4JGNA

Crystal structure of rna silencing suppressor p19 with 1nt-5'-overhanging double-helical rna 20mer puug(cug)5cu
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
125
structure length
125
Chain Sequence
HMTSPFKLPDESPSWTEWRLHNDETNSNQDNPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFFGFDQIGCTYSIRFRGVSITVSGGSRTLQHLCEMAIRSKQELLQLAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA silencing suppressor p19
publication title Procrustean bed of RNA silencing suppression
rcsb
source organism Tomato bushy stunt virus
molecule tags Rna binding protein/rna
total genus 39
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2013-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1810 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4jgnA01
4KTGA 4JGNA 4J5VA 1R9FA 4KQ0A 4JNXA 4J39A 4JK0D 1RPUA 4KNQA
chains in the Genus database with same CATH superfamily
5DQJA 2XZZA 5K9JL 1JYWA 3FU5A 3MN8A 4KUCD 2YAOA 4XPGL 4KI1A 3HG1B 4NENA 1VADB 4WEUD 4OCNC 3RFZA 2AJVH 2F54B 1HCVA 1PLGL 2WGNB 3W57A 2HZHA 3US1A 2XXGA 5IV2A 1U2CA 3WGUB 1NSNL 1IM9D 4HIIB 2VXVH 4AKPA 5M7QA 5DUPL 3TBYB 4PAZA 5DUML 1NEUA 3CLFL 4NN6C 1GKEA 2AF2A 3DRQA 4PJ5A 3VU1A 4RMWA 1S5HA 1A3QA 2ITCB 3QR1A 1EAQA 5F89B 3U7WH 3WIIL 2B16A 5CN2A 1UYWH 3UC0L 1VZHA 1NGYB 1OAKL 1JGIA 2F1AA 5EUOF 4A2HA 3CHOA 2XIDA 2XBTA 3MA7A 4L8BA 4OZGE 2RIKA 1RZKH 1HAUA 2PXYA 3WDHA 4W70A 3AZUA 4OD2B 3VXRB 1PG7X 3ULVC 4YDMA 1UA6L 2AEQL 1OK8A 2B7DT 4A2GA 4QHNA 4K5MA 4XMTA 2J5LB 3FB7A 3HC3H 3ULUH 2GHWB 2MQ3A 2V6HA 3FU9A 3WNOA 2ED7A 2C9AA 3PNWA 5I30L 1FP5A 1IFHH 3UYRL 4Z0XB 2BHZA 3G6JE 3RHWF 4MTMA 3DBXA 4GBXB 5GSRB 1S4IA 4LHJB 4BBWA 2V2XA 3MRHB 3RL1B 3WN5C 2PXYD 2UYLB 2Y7MA 3DVNA 4Q9CA 1QLRA 2R2BA 1EK3A 2EJ1A 3FTWA 2FCBA 3TT1H 4CDGC 1XGUA 4H20H 3GSQB 4ZAKA 3CXHJ 1QFWM 3IDIA 4UDUA 2ZOLA 5A7BA 2AXJA 1AZRA 4TKWA 2G3NA 2HT3C 5INCA 7FABH 4G6JH 5I9QB 1PS3A 1L7TH 4TRPL 3EJQA 2VDOH 4HIEA 3SGEH 4G83A 5AB0A 4PGCA 1EEUA 3RTQC 2ROXA 5DR5L 2NTSP 1IGIL 2UZXB 4UT6H 3TF7C 4AGQA 1Y6NR 4JW3A 4ZAKD 1QA9A 1QBMH 1URZA 4X6EB 3EYOB 5CSBA 4PJBB 1X5AA 5C6TH 4JKKA 3BP4A 4OCRH 3ILQD 3SHSA 5IG7B 4OF6A 2CR6A 2VABA 5DJYA 2KHAA 5CCJA 3CC5A 3M1OA 1BBDH 4IKLA 3LPFA 5C92A 5JORB 4BUHA 3BQUB 1VACB 2NXYC 4JN2A 4XAWL 1LEKA 2JK5B 2Z92A 3FU7A 3I50L 4GRWH 5F1OB 4NJAL 2DLEA 1YC7A 2WAQA 9CGTA 4XNMB 4ERSH 5CLYA 1JP5A 1JD7A 1M9WA 2JKRM 2YO3A 3CFJA 4QRPE 1N6UA 2NRDA 3HB3C 3FN3A 4ODUB 1Q38A 5E24E 3Q2CA 5E8DL 2XA8L 5IF0A 2J8UA 1FRGH 2WLLA 3S4SB 1HH9B 3D34A 1X5XA 3DC0A 2EDYA 1J0ZA 4YDKH 3ZUNC 3HS9A 1WAAE 4U31A 4NIYE 3DOSA 5K9OA 4EN3A 3ZHDA 1QBLL 4TVPL 2IIJA 2A83B 4W9KC 4S1SL 4LIQL 4Z7VF 3PCYA 4ATTA 1UB5B 4JFZH 4HWEH 4P2RA 1DL7H 5JO5A 4Y4KC 3QPXL 5EZIL 1D7DA 1F3DH 4N9GA 4X99A 3QIUA 2RQEA 3HI1B 1WE5A 1NM4A 2XWJB 2X1QA 4F1SA 4FFYA 2ZX5A 4N2OA 1ORQB 4EF3A 4CW1B 1TEFA 1OGAB 5L0QB 5IBLC 4FXTA 5ALCL 5DUBB 4EN3D 5A16A 3NN8B 3ALXA 4OGYL 2BP0B 2WNKA 2XN0A 3VI3E 1PCSA 3FB5A 1V7ML 4HJGB 2RJMA 3GK8H 4M7ZB 1ZHBA 2W91A 3HNVH 4P3CH 5DJ8A 1YJDC 2C4FT 3ULVE 1YEGH 1DDTA 3V0GA 3GZOA 1JG9A 4W4OC 5I74B 1DLFL 4KY1H 3RWDA 1PG7H 4TNGA 2CNYA 4JFEE 2WQSA 3K71B 3NIFB 2ZSWB 3RUGE 4TSAL 3QNZA 1MAML 4PRAA 1OSZA 1FGVL 1BQSA 2FECI 3EYUL 4E5XB 3FUJA 4NQVB 3L3DB 3QDJB 4OIIH 4QT5B 2BSTA 2VAAA 3CDYA 3W3BA 1A7QH 2A1WL 4GO6B 4P4KC 1X3DA 3RVTD 4XP4L 1E28B 4LPUA 1FC2D 1ZHLB 2VERA 4NO0B 2GSGA 2IAMA 2CR3A 3SJVB 5J13B 4QHKI 2ATPB 3JTTB 2ZOTA 1UQSB 1WD8A 1X6NA 5C0CE 3US9A 2PTVA 4NYLA 2VJXA 5DS8B 2P7TA 3V0DA 4BZ2A 1RJZA 4LLVB 3FONB 2DQ6A 1BYNA 4A7VA 4PWKA 1AS7A 2K7QA 4GAYA 5GRVL 3CMOL 2XZCH 2O61A 1UT9A 2EYSB 5HY9B 2ICWB 1E4WH 3U4BH 2IAMD 1BZOA 1FPTH 2G3ZA 3QA3A 4IKNA 3T3MF 35C8H 1OB1A 3PJSB 5M95B 1DVZA 3C5SB 5E6SB 2VTFA 1NCDH 4XMXA 3CVCA 1V05A 2F61A 1ZA6A 3V0IA 3HC0A 4PP2A 4AJ0A 4AMKL 4DKEL 2JI3A 3QK0A 5E8EB 1T83A 3F7RA 3MBEA 1ETA1 1CD0A 1O7DC 3V0EA 2ATAA 1WEJL 3PWUA 1NJ9B 5EUKB 3I75B 3IDGB 4I18B 4Y16B 1N5AB 2K7PA 2X1OA 4TPRL 1HK6A 3ARRA 4JL2A 5FGBC 4IRSA 5AZEH 1JE6A 2DOCA 2EECA 1B88A 5KSBE 1VFBA 2GSIA 2PO6A 4RDBA 5DVOA 4N26A 4L37B 2VXQH 2F5BL 1IAIL 1U9KA 4OFPA 1AH1A 3OKLA 5AOZA 1BOYA 4M3HA 2G75A 3IAQA 3MRMB 1DANU 1QSEB 3MRFB 4UM8B 1ZVNA 3UTSB 3MBED 4ZPTA 5F96L 1W8NA 3EYQD 1MHEB 1MLCB 4U6XA 3VNZA 1A4JA 3FHAA 4WI4A 4EI5B 4IRSD 3TL5A 1GA2A 4D0DB 3GBNH 1RZJH 1P4UA 2PO6D 1GZPA 5EU5A 4MJ5B 5GGUB 2B8OT 4PIBA 1KB5L 1YDPA 1PZBA 4ELKA 3LNIA 1JWMB 4YHLH 4QF1B 4ZFQA 1KEMH 4J3SA 2XXFA 3BKYL 1RZIA 3IDYB 1ED3A 3PGFL 4TNEA 1YN6A 3JTSB 3RU8H 3LKSA 1RZ7H 5I16B 1M6OB 5HXMA 4FQXB 3RFRA 2OULB 2GTWA 5D1XB 4MA8H 1RV6X 3S97C 2LU7A 4CADB 1NICA 2JTDA 2P26A 1TQVA 2LAAA 3KPSE 3PXLA 2OTWB 2ZF8A 3C60A 3J2PA 4JANB 2WAHA 4FQLH 4A2EA 2KC0A 4WZ9A 2H8PB 2IADA 3ALWA 4WHDA 1BCIA 1JF1A 5F44A 5BRZB 1T3FB 5GRUL 2DMKA 2G2RB 2ZUYA 3MPCA 3QH3A 1S7XB 3MJ8B 4I85A 5F9WC 4M00A 4AM0Q 1SF5A 2DB8A 4NKDB 1PZAA 1TZIA 4PRPA 2VR3A 5T5NG 1U30A 3QDGB 3VG0H 3HFMH 3RIAF 1I8KB 3FDWA 1KCUL 2R7EA 2IBBA 3KH4A 3C60D 4YL4A 3RWFB 1KBBA 1OP3H 4X4YB 1ZGLM 4HJ0D 1TQSA 3BVXA 3D18A 3GMQA 4HAFA 3ARFB 1RERA 2Z4TA 4UOQA 1U8CA 1U91B 3S4SG 3N06B 5CKAA 2ZWYA 1AZUA 3N3EA 2E74C 4HUUB 3T4YA 2WWKO 1PKOA 3ZDYB 4WDIA 3UX9B 5JPMB 3IDNB 4KKRA 1B9KA 2G9HA 5E2TH 2Z8SA 1A66A 2FAUA 1BJ1H 4UV7L 4HS3A 4J3UA 1UG9A 1U8PA 1ZLUK 2W9EL 2WINB 4JPKH 1NBYA 4V11A 4ANUA 2R9HC 3ZYIA 2N1TE 1M7UA 3ZDXE 4AYSA 1JF5A 3VFOA 3KLAA 3PQYA 4FEIA 4AIZA 4AYBA 5EIIA 2J57A 2WVVB 3HI6L 1KGCD 4H5SA 3ESUF 3SGDI 4FTVA 3B7RL 5ETUB 3ABKB 4QTIH 3RL2A 1FNAA 1P5VB 2ETWA 2W65B 3QFDA 4JZJA 3FFCE 3CX5K 4L4JA 1O7DE 4MKTA 4WKZB 2VDRL 2VL4A 2DQEH 5K33A 5AQ0A 1JK8A 4OUUA 1Q9WA 1T1ZA 3CFIC 1SYSB 4QXTB 5EOTA 4QY8A 2QPSA 1DDHA 1GC1L 3SPHA 4DZ8A 3PQYD 4Z7QE 5HSFA 4O58L 3AGVA 5FWRA 4RH4A 1SJHB 2DWDB 4FTVD 4UMGA 4E5XG 3LV3A 2ZJSL 3CHSA 1FNSL 2DQUL 4O51A 4BK5A 4LDLB 3X1GA 1DHKA 2X4SA 4N20A 2A9NL 3H56A 1EEYA 2CK0H 1XIWB 4X9HA 2BW4A 3F04A 1H8LA 3O2WL 5GRWA 3DYOA 3VM7A 5DQ9A 3UMTA 2ZAIA 4NM8H 4FQHA 1ID5I 1PPIA 1KIPA 2H2SD 2IWFA 3G7TA 3BH9A 5E6IA 3BZEA 4BFGA 5AFAA 3ZRSA 2J21A 1TLKA 1BW8A 4HUWB 3C12A 2OYLA 3FT0A 1MZYA 4PGDA 1FFPA 2HH0H 4NGHL 1MHCB 4IBQA 4OZGF 4TL5A 2XETA 3KR3L 1G0XA 5MHSD 3WCYA 1COBA 1IU1A 3T6ZA 2YFNA 4Y2DB 4XO3A 3ZK0A 3O2DH 3MJ7B 4MSWA 2X1WL 5E6ID 2JCCE 1E6OL 5EF2A 2XTJC 4BZ2L 1KGIA 1TZHB 3LSOB 2YAPA 2N7AA 3TF4A 2QR0B 5FAAA 3GJFH 1JFQH 2EKSB 1HNYA 3AUWB 3LEXA 4KU1A 2C3HA 3FT4A 3QRGH 5E4EB 5F7KC 3VXSB 4CVXB 1B2WH 3GMNB 5H8DA 3M46A 1SLWA 4QRBA 3CZSA 4B5EA 4KJWC 5JIHA 3QJRB 1E9OA 2PR9A 1D5IL 4KXBA 1RL1A 3V9EA 4E41A 4NQXA 2UXVA 2O6FA 3K5SA 2H1PL 4JY5H 4RQQB 3RVXC 2DIBA 1PAZA 1CK0L 4H8WH 4LSVL 3DDFA 5CWSB 4XO5A 3T0XA 2YD4A 3SO3C 2QT6A 4HX1A 4EI6A 1SLVA 3DTXA 2GK2A 5IJKC 1A6VL 4HIQA 5DK0A 3TTSA 2A9AA 1NOAA 1I7RB 3D69A 2HFGH 1NCAL 3NCCB 5F7LB 3WNIA 2NY3D 4NI3A 4E41D 4ZUVB 2XVBA 5IY5B 1A5FH 1UVQB 4AH2B 2XWBA 3TEWA 4HUVA 4GIAA 1HIMH 1PFCA 3EO0A 4O9HL 3O41B 1DJGA 5DVPA 4MZIA 2DLHA 4LPYA 2CLZB 1XHHA 2DEWX 4QXUL 3SYCA 5ID0A 4NRYB 1BFOB 3B3BA 3JV6A 1UATA 2N7BA 5H35B 3M1BA 4JHVA 5TE7L 2XZQL 3X3FH 1O6SA 1T21A 3PG2A 4K23L 3VXUD 5D1ZI 3AU1B 12E8H 3GMMA 2YA2A 5DO8A 5MP6L 1IC0A 2NY6C 5FLVA 3MRLA 4DN3L 1EERB 5D7LB 3LKRA 5DVLA 4WF7A 3DX4A 1PL3A 3APCA 3VI4B 2A9BA 3K2KA 2ESVA 2P46B 4ALAH 2ZOKB 3I6KB 3C2AH 3GJEA 3EJPA 2B4CL 4KAQH 4EIZC 2VXUH 3EXLA 4TUJB 2Y7SA 1WAAF 4U1JB 2HG5A 5I1GH 3ARUA 3KLSA 4LK4A 4QGYA 1JZ4A 2GY5A 3I9GH 2IQAB 4Y9CA 1TFHA 1MCLA 4LAQH 5C9JB 4QLRA 5GRVK 3VB9A 1O9WA 3L3KB 2JKXA 1DFXA 4PBXA 5E6RB 1KOAA 1DSYA 3WTUA 2GBVA 3EDJA 4KMTH 1NLBL 4K7PX 2ESVD 2AQRA 2ITEA 2SEBB 3TO4C 4GY4A 1TTFA 2VSKB 4OSUL 5KSAC 1I7TA 1NGPH 2XTSA 1SDDA 4ZMZA 5EZJA 1S9YB 4Y19B 1W0WB 3WY1A 1T20A 1KPUA 1QPPA 4FA6A 3MCG1 3VFNB 3EFFB 4ZPVB 3Q6GL 4IOFD 1F58H 4Z95H 4PVNA 5E08L 1BSIA 4HKBB 3K80A 1BM7A 3FU8A 2CA3A 2K78A 4P5TA 1THCA 2EIMB 2F1EA 2IANA 3ULVF 1YLBB 3MHZA 2R0LL 1PD6A 3BUDA 3F5WA 3OBAA 4HD9A 1NGWA 3BCFA 4DEWA 3NFSL 2WZAA 2M8XA 4PRDA 4PJ7A 4OM0H 3BEVB 5EU6B 4JO8A 3RUGF 2XTJE 4GP4B 4K94H 1I3RA 4TUOA 1FZMB 3WLBA 3VJ6B 4FJYA 4AZ8A 3BSZA 2ICCA 3I3EA 5GGVL 3KYOB 3G6JA 1IGTB 1QVOA 1WA0X 4IK6A 3VRIA 3MOAL 4P5TD 4HZLB 3SZ6A 1ZE3H 2IAND 3WYRA 5T3ZE 3BSHA 4PG9A 3HG3A 3FQ4A 3MCYA 2IG2L 1FFRA 1EAOA 1OF2A 3IGUA 4LOFA 1B0GB 4X7TB 5D7JA 3D48R 4L1SA 2CUAA 4H8UA 3EH4B 1A3RH 4X83A 2ZCKH 3X13A 4MNQE 4XVTH 4K3GA 2ERJB 2Z7WA 3L1FA 1E50A 2YQ2A 3QZMA 4XP5L 1CLOL 2YK1L 4XPHL 4NWUH 3S8FB 1UKQA 4RFNB 3RWIA 1J5OH 1CZ8L 3MO1B 1T4KA 1YAIA 4UT9H 1UZ8B 5E03A 3T1FA 3TVMC 2V7NA 1FJ1A 1JN6B 4R4BA 3TCTA 5D7JD 2VZUA 4N8VA 4YHNB 4A7GF 4M62H 2JMRA 3QDAA 4CUCA 4WLCA 5FKPA 5JHLA 1ZA3A 4U6TA 5CP3A 3MCLL 5TDOB 1ZIBA 5DJ0A 3PGCA 4AIXA 2BVPA 3DKHA 4UAHA 5I8EB 1G9NL 2FX8H 2IEPA 4IU3B 4OKVA 1JZJA 4Y4FC 3UBGA 1QSFE 3BUQA 3WKML 3AT9A 3HN5A 3MNWA 4E42B 1ZCRA 4G6MH 4RDQF 4U7SA 4QUOA 5JW3L 1HINH 2X4QB 1KBPA 5JLZA 1J8RA 1YMMD 3FTYA 4PJHB 4G8FB 1HU8A 3ES6A 3SDCB 1DVQA 1MY5A 3IF1A 4H4NA 1XGZA 1G7MA 1T0MA 5KSBF 2O5YH 3CVIL 4BHUI 4FZ8H 1A9EA 3W5MA 5KG9B 1FNEB 4PGBB 1DBBL 3N1QC 1CL7I 1MLBA 3BOVA 6PAZA 2MQ0A 1WFOA 2DMCA 5B1KA 1VFUA 1HILB 1F4XL 4ZXBC 3TBSA 4B9KC 3HNSH 1DVXA 4WK2B 4PSRA 4K7PH 1QFHA 4DSYA 1PQZB 3BZFB 3UDWA 4ORGB 4GXFA 1YA5A 3TJEH 4G5AA 5J1AA 2Y6SC 3U79A 3OKEB 4AJWA 4KHTH 3NRPA 3VI3A 1TG8A 5EZOH 4X7EC 1JGLH 2ENSA 3Q6FB 1FYHB 1KEGL 4JVWA 1IQDB 4HHGA 3B2VH 3Q05A 5BOJA 4M1DH 2IXQA 1N5YL 4PJCB 2V17H 1J5CA 4PD4J 4XPFH 4J7RA 2HRLA 1JNLL 2G2PA 4K71C 4MA1B 1WFUA 4X6CB 2R69L 4F9LC 2F7OA 4NIKB 3M7OA 4JFEA 2KI6A 3DUUA 2WZPA 5GPRA 5FXCH 4X8CA 5HGHA 2QMKA 3A24A 4HKZB 4JRXB 4PJAA 4BWUA 3FTXA 4LU5L 1A21A 1N68A 2X4UB 1EPFA 6FABL 3TZVB 1TYJA 2FJFA 3WN5A 2EH7H 2NDFA 3MODL 2FECL 5AENA 1M7IA 3STBA 3BN9D 1OSEA 1WZ1H 3G08A 2GJ6E 1ZLWK 5KOMC 3JV4B 1ZT7B 1HE7A 4JFED 2HLFC 4NO5B 2MCMA 1CYGA 4KJYA 2WZPD 1JAEA 4NZ8A 1FFQA 3IDJA 3N0PB 3NCJH 5H4YA 5C0CA 4YDLB 4RGMB 1YG9A 5H2BA 4RVBA 5C7XH 1BV8A 2YZ8A 4PRIE 1ND0B 4XC3H 2AQNA 4KZEH 3RWJB 2BHYA 4AUJA 1YN7A 3KPNA 1KYAA 1KN4H 1JPGA 1CPUA 4HLJA 2KDYA 3DHMA 4L29B 4KKZA 1UCBH 3UYPB 3NPSC 5EH1A 5I1LA 1MVUA 3WNPA 2OR7A 4G7SB 4NQSB 3TC9A 4DGVL 3GLAA 4OJDH 2HJFB 4ADGA 4G6KH 1X6LA 5CJQL 2P28B 3BH8A 4W9GC 5C0CD 3U6RA 5ISZA 5JMRA 2HJKB 5E7BA 2GC4C 4Z18A 4XH2A 4EKJA 3ILPB 3QS2A 3DGCR 4NC0B 2BWIA 4ZSOE 4NQCA 4YBQD 2OP4L 5GJSL 4Y5VC 3T3PB 2A9ML 3CJJA 1WA2X 1XR8A 4Z7UE 1EGJH 3GFUA 4PJDB 2OMZB 4Z7QF 5HHQB 3IYLW 2EIDA 4AXWB 5ITBH 5TE6L 5ISZD 4MQSB 5KSBA 1KUMA 3NSDA 4V1DB 3GXTA 4AEFA 1YPZE 1EHLL 2V5RA 1L9MA 4EIGB 1ACCA 5HDRA 3QWQB 4NQCD 4BK8A 2R4SH 4Q8BA 1WRFA 4J3BA 4YDIL 3ZSSA 5EF1A 3IBOA 3HIZA 3PWNA 4Y4KA 2BVEA 4Z7NB 4JO2L 5CN3A 4ODVL 2PR4H 1SY6A 3H3PL 2OFQA 4JFPB 1N2RA 3NFNA 2CJ3A 1LYQA 1QRNB 2OTUB 1E4XL 1IT9L 2E7MA 2G0KA 2VZTA 3W56A 2E76C 3IDMA 4CBZA 1C8PA 3MBWB 4EI0A 5IOKA 5DRNA 2F15A 1BZ7B 3CUPA 4U1HA 1BPLB 4N6QA 1GGIL 3F7VB 4NZRH 4ZODA 5EBWA 3BQVA 1EZVX 1GOGA 1KIUA 5FV1L 3LHAA 3ILEA 4XCCL 5HYEA 3U0TB 1RPQA 4TMPA 1W0VB 2JCCF 2OL3H 4Y4KD 2MCG1 1U3NA 3KPSA 2GBUA 2VLKE 2NY4C 2Q5BA 4Z3JA 2DI7A 4GQ9L 1GGBL 4N6RB 1G6RB 2FL5B 3EHBC 1S7QA 3EG9B 3LXUX 4Q56A 3NJNA 4AG4H 2VN5A 2AANA 4W4OA 4LCYA 1FWXA 2RFXB 3I85A 4YO0B 1MNNA 4P07A 3FZUC 1YNKH 4N25A 3JWOC 4K8RH 4HXBH 5D1ZD 4AT6B 3UAJD 3FO0H 2EEBA 4X0NA 3QJZA 2WKOA 5IEHB 5A2JH 5FYKD 2Y2YA 1WITA 3JWDL 3LPOA 3OLIA 4ODXA 4Z3EA 2DLFL 2VDPL 3UZVB 4XX1E 1PCXA 2YD7A 3ZL4L 5GGRY 1ZK9A 1OM3L 3RB5A 1EXUB 2P45B 4JJ5A 1QNZH 1E8WA 4P2QE 1MWAH 2GPZA 2RCSH 1MZZA 1JGDB 5DTFB 5JA8B 4KKAC 3P02A 1WD9A 3QB7C 1XSIA 1XF5A 1RURH 3TO2B 1EJOH 4U1MA 1CDYA 1I9IL 1J1PL 1TT6A 3FCUB 3PWPB 4LLDB 5KJ4A 1C12A 3FRUB 4I2XE 4JRYE 3SIKA 3ZSTA 5GISH 2YFOA 4W6XB 2IDUA 4DP2X 1HSAB 5BV7C 3HRZB 4P2OC 2KQMA 1WWBX 3ETBF 3NG5A 4NRXA 4OTXH 3TA3B 4U0RC 2OW7A 3P9MB 1U8HB 4D3CL 2P5PA 5I0XA 1QYGL 2D7QA 2ZKHL 2LOEA 3HZMB 3H0TA 1B4RA 1X9LA 3QYCA 4P49A 1C5CH 4JAMA 5IJVB 4I3GA 4HBCH 5L4JA 3BIAX 2XU9A 2AKRB 2MWCA 4JHWL 1HCZA 1DTUA 2CGRH 2J72A 1QNIA 2EILB 4MX7A 3WTTA 2WWKT 2C9RA 2N3JA 1UA3A 2WTOA 3HAEA 1QLEB 4JREC 1A6WL 1JGVL 4L4VB 3H9SE 2Y36L 4OIFA 2AQ3A 1GHFL 2P47B 4KROC 2ZUVA 3BN3B 4LEXL 3V10A 5I1HH 2NW3B 1QMUA 3ZT6A 5FGBA 4X6DB 3TYGH 4DP9X 5SWQB 2OCJA 5TH2A 1LQSR 4RSVA 3MRGA 1UWEL 5EA0L 1F6AA 1DQLH 1RULL 2CBMA 3QCUH 5E56A 1A6TB 3RLSA 1OGTB 3LQZB 4Z7WA 3ZU8A 3THMH 3RDTB 1WHOA 1HQ4A 4WHCA 4ADIA 3QYMA 5F2FA 1MF2L 3APDA 4HHAA 5J5EA 1D7BA 4IQHA 4W9IC 2F58H 3C75A 4W81A 3BWZA 5FYLD 4OLUL 2VJ8A 1DLHA 4LQFH 4HKXB 1HVXA 2ZP9A 1G7QB 1PBYA 4KDVA 3UTZA 4K5OA 2ZP0T 3LS5L 3FSOA 1T7WA 4EOWL 4NSKA 4MA3B 4KXZH 5K1VA 4FP8H 1EFXB 4UI2A 1D6VH 1A22B 1N7ML 1XF4B 1XVSA 2ZSVB 3MRKB 4HISA 3NCYP 4XBPB 2WUBL 4UYPA 2P3YA 4YHML 2EIZB 1JZ7A 3C08H 2MCAA 4W93A 5IHUH 4BHUA 4L05A 3POCA 4NFCA 1NIEA 3AGWA 3GGWB 3BWUF 2ZWNA 2BINA 3TN0B 3DXAE 4OZHA 2R2CA 4V2CB 3D6GA 4W9CC 1UKSA 4AL8C 1IARB 1ZK5A 5AKSA 3S5LB 1A1NB 3KS0H 2FHBA 5C0GB 3AXIA 1HT6A 2EEXA 4I5BA 5LG1A 4G80B 1EO8L 1A4KB 3NJMA 3Q01A 4GI9A 2IGFH 4GW1B 5C2BH 3O6LH 4FKEA 4XP6H 2XN2A 1Q9KA 4ZQKA 5DEJA 3MLSL 5BO1H 3A67L 1HKFA 5F7DA 1I3VA 4YK4C 2DQGH 3X14B 9PCYA 3NDYE 1S9KC 2HSIA 2DH3A 2ZOWA 3V52H 1TFPA 3O3AA 4GP8B 2F8XC 3NQIA 2QVTA 4LVNC 2RGSA 2VOTA 2GVYA 3WHXA 4U1NA 2HLAB 3HE7C 3GBMH 3V4PA 3U9UA 1LDPL 1CR9H 1A1OA 1BAWA 2E6PA 2JKSA 1MJ8H 4GEIA 2HX7A 4GPVA 1CI5A 1JHKH 4PWFA 1CO1A 1WT5C 2E4TA 4ZOAA 3EF4A 1CBVH 4CU7A 3WO3B 4P3DB 4PJ8B 3U46A 4UQAA 3MUGB 3BHBA 3RYMA 1U3HA 3QAQA 1BLNA 2UXFA 3OM3B 5IK3A 4HKJB 1TNNA 1MAJA 1MEXL 1EHKB 3NSCA 5FYJD 1NFDE 2GIMA 3OHXC 3EGXB 1BFVL 3MR9A 2FYYA 2ZCHH 2N0MA 3DK0A 5DJDA 3EO1A 3F7YB 3UH8A 4O2EB 1H9DA 2O5XH 3RE0A 1ZT1B 3Q9QA 1PZ3A 4GUCA 2D7TL 3OL2A 4QTHA 3B2DC 4N68A 3ZQWA 5FYKL 2V3EA 3QZWB 1P7HL 4OQ1A 1HOEA 1U3HD 1ET8A 1NPNA 1J5IA 3ZQXA 3DVGB 1JZDC 5DS2A 3MRBA 3MLZL 3IK2A 1WJ3A 4XNZC 5K59F 5J6GA 4MCZA 4UAOB 4QHLB 3O6KL 3OJDA 4OB5L 4XMPL 1BQRA 3ZGIA 4JKLA 3D87B 3HE6C 1AE6H 3VWJA 4N5EC 5DQJB 5LGJA 4WWOA 4P5KA 1AIFB 2MEJB 3ZT5A 4Q0XH 4PQXA 5EDXA 5CLTA 1Y18B 1HL8A 4UTBH 4L3FA 1Z9MA 2R2HA 3E8VA 3MV7B 3KL0A 2PWGA 4KUCF 2GIXA 4PJ5B 3VX1A 5D7KE 3VWJD 5I8CB 5TK4A 2WYHA 2QPFA 2ZXBA 3COOA 1ZPUA 3B7SA 1FI8C 3C5ZD 4FLOA 5GS2H 2XN1A 4O5LL 4UYQA 3KWXA 4AX3A 1XF2B 4KKLC 5AAMA 1GRWA 1JS4A 3WFEL 1TETH 5ICUA 4FHKA 2A0LC 2JWYA 3MA7B 4DAGH 4IOIB 3KPRE 5DD6A 5IUSA 3CU1A 15C8H 3T0AA 1ACZA 1KACB 4U33A 1FC1A 3GSOA 4PS7A 3TOPA 3F00A 1MFCL 2W80C 4DGIH 2NY2D 5HPOA 1JMXA 4TTDD 2DQIH 3TPUA 3PNWB 3KDMA 2J55A 1YY9C 5D7SL 3SE3C 1OANA 2W60A 3DBXB 1S3KL 2V2XB 3FFDB 4GQRA 4WQOA 4PBWD 1QLRB 1TTBA 1DSWA 4AM0B 4HC1A 5IJKA 3QIBA 1YUHA 5T3ZD 3TM6A 4OFDA 3IDIB 2V7HA 2PETA 2ZOLB 1OHQA 4YSOA 2WQWA 4KJWD 3V2AR 5FYLL 1XD1A 4PLJC 4UB0L 1XWVA 4BFOA 5INCB 5F93C 4BFJA 4BYHA 3VGGA 4CMMA 1I1AC 1RIUH 1SN0A 3V6FA 4GOSA 3RVXD 2Q8AH 5GZOC 4WAFA 1BF8A 4E36A 3HUJE 3RNKB 4RFOL 1GGUA 4KPHL 3S9DB 1RPKA 2FUQA 3RGVC 1BOGB 3M8OH 5I8KH 1LP9B 1NCNA 3QIBD 2AJUL 3MV8E 1AZBA 1RVFL 3ARGB 4KC3B 5L9DH 4YE0A 1MAKA 1C7TA 3BP4B 4HJJL 2VDQH 4Z7UF 4JO3H 1FQ9C 3CXDL 4X9FA 3HOGA 2VABB 5DJYB 3CC5B 2AK1H 4L1DA 3GMPA 1OZUA 3MDJA 1JGEA 4F8QA 1NGXA 4IGBA 1YEIL 1UWGL 3VFVA 2WXOA 1LEKB 3DGGB 5G5DA 2Z92B 5E2WH 3AG2B 1Z5YD 5DFVC 1SEBA 2YXWA 4RMQA 1M7XA 3BPOC 3L3OC 1OB0A 5D2LA 1I1YA 1PZSA 2HVKA 3MNDA 4HWBA 3LS4H 3SQBB 3IKKA 2AQ1A 4GO9A 3S5LG 1X4ZA 5FA3A 1NCOA 1CXLA 1Z5HA 1RZGB 3VXPB 3QUKA 4MD0A 4WW2C 1M42A 1YEDA 2J8UB 2G30A 3WUWB 3WNMA 1CL7L 1T5WA 7PCYA 2HTKC 1YEEL 2WLLB 4IGBD 3F58L 1IZKA 3U7AA 3AADB 1G43A 4NP4L 1M1XA 4R8WL 2AXFA 5KSAA 3DOSB 4EN3B 4BH8B 2FWLB 2WIMA 1W72B 1F0LA 5AZUA 1UASA 3MZGB 4P2RB 4QTFA 3FQWA 4RLDA 3K8KA 5E9DD 3LXCA 1AZNA 4N9GB 4X99B 3QIUB 4HPYL 1UWXK 3D2TA 5LDUA 4O02H 3B2PA 4GEJA 2Y3AA 1WZAA 2E46A 1D5BB 3E1ZA 3BAWA 5ALBH 1MHHB 1KTLA 2J1ZA 2XWTB 2Z7YA 3L4VA 5KSAD 5CEYB 2JJSC 2OMVA 2VDRB 4NUPA 4KZCA 1HXMA 3FPYA 2MPAH 1FFOA 1TZGL 1L7IH 1T6WA 2P5EB 3QHZH 5HHME 1QI4A 5F71A 2E7CA 5FYJL 1MDTA 4BUGA 5KW9L 7CGTA 4OZ4A 5F8QC 4ZYKB 2EZ0C 3V4PL 5J6HA 1UXWB 3LQAH 1IAKA 3WIFA 2Z91A 4A7SA 2AW2A 5EBMA 3H2WA 3UGEA 4MGXA 4ONFH 4GUOA 4R2GC 3RWDB 4KV5F 1GPOH 5F3HB 2XBZA 1YYMH 3ABGA 3QUZB 2BJMH 3M07A 2GJ6A 2VH5H 2ZPKL 5CHNA 1OSZB 5EPMA 5HHVL 5ENWA 3V7AE 4QOKB 1K72A 5K9QI 3QZWG 3LIZA 5CCKL 3EFDL 4K9JA 1KXTA 4L18A 1BX2A 1X4XA 1JZFA 3QC6X 2GTZA 4QRRB 3SDXF 1T2QL 1QO3A 3P4OA 3E8UH 1U8KA 2EXYC 3TVMA 5BPPA 2F7PA 2H2PC 2GSGB 5HDBF 5F9AC 2F68X 5F0LB 2IQ9H 2UXGA 3LEVH 2D9QB 4BA8A 2P7TB 3FH5A 4F20A 1S7TA 4NQDA 1CVRA 2NMSA 3CFBA 4IIQC 1E5BA 4AQZA 3QJXA 2OI9C 4ORZC 4FAAB 5GQBA 4Y4FA 5T1KB 2O61B 1R47A 4ZSOA 3TVMD 4E68A 4GSUA 2OR9L 2QZ5A 4JPIA 5AZ2L 1T5KA 4Z7UA 1G6VK 4CILA 1OB1B 5JR1H 2BSRA 4HH9A 3DX9A 4NQDD 3O6FC 3HNTL 1RUKH 2E75C 4CNIB 4IBWA 3HC0B 1YPZA 2EE9A 5F6IB 4Y4FD 1NBZA 1SXSA 2EDOA 3LJ3A 5KYUB 1Q1JL 2KERA 1JL8A 2NY5C 1TITA 4S2SB 3MNVB 5J3HC 4LFHD 2J43A 4IRSB 1H8OA 4ABUA 3O81A 3RX7A 3SE9H 4NPYA 2GSIB 1F00I 4XCFL 4ZXBA 1XTLA 2CLVA 1SJEB 2DH2A 3OKLB 5EOQH 5I5IA 3SD5A 3HC2A 4LSTH 1IAOA 1MI5B 5T3ZL 4ZMWA 2J44A 5FCUH 2DM7A 1ZDQA 4PW9A 5D1QB 5IBUB 3IAGC 3IE4A 4KOBA 2LLGA 4ZPTB 4YR6A 3V8CA 1AFVH 1WBXA 5FIEA 4FXKC 5INDA 3TXAA 2DYRB 5ABZA 4G3YH 5I17A 2EVGA 1X9QA 1XZ0B 3B2UD 1W6LA 3GM0A 4K7FA 1GZPB 4HIXH 5EU5B 5JW5A 4J3TA 3SBQA 1BLIA 4ZXBD 1P6FA 5GS1B 2Y07L 1NMAH 4LL1A 4WFFE 2G60H 4WFEE 5TFSH 3FQXB 1SOQA 1I3GH 2XACC 1E4HA 4R97C 1ED3B 4R7LA 3B3IA 1A6AB 3CSYA 3B2MA 1QFPA 2GTWB 3MRCA 3FBQA 2V5MA 3EGDA 3E7JA 3T5WA 3ASNB 2M1KA 1KJVA 5TE4L 1H3GA 2GW5A 4PN6A 1MCDA 3QUXA 2IADB 2ZWZA 4PJEA 4AMXA 1JF1B 1NBVL 1IIIA 4UTAA 3S34H 3BW9A 5KAQF 1J0KA 1S7SA 1WBYA 5EZLB 5TQ2H 4A6YL 2EIBA 3MJGX 4PRPB 4S1RH 2EXWD 4P2QA 1CFNB 5GGSB 3V8OA 3W5NA 1BD2B 1Q9OB 4JFVA 1ZVSA 1PEWA 5C0IA 4HWUA 1VF5C 1Z9NA 2R7EB 4ISVB 3T2NL 5AB1A 1FO0B 4I2XA 4JRYA 2KZKA 4EZLA 3QUXD 1FVDB 5DFWH 1X44A 3K2UH 3D18B 3GMQB 2YWYA 2V8MA 1U8CB 3GS0A 3AROA 2AEWA 2X0WA 2XPGA 2Y1YA 5B3NA 2ZZUT 4AGLA 4L3CA 2VW6A 1MDAA 5IOPA 4WDIB 1LNUA 2V5YA 3MXWH 1P7BA 5IQ9A 3NP3A 3QJSB 3C9NB 4JRYD 1VLXA 2NSMA 4HS3B 3F83A 3V4VB 4TULH 5IHZA 1X9RA 1FN4A 2W0LA 4IDJH 1OKEA 4IKIA 5HHOA 3AREB 4S1QH 4FLQA 1CWVA 3PY9A 3IN0A 5HD8D 3H9SA 1DCLA 4Y5VA 1LE9A 1WS7A 4LQ1A 4AIZB 4EBQL 2BNRE 3A47A 2QLYA 3T3MB 2VKXA 1UM5L 1U6AH 2A9DA 5DI8A 1QBAA 2R0ZH 3P0VH 3P3UA 5B4MC 5IMMA 1AS6A 4BWTA 3B1TA 4ETQB 5KJRH 3QFDB 4JZJB 4M61A 1CGXA 4U49A 2H32B 5HHOD 2PLTA 4MDIA 4YX2H 3P9LA 3VH8A 1JK8B 3QEQE 4OUUB 1Q9WB 2W9DH 1IKOP 3H9SD 4OR1A 5EOTB 4QY8B 3BAYA 1DDHB 4DZ8B 3VDBA 1MRCL 5AW5B 3VQ1C 3VD1A 3QJQB 5D4HA 4L9LC 3FB6B 3LV3B 1CGVA 4O51B 5CSGA 4N3UA 4YQXL 2OBGA 3QWOB 4DGYH 1EEYB 3AVEA 3LEYL 3Q06A 2FBRA 2ICES 1Q4NX 1U8JA 3RGBA 3EAKA 1S7WA 5GS0D 1FVCA 1PZ5B 3IGFA 4YXKL 5DQ9B 3M86A 4GAGH 2BSSA 2R2EA 3GXUB 3NAAL 1O0VA 4XWOD 3LIZL 1Z5LA 4JPWL 2EE3A 5DLMH 5E5LA 2YLKA 4PGDB 4F2MA 1M53A 3ETBJ 3U1PA 4OT1L 2AXGB 1GGYA 3RBGA 3VW3H 4WEMB 3IU4L 1TEYA 3GSWA 2YD5A 3LKPA 4FE9A 5GZND 4QNPE 3KAAA 1IE5A 3DXAA 1RUMH 1NAMA 4Y1AE 4AQAA 3TONA 3ZIYA 1R0AL 4X5LA 1NLDH 4AENB 1CE6A 2JKJA 3IN2A 4MJ6A 1F11A 1AGBB 2DL9A 2EDTA 1IJ9A 2NY4D 2L7UA 2IOIA 2DTSA 3NDZE 1BGXL 5EOCL 3FT4B 1VJSA 3EHBD 4OF0A 3LZNA 5BZWA 2C9QA 5I2IA 3D39A 3DXAD 1J8SA 4UZUA 3LXAA 2YGVA 4M4PA 5I1KH 2WJ7A 2H5UA 3AY2A 1E9OB 1KT2A 3SYOA 1SMOA 2GAZB 4JG1L 4E41B 4NQXB 1AXSA 3VFSA 1THAA 4UANA 1BMZA 1C16B 3QXAA 4XNUL 4AZUA 2R23B 3GSRA 1L9TA 4H88H 2RA1A 3ZE1F 2CKBB 4LSDA 1LWHA 4AI7A 1EZUA 4XN8A 2GFBB 3TP4A 3ZUCA 1F6LL 4EI6B 3DTXB 5KZCB 2CHXA 4GMSH 4RMSA 1OL0A 3D39D 5DZVA 4Z8FH 5IBUG 1JPTL 5E8NA 1G7PA 5DZLA 3SE8H 3NJXA 2AXHA 4KK5D 4Y8AA 5GSVA 1MWOA 4Y5YC 3BT2L 5FGCE 4JQIH 3W0WE 1IC5H 3MFFA 4PMEA 3DI3B 4P9MH 4IHBA 1NFDA 2XWBB 2XV6B 2ATKA 4JFDE 5AWNH 3PYCA 4M1GL 5J11C 3AITA 5BQDA 1J8HB 3JV6B 1D5XA 4KVPA 1WICA 1A9BB 1OAUH 4PJXE 2LHAA 2ZXCA 3I9AA 4UT7H 4NQTA 1T21B 2E47A 4XGZB 3I2CL 5EULV 1AS8A 5SV4A 3QGVA 2OLDA 5F7EH 1OD7A 4KTYA 4ENED 5I6KA 1QLFA 4DZBA 2AAAA 2YGQA 1Q0XL 4HUMB 3SGJC 4BDVA 2ESVB 3L5XL 1C5DA 1KGYE 1LO2L 5D96B 3MV9B 4GG8A 4M3JA 4QJ4B 1AP2A 5CEZE 1I1CA 2K4AA 2D03H 2AI0L 3ZKSD 3P2TA 4WUUD 4XCNB 3VGFA 1UA7A 3FSAA 2DI9A 1XEUA 4ZO8A 4J6RL 5JW4Q 3ZQ9A 2ZIDA 2FZ3A 1T03H 4OI7A 1CTNA 4OQTA 2RACA 4B5ZA 1XFPA 1GAFH 4QXVA 1KPRB 4UTAL 1S8DA 4RBPK 3OG4B 4HS6A 1YNLL 5LAXB 2ZUSA 4ERSL 4OM1L 1ONQB 1FNHA 1QKZL 4XMWA 5MERA 1H3TA 4B9YA 3MZTA 3EJTA 5EN2B 4ZD3H 3GEFA 2FJGB 3C8DA 3B5HA 4QCIB 3LZRA 5MEQA 1M6UA 1T20B 1KDJA 3NMEA 4U1IA 1KPUB 1G1CA 3U0WL 4Y4HB 5T1DH 1XCWA 3OB0K 1F2QA 1O75A 5T1MA 5FFLA 1AHKA 2XCMC 3WFBL 3CZFB 1T2JA 4OZGB 1G9HA 4TQ8A 1RMFH 3KPRA 4MB1A 4KRNA 1RIVH 4JFZL 4LSSH 1DL7L 3F5WB 2YA1A 4M6NH 4XOBA 4FFVC 4M8VA 4POUB 3IWVA 1MKFA 1U8IB 2AQPA 4LKXA 4PRDB 4ZZKA 3IM1A 3DRTB 1TQBB 5AVQB 4I1RA 5T3XH 5DHDA 2DYPA 4BINA 1I3RB 4XBEL 3S0PA 5CINH 3RWHA 5EIIG 2IH9A 3WLBB 5D8JL 1KPVB 1WYJA 5FUOL 3BP6B 5HPMA 4R0LC 3G6JB 1QVOB 1WWCA 2YN5A 4KI5C 4ZS6D 2DLIA 4YVNA 4R96A 5KN5A 5I1IL 4LCIL 2IPTL 4X9GA 3WXWH 4DVBB 1OF2B 2NT0A 4OFKA 5D7JB 2DYPD 1XEDA 2DAVA 1DJSA 4GO8A 5F9JA 1PZDA 1TYEB 5GJTL 4JNXA 5K9JH 3S2CA 3QW9A 1H19A 1F90L 1EANA 1ESOA 2CO7A 1OVZA 4PRNA 4XPGH 3HE7A 4Z3IA 2OAAA 2XN9E 3L3JA 4K2UH 4U6VL 1CFBA 1CIUA 1PLGH 2DM3A 1LQBC 3BPNB 3HUJA 1JV2B 4JUSA 5ECJE 4AITA 5GS0L 3T1FB 1NSNH 2XA3A 1CU4L 2NW2B 1WT5A 4I18C 3MV8A 5DUPH 4R4BB 5C0AE 1TTGA 4M1CC 3CLFH 1MCOH 1FNGA 3QUMA 4HUXA 1J86A 4HALA 5FKPB 3NFPB 3WIIH 1ZA3B 5IB3A 2X4RA 1AY1L 3OHXA 3EZJB 1MUJA 3UC0H 2BVPB 3ME0B 1OAKH 4AJVA 2VRQA 4OKVB 2Z93A 2HKHL 3O8XA 1MY7A 5IW1B 3L3IB 3DURA 3WI9A 3NCYS 1UA6H 4GS7C 3FAWA 4TLSA 5KBPA 1AVAA 1LK2A 5EIVA 1P7QB 2C4FU 2WBJD 3RPBA 1BEXA 4PV1C 1O7VA 4KX9A 4QRPB 3ES6B 1ZLUH 2IH8A 3PWJA 4YH6A 1T0MB 2IMNA 1ZWIA 4PEEA 5I30H 5E1IA 2RH0A 4WW2F 4J1UA 3U4BL 5E23A 3UYRH 4G72B 2P42B 4UQCA 3IDYC 3O8XD 1A9EB 3ARDB 3JWOL 3N1GC 4XB8A 3HE6A 3FYIB 1NAML 3NRQA 5D1XC 4B3EA 1MLBB 2HYMA 2X53A 5GIRA 1E9PA 2D73A 2XY2A 2YARA 1EFQA 4AJYV 1CFTA 4C59B 4QMEA 3WHE1 5AKTA 2VYRE 4KQ3L 4G82A 5I1DA 3VQLA 4XNXL 4TRPH 4NZDA 3GC3A 3WGVB 2NX5A 1E3XA 1ZTXE 3DROA 5DDHA 3HE6D 4H25A 2ARWA 2YD2A 2L4OA 3ETTA 1IGIH 3FUEA 3IXTA 1VESA 5DR5H 2ZUWA 4E9RA 5J1AB 4N5ED 4EE2A 1TIUA 5AVUB 1R33A 4LMQE 3BGMB 1V3JA 5DC0A 4G5ZL 2QV4A 4OCYL 3VI3B 3WAJA 1E9QB 2JLPA 3D85B 1HL5A 1Z32X 4WGVB 2QMJA 5I71B 4D0BB 4MD4A 1N0LA 4XHJC 5BV7L 3FCGA 3ARFC 4NO3B 3ZKQD 2EKJA 4HIHA 2IXQB 1M7DA 1QEWA 5FHBL 1JZ6A 1DEDA 2FHFA 1QR4A 2NX5D 2WSDA 4O4YL 3T6QC 1XGTA 4B9GA 4XAWH 3VDAA 3KPOA 1QOKA 4JFEB 3I50H 3QNXB 3RUGB 4NUGH 1ZT4A 4JFUA 4NJAH 3WUZA 1IM3A 3SPVA 4ZO9A 4BH7A 2C1OA 1KBGL 2CRIA 2HT2C 4DPCX 3FL7A 5HGHB 3FT2A 5KVFL 4KKLD 3SE3A 3RU8L 2A0LD 3RQ3A 3B6SA 4TSBH 4M4RB 4E2OA 1W91A 3WN5B 4L8SC 4MA8L 2XA8H 1NDMA 2X42A 1ETZA 1M7IB 3ARPA 4ZTEA 2SODB 3I74A 1JYNA 3G08B 2CKNA 3IETB 2NY0D 2H6OA 1IM3D 1QBLH 1XTMA 3HN8A 4TVPH 2UX7A 5LXVA 5C0CB 4S1SH 5FA4A 1I1AA 3JVGC 4LIQH 4DP0X 1YY9D 3L13A 5H2BB 5CFAA 2DMGA 3W9DA 3QPXH 5EZIH 1SQ2N 4PB9H 1TJXA 3RTQB 3DIDA 3V4LA 3HFML 1ZS8A 3RGVA 3FCTB 1HL9A 5DJXA 2QKSA 4XODA 3Q1EA 4GKZB 4KQ0A 1ODAA 1AD9A 1JHTA 4XVOA 4OQTL 4HLZG 1SXAA 1KCBA 1JOIA 1KB9K 5CJ8A 4LBAA 4OGYH 3U6RB 1I1AD 1JIBA 5C07A 1WFIA 4J8RB 4K9EC 4LEOA 4HH8A 3LCYA 4WHTB 4AQ8C 4Q97A 5K9KA 1TMCB 4XH2B 2CH8A 2AQ2A 1V7MH 4X9BA 4WI3A 2NXYB 3OKKB 2NR6D 3WS3B 2VLLA 1KN2L 3UO1H 2VDNL 3RGVD 3HZ3A 5SWZE 4BJLA 5E2TL 1E5CA 3Q3GB 4B27A 1WQVT 3QDME 1DLFH 1UKTA 3B7UX 4U3HA 1XR8B 3QUYC 5F7NC 1TKWA 3HB3B 4TSAH 1MAMH 4ZFZA 5C07D 4ONOA 3BVNA 2OMUB 1F1GA 1FGVH 5KSBB 2CALA 3D0LA 3EYUH 1B90A 3D1MC 5KS9E 4YSDA 3MFGB 2QPUA 3RWEA 1JPSL 2IC2A 4FGMA 2Q8BH 2JLLA 1JZ8A 2MQGA 2NUTA 1KBKA 2B0SL 1IL1A 5DFVD 3S37L 1JWUB 1E7VA 4GRMA 5HHPB 4XP4H 1ZANL 2AABL 3PWNB 3CFEB 3LAFA 5GGRA 1MQ8A 3US0A 2BY0A 4L5FL 3T09A 4JFQA 4KWUA 3TBWA 3OKNB 5KTEL 1FSKB 4DTGL 2WY3B 1XCQB 4WGWB 4QNPF 1A47A 3IDMB 4S10A 2J6EA 2VDKL 5HVHC 2JJSA 3CMOH 3CUPB 1RZKC 3H3KA 1A4CA 2IMMA 3O11A 4A39A 1KIUB 4C8XA 3D2UA 4M7JL 4M03A 1CXHA 4BQ8A 4CGTA 3KPSB 3N41F 2X6CA 5C6WH 2A6KA 4XVJL 3FT3A 3I84A 4PS8A 5EORL 4YEFA 3V55A 3LKQA 3S3PA 3TH2T 1S7QB 4UBDD 3QAZB 3ZZLA 4LCYB 2JJVA 1J7VR 3PUUA 2VC2B 3Q1SL 5HYFA 3LOWA 5CGYC 2PYEE 4AMKH 4DKEH 2A73B 3ECBA 4U1LA 4P2CG 4BSWB 4I4WA 3RY6A 4Z0BL 2XPYA 1WEJH 2LFGA 2MMXA 3G5YA 4N2NA 4M5TA 3WIAA 4M43L 1Y1UA 5FDYA 6TAAA 2X0VA 4TPRH 5LWYL 3AS0A 3FBKA 1VGKA 4P4KB 1YRKA 4G6FD 3CVHA 2F5BH 3HR5A 3K74B 2VDLL 1IAIH 4JJ5B 1H8NA 3IXAA 5A3IC 4GW5A 3SDDC 1TQCC 4XOCA 1OPGL 4G8EB 2YQ3A 3Q8AA 2X5PA 2XNAA 1DVYA 1X9UA 2A77L 2AGJL 3QSKB 1Q8MA 4FQQA 4X6FB 5F96H 1C12B 1TJGL 2J71A 3NA4A 5AW0B 1NC2A 4IIQA 2V2WB 4WI8A 1XDTT 2OM5A 1CC3A 4NRXB 2BY3A 3BLBA 1CURA 1UC6A 2DQFB 4NLHA 5FO8A 1DJZA 1KB5H 3FQUA 2EXYD 3N40P 3ZDXB 4XN4A 1OT1A 4PHXA 2H2PD 3BKYH 3PGFH 4PJXF 3X3GH 5IHHA 3UIZA 4JR9H 3ZO0A 3VXQA 3MGAA 1E3ZA 1ZS2A 1NC2D 1TJIL 4Y9EA 2Z31C 3EDKA 3O6FA 4AK2A 1U8QA 2CJTA 4AKQA 3K5RA 1XBDA 2BVYA 2EDDA 5DYFA 2BO0A 3FFCB 3V0VA 4I0PC 1ADQA 3FQNB 1OK0A 5GRUH 5IEKA 5JYLA 1CXFA 2VRAA 3QEQA 4WFGD 1C8QA 1KC5H 4HGKC 4KTDL 1NBQA 4I77L 4Z7QB 5HYJE 4N4YB 3UGXA 3AB0C 2VSDA 1XH0A 4F80A 5TH2B 2MHAA 3QORC 2XHNA 3RA7H 3EH1A 4TQIA 1NUGA 3O6FD 1KCUH 5F97E 3P4MB 4PV8B 4APQC 4PLOB 2MH4A 4UIKL 1ZAGA 1HQ4B 2FT7A 3FQRB 3N2JA 3VXMD 3KPMA 4ZMOA 4ZMYA 1I4FA 4B53A 3CZNA 4HHAB 4QHUA 1R5WA 4FXKA 2ICWI 5J3HD 3PP3K 4U6YA 2YSTA 3GBLA 3MOBL 1FUNA 2B15A 1HE8A 2Q20A 1NCTA 1QHOA 1VGEH 4JMXA 2QVMA 3SQOL 1JNNL 3ZW3A 1H9VA 1Z1WA 4AYID 1XBRA 4LAQL 4F9PC 1N26A 4N0YL 5JIIA 4NZJA 1KJMB 2Z34A 3QEGH 5D4JA 3KYMB 1BEYL 4PY8J 5FFGA 4FNQA 2OXHA 4Y1AA 5C0BA 3D0AA 3BD4A 1L0PA 1P7KB 3L81A 2JCCB 4LDEB 4MNHB 3MRDB 5DMGC 3HG0A 4XXWC 4H1LB 4NI6A 1EEZA 3ULUE 1DJHA 2PF6A 1NGPL 3A4EA 2Y1ZA 3KDPB 2NNFA 4YPJA 2XIBA 2VZVA 1ROWA 1T6VN 5F9WB 4JKWA 2H3KA 1N4XL 1T0PB 3DETD 3R0MA 2XWCA 2XQ0A 3GDBA 4JCLA 4RDQG 2R0WL 2VDRH 5C0BD 2ZAHA 2X89D 4Y1AD 2GT9A 4UQ9A 1AGCA 4S1DC 1SJMA 3ZTNL 1T6BX 2NNCA 1GC1H 4N2EA 2RR3A 3NSJA 3QARA 4ZQKB 1Q9KB 4AY0A 5BUGA 4LPTA 2VM4A 2WXFA 3QULA 4F3FB 2C9UA 2DQUH 4K94L 2OZ4A 4IRZA 4NZUH 5HGAA 2A9NH 3FSWA 1XF3B 4YHPB 1BG9A 1QTYT 3KJ6H 1JXKA 5A2FA 3O2WH 1JDCA 1GR7A 2WHVA 3FO9A 4KX8A 1IZJA 3GTNA 4FXGC 1WTGT 2I5YL 4JQXA 4OF8A 2E6QA 3U7YL 2Y69B 4X5XA 3VFGL 4GMTH 4NGHH 2HT4C 3MJ6A 4P5MA 3UJIL 1IBHA 4XC1L 2JXMB 1FGNH 2ZCKL 3KR3H 4XNBA 3POHA 2EXSA 3ROOA 1L5GB 4GRWE 1VADA 3BHBB 3NOIA 2O72A 1BLNB 3F6IA 1F42A 2F54A 5KYYA 1WAPA 2VT0A 5EO9B 1DP0A 4DKFL 5J89A 1E6OH 1P4IL 2AJXL 4BZ2H 4HIIA 1Q0YL 4JRLA 2VDMB 4CBPA 3MR9B 2FYYB 3MMEA 5DJDB 1IKFL 5DO2C 2J6EL 1U8NB 5F9DC 4CVWA 3CLWA 4YWGL 2IALA 2ITCA 2FNBA 5F89A 4PTTA 3CLEL 4QTHB 3WE6B 3N1MC 1RHFA 3HG1D 2B1OA 4IU2A 1NGYA 2Y24A 1MREL 1X5JA 3ELAT 1J0IA 2F54D 3SKJL 5KYWA 1G0DA 3O45A 2ZWLT 4G9DA 1D5IH 3MRBB 1J1OL 4XAKE 5B4MD 3QO1B 2BM3A 4N2DA 3FW6A 1MW3A 2EINB 2B39A 2H1PH 2OMBA 4FXLA 3L2NA 4G6ML 3GIVB 4WTXA 1CK0H 1RZJC 4LSVH 4NXSA 4B0MB 3VSVA 4BKTC 2C3VA 4XOEA 2ZUXA 5LGJB 4M5SA 1S3RA 1A6VH 4P5KB 4A68A 3RURA 3GI8H 1F41A 2R59A 4FLSA 2QGCA 2DWTA 2XLLA 4FZ8L 3CWGA 1NCAH 3BLPX 4GBXA 3IMBA 3RL1A 4UNVA 5CR1A 2IFGA 1QPKA 4L3EE 4QRUB 2BOCB 3CVHL 2WBWB 4JUTA 3L7FB 4L8DB 2R2HB 1BM3L 3DOIA 5CR8A 4RZCB 3L4XA 4O9HH 4OIBA 3DHUA 4W1TA 4AQEB 3C6LC 3CHPA 4WKXA 4QXUH 2E9GA 3HNSL 2XTJB 1IC4L 2AQQA 4LGPB 1EWHA 5TE7H 3QZBA 4GBXD 4K23H 5MP6H 1A7OL 5C0DB 4DN3H 1BA9A 2AEPL 4UQ3B 4JDVA 4KHTL 3QWNA 5DQDL 1J48A 1WDAA 4X6EA 4B96A 1HWHB 2K6WA 5HGGS 3TGXA 2NT1A 4PJBA 2B4CH 3MRRB 3QZOA 1QWUA 2QTVA 5IG7A 3TPUB 3HFFA 4BFFA 2DV6A 5ABAA 1U8LA 4MNQB 2W60B 1E7UA 1SOSA 3IT8D 3L4CA 5JORA 1HSBA 3IU3A 4U3XA 4FJ6A 4GKSA 4HUNB 3SO3B 1XCTA 1MPAH 1G7LB 1NLBH 2OJ1A 4KRLB 1YUHB 3H9YA 4RMBA 2V7HB 3OSVA 5DJAA 4XNMA 2NY5L 2ZTBA 3N44F 3FTZA 4OSUH 4ODSL 1TF4A 3N0AA 4ODUA 4Y5YA 2QKIC 4BEIA 4DP5X 1PMYA 5L2KE 3V6FB 2VWEE 3B9DA 3BQUD 1WZ1L 1HH9A 2QLVB 5CIPA 3Q6GH 1RZFL 3CIQA 5LCVA 3EYSL 3LD8C 5DD0L 5E08H 1NKOA 1QSFB 3RBSA 2A83A 1WUNT 1JMZA 5DRWB 2R0LH 4ZMQA 5HYIA 2HVJA 5BVJA 2EVFA 1VZIA 3NFSH 1OTSD 3ULSA 2ZCLH 3CVDA 3HI1A 3WOVA 1ASOA 2NY6B 4RAHA 1SVBA 2WSKA 4H1LG 4BWWA 3SGJA 4ZNEE 1JGEB 1BREA 2OXGB 3VFVB 3WNLA 2CHDA 5GGVH 5DUBA 5KWYC 3NN8A 3VCLA 2K3HA 3MOAH 1SEBB 3D05A 4MVBD 2BP0A 4KKCC 4Y5XC 5DMIL 3RVWC 1KCLA 2EYRB 2ALAA 1IRAY 1ULVA 2HVKB 2LU4A 2IG2H 2NOYA 2VUKA 4Q74A 3EBHA 4X80L 4HJGA 2UY6A 5IUCA 4MD0B 5L4FA 5EU3B 2OMTA 4A2MA 1OGAD 2QVIA 1F6FB 4XP5H 3TO4B 1CLOH 3B4NA 1J10A 1M1XB 2AXFB 5KSAB 4XPHH 2FE0A 3K71A 4M7LL 4NM4H 4Z5RA 2LU3A 1UJTA 4ZI8A 3FU6A 1CZ8H 3FQWB 4X5QA 3GXDA 3L3DA 4QT5A 3G5VA 2AQTA 2X2YA 3B9KC 3PDOB 4YEEA 3V0AC 4OZIE 5EEXA 4EIBA 3MUUA 1IEBA 2OZ4L 1E28A 3MCLH 4IRZL 1KTLB 2DRUA 1ZHLA 1G9NH 1AD0A 1RY7B 2BIMA 2OMVB 1PLAA 3DOHA 3SJVA 1HH6B 3ROLA 3UROR 3ARQA 1F02I 3MACH 4IOSD 3WKMH 1RD6A 2YEZA 4LEBA 4QAWA 1TZAA 1OO2A 4OZ4B 5JW3H 4LPWA 2K70A 5J6HB 3HRZC 3Q5TA 3O4OC 4ATWA 4DFHA 2EUXA 1X4YA 2Z91B 2Z8VC 5FR3A 3D07A 4BKSC 1NUNB 2XFGB 2EYSA 2BIIA 2V9QA 2ICWA 3CVIH 3QHTC 5FO7B 3TESA 4H8WC 3L2LA 4FFVD 3K91A 4KKBC 5FCSH 4PVLA 3SJVD 4B3VA 2GJ6B 3WFZA 5EPMB 3CK0L 1DBBH 2Q2LA 3OAUL 3QI9C 4TYUA 3PJSA 2VGLM 3C5SA 2WQVA 2Y7LA 2CD0A 5AVXB 4C4UA 3QQ4A 4F5CE 1BX2B 4P4RA 5G2NA 3EXJA 1RK1A 3S6CA 4DW2L 1H3XA 4PRIB 4KI5D 2GTZB 5E8EA 2BDNH 4F57H 1F4XH 1QO3B 4LP8A 4OAWA 3B2XA 1NJ9A 1U8KB 4DGUA 4I18A 3HMXA 2DDQL 5BRPA 3HBZA 3ZR5A 3FMGL 4J3OC 4GAFB 3F2LA 4FNPA 2ROYA 1S7TB 1I9JH 3CFBB 2NXZB 4IMKC 2VSCA 4L1BA 3RX9A 3MRMA 3J8F7 1R1CA 2YS4A 3RDTC 3WIHA 1KEGH 4G70B 3MRFA 2QSQA 1EJOL 2KMWA 1U8MA 1N5YH 4ZSOB 1MHEA 1MLCA 3NCWA 4IBVA 4EI5A 2Z35B 2XBDA 4Y16D 5A43C 4JPIB 1JNLH 1V3LA 4M1CD 5D9SB 5T5FA 2XG5B 2R69H 1BFTA 4D0DA 4QYOB 4Z7UB 1GXEA 4OTXL 5GGUA 4HH9B 4UQIM 3DX9B 1KZQA 1YNTA 3D50A 2EDKA 1JWMA 5CD3A 1YPZB 2YAFA 1QSED 1QUPA 2YD1A 3SPGA 4Z7OE 5KS9A 4LU5H 4HBCL 3JTSA 5I16A 1M6OA 2OKMA 2EDFA 5D1XA 2J6WA 3LB6C 1K4DB 1KTJA 4UINL 2Y25A 4CADA 4EI5D 5HGDA 4DP7X 5C0EA 2OTWA 4JANA 3SBPA 2BNQE 3ZY7A 2BRRL 3N55A 1TUPA 2FSEB 5CD5D 3GSNA 3ETSA 5BRZA 4PCSA 3TCLA 4Y2LA 4UIMA 5FO9B 1NEZA 2G2RA 1S7XA 3U82B 2YRBA 4NKDA 4M5YH 3VRJB 1WPCA 3L6FA 4YR6B 4FQXD 2DL2A 5D1XD 5I17B 1KYOK 1XGQB 3VFWA 4W9FC 4U3SA 3THML 2H3NB 4DGVH 2YAEA 2WQAA 5JW5B 5CJQH 3SBWC 2VLKB 3OX8B 1KFGA 4RAVB 5BRZD 3ARFA 4JPSA 3ULUF 4FHBD 3CV5A 4NNXB 3DPBA 5JIDA 1U91A 2F58L 1UM4H 4PV9A 5I8OL 1FLRL 2Z65C 1AQHA 1FIEA 5F0PB 1EQWA 3TU6A 4GKNB 4K71B 3ISYA 4HUUA 4LQFL 3NJGA 3QDGD 5AW3B 4OCSL 2PYEA 3MRCB 1ZE3C 3P54A 3IDNA 5CP7A 5JPMA 4HLZH 4MXVE 5GJSH 4R90L 2RB8A 3AY4C 4KO6A 2A9MH 1KJVB 2CM6A 4FP8L 4XHJD 4YAQB 5LCVL 5BQ7A 2WINA 3ARFD 1D6VL 4L8SA 3BW9B 5TE6H 3DV4B 4JM2F 2WYTA 1EHLH 4P2QB 3K6OA 1OEZW 4Q9BA 2NSQA 3I02B 1UD2A 2PYED 1BXAA 4U6HA 2YPKA 2WVVA 3QG7H 5C0IB 2JKWA 3KD4A 3ZE2E 1REIA 3ULAB 5ETUA 2HT2D 5GGSY 4YDIH 3JVGA 3CFKA 4AYFB 1OGSA 4I2XB 4JRYB 5EN3A 2E86A 2CA4A 2W65A 3B37A 3KM1A 4ODVH 2MRYA 3H3PH 4KFZC 3TPKA 4WKZA 4QPEA 2Q87A 5DHXB 8CGTA 3EIFA 3NPSB 1EDYA 3CSPA 3GLZA 1Y6KR 1IT9H 5T33L 1WG3A 3E38A 1UURA 5IOPB 1LNUB 1W9XA 3RVUC 4CJ1A 4GRWF 3NGBC 1K5NA 1F1AA 5IVOA 4Y89A 3RY4A 2CSPA 5IQ9B 3HW7A 2FX9L 2HKAA 4XCCH 4AQ8A 4UAOC 3VG9C 4U7MA 3WD5L 4LVOC 4H26A 2WXGA 3DO4A 3PABA 1NCJA 4GQ9H 1GGBH 2FATL 3BLKA 1DZ0A 1TPXC 4X0KA 2D3JA 3H9SB 2FEDD 4LL9A 4TNVF 5FW6A 4Y5VB 2MNWA 1AJ7H 3S98A 2Q2EB 2AV7A 1I82A 2XQYA 4HUWA 5MENE 2WUCL 5HYJA 4FHJA 1QTSA 1DJIA 3SODB 4W9JC 1JHKL 4D9QE 1MCIA 5CP3H 1AR1C 3H6AA 3JWDH 4HJUA 2DLFH 2VDPH 2WOBA 2CCVA 4Y2DA 4MDIB 4AQ1C 3P9LB 3ZL4H 4WEBL 3BESR 1TZHA 3QZLA 1KTBA 5JTWA 2W94A 2ZX7A 2QR0A 2RALA 2ADGB 2NPLX 5HYJD 1A2YB 1P6WA 2EKSA 2ZG1A 2DQCL 1I9IH 1J1PH 4EQ3A 5CKGA 3VXSA 3ABLB 3MTXA 4FJZA 4G8AC 3L95B 1A7RL 1NFIB 3GMNA 3WJLC 3L7EB 3MNZB 1MXDA 3UG4A 1P5UC 1M05B 4Y2DD 5J7CC 4NAQA 2VR6A 1B4JL 1FVCB 4OV6F 2CK2A 4D3CH 2R2EB 3BKJL 4X8JA 3F3HA 1Z5LB 1G5AA 3LZOA 4LPXA 4BRVA 1NPUA 4NPKA 3GRBA 2LVCA 5CWSA 4J4PA 5IHBA 4FLHA 3O4LE 4JZOA 3VXSD 3ESMA 3LKPB 4JHWH 5IVZB 1KZYA 1AQMA 3BFOA 1NMBL 1I53A 3DXAB 3HMXL 1I7RA 3K2MC 2H6UA 4NZTL 4PVMA 4M6ML 5DZPA 4AQAB 1A6WH 1UWXH 1JGVH 2J4WL 2JKNA 3SGDH 1CE6B 2Y36H 4FL4C 4UTBL 2NQ3A 4ZUVA 1QX1A 1GHFH 1NQBA 3VTMA 3WEBA 1UVQA 3GF8A 3OGCA 3R4RA 2BCMA 4AH2A 5FUCC 3CZUB 4YPGB 3WIHL 4J4PD 4WY7L 2Q76B 3O41A 2MOGA 2IBZY 2NY1C 4NRYA 1BFOA 1Y7VA 1L9SA 1UWEH 5EA0H 3QQDB 3UBXB 1QR1A 1RULH 2Z0BA 5H35A 1Z9SB 1JGUL 3SDDA 3GS7A 3ZKMD 4LLWA 3P11L 5T5FL 1GW6A 2P5WE 3E1F1 1KT2B 1N0XL 1R24B 3PV6B 3AU1A 4HF5L 4DAGL 1DQML 1MF2H 5D7LA 5HVFB 3D12B 5IP4A 2A4EA 3QXAB 5JA9A 3VI4A 15C8L 2ARJB 1LE5B 1BQHB 2AJ3B 4OLUH 2ZOKA 2FB4L 1DVFC 4P2OB 3P3TA 4N2LA 2XT1B 4U0RB 4TUJA 4U1JA 4BXSV 4FS0A 4YOKA 4GUPA 1XZWA 5A3ID 2IQAA 3LS5H 5E8NB 3SDDD 1G7PB 2OSXA 2YLHA 1KY6A 1L0YA 5C9JA 3PPSA 4EOWH 4AGOA 5GSVB 4TQPA 1MCRA 1N7MH 2YAMA 3CH1B 3GSNL 2VQ1B 5D7LD 4YHMH 2WK2A 4DCQB 2WUBH 5AVSB 3GKZA 4J2XA 2Z31A 4JFXB 4MQTB 1A1MB 1NFDB 2R51A 2ATKB 5T8IA 2WSPA 5E7FA 4Z9KB 5HI3C 3R18A 4JREB 4I0PA 4Y19A 1W0WA 4S0HA 4PUBH 4S11A 4M02A 4N90D 4KROB 3RY5A 1KXVA 4N8UA 4BZ1A 3VFNA 3EFFA 4ZPVA 4MS8D 5DFTA 2D2OA 1P9MA 2Q86A 1QLFB 3QORA 1ZDSA 5E70A 4BDVB 3TS8A 3GXFA 2FK9A 1EO8H 1C5DB 3GUTA 3UAEA 4GG8B 2IV8A 3SPJA 4APQA 2LU5A 3PXJA 4XX1G 2YD9A 4OCWL 1OAZL 4I0PD 5C09E 3SOTA 1F3JB 2E4FA 4JO3L 3BEVA 4NT6B 4Y19D 5EU6A 3SSGA 3L9RA 3FT1A 4POZC 4POYA 3A67H 1FZMA 3QBTB 4JFHD 3AG3B 1XSKA 1RLWA 3VJ6A 1GGCL 3DTUB 1E2WA 1YVLA 1J9RA 5E2WL 3VFTB 3BD3A 3D7PA 4ZOBA 4QO1B 1S8DB 2BMKA 4HZLA 4OZIF 4CC4A 4HS6B 4QRSB 2B14A 4L3EA 3VGDA 5JIPA 3CCHA 4KRPC 4Z7AA 3AWFA 4APQD 4F9PA 2I60L 2EDWA 1LDPH 3QUZC 2VZ1A 2ZKWA 5IMOA 1U33A 4X7TA 5EU6D 5TPWL 4BUQA 4P8QA 1C1EL 4U1IB 4ZW7A 4LHUA 4K8RC 4XXWA 4KVNL 5E95B 1B2YA 2HTLC 1MEXH 5E1GA 1QD0A 4L3ED 3KPRB 3K6NA 3MO1A 5I1JL 3DX7B 1BFVH 1JN6A 1T7YA 4BE6A 4LKXB 3D08A 4PRHE 2WCPA 4FKKA 4A66A 3ISRA 4LNVA 5DK2A 2X4NA 5EV7A 4LHUD 2D7TH 4K9EL 5TF1L 1A8ZA 5DMGD 5CZXC 1WBZB 5ALBL 3BVVA 4X4ZA 5FUCE 5FYKH 5HPMB 4GXUM 5I8EA 3CFTA 5D70L 2X05A 1SUHA 4BELD 4XTRC 2TAAA 4Q58C 2MPAL 4R96B 3MLZH 1GY1A 3NJLA 4YK4B 4E42A 4PY7A 3O6KH 4OB5H 2YMOA 2TSAA 4XMPH 3MRIB 3LQAL 3VH8G 3NIGE 5C1MB 3UACA 5F9JB 3SDCA 3FFOA 4S1DD 3K8LA 4JB9H 4F7CB 2CO7B 4G11A 4FXGA 4GQPH 5DHVA 1QABA 3HE7B 5I76A 3BVTA 1YYML 4F1ZA 1HYSC 2Y1AA 1KJ2B 1GOHA 1TO5A 3HUJB 1FNEA 4I9XA 4PGBA 5KG9A 2QQLL 1XB8A 1XF1A 3QO0B 3E3QC 3L1EA 3UAFA 4XXCA 5FECA 3MV8B 2ZONA 3DMMC 1OWRM 2P8PB 1G0YR 2OR8A 1FNGB 3QUMB 3JV5A 3DYPA 3SDCD 2UWEE 1G1KA 4UOJA 5IB3B 4BFKA 2AITA 5JOFA 2KQNA 2XC8A 4O5LH 2GABA 1MUJB 4R6UA 4Z23A 5CF3A 1TZOA 3WFEH 1EHNA 5EEYA 3BZFA 3HJEA 4ORGA 1JFHA 4LKCA 1LEGA 2YXMA 3TWYA 2VXQA 2E7BA 3IFOA 3TYFA 3UZEC 3SZKC 2F53E 5GRJL 3IJYA 1LK2B 1IGML 4G8GE 1KWGA 3Q6FA 5FKAA 3AU0A 3FQYA 1IQDA 1RLBA 2WVSA 1MELA 5GS1C 2ZX8A 3TJHC 4PJCA 4TLUA 1KGWA 4AV0A 4XNZB 5ICZA 2J88L 3MJ9A 2QQQA 5D7SH 1Q94A 4XXDB 5DO2D 1S3KH 1YQVL 3HAEH 1YZZA 3UBXG 1ZV5A 4Z3FA 3N6YA 2C9PA 1C7SA 1E9PB 1X5MA 5JZ7D 3NJIA 5EUOE 4NBXB 1CFTB 4JRXA 5C08E 4OLZH 4H44C 4YN3A 1NWPA 5FYLH 4UB0H 2X4UA 4H7VA 4NS0A 2EIEA 1JZGA 2KLSA 2DZEA 2B59A 2O5NA 5I1DB 2NZ9C 1BQHG 3GSVB 4CSSA 2R4RL 3CHQA 3L4ZA 2FO4A 4CC0A 3C8KB 3DROB 5DDHB 3ELQA 3MRQA 5JMOC 3JV4A 4P48A 4H8HA 4OIAA 4RFOH 1E6JL 4NO5A 4KPHH 1OOWA 3GNML 4XMUA 2AJUH 3EJZD 1P4LB 1RVFH 5CU5A 5HHMB 1P4BL 3GBDA 4JRXD 4F2EA 4MXVF 4K0OA 1K4CA 1MFDL 1X5ZA 4HJJH 1PZUB 3FTGB 4MD4B 1N0LB 3RWJA 1JYXA 3BAIA 5HBBA 3CXDH 2XYBA 1QEWB 4G3YL 1G9EA 4L29A 2X12A 3G6DL 2AK4E 2FX7L 4OKDA 1XGTB 1NC4B 1UWGH 4EUPH 3KPOB 4MB5A 4NQSA 2Y7OA 1IEAB 2HJFA 2MOVA 5K9QG 3OXSA 4F7MA 4KZDL 3SPVB 4BH7B 1MSPA 1BZ9A 3ZE2F 3NH7L 2WXNA 3HCVB 1MFAL 4AMWA 5TFSL 5IJBC 5JQ6L 1SBBA 2F8OA 5D5ME 2AAVA 4F5CA 3ILPA 3NZHL 1SHWA 2XG4A 3F84A 2H47C 4CVUA 2A2QT 5K5YA 1CL7H 1NAKL 1YEEH 3F58H 5EMYA 3D06A 4BZ1L 4GNKB 4Q9RL 2R15A 4NP4H 3MLXL 2Q6WB 4R8WH 1ANUA 3VGEA 2OMZA 4I3SL 3IAPA 4YDVB 2QKIA 5FA4B 3KGUA 1SF3A 4KH9A 4V1DA 1I8AA 1WK0A 4JE4B 4S1RL 2QZQA 3IDXL 4AVKA 1IAIM 3OAZK 4HPYH 5DXWA 2WKGA 3E3QE 3RGVB 1IBBA 1SHSA 2W5PA 5DJXB 4NP9A 3WDIA 4XPTL 3CN1A 2DBJA 4QRQA 1YEKL 4MMZC 4F58L 1N64L 4G2AA 3MLYL 1WAEA 1AGEB 2VM3A 1KTCA 4JFPA 1TZGH 4V1DD 2OTUA 3PV7A 1QRNA 3VB8A 5FYJH 4ANXA 3DVFA 5LAPA 2C26A 3SE6A 5EC2B 5KW9H 3V4PH 2CGZA 2E0PA 5E94A 2L8AA 3MBWA 5D71L 1Z6JT 2VLLB 1BZ7A 4Z7VE 1FORL 4PWGA 3L3OB 1EXGA 5EU4B 3U0TA 3P0GB 4CGUB 4FQIL 1E42A 1I8LC 1RU9L 5CUSL 2ZPKH 4HS8L 5HHVH 5JHAA 3MCKA 4OVVA 1G6RA 1QRND 2WOYA 4WW2B 4OGZA 1BYPA 2RFXA 5CCKH 5D93C 3EFDH 2XKNB 3RWEB 3U6XS 4KJQC 2GJZB 1PEZA 1IL1B 1U6AL 3RVWD 2XV0A 3K4DA 2NYYC 5JOPE 2K9UA 1T2QH 2QTEA 2CO2A 5IEHA 2NNAB 2FGZA 5KJRL 2ADFH 3UZVA 3WEAA 1JUFA 3B9KA 1B6UA 5E9NA 3PL6C 3F6JA 3NA9L 3S2AA 4Q14A 2W9DL 2O26U 5I6PA 1EXUA 2MTAA 5ANHA 1JGDA 2C3XA 1MCPL 2B2XL 2YOCA 2C4XA 1FBIL 3O11B 4PW3A 3SB3A 4OZFH 3MBXL 3PWPA 3D2UB 1EMTL 3FRUA 1AO7E 1IBGL 3P4NB 2OR9H 4JRFA 1Z3RA 1HSAA 2A6KB 3B9KD 3FT3B 2Z7UA 3HRZA 4J3XA 5AZ2H 1B0IA 3LKQB 1FLTX 1BBJB 4LSUH 3P9MA 4GAGL 4YSUA 3HNTH 4R2GB 3WKNA 4MJIE 4ABWA 2J5WA 4JZNA 3U48A 2EABA 3ECBB 3ESPA 3QT2A 2WD0A 3OB0H 2X6VA 2X4TA 3PWPD 4WNSA 2AKRA 3G5YB 3QI9A 4E9YA 1G94A 1YUKB 4RRPA 4M8QA 4M8RA 2QVFB 4DK3A 2F74B 1NM9A 5BUAA 1O9VA 3TA3D 2IGTA 1A7BA 1BIIA 4XCFH 5FUZL 4PR5A 4RX4A 4PG2A 2XWRA 3IXAB 4GW5B 2LE9A 5I19H 4KKBD 4K3JL 5T3ZH 2XNAB 2NW3A 4E9XA 3ECWA 3WJJC 3ZE0E 4X6DA 1VCBC 4FQQB 2JQAA 4I3RL 5SWQA 1BAFL 4NFDA 1OTUC 4QLWA 2DTML 5I1EL 1IGFL 3FRPA 4OCMC 3MJ9L 1A6TA 1OGTA 2BSEA 2OI9B 1E30A 1A7NL 2MCPL 3RDTA 3PXHA 4MA7L 2GCYA 4ZBJA 4RX4D 4KDWA 4JS7A 3KVPA 1DQVA 5FO8B 1USZA 2Y07H 3FQUB 3HG4A 2LTQC 3MTRA 5LVEA 3CFCL 5E1HB 4J3OD 3FCSA 4ZW3A 2BNRB 5MENA 3VXQB 4PSPA 2GEQA 4NX0A 8PAZA 1G7QA 3CFMA 3F7QA 4X5WB 4KK9C 2Y1VA 1U8QB 2XQYK 2HRHA 3T8MA 4R4NC 2BSED 3RDTD 5IBTL 5TE4H 4E9VA 3R7RA 1G7JB 4MA3A 4KOCA 3DTDA 3V0VB 1NBVH 4NCDA 1PAMA 4XP1H 3MRKA 1UOWA 4A6YH 5IEKB 3QEQB 4FI6A 1WSST 3HG2A 4FFZA 1RIHL 5MEND 3ZXAC 3V7AG 7TAAA 3ARBC 2J25A 3OJ2C 3RAJL 2JJTC 5E99L 4W6YB 5EFIB 1ETB1 3T2NH 4FKHA 3TN0A 1OAUL 2DIJA 4XB3A 4ADJA 2P48B 4L48A 1A1NA 1R5WB 4FXKB 4WTZA 5C0GA 1YY8A 3FC8A 1GJUA 4G80A 1A4KA 4GW1A 2UV3A 2WIIB 2L04A 5DHMC 2EIKB 3OSKA 3SBWA 5JDSB 2QFRA 3DJRA 3D25B 4MRCA 3TN0D 5DD5L 3X14A 4IIZA 2ENYA 4R97B 1AG0A 4C55A 2AP2A 5GHWL 4RGOH 3QFGA 32C2B 2OXHB 4Y1AB 5BCAA 3AJ7A 2I24N 1T1YB 1VHPA 4BSJA 3AY4A 5J06A 1JPEA 1EEZB 4X98B 4C56E 4EBQH 5E1AB 4NHUB 1GZQB 3FJTA 1GYUA 4ZZFA 5BZXA 3H2QA 5ADPL 5E51A 4P3DA 1N9PA 2QGBA 1UT1A 2A7BA 3MUGA 4XP9L 5F3FA 2EO1A 1M9SA 5L88L 2O6CA 4ELDA 1CDIA 1AGCB 4PW4A 3NIGF 1X5GA 3CSFA 5LBVA 2MKWA 2XKUA 3DLQR 1J9SA 4HSCX 1MRCH 3OR7A 2HFEB 4KX7A 1F3DJ 1O5PA 1VFAB 2OMXB 3F7YA 4MJHA 2A4CA 4O2EA 2AS5M 3QULB 1ECZA 4YQXH 5LLIC 3CPLA 2Y5EA 5HGAB 1R34A 4ODTL 2WO4A 5TTRA 3LEYH 4YLQT 4ZO7A 1RP9A 2X3BA 2Y23A 4JDZB 2IDQA 4YXKH 4XE5B 3U0PB 3WKYA 3DVGA 3TCXA 5EG6C 1G6RL 5FGCB 1OM9A 3NAAH 2UWEF 2WMPB 5DRZB 3W0WB 3LIZH 2MIZA 3UADA 4QHLA 4KXZI 1TOXA 2EDXA 3ARDC 3UP6A 4JFDB 2YGPA 2EDNA 3TEUA 1KBVA 4P5MB 1R19A 3IU4H 2C34A 2ZKYA 4IJ3C 4JFYB 4K5PA 4DWHA 5DUJA 3ROOB 4JCWA 3ORJA 4PJXB 4RNRB 4RMUA 1AIFA 3RVUD 4K2UL 5J57B 5KYYB 5DJZB 1R0AH 1T1WA 3V6ZA 1Y18A 4HHWA 4OCXL 4MQXD 4IDLA 5SX4I 2V9TA 5JXEC 3EJRA 3MMEB 3MV7A 3K2IA 4TOYH 2WANA 1MCOL 3MRNB 3S5YA 3K1DA 4ONGL 1XMEB 2BY2A 4TQHA 1BGXH 5EOCH 4AQ1A 2IALB 2DWXA 4B60A 3RZCC 2DQMA 5I8CA 4PTTB 3NIDE 2R8SL 2B9AA 1I8IA 4RGNC 4IU2B 1XF2A 1X5IA 5E8OA 5I71C 3EF7A 5KYWB 3O45B 4M48L 4L9LB 4G9DB 4WCYH 4JG1H 4IOIA 4NCC1 2W8CA 1LO4L 4QR7A 4XNUH 3MV7D 2YHGA 3ZIMA 4BIKA 1EAPB 2PWHA 4PJ5D 2C3VB 1RSFA 4D9RD 1JRHI 2I26N 1L9OA 1SYVA 3V4UL 1KGXA 2KH2B 3IDUA 1E2ZA 3VE0A 2WP3O 1FL6B 1JPTH 1N8ZB 2F5AH 3OF6A 2X41A 5C0FB 4ZW6A 4OH2A 2OJZL 2VLJE 2CMRL 1CQYA 1SBSH 1SRDA 3FFDA 1AKJB 1QLEL 1WZKA 3BT2H 3G5WA 3A6OA 4XVUD 2YUWA 4AM0A 3LNGA 5IW3A 3BAKA 3CG8A 4KNUA 3HPLA 3ISWA 4M1GH 1S5IH 5B7EA 4FC3E 2NZIA 1WTLA 4DQOH 1WIUA 2A4ZA 3Q13A 4PRHA 3WS6C 5C0JA 1II4E 4RFEB 4DF9A 4XRCB 2XX1A 2J7LA 2CXGA 3OF6D 4OLVL 1C08B 5H4ZA 3I2CH 3RNKA 3P40A 2FT8A 5D5MF 3U25A 2PMZA 1BOGA 2E9JA 1LP9A 4XNDA 4JDVB 1Q0XH 3ARGA 3L5XH 1LO2H 3AQZA 4MASA 3TEXA 2AI0H 4IK7A 4KBPA 1PX8A 1LD9B 5IESL 4AUYA 2E7LC 1U8LB 4J6RH 2HRGA 3IGKA 3Q8CA 1HSBB 1KCSH 3IU3B 3DGGA 1DVFA 2XN9B 4GKSB 2BVOA 4NUGL 1XCTB 4UTAH 1TTAA 3ARGD 1G9ML 2HLEB 1YNLH 3GXPA 5DJAB 2APVA 4OM1H 3QPQC 3E6FA 1QKZH 1CYXA 3C09C 3SQBA 3NSFA 3HC4L 4FFZL 5C0AB 4M7LT 4TSBL 4Y5YB 3VXPA 1RZGA 3H9HA 1CGYA 5ERWA 1A6ZB 5H37H 3H7BB 5I0YA 3CXHK 1WA1X 1I1FB 4ZMNA 1XL4A 3ABZA 3U0WH 3MYJB 3K6FA 3P3YA 3WUWA 2FRGP 2D2CC 4PCKA 3V0HA 4N87A 5ILTL 5CIPB 4MJ2A 5J11B 3WFBH 4B9ZA 1RQ5A 5J8OA 4LCVA 1U2YA 4BH8A 1CTMA 1ML0A 4N0UE 1W72A 3AQXA 2LABA 1DVUA 4UOZA 4PJFE 1S9XA 2HVJB 5BVJB 2F53A 4PBVC 4FABH 4PB9L 4M93B 3ULSB 4G8GA 2X3AA 2LGNA 2W95A 3EO9L 2HRPL 1FSKC 5T5NF 4XBEH 1B3JA 1Y07A 1D5BA 3QCTL 3ZHFA 5D8JH 1MHHA 5FUOH 1RJCA 2XWTA 3IPBA 5CEYA 1SFHA 4LSPL 5HI3D 3VCLB 3VXNA 1OTTD 3ZGHA 4WWPA 1SZNA 2XY1A 2P5EA 4MAZA 4P2RD 2DKMA 5DZOA 4RGNE 4UQBA 1DQQA 5I1IH 2PKDA 4LCIH 5AOLA 2IPTH 4KO9A 3QIUD 5EUOA 4ZYKA 2HMIC 1UXWA 1S9WA 5C08A 3MOQA 2UY6B 3UO1L 2OMTB 5GJTH 3ZTJG 3QAZC 1AI1L 4OJAA 3U1SL 2OMYB 2BP8B 1BJ1J 1F90H 4Y2OB 4U0QB 2UX6A 3QQNA 5F3HA 1FZJB 5KBDA 3QUZA 1HHHB 4EDWL 4U6VH 1KCRL 4Z5RB 3NCMA 5GS0H 2BZ7A 4AV4A 2P5ED 4QOKA 3N9GL 3LIUA 4RMRA 1CU4H 3KHOA 1T5XA 2VXSL 2EE0A 2FD6L 4I0CC 3G5VB 5D72L 3L1GA 2Q8BL 4DPRA 3LPGA 2KDGA 4QRRA 4XZ4A 1LMKA 1IEBB 4HWZB 3DX2A 3B8SA 4YSRA 3STLB 3DIVA 1AY1H 1HC1A 3QUZD 2AK4A 1AD0B 3PP3H 5KBNC 2HKHH 1U41A 3N5AA 3ROLB 4QOKD 1DYZA 2VQTA 1CG9A 1JNHB 2YEZB 4TLKA 4X7FC 1NKGA 3VWKC 5I24A <