3EYQC 3ZZLA 3UP1A 1PD0A 1KG0A 4OF8A 1A4JB 5ESQA 4JFEE 1S7RB 4GW5B 2P52A 4PUBH 5K9KB 4HV8A 2GT9A 4QUOA 1NMAL 1AGEB 4KJYB 3VXQA 1ECYA 4Z0XA 4QOKE 4BGLA 3CN3A 5AOKA 3IYLW 3O0RL 2A9MH 5EOCJ 3S2CA 1JZ6A 1I7ZB 4ZDHA 5HBBA 5KYYB 1MJ8L 3OL2A 2CJSA 1G5GA 4LNRB 2NYYC 1XGPB 1DJZA 2J7LA 5D8JH 1PAZA 4FP8L 3WBDA 1LE5A 4L0PB 3K1DA 4L8SA 1IMHC 3CHOA 3WL9A 1SOQA 2B8OT 1ACYL 2RCSH 2VABA 4RLDA 3KM1A 3CWGA 5FECB 2Y9RT 4WTWA 4E9LA 3O3BB 3LNDA 1HZHH 3D0VB 4POZC 5I1IL 4JFPA 2O93L 3U9WA 4N68A 2ALWA 5E9NA 2OTPA 2GBVA 2BPBA 4QRPA 2BX5A 3HN8A 4XMUA 3HE7D 3L3OB 3GMLB 3G08A 2H6UA 5E1AB 3OC5A 4OQTA 4M4RB 3AS1A 3L5JA 4JFHE 4YJZL 4FLOA 2CHDA 4NSKB 1YPZE 3ZTJH 5IF0A 3U4EA 3X3FL 4AW7A 1ORSA 2JJTA 1P5VA 3L3IA 4R3SA 1RUMH 3AWEA 5I6PA 4Z7WB 1PIFA 1QR1B 3O4LD 2X4SA 3FU3A 3WJMB 3JWDH 4KROB 2IF7A 4RFNB 5HHVL 2YSSB 3HZYA 4YDNA 1QZ1A 3LD8B 5MEQA 1JD7A 2FECL 2J44A 4RWYL 4WHTB 2M8XA 4YC2B 1FYTE 1M7XA 2EEBA 4G6ML 1DVZA 4PJEB 1QFWM 4LSSL 4XWGH 2UZIL 3ZT5A 2NR6A 1IGIH 3SDCA 1NCBH 3DMMD 4IBZA 4WGVB 5DHYA 6PAZA 1HSAB 4NI3A 1U8CB 4K3JH 4XCEA 2GJ6A 3H3PL 3TCXA 4F15C 3VX0A 3NSDA 3CZNA 2OMUA 5DRNB 3UROR 1JYWA 5E4EB 3OJVC 5HHOA 4P2QB 2B4CH 4FG6D 1P2CB 1E67A 3S3DB 1JFQL 3OWEA 4LSTL 3DHPA 3MTXA 1P7BA 5DFVC 5FM5O 3SB3A 4XE0A 3EDFA 4KQ4H 2HUHA 2AXGB 3LXAA 4HWBH 3UO8B 4NUJA 4Z7NF 1O5PA 5ADOH 2VLJB 3GXFA 2IQ9L 3RIAF 5I82A 5FYLE 2PCXA 3HNVL 2HWZL 2BP0B 1E9PA 3MJ9H 3IE4A 4RZCB 4ELME 2I85A 1Q9LA 1F4WH 4DHLA 2R69L 1U33A 4MCYA 4O51A 3MV9A 1D5ZA 4M5YL 5DJYA 2YK1L 2BOBA 4W4OC 3T3PF 4LCVA 3AS0A 1OCWL 3UBFA 1NDGA 1J1OH 3HI1A 3E0GA 4NHCL 4ZFZA 2FEJA 3QUZD 2VC2L 3OPZH 3TIEB 1F45A 3VRJA 3WAJA 2AK1L 3QCUL 5CEZE 1OGSA 4FGMA 4V1DE 4WEUD 4FNTA 2MHAB 4WWNA 1ZLUH 5ACZA 2OXGA 4W9CC 1MCOL 5H37H 3PL6D 2ALAA 3VU1A 2NY1D 4ADGA 1KV3A 4PV8B 4OU3A 1JF5A 3EKCA 5AAWA 5DD1L 4Q6YA 4I18A 1OCCB 2NUPB 4U6HA 5D6CA 4BGDA 2TAAA 4OKVA 4KRPD 4G43B 4CW1B 1FCGA 3MCLH 3B9VA 2B16A 3Q44A 2JV6A 1WPCA 4PTUA 3NQIA 5DHDA 3FCSA 2Y3AA 1EXHA 2PMZA 4HOMA 5D7HA 5BO0D 5J6GA 2GHWB 4ADIA 2X4UB 4F80A 4S0TD 2UY7A 4JBSA 4FXKC 2X9XA 3ROOA 2IDUA 4HXAL 2JI2A 2PYEA 1ZLSH 3KR3H 2UVEA 3PQYE 5C0DA 2UZYA 3VFVA 5B38G 3MRHB 3MRKB 4BFJA 3J8F7 1IAIH 2X1QA 5DZAA 1PYWB 4NLHA 2FQEA 4UQDA 4B7LA 5HVHB 1MFBL 3UEZA 2BW4A 3K81A 4M7KL 1DDHA 5DU7A 3FPYA 3IJ8A 5T1MA 2WOYA 4JY4B 2XBDA 5C6PB 5JZ7C 3N85L 3ZDXF 3RAJH 1LO4H 2P8LA 5E00A 3JV0A 3LMJH 1CE1H 5EO9A 1DSYA 2IEPA 4NZDA 1I1CA 1UOVA 4P46B 4TUOB 3MRQB 3RILA 1RY7B 3VYOA 4F3FA 1JGDB 4JFDD 4EXPX 4XBEH 3IPBA 4PJ5B 1R5VB 3WTXA 2H0FA 3C60D 3FCUB 4Z3TA 1RJCA 3BMVA 2MFNA 3B56A 1DE4B 1NEZA 1EO8H 3JTBA 3TIDB 1P4IH 5B7FA 1BOGA 3IJ7A 1XIWA 5JPNA 3G5VB 3FOMB 3QORD 1ZGLM 1X44A 5D7JB 2R2CA 5IBTH 4RNRB 4W70A 3ZLQC 1DJXA 4O5LH 3POHA 3FQ1A 3WENA 5HI5C 3LN5B 5DEGB 4XCFL 3L8QA 1VENA 2FB4L 4A63A 2OTUB 5F7BA 1F1GA 4PG9B 1GS7A 4UTBA 1W0VA 5JQIB 1DO5A 2OCJA 2VN5A 4PJXA 2X4OA 1UA7A 2FD6H 3T0EA 2GTZA 5SWZB 2FK9A 1RUKL 3F6JA 2LHAA 3EDKA 4V2CB 2AV7B 2GBTA 2EP6A 3QFJA 4ENED 4PLNC 1FGNH 3SE4A 4XVSL 4S11A 4FNSA 4FTVE 1UWEL 3CVHB 1QTYT 3DDGA 5EDXA 3CVHL 1YY8A 1JYXA 1IIIA 1NAKL 4N0UE 5CZVL 1N7ML 1PNCA 1UTDA 2VW6A 1TTFA 5GRZA 2VM9A 2ZUSA 5DVLA 5FO8A 3OAYH 1EZLA 4PTTA 2Y1YA 5H2BA 5TE4L 1OAUH 2O5NA 4DERA 1OTSD 3P77A 4LFHD 1F3JA 1F86A 3VYPA 3T1WA 3AQXA 4TOYH 5J1AA 1FL3B 3QIWD 1T7YA 3FS9A 3VG9B 4MVBC 5HGBB 3WD5L 1NMBL 3AWFA 2DDQH 4X80L 1A9VA 1TYEB 4KDTA 2A83B 3CFNA 3UG5A 1NIAA 4OCYL 3SYCA 5JUEL 3WIHL 3MJ7B 1UKSA 3U0PA 1QA9A 3MRGA 3EXJA 2X10A 2J8OA 3V6ZB 1WFTA 1MIEL 2HLFC 1HCZA 4KTDH 1DQQB 1R3LA 3C09C 4NRXB 4F33B 4QGTA 3ZTNL 3VFUA 5JQ6L 4HIHA 2DS4A 1GW0A 2A9NL 3REVB 4D9LH 1RP8A 4X4XB 1C12A 1NIBA 1MCPH 3UTSA 2HG5A 1MJUH 1T1YB 2E76C 2JB6B 4FJZA 3S5LA 2C1PB 5L88H 4I85A 1R3IL 4B60A 1U95A 4R9HA 4LEXH 5CSZA 1XHHA 4B9JA 5CD3B 3PDOA 5DHVA 2WSKA 3CFEA 4KK6C 4NKMB 5AW8B 5DTFB 3UC2A 5FLVA 1AY1L 4RAUB 3N9GH 1SOSA 1ES0A 2JKJA 3TT1L 3ZE0B 5C0NC 4NZTL 1UWXH 1WZ1H 2FH6A 2F53A 4NQEE 4A6YA 2OQJB 3C5SB 1RKRA 2X4RB 1I1AC 4UBDD 4N85A 2R2EB 4M8QA 1XEUA 3BW9A 2CO6B 1IGTA 4JN2B 3PWLB 3FZUD 1S9WB 2XTJD 5DJDA 5FGRA 2I32A 3GBML 5DURD 4KWUA 1GAFH 3DHUA 5AEAA 1EDHA 4L5FE 5F3FA 1PL3A 3UGXA 4G8EB 2HFFA 2EDXA 3DA0A 4Y2LA 4GFXA 4OKDA 4DO6A 1A6TB 2PPCA 3CC1A 4RRPA 5E99H 5EBLB 2CDGA 3CSBA 3E8UL 3FBKA 2JIXA 1A6VL 3IDYC 2L3BA 1WIUA 3H85A 4G8GE 4HIXH 4CU6A 4KVCH 2EH8L 2JJVA 5INCA 1U8MA 3DBSA 3SYAA 3V0WL 5I1GL 1GZPA 4OJFH 2VKWA 4QRBA 3EYQD 4YK4B 2HMID 3SN6N 4Z7NE 4X98B 1I3GL 1FQ9C 3W38A 3BOVA 5F7LB 1LEGA 1KTBA 4HKXB 3UTTB 1ZAGA 2BVTA 1HHIB 4L8DB 3GXMA 4DP9X 3TF4A 2HT2C 4LIQH 4CMHC 1J5IA 1ROCA 2YEZA 2JXMA 3GEFA 3ZK0A 2NLJA 3T3PE 1F02I 1N18A 1XGQB 3GSWB 3H54A 1MJ7L 3L6FA 2NY3B 5E8PA 4UV4H 5LAXA 3FSZA 3AGVA 3SYOA 3OXRA 5FKAB 4POZD 4K2UH 1AC0A 4OR1A 5H35B 3SY0B 3UERA 4B6ZA 4LSDA 1WH0A 3KYNA 2IOIA 2P5EA 1MCFA 5LWYH 4QO1B 1Q1JH 3UBHA 1U2CA 3N1FC 1YEJL 3P40A 4IRJA 1URLA 4KVNH 4OCXL 1I8IB 4YDVB 2BIPA 1FH5L 3BEVA 1WWBX 2MRYA 5IVXF 1IT9H 1TVBB 3L3OC 2D9QB 4P5SA 1A1MA 4Y19E 5BZWA 4B0MM 1NCAL 3N40F 2B20A 4I0PA 3NJGA 3MLRH 4Q74A 4NKIH 4D0DB 3BH4A 4KRMB 4NLAA 4GKNB 3O3DA 3LV3A 2DEYX 5EOTA 5EC1A 3DRQA 2ZSVB 1TETH 4HHWA 2JSFA 4LP5A 3AY4A 2QDWA 5SWSD 3A6CL 3OHXB 1KIQB 1NDMA 5B3SB 3W0WE 4NBYB 4G5AA 4JZJB 3LD8C 1QBBA 3X3GL 4P59H 3ESVF 1QEWA 4AW4A 3ZPDA 4YC2C 4XODA 5IFHH 2Z31A 2E4TA 2AGJL 2DMBA 3ZDXE 3MV11 1N70A 2GY5A 2YR3A 2YIHA 4WCYH 2DQTH 5EZJB 4JLRA 4AJYV 1VFBA 2BINA 3K5RA 2OP4L 4JN1L 4OJDH 3BH9A 3ETBJ 1UD4A 1NM4A 5CF3A 3PP4H 4L1TA 4G6JH 1O9VA 3L3HA 4HS6B 2NX5D 2YPVA 5ALBH 3FK3A 3LZOA 2A9BA 1BD2B 2W88A 3OZ9L 4KAQL 5D96C 4ZAKA 1TCRB 2PYFB 2WXIA 1S5HA 1L0QA 3HC4L 5BRZA 5DJ6B 3LAFA 5JOFA 4O58L 2YFNA 1YY9C 3JWNC 3CFCL 2CLZB 3QCVH 4FOMA 3PWJA 2EDOA 3NACL 4CADB 4M7JL 3T2LA 1OP3K 2OJ1A 5DD3L 4ODSH 1IEAA 2R4SL 3IGUA 1QVOB 3VFGH 2KHAA 5GS1A 1AS7A 1SHMA 4JZOB 1NFDB 1WDAA 3C6LA 1XH1A 3WKNA 1WBXB 4MBRA 4PJ9A 2A74B 4R97C 5DF0A 1FUNA 3CE1A 1G7JB 4JQVC 5C0FA 3L1EA 1FFPB 4BSVA 3EFFB 3V4UL 1K4CB 3A5VA 1ZV9A 3OKNA 4KMQA 4OFVA 3OAUL 2WIIB 3HIZA 5HYSA 1EFXB 1IFHL 1M2VA 1KBKA 3IFOA 1V8HA 2WBJA 3EYSL 1CLVA 1XWVA 4UZSA 3OKDA 3KEHA 1K2DA 3BZ4B 4JE4B 3FQWA 4FFWC 4MXWH 1CL7I 3B5TA 5DO2C 3COOA 3LQAH 4DNLA 1HC1A 4KV5E 5LGHH 1JRHL 1TEYA 4QRQA 4YIQA 5GGSY 2VDQL 4IJ3B 1EEUA 4CVZA 4GBXC 5EEYA 2ISDA 2VLME 5EIVA 1M6OA 1VLXA 2R8SH 4LSUH 1G9EA 1ZHLA 1TQBB 1A9EB 3WUZA 2EDEA 3X1GA 3ZHFA 2FATL 1NCDH 2A5UA 2J55A 3VQ1C 3NCJH 1DN0B 4UT9H 5L8KB 3GSVB 3MR9A 5JOPD 5GGVY 2DI8A 1UVQA 3MNZB 1WFJA 3WS3A 2N4IA 4HCIA 4DN3H 4AZUA 5I9QC 4YXKH 3TBBA 4H8HA 4HLZG 3VD4A 4DW2L 3IDMA 3D2UD 3FQRB 3QXVA 4NUGH 1UWGL 2FJHA 3C75A 4KKBC 3EOBA 5IROA 4KHTL 4HULB 5I6KA 4PRPA 7PAZA 5JZ7D 3MBXH 2O4EA 5DUPL 5FYJH 5DJAA 3T2QA 4XVJL 5IJVA 1G1CA 2HH0H 2FX9L 5DHEA 4DKDC 5LXGL 5E8NB 3CBKB 2PPEA 5EF2A 1FIEA 1Z3GH 3DK2A 3INOA 1LTXA 1HDMA 5CWSB 2QVMA 3FN3A 4FNLL 4ZFOA 3MUGA 2ITCA 4QYOA 3B3IA 3EJRA 3L1OL 5CGMA 3EFOB 1KELL 4LKXB 5FM5M 2A9DA 4N22A 5BUAA 4AZ8B 5BMFH 1J1XL 4YSRA 4P46C 4GFTB 4LFHG 1AR1B 1ULVA 3LB6D 5EU3A 3WIIH 4E42A 2ZCLH 3WJLC 3TCLB 2GFBA 1F5WA 4ENZA 4P04A 5HI5D 2E8ZA 3PYCA 5GZNC 4AIZB 4KY1H 5I17A 3VO0A 1AAJA 4WVRA 1CBVL 2F8XC 2GK0B 5BW7A 2VZTA 2EIZB 2O1AA 3BUYA 3MJ8B 3T2PA 3GEWB 5I15H 1AQHA 1U92B 5FCSH 4JCLA 3ZRSA 5IEHA 3V79C 5T5FH 3Q2VA 1BQKA 1MRFH 2VLKE 4DKFL 1S7UB 3DJSA 4QRUA 3CMOH 4RGNE 4XE5B 5EU5B 2BFVH 3MRRA 1BF5A 5IUSA 3W2DH 1D5BB 4G8FA 4NYLB 1ZGLB 4HGMA 2JFCA 1PKQE 3B7SA 1E0OB 3FAXA 5T1LD 3D87B 1NFAA 2ZCHH 3WYRA 3L13A 1OTTD 4UDUA 2AP2A 3F7YA 3LRSB 1VGKA 3P3SA 2B08A 3EGDB 2EH7L 3N44B 4CSZA 1XCWA 4MVBD 1WUZA 2J4WH 2ZJSH 3ES6A 4JK0D 2XWCA 3KPSE 1EDYA 1OKEA 2P5WA 1MIML 2O5ZH 2GSIA 1OAKL 4U3XA 5CN2A 3WIFA 2I7SA 4MB4A 3JV4B 4WU7A 4IU3A 3TYFA 3VG9C 2WLYA 1L9MA 3BP6B 1Q94B 4GXUN 2WLJA 1MVUB 2XZQH 4W6XB 4U05A 5D5MB 3MBEB 3WG7B 2XA8H 5AW2B 3SKOB 5T3XL 2EUXA 1Q0EA 1WP6A 1Y6KR 5HGDB 5AB2A 4DAGL 1OGAB 4JAMB 1UZGA 2B9BA 4X9BA 5KVGE 5GJTH 1BYOA 1EH9A 3ZGHA 4HA1A 4KK6D 2O5YH 2BNRB 1PY0A 1BZQK 1KCUL 2VXQA 2Y5QA 3NEEA 2CO4A 4O02A 4P99A 4RWYH 4Y9GA 5DC9B 2AC0A 3OKEB 4GAAA 5IVXE 1CCZA 3TEUA 2MKLC 1HFUA 1CDHA 1PG7X 1CDUA 2NNFA 2AABH 3WTTA 1NGPL 2YUWA 3P0YL 4HHAB 3MROB 1I1AD 3DX7B 2DQMA 4UANA 3SBRA 3WLWC 5KSAA 4NWTH 1M2OA 3KVPA 1NBZA 1BAFL 3VXSA 1AHWB 5FYJD 3LKSB 4Z7QE 2DJSA 1UGKA 3QHFL 4NDMA 1RJLA 4PJXF 5FW7A 3V7AG 3WHXB 3ZX1A 4YS4A 3GYRA 3GWJA 3KPTA 4R2GC 4YDJA 1DFBL 4AK1A 5ESVA 3DUSB 3SGJA 3SGEI 4LCWB 4X8XA 4NZUL 2BC4A 2PCYA 4KGJA 4OT1H 4QRRE 1MCKA 3JWNH 4KNSA 4EO5A 2Y1ZA 5IHLB 4KY2A 1P7QA 3HC2A 1I7TB 2FRGP 1CTMA 3DBXA 1F4AA 1CC3A 4Q56A 5IQ9A 5E8OB 5BZXA 4NQDA 3RWEA 5JOEA 1UUNA 4FA7B 4IHOB 4W9JC 4ZQKA 3U6RA 3D5OF 2J8HA 5C6WH 5FWQA 1NDTA 1E6JH 4ECNA 1DCEA 1DBAH 2ITEA 4BDVB 5IB3A 4YDMA 1MCLA 2MTAA 2N56A 3VXRA 5AKTA 5DUML 2WUBL 4JFQA 3BISA 2AVFA 5AL0A 1ACZA 4L48A 4DGIH 5E95B 1BLNA 3BVNA 2J1KA 2HT2D 3GFUA 4L2LA 4JDVA 4WW1A 2ZSWA 4GKSA 4AGLA 1JZ5A 1XQ4A 1ZOXA 1Y7VA 4YK4C 3CU7A 3DGDA 2YUZA 4Y7OC 3U1QA 4B95C 4JFTA 8FABA 12E8H 4MQ7B 4G7YH 3O6KL 4Z8FL 4ZQTA 3U9UA 4JL2A 5KVEL 3NQKA 5J4MA 5TDPB 3FDWA 4P5KB 2N1KA 1XMEB 4MA8H 2XV6B 1MHHB 1EJOL 2ESVA 4L8CB 1PJWA 1KSRA 4LCYB 3VXTA 4KKPA 5C0EA 5IJKA 2AXHA 4RAVB 3ELAT 1JV2A 2VDOL 2NY3C 1ZVSA 2H0JA 2X0UA 1NGXA 3ZHNA 2HXAA 2FT7A 2GBUA 5E5MA 3SPVA 4GQPH 1BV8A 1KJMA 5F1IA 1DDTA 5F6HI 4A2HA 4HX1B 2DM7A 5J56B 2IH3B 1I9JH 1BG9A 4JQXC 2F7OA 1D5MA 2J6EA 2LT9A 4WI9A 2BVYA 3T0AA 3QEQB 1ZJAA 1D7FA 3PWNA 4XCYB 4JUSA 3LKQB 4RFEA 4KK5C 3F04A 3SE6A 3IKKA 4FX5A 1LDSA 3DV6B 5I6MA 4URTB 3O2DL 3VRIB 2GJ6E 1EZVY 2V5RA 1K5NB 5GISL 3VH8A 4X6EB 1T83A 2LE9A 4M1DH 2D0HA 4PV9B 4WF7A 4M00A 2V8MA 3VFSB 5BPPA 2J21A 1LQSR 4K4KA 1HKLL 4QHLA 4GUPA 4E36A 1HEZA 4P57B 1K4DB 2HLAB 2BVUA 2NW2A 2KC0A 4XOEA 4XVOA 3TVMC 3PHQB 4B0MB 5I1EH 3EO0B 4JZJC 4IMLA 5HDWA 1L4IA 4HMEA 4N25A 1QSFE 3JV6A 4NCC1 5I75B 2HVKB 4IBVA 1NBYB 3US1A 1VGEL 1XF5B 2R1WA 5IB5B 3MV9E 4PJ6A 5DMYA 4JREB 2QLVB 1PZ3A 1QFOA 4LGRB 1T03H 5KEZA 2B39A 3OR6B 5HJDA 1QO3A 4MJJA 1LM8V 3K6OA 1E4XL 4IYKA 2FCBA 3FCTB 4IBQA 3WGVB 3HMWL 4HJJH 1INQB 3NESA 5F7EL 1YY9D 2VLJD 4F7MB 5HPOA 4J3BA 3GMRA 1WAAA 3JQOB 4ZZKA 3GMNB 5JXEA 5JQHC 2CCLA 4WUUB 1J48A 1A9BB 5EEXA 4ZO7A 2EC9T 4GG8A 4JO5A 4YSDA 2J88H 2X44D 1GXEA 3GIVA 3ZW3A 2CH8A 5HYFA 3EFDL 5EBGA 3AADB 1TYJA 4I48A 1NIFA 3NJLA 4G82A 3DSNA 1NPNA 1KXQA 4YLQT 3TO4A 4IKJA 4QYAA 4O00A 1DYZA 1UOWA 4HU8A 3GRWA 1KXVA 3NCEB 1KENL 4KJQD 5JHLL 2UXTA 5HYQA 2A74C 3GSQA 1MHCA 3GLZA 2ZP8A 4L2YA 2GQHA 5F9JA 5DO2D 4LKCB 2VSKB 2AEPH 4GEJA 5CMAB 4AYMC 3QDGB 3BZEB 4LEOB 2A9AA 3I2CL 3LPGA 4GBXD 3T8MA 4AL8L 1N64L 2R0KL 4TYUA 5I16B 1RAMA 15C8H 3CU1A 4NC1C 4HJGB 1ETZA 5AKSA 2AEOA 1ZT4A 5DZVA 1U41A 3ZTNH 3EH5B 4KRNA 3OF6D 1IBDA 3DK0A 5C0JB 5DT1H 5LGJA 2FHBA 3GGWA 2ENQA 2XNAB 4KKBD 4UQ2B 2DTSA 4PI2A 4YZFF 2O5XL 4YLCA 5ENWB 4UT6L 4YFLF 5AB1A 2BP8A 4J27A 1R3JB 4N4YB 1I8LA 1FO0A 4L18A 1WCBA 1XF4B 4XPAL 1J5DA 3QZWG 4PGJA 1P6AB 4KFMA 2NY2C 3DLQR 4ONGL 2XKSA 5KSVB 4OI9A 3MDJA 3WY4A 1U9KA 3EIFA 5I30H 2A6JB 1KCKA 2D31A 2Y1AA 3GUTA 3V4VB 5E1IA 3UTQB 1U8HA 2K70A 4LVNB 2JKNA 3BAWA 4YVUA 4KU1A 1S8DA 3L54A 3LS5L 1FG9C 2Q2EB 4P46D 3P4OA 4HDIA 5AAMC 4TQPA 4RGMB 3QP3A 4U6VH 3RWDA 2BS9A 4U1IA 1XBDA 4PJ5D 5MEOB 1OE3A 5CUSH 4YBLB 5DQ9B 3N5AA 3HMXL 1SYVA 4FABL 2RJMA 3GSUA 2YA0A 1WAEA 4QMEA 4PJXE 5ERWB 2EYSB 3OVUB 3CBRA 4K7PH 5IHZB 2P7TB 1L7TH 4MJID 1Y6NR 1TJGH 1QSZA 5D7JD 2R0WH 1AO7A 2ATKA 2ZTBA 4V33A 3UYRH 1HHKA 2ZX7A 5IMKA 2W9DH 2PN5A 1UACH 1ET5A 4MD4B 1VFAB 4DKEH 1ZLVK 1NFIB 4E9SA 3ME0B 4QHNB 2VIRB 1MCNA 4D9RD 1UB6B 4JQIL 2HJLA 2H1PH 1OXYA 2Y7SA 4IOIB 4Q2ZA 3S8WA 3BD3A 5A3IC 2ZWSA 4TN9A 1KPUA 1TQTA 4AQAA 1ZVNA 2ZUXA 1VB9A 3WFHA 1PG7W 1MCSA 2H9GA 4B9CA 4JDTL 1LMIA 3OKOB 3QUKB 2AQNA 3MLTA 3DVNB 2GITB 1N6QL 1SDYA 3DTUB 4A7QA 2R51A 2Q8BL 2CO7A 2PTVA 3S35X 4ZXBA 4HP5A 1ICTA 3C2SA 2ZNWA 5I19L 5D1QB 2CJTA 2TRHA 3IETB 2VUKA 4JO8A 1EHLL 4NO3B 1ZK9A 3LN4B 1AHMA 5CN1A 3VTAA 3IAPA 3IMRA 1SEQL 4TVPE 5D9SB 2OMZB 4ZUWA 1KGYE 1RZPA 1EPFA 2DBLH 3K6DA 3IKCB 5C0GA 3SJVA 4A55A 2ORBH 2RHEA 5GS0L 3MXVH 3PCYA 2VN3A 3QQDA 3UTSE 1O75A 3VWJA 4MQTB 4QTHA 4YPJA 3RPIB 4XHJC 3T8VA 3FRUB 3FBQA 3Q5OA 2GG1A 4M62L 4KZEH 1JZDC 5HHMD 3KBHE 1KPRB 4ZS7H 2VM4A 4QCIA 1T22A 3L3DB 1OM3L 4LEBA 4Q9QH 4KTGA 4FFYL 1T1ZB 3KBFA 3MBEC 3NIGF 4PVLA 5HI4C 4WJ5A 3U4AA 4ZFGL 2Z64C 4ZMXA 3RKPA 2JTYA 1QSEE 5AZ2H 3RJOA 3RNQB 3KJ6H 4KK9C 4F9PA 2Y5TB 1A7PL 3WLWD 5JA8B 2WZPD 1RZ7H 5HDLA 3N1MC 2DQIL 4FQPA 5H94B 1F2QA 4MS8D 3ZE2B 1Y18B 4JO2H 3P4MB 5LQBL 4MSWA 2K9FB 4KMTH 3GMQA 3W9EB 4HSAC 4R2GD 5DZPA 2B0SH 2B3IA 4EIBA 4KUCD 3QZPA 1QEXA 4GKLA 4X99B 2OCFD 2VR8A 5JIQA 2APVA 1GIGL 1AHWC 4AEFA 4Z7UA 2NY0B 2AHIA 4E0RA 3A6OA 2OMXA 5DUJA 1OPGH 4HKJA 4YE4H 1RJYB 4QDGA 1CZ8H 3LXBA 2X09A 5E08L 2QELA 3MXWL 5CS7A 5MI0C 3F65A 5F8QC 1PLGL 4X6DB 1UH4A 5GRWA 1D6EB 2Y0SA 5C0AB 4ZMZA 4F9LA 1N6UA 4WHDA 4X7FC 1R0AL 5B1JA 2XQYG 1XSKA 2VZ3A 3VUAA 2ZPKL 3BPOB 3ULUC 3RFRA 2G4GA 3IMWA 3MHZA 2ADFL 1TG8A 1KCVH 4Y9CA 4YFLI 3KPRB 3ZTEA 5E23A 4PRID 2IGTA 1ZSDA 1DEEA 1FLRL 1FNHA 1NM9A 3UTTD 3FNKA 3SBQA 3ZYZA 4Y16B 4WAFA 3HI6L 2L7JA 1IFRA 1CGSL 1T04A 4L9DA 3A6BH 4LOVA 3H56A 5FO9A 1F11A 1FYHB 2YAQA 1CE6B 1B9ZA 2ZX5A 4H1LB 4LQFL 2ERJC 3Q8AA 3GS7A 4KTEL 3S97C 2NUTB 5FCUH 5AVWB 4Z7IA 1KN4L 5D70H 5D2NA 3VE0B 2Y25A 1JGVL 3LKOB 1EFQA 2NY3D 5ACLA 1RUAL 3H2PA 3RZWA 2WO4A 4RCAA 4XXDA 4ZS6C 2H5UA 3BLKA 3RKDC 2CD0A 3TA3A 5F7KC 4ZW5A 1XCTA 4PIRF 1V7NL 1BEXA 1IQWL 3AG1B 5D6DC 1OT4A 2ZXBA 1P1VA 2HVJB 3FHAA 3MKGA 2JI3A 5LGYA 3V0JA 1P5UA 3KZ8A 2VDKL 3MLSL 2J1XA 1IILE 4KK5D 4LLYB 2OSLA 1ED3A 5ICYA 2QR0B 4QXGL 4AM0A 5L2JB 5BVPL 4HCRH 1YUHA 1WD8A 4HT1L 1WWAX 2I27N 4FFZL 5DSCA 4JVUA 1MCEA 4NM4H 4RRPM 4PW9A 5HHNB 4AQ1B 2WXFA 3DXAA 4RETB 2ZYSA 3B5GA 4TPRL 3KGRA 1RMFL 1SUJA 4R5XA 1UCBH 1T20B 3K2IA 3FT4A 1V05A 2F74B 4P3WA 3ZUNC 2WW8A 3IDJB 5HDRA 2VERN 3MNDA 3EAKA 3ZKQD 3MTRA 4NNYB 2WC7A 4AK2A 4YZFE 4XNMB 5HHPA 1XEDA 5IQMA 1JWUB 5KJRL 1QRNA 4KKAC 1CFBA 4KZDL 3TVMD 4N86A 4HLJA 3OXSB 1BQHB 1D2OA 1XXFC 4TRPL 1CICA 4XAWH 2BZDA 2C5DC 4PVMA 1DP0A 3APFA 3OMAB 4X6CF 2NSXA 2MMXA 3GI8H 4CAGA 3ZMRA 1RZGB 5AOMA 1DUZB 4OGYL 4J39A 2VQUA 3NSJA 2L8AA 1GZHC 2GTWB 4BZ2A 2FEEL 4LHQB 5K9JH 3UC0H 1D7BA 3HJ0A 3TPKA 1N3NA 4U7SA 2ZAGA 2JE8A 4DSYA 5I75C 3VGHA 5JMOC 3IF1A 2W07A 4OAWB 4OZGF 4NPYA 3SOTA 1BD2D 3J27A 3HS9A 1Z66A 4LLVA 5IQLA 3FQUB 5MENB 3FU7B 2AEQH 5J8OA 1SJXA 1BQUA 4L4VB 2FBJH 3IU4H 1IM3A 1CF1A 2UYLA 4HJUA 2CRZA 2XBTA 5DI8B 5E0QA 3QZLA 1GJWA 4G5ZL 2A6IA 1AP2A 3BPNB 4H0IA 4HALA 5CINL 4ABVA 3V5DB 2WXLA 3CSYB 1BFVL 1RFDL 2Q3XA 4Y5YA 4ORGB 1QQDA 4XNAA 3BN9D 1QUNB 1SMOA 4NT6A 2R83A 3LN9A 4GIOA 4V2BA 3BJ91 1CD9B 2DW5A 3I85A 1OP9A 1WT5A 4XVTL 2WB7A 3VI4A 5I1JL 3DGCR 3RX7A 2B9AA 2Q20A 2H3XC 3FO0L 3Q6FA 1HI6A 1CO1A 2HJFA 1NA8A 4EZLA 2DPKA 4HIQA 1S4IA 1FH2A 2D7NA 1YUKB 4G6FB 3KPQB 3QDAA 1EFXD 1GC1L 3L17A 1SQMA 1JCKA 3WFDH 4UNVA 3TNNA 4KHXL 4C4KO 5AW3B 5GRUL 5SX4H 3HAEB 3NFSL 1MCRA 4HC1A 3LSOB 3U1PA 1MCQA 1AZZC 1KGUA 3S3SA 4X4MA 2Y7QA 2IWEA 4W9LC 3SSGA 3QUML 4AGOA 1NFKA 2WNKA 3AT8A 5E8EB 2OR9L 4R96B 4PRPE 1VJSA 4J3OG 4WRLA 3GHPA 3T09A 1E4HA 1U21A 4EN2A 2DQGH 5AW6B 1RQ5A 3S3PA 1MCWM 3DETC 3UZEC 3HE7A 2NNAA 4Q9RH 4F58L 4HUWB 5LDUA 3EADA 3SE3C 3TV3L 1NCTA 3UJTH 4F91B 4XMLH 4YGAB 2RQEA 1FRGL 3NFNB 3GJEA 1BVKA 3O4LA 1MI5B 1JE6A 3NIGE 3RZCA 5F88B 3OWRA 5BQ7B 4TXVB 4I7ZC 2FJFA 4D0CA 3UZVB 3Q8EA 4RSVA 5H8DA 2IMMA 2C9XA 3FO9B 4CRPA 1MCIA 4EIUA 3A22A 2YEVB 2V9RA 3P3UA 2A99A 3I50L 1A7NL 4LVNC 1JZJA 3G6AA 3IU3A 3P73B 4YHLH 4NENA 3VI3A 1KULA 1CK0H 4L1BA 4BCYA 2B14A 1IGYB 4GQZA 4PBDA 2QPEB 3DMMA 1NL0H 1ZVYA 4RX4D 1FVEB 5ESAB 1AR1D 1ZHKB 2Y69B 3RY6C 3ULUH 4OY9A 2W94A 4YBLC 1WGOA 3LKRA 3NN8A 2YAMA 4OCRH 1HK6A 2XWBB 3VFOB 2ATAA 4DGVH 5I8CA 2FX8H 5I6LA 4WFEE 3VX1A 1SXBA 3U7AA 4WEEA 5G5DA 1QBMH 2VXSH 3L5WA 2ZOKB 4J28A 1EHKB 4XCCH 5CKGA 3TM6A 5I1HL 5CILL 4ANUA 2GSGB 4FQ2L 4WU5B 4DUWA 5LDSA 1BF2A 4GRWE 1NLBL 3N41F 4NFDA 3LPFA 5EA0H 4ODWA 2F19H 4HJ0C 4H4NA 4IDJH 4S0SD 4H5SB 1A21A 2Z0UA 2GYSA 4Z0BH 3KWWB 4WWKB 5G55A 3F7LA 1GSKA 3IPEA 4LSVH 2HUEA 2RH0A 3L3KA 3LZQA 4FXGB 5I66A 4JM4L 1G0DA 1BCIA 3HUJA 4TULL 1A6UH 4XGZB 5D7LD 1EJOH 2BK8A 5JXAL 3QUZA 4AVHA 2YAFA 4QRTA 2L04A 3ZHLA 1KUMA 3CN1A 2YO3A 1NEUA 5C2BL 4XPGH 2R0LL 3AGWA 3M8OH 3F5WB 5I1CH 4HIIA 4IIQB 4Y2OA 5D1QC 1JPSH 1JTTA 3PL6A 1GL4B 4I2XA 3UG4A 5I76B 3PXLA 3SOBL 4XHJD 5EORH 1VCAA 4UYQA 1MFAL 1M56B 3SCMC 2CG9X 1AD0B 3EGXA 5CJXA 3W5MA 3WS6A 4FZEL 5FUOH 2XN9B 1N0XH 3VXNA 1T21B 1S9XA 1HYRC 2W80C 4G72B 1YDPB 1FGVH 1PY4A 1AQKH 1WF5A 3CZJA 4PJFA 3VM7A 5C7XL 4N1HB 3MBED 4JFVA 2MSPA 4PGCA 5EC2A 5DZJA 2WUCL 1KTDA 4JFZH 1HSBB 1OGAD 2X12A 3ULSA 2WPGA 3F7VB 4KK9D 3FB7A 3QULA 3EH4B 1AZBA 3O2VH 3HJEA 5DJ8A 3WKMH 1E4KA 3A47A 3APCA 4PBXA 1AC6A 1G7IB 2BNRD 2FBRA 5I8OH 1MEXH 4I3SL 4LGSB 2Y36L 4QXVA 3NA9L 3DX8B 3RPKA 3LTVA 4AG4L 4NKDB 2ZG3A 2J8UA 3NPSB 1EAOA 1JK8A 3IN0A 3QEGH 4BE5A 3MI6A 4NZRH 1H6TA 4GKZA 3QI9B 4FYRA 2AQTA 2W65A 3GZQA 2HA1A 5FGBC 3BP4B 1U8NB 5DJCB 5B22A 5KSUB 2JJSC 1INEL 4NQDE 2Y22A 4CBPA 4MJ6A 1U36A 4JCWA 3MREA 4OCSL 4GAYA 1KFAH 5E5UB 3NH7L 2KERA 1OARH 1M7DB 1WISA 3RHWK 1DUYB 3CX5J 4OJCA 4YBQD 4NWUH 3VXRE 3WJJA 4LCWD 1FVCB 1KB9J 3RWJA 1ADWA 4JFDA 5J6HA 1XGYL 5CGTA 2G2RA 5KYUB 1BSIA 4X6CE 1RHFA 2NY0C 5EO1B 3C60A 3V6OC 2AK4B 4HVBA 4H88L 2JCCB 5CZXC 1TDQA 1GZQB 3QXWA 3ZL1A 5KVFH 2XOTA 3ULUD 3LEXA 4AITA 3MNVB 2D4FA 4S1QH 3QORA 2H26B 5DWPA 5TQ2H 1WC7B 1KLFB 1EAPB 2VDNL 4JPIA 3R06B 4QI3A 3KBEA 4P49A 3EJPA 3RVUC 4P2AA 4PJGB 1AGCA 3MRLA 4OZGE 4I13B 3QZMA 3MLXL 5DZ9A 4HWBA 5D7SL 1JZHA 2ESVE 3P30H 3BPOC 4A2LA 1FG2A 4KI5C 4R7VA 5KANG 5A16A 3WIAA 1N5YH 5JHDE 3CZFA 4HZLB 3RGBA 1SHWA 3EJYC 4JW3A 2VDPL 3MJ9A 5C9JB 3F01A 3MOBH 4FQCH 4N24A 5SX5H 3ABGA 4G83A 4DOHE 2C9AA 4Y16C 4FFTA 4R7LA 2AZAA 2EUZA 4ZS6D 1CF8H 3RKDD 4AYSA 1TLKA 3G5YA 4K3DH 5DC4B 2YHGA 4J2XA 1U8IB 1OALA 1R5WB 3DC0A 3LQZA 1ZEAL 3UO1L 3PV6B 1KPVB 4HWZA 4JMXA 2NW3A 4X4YA 3Q06A 3RRQA 2ARJQ 5DGRA 4JM2B 3MO1A 5H37A 2IBZX 1DVTA 4XP5H 2B2XH 2YPLD 5KS9B 1YECH 2V17L 5C09E 3QIWA 1VDGA 5F6IB 4IBYA 2IFGA 2JQAA 3WEXB 1FZJB 1XZ0A 1JN6A 2WP3O 3L95B 5I1LB 1REIA 2NRDA 1Y0LA 1BZ9B 3GXUB 4LSPH 3GLAA 4UU9A 1IQDA 3QEQD 5DZNA 1J05B 3BP7B 4Z7UF 4BD4A 2EVHA 4HU2A 3O6FB 3FO2A 1Z9PA 1YO4A 3SZKC 3P4NA 1P4BH 5D4JA 4RQQA 2V7NA 4HF5H 4I77L 1HQ4A 4HWEH 3P54A 5D4IA 3V4VH 2ZXCA 1L0PA 3FO1A 5E2UH 3WXVH 2BNQB 2CK0L 2ED9A 4KKAD 3DUUA 4NO0B 5LG1A 4AQ1C 4I9XA 1MFEL 3TEYA 3L9RB 4G6KL 1IGFL 3GSNL 4QRSA 1B4JH 3L2NA 2D03H 3U1SL 3SQBA 3UTOA 2NOYA 3W56A 1BMZA 4I4WA 5F96L 2QKIA 1IC1A 3PFUA 2X2HA 1WZLA 1ZT1B 1L5GA 4IRZL 3HMXH 4FYSA 1MFDH 1KGCD 5LBSH 32C2B 4XCNB 2I9TB 3W39B 1N0LA 1UD5A 2YZ1A 4XXWC 2EIKB 5KW9H 4A7GA 3NK3A 1HS6A 1ACXA 4X6BA 2ODHA 1ZLUK 4L3CB 2C4FU 4AV4A 2J73A 4BUGA 2G75A 1NMCB 1A6ZA 1OW0A 3CFKB 4AKOA 3QJHA 4A38A 2M26A 5AKRA 3FONA 5I1DA 3UTPD 1AZRA 4TL4A 1R3HA 4H8WC 2FDBP 5FYKH 5FGCB 4GRMA 3CH1B 4WUUD 1SJHB 1KIPA 3JYCA 5T3ZE 5HVWA 1J5HA 1NSNH 4UTAH 3CXHK 5ALCH 4FMKA 4WWID 4F8NA 3D33A 3FT3A 3KLHD 4R4FH 5A7BA 3RNKA 1QKZH 1U3NA 3F7QA 4KNUA 1CTOA 1FC2D 4XMXA 1NGZA 1NGQL 3Q8BA 3BPNC 3B7YA 4MKMA 4I87A 1JGUL 1UUSA 3FUEA 4Y8DC 3WY2A 2HX9A 3I02B 4BZ1H 1F6AB 4GQ9L 3S4SA 3ZGIA 3HG1B 1IV8A 2JELL 3CVDA 2AZUA 5FHAL 1MVYA 3KYKL 1RP9A 2Q10A 3RY4A 5HYJE 5AYQA 5GS0H 5AFAA 5EFIB 5HHXL 2LAAA 1UYWL 4FFVC 4DGYL 3HFMH 4GIPD 2W91A 3VFMA 4ZO6A 2XT1B 3ZVVA 5AD0A 2CIKA 2JF1A 2C3VA 2YBRA 2ITFA 2Q3AA 2ZKYA 3IFLL 2BLFA 2E9WA 1KCBA 3CXDL 4XPHH 5CD5C 3FFOA 3AROA 1R9FA 1XMWA 4HK3N 3KWUA 4LCIL 4UIKH 5IESL 3UPRB 3C8KB 1MFMA 3DETD 5TFSL 2DBJA 1C8QA 2JJTC 3BP5B 3CDGA 3FUNA 3OR7A 1TZHB 4J5VA 1P9MC 4LRIC 4K7FB 5A1AA 4M7LT 4LPTA 4DP4X 5IV2B 4PV1C 4YQXL 5ITBL 3QA3B 1MREL 3J7HA 2VXTL 5CP7A 4UZUA 2R0ZH 3ZE1F 4OUUB 3SO3B 4NCDA 3JT0A 1LD9B 2O6DA 4AEIL 3BH8A 3K1KC 2ZKHL 3EJZD 2CO2A 3ZKNC 2DQUH 1S7XA 3IJSB 4NQVA 2FAUA 2RACA 3FJTA 3LRHA 3HZVA 4AKQA 1UQSB 3LEYL 4ZO8A 4HLEA 2QFRA 2DQ6A 1K9TA 3MRNB 2QMKA 2YD2A 1ZTMA 4O2FB 1YYLH 3AT9A 1J88A 1AO7E 2MEJB 3QPXL 1I1YB 3JVGC 4ABWA 3EHBB 5SWSA 3GUFA 3WSQH 5ABDE 1A2YB 1QBAA 1XH3A 2CIIA 2I07B 3U7WL 3NFPA 2J2ZB 1BWWA 1QZNA 1VEMA 5D1XE 2OYPA 1ZANL 1DJHA 3D06A 4GG6B 1E90A 4Q4EA 4C58B 2ADJB 1PF3A 3OAYK 1LWRA 3VI4F 1QLEH 4PJCA 5FK9A 3NJNA 3X1BA 3UJJL 3FT0A 1UASA 4L9LC 1XSJA 4LL1A 1S5IH 3QC5X 1IZKA 2X1PA 3HS0B 1TU2A 5BVJB 1QFUH 3CHPA 4Z77A 1JHTB 4ABQA 3HZMB 4K7PX 5GGTL 2WZ5A 4OI7A 5GGSB 1EUUA 2NX5A 4U6XA 4HJ0D 1ADQL 1RPUA 5LCVH 2EYRA 1JK9B 5FYKD 1LYQA 4CKVX 2MPAL 4MX7B 3K71A 4PREB 3TNMA 5C0CB 5IUCA 4W4OA 5DS8B 1EMTL 4EQ2A 3HNTH 1ZIAA 4I88A 4H1LH 1NUDA 4N90D 3ML8A 5GGVL 3SJVE 1YC8A 1KC5L 1YEEH 2WANA 3O3AB 1KN4H 4CVUA 1QFWL 3THMH 3BCDA 3BLBA 2OTWA 3ARDC 1UOKA 5TF0A 1ZS8A 2BSSA 1AQDA 3FFDB 3C6SB 1QHOA 5D1QD 3EDJA 3MBWB 3MV7B 4LASH 2X4PA 1A4KA 4QIRA 4QAMB 3H7BA 3MACH 3GBNH 5FW6A 3MLUH 5I5IA 1VKXB 4UUJA 3U48A 3VVVA 4PCTA 4GAGL 3H6AA 4Z76A 2VDLB 5EWIH 5JHBA 1BXXA 2J56A 1LO2L 3FSOA 4R8WL 4OFIA 1N2RA 3WE6A 4EE2A 5GS0D 4XOBA 1UWXK 3ILDA 4F20A 4WI0B 1P4LA 2NY5L 3H0TB 1A14L 4QOKB 4BA8A 4KUZH 4D8PB 3BVTA 2D8KA 3AACA 1Z9NA 5KAQG 1HXYB 3V4PB 1RMFH 5ICXB 1IKNC 2AKRB 5DK0B 3BT2H 4ZJ9A 4AXWB 3K6SA 4FXKA 2D7TH 4S1RL 4NKOB 4FHKA 3EYFA 3L16A 1NAMB 2P26A 4JFUA 3MRMA 4Z7UE 1HEJC 1J8SA 3S88L 3BIKB 1C16A 2P45B 1E2VA 1XH0A 3B5HA 1SJEA 1XF2B 3BWSA 4AYGA 3RX8A 5IZ7A 3UTZB 4M6NH 4RGOL 4ZD3L 3WE1A 3MRIA 5EUOA 1PZ5B 1Z1WA 5DK2A 3L9EA 1YPZB 3N42B 1G9MC 3MUZ1 3QI9C 3P9MB 2HKAA 5TH2A 2OMVA 4H8WH 4XPFL 5F1KC 4X7SH 5J9PB 2NY0D 2VERA 1NJ9A 3HBZA 1MFCL 4HPOH 1KTLA 5HP5A 4HUVB 3HUJF 5DEJA 2Z4QB 1SOXA 4OBSA 5CZXD 5F7DB 3T65B 1UURA 1A3ZA 1FFOB 2BRRL 2BVQB 2XSKA 1RZQA 2QTEA 5GHWH 4YSPA 1DL7H 1FYTB 1IC5H 3RVUD 1AE6L 1MLCB 3CLWA 5T1DL 4D0BB 4F2MA 4XN2A 1MHPH 5IMMB 1FBIH 3T0EC 3RHWF 1X5KA 3RDTB 1AZNA 1IL1B 1T3FB 1H8LA 4TNEA 4OB5L 2ENPA 4JFFA 4YN3A 4KI5D 4HWNA 2A0LC 5D2NE 1L3WA 1EXUB 1UM5L 3KPRD 4JANB 4QHKJ 3LIZL 4KC3B 3EJYD 3TA4D 1QP1A 3O6LL 3NBNA 3LHAA 4Y16D 3QZWA 1M1XB 3IJYA 1K8DB 4BSWB 1YNTB 4YSAA 5IB2A 3S2AA 5FYLL 5JLZB 4GSDH 3D18B 5F0LB 1CXEA 3BVDB 3WUWA 3HAEH 4FKHA 5DDHB 4ELMB 5T1LA 2JK5B 4YHOL 5J1TC 4OLXL 2VYRE 1TENA 3ISRA 3HR6A 5GPRA 4NCC2 3KPPA 3RJDA 3U6XS 4O2CB 5E8DH 2GTQA 2J8UF 4H25A 3GRBA 3DXAE 3Q1SL 4TUKL 3SDDB 1UEYA 5GSVA 3SQRA 1KXHA 5GJSL 2CNYA 2ZXEB 4PWIA 2DF3A 4YHPA 1MY7A 3AXLA 1NKRA 1JMXA 2YKLL 1L7IH 1JZ3A 4V1DB 4LLDB 5CEZL 1AXSB 1MRCL 2CDFA 4YGVA 4ODXB 3VW3H 1QRNE 4ZTPH 4OV6F 3FOLA 5F6IC 1QLRA 3TJEL 1J9RA 4UT7H 4CC4C 3GB7A 3VA6A 9PCYA 2WVVA 4TKWA 4CILA 1JNLH 3FMGH 5F3HB 4YSTA 4TTGA 2X9WA 2OLDA 1ZA6A 3GO1L 3QJZA 3O6FC 2K45A 3FTWA 2KLRA 3PWVB 1OB0A 4RMQA 1HOCA 1YNLL 2ETWA 4UT9A 1HXMA 5FA4A 5IW6B 2XZAL 5ACMA 3DX4A 1BVLA 1LEKB 3ZE1E 3K2KA 3LS4L 4CU8A 1MPAL 2ICEB 1M3JA 3OLGA 5F8RC 5GIRA 1TPXB 4RIRB 4D9QE 1WIPA 3KLKA 3NABH 3U2SA 3SY6A 3ZDYB 1PFCA 5I8KL 4F8OA 1I1AA 1Y1UA 3F62A 3FQNB 2QQNL 4JS7A 4CU7A 3PQYB 1G7PB 3R19A 5EF1A 1S7TA 3BSZL 3MGOA 1KBWA 1X7QA 3ZO0A 3IFPB 1BQSA 5EZIL 3VMNA 3OM3B 1GOFA 2A2QT 1HILB 5AW7B 1FNAA 3AM8A 4PJDE 1TQSA 1BBJB 1ASPA 3OAZK 3ULVC 2VQTA 2DRUA 1BX2A 1G7LA 2YAOA 2ZUUA 1K8IB 1KYOJ 4ZYKB 4GUOA 2OMWB 3A4DA 2HZHA 2FX7L 2HRPH 4KK8D 1OSZB 1FC1A 5J7CC 3NIFF 5DR5H 4P9HL 3QH3A 3SKMA 3FW6A 4KKZA 4B50A 5MEND 3ATAA 4R7DA 4KKRA 1A3QA 4L4VD 2WYIA 3B7TA 2BOLA 3WKYA 1N10A 5AUMA 5E2TL 4ODVL 2D7OA 1CBJA 5L2KE 4U3SB 1X5HA 3PV7A 4MMYB 5E6IB 5FKPB 5T33H 3GLEA 4UB0L 3KNBB 5IK3B 3C2AL 2IAMC 2APBA 4ZUTB 1I7UA 2BY2A 4PY7B 4X4ME 2FR4B 2NY7H 1UATA 2N0MA 5T5FA 3IMTA 2RGSA 1QLFB 5EIQA 4FFVD 1S7RA 4GW5A 4I1PA 4LSQH 5K9KA 3WY1A 1AGEA 4KJYA 4G6FD 1AKPA 3TPUA 4F2EA 3P9LB 3AB0B 5EPMB 5JTWA 4FZEH 4YHML 3ARPA 3ZZ1A 5CD5D 4MCZB 4BFFA 2C9PA 3B43A 1AH1A 4J4PC 3X12B 4LNRA 3IDGB 1EEZA 1XGPA 2N59A 2JQMA 1G6RL 3BAJA 1RD6A 2QADC 2G5RA 2ZOTA 3VXOB 2Z1PA 4FTVB 3QNXB 5KBNC 4LVOB 5FECA 5TDOB 2M2DA 3SE9L 1BREA 2Q7YA 3O4LE 3VAEA 1PBYA 4LSRL 1PPIA 3D0VA 3IB4A 3OHMB 4WKXA 4PS4H 2R29L 5CLYA 1PX8A 3PIQB 4I0PC 4A7GF 3FAWA 3CK0H 2WBXA 5DS1A 2DM4A 3L3OA 3ZKND 1BZ7B 3GMLA 3VD3A 3T0WA 5HPMB 3IK2A 2OL3B 2VGLM 1H3TA 2Y2WA 4M4RA 1T5KA 4DUXA 3TBYB 2RFXB 1IGCL 2Y24A 3IJEB 3DPBB 4PGDB 4RDBA 1G9MH 5IQNA 3CFTA 1W72B 4U31A 1TTGA 4Z7WA 1PU0A 1MNNA 2CJUH 1MI5D 1VZGA 4NNPH 5E7FA 3S34L 3SO3C 3WJMA 1U42A 2W0FA 4PB9H 2YSSA 3ESPA 3STZA 4DK5A 4NIYE 4PLKC 3VU2A 3QR0A 3FUFA 5ABAA 1KBGL 4OIIH 2V2XA 5C0RL 4U1HB 5DRXA 4WHTA 5B4MC 1YG9A 4XMPL 1JYNA 3SE8L 2ADGB 3MRCB 4OLVH 2KYIA 3WN5B 2YGNA 3EHBC 4OM0H 3ARBB 3UX9B 1EHNA 2YARA 4LVHB 1HSAA 3EYOB 1U8CA 1Z6JT 2NYKA 4OGXH 3CGTA 5DRNA 1SXSA 3ORJA 3EUDA 4ZMQA 5KN5B 1P2CA 3E6HB 3DNKA 2CLVB 4NQEB 1CYWA 1J1PH 2AMUA 3HUJE 4UI2A 1VADB 4R6UA 3GHBL 5A6IA 2FH8A 2VR4A 5JIDA 5A2FA 5F9AC 2VLJA 1XB3A 4XNUL 2X2JA 4K8RC 4ZUVB 1A3LH 1HX0A 3L7FB 4E68A 4CNIA 1KDJA 2BP0A 2X6CA 4QWWC 5HHQB 4L5FL 2VISB 3ARDD 4I2XE 1KDIA 3BVWA 3C9NA 3F6IA 3KXFB 4UQ3B 4PRAB 5FO7B 4LRNL 1QG3A 1FL5B 1M71B 2WLNA 2X6UA 3BSHA 4JQVA 4OD2B 3RUGB 3TIEA 4OFKA 1E9QB 1EHAA 3P0GB 4G8GB 2FGWL 1OD7A 4GXUM 2MHAA 4XPTH 2Z92B 3IVKB 2AJZB 4Z7NB 4G7QB 4P23B 5B39B 2EE3A 4DK6A 3GJFB 2I26N 4EZKA 2GCYB 4EOWL 4M61B 4R90L 2BDNH 4PV8A 3K72B 2XWTA 5FYJU 1I9EA 3T6XA 4JHAH 4P9ML 3HVNA 4TVSa 1KB5L 2NUPA 4GBXA 3MQIA 3T3PB 1B0RA 4G43A 4Y2DB 4CW1A 2J8UE 4J3WA 2AJSH 3G9AB 4RFOL 2XTLA 1PX3A 2XG4A 3HHSB 5I24A 2CGYA 4NJAL 2GY7B 3BD4A 3LQMA 3GNMH 2H32H 5K69A 3TF7C 3RTLA 3OF6A 1H0DB 2Z8VC 2RD0A 1PLCA 4GH7B 4F27A 4R0LB 2X4UA 4AI7A 1D9KB 5J06A 4PJCF 3K2UH 4WEBH 1OVZA 1BFSA 1O6SB 1ZTXL 3G6JB 2DQJL 3E3QE 3W81A 2ZZUT 3MRHA 3MRKA 5EBMA 1RLBA 4RSYA 1QOKA 1TIUA 3H9SB 1PCXA 1PYWA 1I7RB 1GMEA 3QI9D 4H2CA 4NFCA 3ZTCC 2OM5A 3O8XB 4P5RA 5AENA 3ULVH 4DO5A 5E2WH 3N50A 5EOQH 2OK0L 3BZDA 4JY4A 1N4XL 3OGOE 4OLWH 5IM7A 2FYYB 4E5XB 4Y19B 5B1BB 1AKJB 3AG2B 3VFPB 1CDIA 4HCGA 3U46A 4TUOA 4HUNB 2V5SA 4J8QA 3MRQA 4P46A 5HGHB 2PWDA 5CU5A 5F1NB 1JGDA 2OCCB 3Q3GB 1FL6B 1PAMA 5F97E 1KJ2L 4PJ5A 1R5VA 4WW2B 5KVEE 5MHSD 1ACCA 1VFOA 3WJLA 2LFGA 2AK4D 5L9DH 1DE4A 4PSRA 5A6MA 3TIDA 5HDQL 4MJIA 1IAII 3G5VA 3FOMA 3ALWA 2A0LD 3SDXB 5D7JA 3WTSA 3O4OB 2CBTA 3QXTA 2CGRH 4LEEA 3FKUS 2J6WA 1T1XB 3RVVC 5CZRA 4F57L 2XXCB 2EDQA 1F8TH 1GPOL 3QNYA 4C59B 3NIFE 5HJGA 2NT0A 3LN5A 3RDTC 2IWFA 3D07A 1BXAA 2VH5L 2VZSA 2OTUA 2C9RA 2G3NA 3D25B 2J57A 3V0DA 2VO5A 3IJ9A 4FNPA 3SDAB 4XMTA 4GW1B 2C1OB 2FIKB 4MXVF 5F7HA 2D0FA 2GEQA 3O45B 5E1HB 2AV7A 1A3RL 5EZOH 4UOQA 5LVEA 2VN6A 3ELQA 4ALAL 3V6FB 1WHPA 2DWSA 4YUEL 3Q2LA 1R5IB 3PAYA 4ESKA 3ASNB 1O7DE 2F7QA 2HAZA 4NGHL 5E94B 1OLLA 3CC5B 2A4EA 3HC0B 2X05A 3SODB 2MCPH 4DIXA 2XVLA 1J8HE 5CLTA 4DN4H 4JM2D 1JYVA 1CN4A 1LO3H 4LARL 1FL3A 3I84A 3QEUA 1T7ZA 2Q76B 4K5OA 4WI8A 1MREH 4YPGB 5HGBA 5KOVC 4KI1A 3VG0L 4OM1L 4WKZA 3NZHL 1HZKA 1OAYH 3O6FD 4R26H 4BK5A 4BJLA 4HKBB 3UJIH 5IBLC 3UDWC 4GI6A 2GK2A 2SEBB 3CLFH 1JGEB 2BCKB 1DQQA 3UOAB 3V0GA 2ZXQA 1VIWA 5ID0B 2BNQD 2VWEC 1S78C 3REVA 4NO0D 4X4XA 1CGVA 2PR4H 1GCFA 3FF8A 2X7LB 3AWGA 4F1ZA 1U4FA 1J9TA 1FWXA 1T1YA 2JB6A 1A1OB 1SJVA 4AMKL 1IC7L 5CD3A 2OZNA 2WZPA 4NKMA 3RIFF 5B8CB 3EH3B 4S10A 4RAUA 4JB9H 1J0ZA 2ICEC 4UQEA 5EZLB 1TPXC 4POUB 5DQDL 5AW0B 2OQJA 3C5SA 4DFHA 3ULVD 1U6AL 2VTFA 3D05A 2R2EA 4UV7L 3M1OA 1C8PA 1FN4B 3DTXA 3U4BH 1BBDH 1S6NA 2CO6A 3L4XA 3EOTL 5DZOA 3PWLA 1FLTX 5EO0B 2Y6SC 1S9WA 4K8RH 1ETB1 3IM1A 1NGYB 1XR9B 3IFNL 4ZFQA 2P8MB 4S1SH 2F8IA 1HNYA 2E7DA 1DFXA 1DVFC 2MOVA 3FH5A 5DRWB 4G8EA 4BUHA 3LZLA 3D51A 4LLAA 3REWB 3UBGA 1A6TA 2N7BA 5EBLA 4PWEA 5AZUA 2WCPA 5AWNL 2WWOA 1U8KB 2IFFL 1E9OB 4YLBA 1OGPA 5AOIA 3V7AE 4QHPA 3VFRB 3ZR5A 5EG6C 3UH8A 2N7AA 5DD0H 4CN1A 5ISZE 3KYOA 2OI9C 3MLWL 4X98A 1DBKH 2VW7A 4PRIA 4K94C 2OYKA 4GO6B 4HKXA 3UTTA 1CL7L 3HG1D 2JWYA 4L8DA 1DQDL 2VDLH 1LO2H 4R8WH 4LO9A 4JO4L 2AXWA 3S8GB 2BSED 4J4PD 1YAZA 3NCMA 2AJUH 2DQEL 4NO5B 3VFNB 1JHLH 5ILTL 5IQ7L 5D2LB 3US9A 1XGQA 3GSWA 3H9YA 2VLKB 3PGCB 5K5YA 1V54B 2QADD 3F85A 1OK0A 1T66C 1X3DA 4TQEH 1ZD6A 3NDYE 3SD2A 3UIZA 2VE6B 3AB0C 5K93A 3BYTA 5FKAA 2BW5A 7FABL 3OB8A 4L4TE 3V4PH 2C3GA 3SY0A 5H35A 2FJUB 4AH2B 1TZGL 5HSFA 2XXMB 1QWHA 4QO1A 5FUCC 3EJJX 2X87A 3QG7L 1AGFB 3A67L 4MAYB 3S48A 3CZLA 4JQXA 1NAMH 4JPVH 3DIDA 2E86A 4DCQB 2RB8A 1X5AA 4FG0A 4HH8A 4YDVA 3S88H 3KPSB 1QTPA 3Q8CA 2IJ0C 1FI8C 1TNNA 4YXLL 4BFNA 4GYBA 2LLGA 1TVBA 2OMNA 4OSUL 4OLUL 1I31A 1WZMA 4PLKD 4RMWA 2Y07H 3QSKB 4D0DA 3BO8B 4GKNA 3GLDA 5EU4B 5B4MD 4PJCE 2X88A 2PKDA 2ZSVA 1HHGB 1MFCH 3HC3H 1IC4L 2WZAA 1CLZH 3DURB 3EHBD 3L3GB 4QEGA 2YGPA 1BIIB 1A5FH 1KIQA 3HB3B 3OHXA 4XRCA 3TVMA 4F7EA 5KVGL 3WXWH 4JZJA 1QI5A 3ZYIA 2ITDA 2XY2A 3IDNB 1LK3H 2K4AA 1EO5A 1Z0NA 4ODHH 5KYXB 5C0BB 5IVXB 4UIMA 1RZJL 4H8UA 1BZEA 4EN3B 2V6HA 4KJPC 1VEOA 1P7HL 3PHOB 3WN5C 4FQJL 1UGNA 3ARBC 3BVVA 4LVHC 4IW4C 2XRAL 4XP4L 5EZJA 5KYNA 4K3EL 3QO1B 4XNXL 2DWEB 4K8RD 4Z7QB 4J3VA 1RUPL 4PGEA 4X6FB 5BV7B 4QWWD 1NCCL 1MW2A 5CCJA 1BD2A 2F58L 5GRYA 4ERSH 3V7MA 2J1YA 1TCRA 2PYFA 3Q0HA 3EO9L 4QRRB 2VRKA 5DJ6A 3TJHC 5C0CD 3BWAB 4LHUG 3JTTB 2CLZA 2MKWA 3DVIA 1XB8A 4MNQB 4HXBH 1EWHA 5C3TA 5CSBA 5LN8A 5ESQB 1RIVH 1QVOA 2ARJB 4JZOA 5DD5H 1MNUL 1NFDA 1V3JA 2D7MA 4M3KB 1ODUA 3LRMA 4M48L 4RISH 4XO8A 3VXQB 1VPOH 3UBXB 2I7OA 1JZ2A 3B7RL 1NEZG 2EECA 4FTDA 4I9WE 2A74A 4PJAE 2DMCA 3KLDA 3BDBA 4FI8A 4RMRA 4PMEA 2CKNA 3T4AB 4RDQF 5EIIB 1CD1B 1IARB 3EFFA 4MXVE 1JZ7A 1QNZH 4H20H 4WUKH 4D2NA 1JERA 5B1AB 1YEHL 3VXUD 1E5ZA 1I9IL 2WIIA 6FABL 1EFXA 3LIUA 2BVPB 4P23C 3PJLA 4EF3A 2VABB 5JOPE 3DIVA 5AG9A 3BDYH 1THAA 4UNTA 4HQQL 5CJ8A 1E8WA 1GTNA 3D9AH 1MOEA 5I2IB 4HETA 2X3AA 2OMYA 2QPFA 1I8LC 5JIHA 4KXCA 2DIAA 4NQSB 2QLYA 3JUZA 3G08B 3WFBL 4Y2DC 4OVVA 5HVFB 1A9EA 4OQTL 5IGXH 1SBSL 1DN0A 3GSVA 1RUQL 1KLUB 5C86A 1P5VB 4FL4B 4N8CL 1A1NB 3L4CA 4R0LC 5A2LH 3CLEH 5MERB 4HCRA 3FQRA 2IPKB 2E75C 2Z7WA 3HZYB 4M9OA 2AS5M 4NOFA 4FZ8L 1LE9B 4ONHA 1CG9B 3HKFA 1U3YA 5F1SA 5E2JA 3OJMB 2ZXAA 3RG1C 5CEXB 5ETUA 3WV0A 1UA6H 1CPUA 5E8NA 4XNYH 5AAMA 3W82A 3SDCB 2CMRH 2P8PB 4R4ND 1QW9A 5CWSA 3ABKB 4ZX3A 1RK1B 2GEEA 2GJ6B 1PSKH 2OMUB 4JFFE 4X0KB 5J6SA 4Z5RB 1LNUB 3EFOA 4LKXA 2A38A 3MLZH 4AZ8A 5GRJH 3LRKA 1YQVL 4RX4A 3OMNB 5D93C 1FYTD 4WW2C 3RVVD 3S5LG 4A7UA 5DWUL 3TCLA 1KCWA 3VDBA 3X17A 1NBVH 3QQXA 5GGRA 4K94H 3RDTD 4AIZA 3CFMA 4POYA 4NN7C 2FE0A 3OAWA 1BVZA 1TJHL 1QSFB 3MJ8A 3O4OC 1YEFH 1U92A 3TESA 4O51B 2FSEB 2OW7A 3IDXL 4NZFA 4HBCL 4ZXBC 4D7PA 4GXFA 3GPEA 1HU8A 1HH9A 3CZEA 4H0LC 1S7UA 2DICA 5HTSA 4G6AC 1F90H 3PJSB 1D5BA 4GT0A 1OLZA 4NYLA 1ZGLA 1DBBH 4X7CC 4TNWF 3U0WH 2PO6B 3QUGA 3C5ZB 5D7LA 4FRWA 2O6FA 1YNKH 2GW5A 3ZQ9A 1F1AA 2D3NA 4M1GH 4P5MB 1SY6H 4RRPG 3KPMB 5TF1L 5C0IA 2DIBA 2O6PA 3LRSA 1IEBB 4I18B 4PJBA 4M9PA 1EO7A 2LU4A 2PF6A 5D6CB 3SDDD 4CBZA 1JVOA 4OKVB 3S3CB 3ZYJA 1NLDL 1TCMA 2AAVA 2BERA 5K9OB 1JNHA 3DX0A 2L0DA 3N1PC 3GXIA 3WLBA 4C4BA 2OL3H 5IBLD 3JV4A 2G5BB 1ZDQA 3CDZB 4XNBA 4ONFL 1RVFL 2E4FA 2QQLL 4FLSA 3F12A 3FN9A 5DS2A 1UJ3B 3BP6A 1W72H 3PDGA 4J6RH 1Q94A 5E4IA 5BS0A 1MVUA 1KV7A 1MCJA 2UY7B 5D5MA 3MBEA 1S78D 1XT5A 4OZFB 2HPTA 4EDWL 4UILH 1RZIB 5AVRB 3SKOA 4TTDC 4BQ9A 3QRGL 3ZMEA 1N67A 5HGDA 3S37L 4IKKA 1SLXA 5DEFB 1OGAA 1FNSL 2F1AA 4JAMA 5HI3C 2DQDH 5FHBH 2NNCA 4OF5A 2PR9A 5IREA 4M5ZH 2BNRA 3BC9A 4M6ML 1JBJA 5I1KL 1DVSA 3VQMA 2UY6B 1T0PB 4FQ1L 3OKEA 1FP5A 1FZKB 3ARGB 3EUUA 1LILA 2K7QA 4HHAA 3LKPA 4ZTOL 4C4UA 2HFGL 3DX7A 2WNXA 4WI3A 4JJ5B 5E00B 5JIKA 4CDHA 2PTUA 3WDJA 2DQHL 3FUDA 3PQYD 2XN1A 4GUQA 1CDYA 2Y6SD 3SBWC 1AHWA 2BHYA 1RH8A 3LKSA 2ZE0A 3H42L 1HT6A 1UM4L 3FPXA 3PWPB 5CJOH 1U3ZA 5C70A 1DVFD 4UAOB 1GCYA 4JM0A 3DUSA 1HXKA 1K85A 3B6SB 4LNVA 1TJXA 5K9QI 4LCWA 1BOGB 1XIWB 1Q72H 1HNGA 1SN0A 4JHWH 1I7TA 1BVNP 3UPCA 4IRSB 3HBQA 3L1GA 1YJDL 1PQZB 2ZG2A 5E8OA 4TSCH 3FRPB 3PHSA 5ANHA 1EEQA 1JZFA 1S3KH 3APNA 4QRFA 5CKAA 5I6XB 2W9EH 3HNSH 2HCZX 1AXTH 3BQUB 5E6ID 4NM8L 2KL6A 1T6VN 2IGFH 4M43H 4PJXB 2X4OB 1KCSL 5TPWH 3FU5A 3EOYG 3I6LD 3BUTA 5HGAB 2Q87A 3JTSB 1WITA 4AQOA 1NCWL 4F37K 4FQIL 1J0YA 5F70A 2YXVA 1E6OL 3GJFH 2IANE 3QRLA 4WHYH 5EUKB 5MHSE 4E2OA 3ILPB 1T66D 2GBAA 3EYUH 2NDGA 4QY8B 1SUHA 4MQ7A 4EAEA 4PTTB 4P9MH 2MNUA 3SD5A 3BKML 4TL5A 4OFDA 1U8PB 4KQ3H 2AJYH 4WSJA 4P5KA 1RCYA 2I5YL 4Q0XL 5TDPA 3S0PA 4A66A 2NXZB 2DMHA 1EEYB 2WQUA 4DH2A 2VAAB 4L8CA 1U93B 1R47A 4KZCA 4RFOH 2EDNA 5D6DA 5J1AB 2PWEA 2GI0A 4XN1A 2EC8A 3U9PH 4FTVD 4G1EB 4RAVA 4Y1AE 3TBWB 1R19A 3GXTA 2FZ3A 4Y4HB 1YEKH 4J7RA 1U0QA 2YPLA 1C5DA 4PRNB 3OJDA 3MRGB 3GPSA 3ZJAA 1E3FA 1T5XB 1WFMA 3U82B 5L0QC 3US0A 2X9YA 2IH3A 5FB8A 4ELKA 4FQQB 4MAYC 4TVPL 2G60L 4F92B 1KCRL 1CFVL 4U1LB 4WWPA 4O9HL 3QEQA 2XA3A 1QW8A 4BRVA 3B34A 4WNQA 4XCYA 3FN0L 1A7RL 1MUJB 2AXJA 3LKQA 3NRFA 1GVIA 3UTSB 1OV8A 4HPYL 2G3ZA 4HAFA 5C92A 3DV6A 5HYSG 3APDA 5CSZB 1GH7A 2EDYA 3HLKA 3AC0A 4EUPB 3PDOB 4WY7H 3VRIA 5JMRA 4C83B 3OJ2C 2CAKA 1K5NA 1BM3L 3GHEL 5I1AB 5TQ0L 4X6EA 3UEQA 3PAVA 1Q0YH 4EI0A 2XPYA 2DJMA 2KZBA 4OI8A 3LKNB 3AQZA 4A6YL 1J9CT 3HRZB 4WHCA 3VFSA 1Z9LA 3E6FA 4ODBD 3MRPB 1TJIL 4AYID 4M8QB 3BW9B 1J5OH 2EUWA 3G5XA 4KJPD 4JRXE 2F5AL 4P57A 4JPWL 1K4DA 1QSEB 2HLAA 4GSRA 1YZZA 4LP4A 3ARBD 5DJDB 1GZHA 4AOFA 2DIEA 3HB3C 4Z7VB 3PHQA 4B9ZA 5F44A 3EO0A 4K23H 2FUTA 1OF2B 3OLDA 3CVIH 4QKXB 3NAAH 3DRTB 3QUXB 4TNVF 2HVKA 1JUFB 1NBYA 1XF5A 3P2DA 2Z7YA 4EN3C 4NQED 4GRLB 4URKA 3FCTA 1DJGA 1INQA 1MQKL 3TJHD 4EI5B 1NIEA 4MD0B 5INCB 1E5AA 3GMNA 2DMGA 1MN4A 3ZIYA 1A6WH 3ARXA 5CCGE 2M1KA 5BV7C 1A9BA 4LK4A 4I1RA 3LXUX 4ODTL 1GHFH 4H8VA 2I60H 3KXFD 1LEGB 1OAQL 3HI5L 4WSGA 1KYDA 1IKFL 1TQUA 2D2OA 4MAUL 5HY9A 4HEMA 2FT6A 2QVIA 2JXMB 1RULL 5IOKA 3JWOL 4G8GD 1CLCA 3WMSA 3D0LB 2V8LA 2X40A 2APTA 4JG5A 1TVHB 1AQ8A 2VR7A 3E38A 4XTRC 5FUZH 4P23D 5IW1B 4OW6A 1OAXL 3ARFB 1KWGA 3S36L 3BAEH 2XN2A 3T4AC 4LKCA 4OZHB 1NIDA 3ARWA 5JYLA 4MD5B 1OAZL 3KYNB 3BZEA 2WCGA 1F3DJ 3GT6A 5GGQH 3DYOA 3MLYL 1KNOA 1RV6X 2LGNA 1L0YA 5AVTB 1X7SA 5I16A 1PEZA 3ATEA 4AEHL 4Y2DD 4FEMA 1I9RL 1LO0H 3CV5A 4G3YH 1EX0A 4C8XA 1WFUA 2YD3A 4ZX4A 3NJXA 4YHYC 1HESA 3UZEA 2YRPA 4XP6H 1T89C 5C0JA 2Y06H 4WO4C 2UZPA 4P3CH 2AAAA 4JG0L 5FOJA 3BKJL 2E7LC 1A1MB 5E4OA 2XNAA 1OQOA 3LEVL 4UQ2A 4AUYA 5ENWA 1BW8A 3UAJC 1RZKC 3N40P 3LV3B 3O3DB 1XF4A 4FL4C 3KVDD 5EOTB 2E6JA 5EC1B 5IY5B 4XP9L 3H9SD 2ZX9A 1W15A 5DXWA 5KSVA 5ADPL 4OTXH 2A6JA 1JPGA 4YX2L 3DMMC 3V4VA 3QXDB 2GKIA 2IADB 2P46B 4MJIE 5LO7A 1A7OH 5C6TL 3UTQA 3JXAA 4Y19D 2WWNA 4XP1L 1AKJD 2X6MA 4NRZB 1L9RA 4H13C 1PDKB 3D69A 4HJIA 5F7MC 1S2EA 4FG6C 4PJ7B 1HVXA 3FCGA 2Z35B 5AW1B 5SX5K 2BY1A 1UH3A 3RY6A 4K71B 1NFDF 5BUPA 2WXHA 5DQ9A 5CM1A 1VFBB 3HMXA 3NGBC 1X4ZA 3BH9B 3FSWA 5LBSA 3RWIB 5KBDA 3QRBA 4N5EC 5ERWA 2EYSA 4JR9H 2CZNA 4RESB 3ZKMC 1T6WA 4ZK8A 1RIUL 2YPVL 4X7TA 4Z23A 5D1ZB 3NSYA 4OFYD 3WNKA 4X9GA 4XBGB 2EIEA 3H53A 1OO2A 3ME0A 3D39E 2K78A 4QHNA 5F6HJ 4FQLL 3ZMNA 2VIRA 1C1EH 2CPCA 1GTFA 1NC4D 1UB6A 4GXVL 4W93A 3HZ3A 3QUZC 1QR4A 1E4WH 2OKMA 4OLZL 5KSBB 3QS2A 2CKBB 1EZSA 4J8RB 2YGQA 1RJZA 5I0DA 2Y7OA 4B7IA 3OKOA 2AJVH 1AFVL 3DDFA 3QUKA 1O0VA 4UTAA 3P4LA 5DFWH 3DVNA 2GITA 2JKRM 1T1WB 1GYUA 4L3FA 1GY2A 3ZYOA 2BSDA 3S6CA 3L48A 2X0VA 1ZHNA 3OKNB 2NXYB 3QK0A 5D1QA 3IETA 2PO6C 1AANA 4NO3A 1CS6A 1UXSB 3GSXA 3C5ZC 1B2WL 3IFOB 1YHPA 2WBJB 3LN4A 3PUCA 4KVPA 3P0VH 5HHME 4BZ1A 3D34A 4KRPC 2ICCA 4YWGL 3TYGL 1ERNA 1J0KA 4IBWA 3QG7H 3ALXA 5D9SA 4B9GA 3FQWB 5JW5B 4KTYA 3IGLA 3IKCA 1AMXA 1WVZA 4N0YL 1QTSA 3ARUA 4A7TA 1C5BH 2VLRE 4YIQB 2H7WA 3BVXA 2CXGA 4M4PA 4UMSA 1W0WB 1L0XA 5SWQB 4WQOA 3RPIA 3TL5A 4HSCX 2WLHA 4TTDD 3FRUA 3VD2A 2GAZB 35C8H 3VXPA 3GQFA 1KPRA 5HI3D 3NRQA 3L3DA 1QASA 3ZHDA 4KH2A 1UJ3C 1PLAA 1T1ZA 1RIHH 3V5KA 3T2NH 3Q6GH 3GMPB 4U6TA 4ZMAT 4JO1H 2FJHB 3T0DA 1TTUA 1MCDA 2APFA 2DQCL 3MV8E 5EF0A 1U91B 2JB5H 1MF2L 2FJGB 3RNQA 4QTIL 3QQ4A 1G1KA 1IAKB 4MNHB 2Y5TA 3LH2L 1QPPA 25C8L 3PREA 4NAMA 2YJLA 4M29A 2C3HA 5DJAB 2E7MA 1MG3C 3S5YA 2E6QA 2JJSA 3WJJC 1Y18A 4DPCX 4GUCA 4FS0A 3ARGC 4PH8A 4DVBB 5JW3L 1Q0XL 2EXYC 3QCTL 3W9EA 5L6YL 2Q9OA 5E2VL 1DZ0A 3MUGB 4ZFOL 3B3IB 3QWRD 1HWGB 5B1CA 3KE0A 4A2EA 3T0XA 4N2NA 2XZCH 3VGAC 1DLHB 2RR3A 4LGPB 4DFIA 1UWYA 2LABA 5KANI 3FSVA 3IGFA 2X38A 4U1JB 4BRJA 2XWEA 3NP3A 1E5UI 1GRWA 5D7KD 5MP6H 3V6OA 4CVWA 4PB0L 1DQJB 1BA9A 4E42B 5BV7H 1OP4A 4UAOC 4D8OA 4JFYB 3KMDA 4KPHH 3WFEL 5F7WC 4GINA 2XKUA 1RJYA 4PRIE 1HEHC 1YEIL 5JA9A 5I17B 3VH8G 2L4OA 3BMWA 1X5IA 1DSWA 5EZPA 2VDRL 1HCVA 4PJBF 4X6DA 3AQYA 3IXTB 4FHJA 4LCCB 3VQ2C 4IRSC 3VTTA 1D6EA 3EBHA 5EBWB 4XB3A 4PS3A 3LX9A 1MQ8A 4GAJH 2UVFA 2V2TB 3BWUC 5AAPA 2BOCB 4NJ9L 4JFXB 4D3CL 5I6XC 3MRRB 3KPRA 1YEGH 3BQUC 3WY3A 4N2HA 1CFSB 1FAIH 2VN7A 4A67A 4LPXA 3H9HA 1RU9H 5LCVA 3PGDA 2OJZL 2R23B 4Y16A 4HAKA 3EF4A 4EQ3A 3HLAB 1EJ8A 1FCCA 4IQHA 4AGPA 1S7SB 4BFEA 2FWSA 3GIZL 1ITBB 4BKSC 1CE6A 4GRWB 4H1LA 2VLKD 1D5IH 3QIWC 3VE0A 1USQA 1ZSHA 1KT2B 1MWAB 3EO1B 4X8GA 3AW5A 1QYGL 2AJXL 3NZUA 4YXHH 2GSIB 1XL6A 1U8QB 3D1MC 3W1ZA 1EGJH 2NXZC 4QNPF 2PPAA 3MA9L 3QHZL 2M83A 2O26U 4FLRA 1FPTH 2YRLA 5KTEL 4IU3B 1BPLB 4YDIL 4MAYD 2HVJA 4TSBH 1IGMH 5HXMA 3CQQA 5KBLA 1F3DH 3AREB 4TSAL 1YYML 4LLYA 3KPSD 5L2JA 5E24E 1B0GB 1CLYL 4OIBA 1H15B 3CX5K 3FFCE 1UXWB 1RLWA 4XPBL 2CWRA 1T0MB 1KB9K 2QKIC 2VXQL 4AQ1A 4O02L 5BXFA 1KN2L 4QD2E 4FKEA 2WLIB 4Q14A 1MAML 1T20A 2FTAA 3D85D 4UAHA 2ADYA 2F74A 5FYKU 4LAQL 4BELD 3MLVL 3IDJA 4BSJA 1OEZW 3G7TA 1TITA 3CSGA 3ULUF 5IVNA 4XNMA 5KSAB 1FAKT 4LPWA 3NEOA 3FZUC 2AI0H 3HB3D 5C07D 2XTJC 4NDMB 1RJLB 3OXSA 1F58L 1OW0C 4JDZB 4XXWA 1B3JA 4PM1A 3HRZC 4L37A 5C0BD 5ESVB 1OM9A 3LDBC 4BQBA 1CGXA 4BH8B 4EN3D 1OL0A 2VDML 3MUJA 1RZGA 1MJJB 2GTWA 2R4RH 5CBAB 1SLVA 3CFUA 1GGBH 3TH4T 2AQ2A 3AJ7A 4MQSB 5TK2A 1BWMA 2KT6A 3C5JA 1ZWIB 3QUXC 3SYPA 4NQUA 2DWTA 4XO9A 4ZQKB 1QNIA 4OAWA 3E2HC 4EI6B 5IB3B 5CGYC 4M7LH 1YEDB 4GRLC 4QRRD 3FU7A 4U1MB 4EI5C 1BLNB 4L4VA 3BVNB 2KDGA 3LNIA 1ND0B 4M6OH 4OCWL 4X6CB 2YUXA 5LLIC 5DI8A 4MNQD 2HN7B 2WVUA 1G0YR 1KJ3H 1QBLH 4NC1E 4G9DB 3ZXAC 4EMZA 4B9KC 4RBPH 3CSYA 1CDBA 1JWMB 3O6ML 4NRYB 4ORGA 2CR3A 5FPIA 1H6FA 3HG3A 4XTRD 1QUNA 2NNXA 3BE1L 2XQ0A 4LLUB 3U9UB 2ZAIA 2IPTH 4ZUUA 5E0FA 4R5TA 3EJSA 4U7KA 1CU4H 4OZIB 3Q2NA 1JNNL 4WV1B 4NOBA 4JZNA 4OZGB 3WI9A 2CHZA 3GI9H 2FEDC 3Q48A 2ESVB 2H0PA 4JG1H 4Q6IC 2HKFL 5DMIH 1RZFH 1VESA 3IDIB 2OYLA 4WSKA 5JHDB 1XGTB 4G7VH 4LMQI 1JV2B 4U1NA 3ARFC 1HAUA 1VACB 1ZVSB 4JGMA 4ONFH 1AI1H 4DEWA 1BHGA