4JGNA

Crystal structure of rna silencing suppressor p19 with 1nt-5'-overhanging double-helical rna 20mer puug(cug)5cu
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
125
structure length
125
Chain Sequence
HMTSPFKLPDESPSWTEWRLHNDETNSNQDNPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFFGFDQIGCTYSIRFRGVSITVSGGSRTLQHLCEMAIRSKQELLQLAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Procrustean bed of RNA silencing suppression
rcsb
source organism Tomato bushy stunt virus
molecule tags Rna binding protein/rna
molecule keywords RNA silencing suppressor p19
total genus 39
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2013-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1810 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4jgnA01
4J5VA 4JGNA 4JK0D 1RPUA 4KQ0A 4JNXA 4KTGA 4KNQA 4J39A 1R9FA
chains in the Genus database with same CATH superfamily
3RWJB 4DKTA 2P9RA 2ENYA 3CUPA 5EU3B 2FGWH 5C0CA 1MG2C 2ARJB 4YUEL 5FEBA 4BQ6A 4KDTA 4X6CE 4I89A 1RUPH 1HQ4B 5DK0A 1KBKA 3NMEA 5J56B 4IOIA 3SGEI 3QJRB 3MR9A 4G43B 1AY1H 1MWAL 4OU3A 4PMFA 2KT6A 2B1AL 2YKLH 2VLRE 2G5UA 1HE8A 3PV6B 2Y3AA 1A5FL 3QZLA 4HAKA 3UG5A 3QDJA 5I1JH 1HYSC 1R34A 3H53A 4G5ZL 5EFIB 4Y2DC 5ERWB 2VO5A 1MDAA 4NWUH 3IDYC 1CLVA 4ZX5A 3MV9D 2NMSA 3RX5A 3VH8G 1EGJA 1IGYB 2NQDA 2KMWA 4HCRL 5FX3A 4HIEB 2K6ZA 5IOKA 1QLEH 3WLWD 4IMKA 2V7HA 4KRNA 2J5LC 4D8PA 4X0KB 4LCWA 4XGZA 2X9XA 4A7UA 4HUVB 2X1QA 4F7PA 2H41A 1FL5A 2BP0B 3V0JA 5AAMC 3TN0A 1OARL 2Z91B 4BXSV 3ECBB 4UQIM 4BK8A 4I2XB 3H1ZA 3P3RA 5CBEA 3FOLA 3WOVA 3ZQ9A 1Y18B 4EPSA 3QC5X 3FO1A 3MGTA 2BNQE 2B9AA 2DYPB 2K3HA 4RFNC 1YQVL 3VD9A 2LU5A 2C9UA 2E4TA 4GRWB 4KKLD 3A6CL 3ZTEA 2DN7A 4HC1A 4GINA 3CN2A 1EDHA 3STZB 5DFWH 3CZSA 4MD0A 4H1LG 1KGUA 4JEGB 1OAZL 2J44A 2DY2A 3HB3C 4UUJA 4WU7A 2VZTA 4XPTH 4L4VB 5IFJB 3FO1B 3LX9A 1A6PA 4HAGA 2W65A 4HJTA 2G30A 4P4RB 1N3NA 2PNDA 5IW1B 1AD9A 1ITBB 3RWGB 4KZDL 5B38B 3O9WA 4X83A 3ZXAC 1L9RA 3NZHH 3JT0A 3MBEC 2EE6A 4NKDB 1PJWA 3L08A 4UQEA 3Q06A 4E0RA 1Q4NX 4NKOA 1B0IA 4Z0BL 2YPKA 3BP4A 3FNKA 1WV7T 4ZO8A 1RU9L 5ALCH 2DWEB 1FL6B 4XE0A 4P2OA 3FUFA 1S7VA 1U8KB 4O02A 4F1ZA 1P5UB 3JWOH 3FSZA 4IW4C 4H8QA 3BO8B 4FQXD 4UZGA 3F83A 5A3ID 2ZXCA 3MYJB 3SCMD 5JDJA 5BO0D 3MV9B 4R7VA 5I76A 5EORH 3ZYZA 2E9GA 3KW8A 4Y4FC 4FADA 1SDYA 1MRCL 3Q8EA 4GT0A 2YFOA 2A73A 4GXVL 5E6UB 5KSAC 1OAQL 5GGVY 2AEPH 5FGRA 1KGJA 1MJ8H 1FIEA 4N2OA 3C60B 2HKFL 4M3HA 3FQRB 2IADA 3B9KD 5IW1A 1QNIA 1RZPA 1QFWI 2ZCHH 1ZHBB 3A21A 1D5BA 4GI9A 4KO6A 3RWEA 1CVSC 5MEQB 2BSED 4WW2A 4B0MM 4YQXL 4A2FA 4UTCA 4ZPTA 1TSRA 3UTTA 4XWOC 4ZPVB 3P4NB 1F3DJ 15C8H 2JKWA 2YRPA 1B6DA 4JQIL 3RGBA 1NFDA 3ESPA 2DDQL 2CR3A 3MA9H 1BZOA 1KCVL 1ZLVK 5B3JF 1B2WL 4U7KA 4DGUA 3SQBB 3ABGA 3QQ9D 4I0CC 1CDUA 3LKSA 4M1GH 4AL8L 4EIUA 2ADIA 5DHYB 4PYGA 1UM5L 3TNNA 3CQFA 4XP5H 3CXHJ 5CD5C 2JI1A 1OVZA 3DX9B 1RD6A 3PWUA 1HI6A 1QZ1A 4L3CB 4OAWA 2CLVB 5KS9B 4X8XA 3KPSD 2F54D 2I85A 3NZSA 3P9WB 2NRDA 5DFAA 4GRMA 3U2IA 4IBQA 5KVFL 3MRHB 1ZLSL 3FU5A 1DANU 5C0BD 2C5DC 1F00I 4TTDC 4F33B 5D7LD 4LLQA 1GOGA 5TK4A 4L29A 5ID1A 4KKBD 1MLCB 1MW0A 2DIEA 3DX8A 4W4OC 3ZMEA 2DJSA 3QXUA 3VI3B 4Y9CA 2Y7OA 1URLA 4JO8A 3GZOA 1CE6A 1SXSA 1FZMB 4TSAL 1FAIH 1RH8A 4MWFB 1MCDA 4GKOA 4TXVB 1UOWA 1UT2A 1UB6A 1QSFB 1UT1A 2VTFA 5EWIH 3IRPX 3MLSL 2VW7A 4PI2A 2CXKA 1R5VB 2X70B 3BQUA 4TQEL 1QSZA 5FA4A 2OJ1A 3D18A 3LXBA 2CALA 3PGDB 4K7PY 1VACB 1OZTG 1UURA 3D85D 2XRAH 4IK7A 5E9NA 5I0ZA 1SF5A 5FO9A 1MCSA 3HUJA 3PGFL 4XB7A 1A3LH 2MEJB 1OF2A 3T8MA 5A2FA 4IKLA 4PJGA 1T22A 4KUZH 1YJDL 3NAAH 3ULUH 3VFTA 2JB6A 4JHVA 4WGVB 3KPSE 5FYKD 3KYNA 5CGYD 2YMXH 3OZKA 3QO1A 4JRLA 2Y07H 4QTHA 1EUUA 1YNLH 5EC2B 5D93B 2CDEB 4GS7C 1W72L 4TNVF 4WFFD 5I6MA 2HJLA 3A6OA 4F20A 1M1SA 4PVMA 1DVFC 2BRRH 4R0LA 3SDYH 1DQQB 4TUKH 4PRID 3RL2A 4CC4A 5IKCB 2FR4B 5CEXA 3P2BA 2CDEA 1H3UA 3MCLL 4QT5A 4ZMTA 2IWFA 2MIZA 1MCWM 3BCDA 3OPZL 1ROWA 4M4RB 3OMAB 2YRBA 3EH5B 5AZ2L 3L45A 3BDBA 4JFZH 1WHOA 2ZF9A 4TULL 4U6YB 1WA2X 3PHOA 3QPQC 1UA6H 2L0DA 5E7FA 1SRDA 3AJ7A 2B5IC 2VM3A 2NSMA 3MOQA 1P5UC 3HCVA 3S34H 3PP3K 2B16A 5E08H 3OQRA 5HYJA 4LHJB 2YC1B 4Z7VB 3RVWC 5C2BL 3C60D 2BSTB 3OMIB 4S1DC 2X41A 1BIIB 4N9GB 4R7NB 2OYLA 1F4AA 5IJBC 4CBPA 2L3BA 4WK4B 4WGWB 1HE7A 3WY2A 1NIEA 2FEEI 1I8KA 3EJZD 5D93C 3DSNB 4X9HA 3CFDB 3IPFA 3O45B 2QQQA 4JFTA 1FC1A 1FV1B 3T0EC 4MA3B 1OM3H 1YLBB 2Z8RA 4FABH 1KY7A 4PAZA 4YBHA 1D6EA 1MNNA 4Y4KA 3S34L 4PLOB 4Z7AA 3CXDH 2WTRA 1ND0B 2GJJA 4PJCA 2BFVH 4MD5A 3GIVB 3K4ZA 5F6IC 5GGSB 3KM1A 2Z8VC 4TULH 3QNXB 1LK2A 1UJ3A 3SHSA 5FS5A 2EVGA 4OCSL 3DUUA 5F72S 2C9SA 2HFFA 2FIRT 4FFZH 1AOHA 5T1LA 1IVLA 3NIGB 1X5AA 2ATPB 1GGCH 1N59B 4M7JH 3AS0A 3RPIA 4H20H 4MA1B 1SYVB 3C60C 4UV7L 3L5XL 2P5EA 5SX5K 1IGJA 4ZMAT 3G6JA 5K9JH 1GYUA 4TVUA 4JM2C 2JI3A 5LCVL 3QXVA 1AO7D 1DJZA 4UT6A 5EBGA 1EBAA 1WGVA 4JANA 4H0HB 3DO3A 3ZRFC 1V3KA 5SWZE 1HS6A 3HFMH 2H32B 1BD2E 2IV8A 1A9BB 4YEFA 5GS0H 3ZDYE 4HKJA 1L7IL 1RSFA 1XSOA 4X5XA 2J3SA 4R5XA 3HZKB 3SPVA 3KS0H 3FU3A 1A7NH 3NFSL 3DX6A 1INDH 1U8LA 5A2IH 3OR6B 2ARJQ 3EJYD 3WFEL 2DQ6A 5GISH 1XF5B 4RQQB 1ZJBA 1XIWA 2AEQL 4WWKD 2QV2A 4G7RB 3R8BB 1SUHA 5HPMB 1LILA 5EF3A 1LO4H 1A2YA 3KPOA 4G8AC 1B4JL 4WUKH 3LSOB 3O6FC 4XVUC 5GSVA 2BS71 4TPRL 1NKOA 1K8DA 1XMEB 1V3JA 1QRNB 4HCIA 4OFDA 5DZLA 1JPEA 2CO6A 4KZ0A 4QGYA 3ZKND 4M1DL 5AW6B 4WWPA 2N3JA 2X4SA 3N43F 4DTGL 3VU1A 5FPIA 4HCFA 3AS2A 2FB4H 5EZOH 1S46A 3RG1C 4BV1A 2NYYC 3P3SA 1L9PA 2NY5L 4IRZH 3BUPA 4GMSH 1HKFA 4RMBA 4NHCH 1EUTA 2XY1A 4PD4K 2CGZA 1BMWA 2PPCA 3QQ4B 4JFFD 4LEEA 1E8WA 2FVNA 5HVHC 4MYPA 1RZ7L 4TNFA 1SFDA 2COQA 3JTTA 1A7QH 2UZIL 4ZMZA 1L0XA 3DBXB 3QYMA 4NM4L 3AT9A 5AW3B 1TQWA 3BJ91 3QWNA 4PGEA 3NIGF 4FFZA 2Y6SD 3EYVB 1UCBL 2P45B 3HVNA 4O4YL 1W6LA 4LPYA 4PS4H 1BZ7B 3W81A 1BCIA 2X7LB 4LU5H 4XP1H 5DZAA 3O3UN 2DLIA 1M7IB 3FUIA 4MFHA 1YC7A 5F7DB 1DVQA 3K0WA 1AKJB 2N7BA 1CF8H 2BP8A 3BMWA 3U1QA 2R51A 4DVBB 4P5TB 2YS4A 4YZFF 2WO4A 1LE9A 1GKOA 3GM0A 1IBFA 3UAJA 3IFLL 2AABL 4N0FA 2NY5C 3CMOL 1J8RA 1GGTA 3RGVB 3T3PF 4I18B 2JF1A 3FO2A 1JTOA 1RZKL 5HJ3B 5ALBL 3SDAB 5MP6H 1WZ1L 1S9YB 3V52L 4GOSA 4PB9L 2HKFH 3FT4A 5DRNA 1CGUA 2ZOLB 4KJQD 5EU7E 5EU5B 5EEUA 3ILDA 2DMKA 3TCLA 2OMVA 3ILQC 4YDZA 5D71L 3SD2A 1UXSA 4FMKA 4JBSA 2CAKA 4Q58C 5EO0A 6FABL 4GP4B 1D7BA 1WISA 3RY5A 2YQ3A 4UDUB 2J73A 4WHTB 3H9SA 3HC4L 3SE4C 4F7EA 5E2UH 4D0CB 4P46C 1IILE 3FU8A 1KJ2B 1PZCA 2LGNA 3K6FA 1CDIA 3EG9B 4UINH 1DVXA 2Y2YA 1AGBB 5SX5H 1T20B 1FLRL 2WB7A 3NOIA 3RTQA 3T5WA 1ITCA 1LDPH 3MNZB 4YDKL 3QUYA 4P2RD 2GJPA 2H6PA 2APFA 3OAZK 4FJYA 2CO7A 2ZSWA 4GIAA 4IRZA 3TBBA 2C1OA 1PZAA 2J2ZA 1DL7H 5I1DB 4FXGB 4MDJA 5CJXC 3PNRB 5J13C 4YDMA 2EVIA 3KMDA 2WNGA 4XWGH 2GBTA 2KLRA 2H1XA 3GDCA 2XQYA 2VL4A 4L9LC 2HFGH 4XVTH 2WQRA 3EJCA 2CJSA 1K8IA 2ICWA 1XCTB 3PY9A 4NX0A 3FMGH 3CPLA 3PAYA 1A4JA 1B0RB 2VH5H 5IP4A 1OE3A 2Q7NA 4DGIH 5DJ2B 3KLHD 2FZ3B 4PJIF 1I8MB 3MTXA 2BCKB 2FEEL 2UZXA 4YHPA 3WUWG 2H3NA 4A6YH 1GIGL 1X5MA 4NLHA 4NO3A 1CLOL 3E6HB 4CN4A 1NGQH 4XPAH 3QEGL 4OW6A 3T08A 2DI8A 1KIQA 1S7XB 5ACMA 1CBVH 2VDML 1YDPB 3GD1C 3NSYA 5H94B 3PV6A 3RQ3A 4HS8L 3NTCH 1IQWH 1L9OA 4FNLL 4G43A 3FQWB 2ZJSH 1T1WA 3H7BB 4MLSA 3OJMB 2DKUA 3PUUA 2EC9T 5SWSB 1R33A 2YMOA 2OMZB 4NQCD 3SGEH 3B9KB 2NQCA 3L1EA 4G9FB 4GUQA 1UD2A 3N1GC 1PVHA 1G7QB 2EDOA 3N06B 5F9OL 5B38G 4ICXA 3VDBA 1IUZA 1KG0B 2QGEA 4OZGA 4DFHA 4N5UA 1O5DT 4OV5A 1EFQA 2X6CA 4Y19D 2R39A 5EUOB 4PBVC 3QXDB 1OGAE 3DX7B 2ICEA 3AY2A 5EOQL 4FLSA 5HGHB 4HIIB 5J06A 3HC2A 3FHAA 5IHUL 4XMLH 5E1GA 2IJ0C 2C7UA 3GMOA 3EYSL 1DUYB 4KVCH 5ETUB 1O7DC 4R90L 1UB5B 3O6FB 4FQCH 4Q6IB 2B1AH 2YKLL 3WTUA 4G8EB 3K8KA 4HMCA 5E6SB 4LF3A 2BRQA 5CO1A 5F7BA 4WEMB 1Q9KA 1KJ3H 2YAEA 4PJDE 3MUUA 3NG5A 1MXGA 3SO5A 1JYXA 4GI8A 2P28B 3B5HA 4P8QA 2YIHA 2A9DA 2DAVA 4XBGA 3QORB 3FF8A 4R4BA 1KPRA 4GLRI 3JV6B 1MH5B 3CFJA 3CFTA 1H15B 4CKVX 2CKBB 4TQHA 4PSPA 2UWEE 4KH2A 4Y4FD 3VRJA 1HHIA 4EI6A 1ZS8A 4ZW5A 1WAAA 3SY0B 1QUPA 2XA8H 3M17B 4Y9BA 3BPOB 5CCJA 2F6AA 2SODB 2VLME 4P59H 2I5YH 4KQ0A 1A1MA 1E42A 3ARSA 3TA3C 2IQ9L 2F5BL 2A2QT 4IIQB 3CIQA 5AYUH 4OI8A 2DI7A 1QR1A 1WO2A 4G7SB 5IW6B 4QD2E 1TVDA 1ID5I 4UILH 2X53A 5JO5A 1FNFA 1JWUA 4QAWA 2IANA 4BDVB 3QUMH 1TZGH 1EEYB 3RURA 3KBFA 1V3MA 2EDJA 4J4PC 3WN5C 2DQEH 4IRSB 1S7VB 1C5BH 3VRLF 4APXA 1CE1L 2VDOB 1P1ZB 1UJTA 3DARA 3L95A 5K39B 1JCKA 3SGKA 4D94A 5EU7C 3RI5F 2VRAA 2R0LL 1FG2B 5LWYH 1FAKT 2Y2WA 1XCWA 4KDVA 3EH2A 3QUMA 3G5ZA 3CCHB 3WXVH 4JKKA 4JAMB 3HE6A 1QW9A 3TBVB 2EXYC 5AUMB 5CZXC 5HDWA 5IB3A 4ZO6A 1VZGA 2EJ1A 4NC1E 4N6RA 1XBDA 1IGCH 4JFYB 4D8OA 5BS0B 3OJ2C 2ZCLL 2VSCA 4F8OA 2CRZA 3S3SA 3UO1L 2O1AA 2W94A 3AREA 1G9HA 4NEHB 3BFQG 4RAVB 3T4AC 1ZHNB 2PYFB 1OW0A 1SUJA 2VXUH 2ZICA 3FU6A 4MXQC 5ICZB 1NC4D 1AGEA 3ARDB 5JPNC 3RB5A 1B0GA 4Y89A 3SDDC 3QI9B 3LDBC 5C7XH 4OCLC 5T33H 2BIPA 5DFVC 2DLFH 2GJ6B 3FO0L 4MNGA 3MOAL 2WXNA 3W3BA 1OP4A 2VDNL 4JG1L 4ADGA 3KPSB 3TPUA 5I8KH 1U3NA 4OZFH 4AENA 1WRFA 3P54A 5DSCB 1YRKA 1X9RA 1I8IA 1XH0A 2VDPB 4ZOAA 5GSRA 1ZT7B 3VGAC 1PG7H 5DHXB 4PJ9B 3VXOB 2NQ3A 3HG4A 1RIUL 2HVJB 4JFPA 4BUHA 5ISZB 1TZIB 4AMWA 5KYWA 4W9DC 5HGBB 2OTUB 3N2JA 3LXAA 5L9DL 1HXMB 1U2YA 5I8OL 4FQXB 4LQ1A 5CP3A 1I9RL 5EU6D 3IFPB 1F90H 4KVNH 2ZUYA 1KCBA 3BT0A 4OCWL 5E23A 3S6CA 1IEAB 4PR5B 4X6DE 2PPEA 4N20A 3QG6A 4BSVB 4K8RD 3AU0A 3AQZA 4OJFL 4WGKA 5IB1A 3RIAF 9PCYA 2C7FA 2NY6D 4UNUA 1OGPA 1RJLB 2VXUL 3SBWC 5L88H 1JIBA 1VCBC 1ID2A 2M83A 4YPJA 2CQVA 4IOIB 5EO9A 1KMGA 4ONHA 3ARGD 1SHWA 1TQSA 5BRZD 1ZVSA 5K1VA 5T3XH 4UOW0 3MLWH 5KVGL 1IGCL 1BVOA 2GY7B 5EO9B 2FL5A 5GIRA 1FYTA 4FP8L 1E30A 3TO2B 2X1WL 3D0LB 3I9GL 4UOZA 1RHHB 1CXKA 1AHWA 5MHSE 2WD0A 1KXVA 2AQQA 1ZGLB 3B9KC 4N90E 4HUKB 5C3LD 1OAKL 2O5YL 2D9QB 4YEEA 1ACZA 1ZTXH 1MCNA 3CFUA 2YK1H 4GBXB 4GT7A 5K9OA 5ITFA 2DYPD 4PUBH 1H5BB 4DPAX 1VADB 3HZYA 3NJXA 4X99B 4ZX6A 4N2LA 3DTXA 4Y9FA 3VFNA 4BE6A 3RUGE 5H37A 2ZYHA 3WFBH 3F5WB 2FJGB 3IXAA 4CKQA 2CSPA 3DX1A 4OZIB 3D69A 1XQ4A 4PRAB 3G08B 3M46A 1M6OB 2F18A 1MSPA 3SEPA 5D2LE 3UC0L 4LOUC 1ZXQA 4Y4FA 1XDTT 3N3EA 1A1NA 1IAKA 5AOIA 4PS8A 3KYOA 3TIDB 2NY1C 4F2FA 3LZFH 4XX5A 2J55A 2Z9TA 1MCFA 3GJFH 4NPYA 4OJEH 5IF0B 5JR1L 3J2PA 5D7KD 2QKIB 4KI5E 1J1XL 4S1DD 4IMKC 3VU2A 2B0SH 4P2QE 3SJVB 2FYYA 4DGVH 4PV9B 5FO7A 2COVD 1H9DA 3DGGA 2VE6A 1JNHA 4GAJH 5GHWL 1TU2B 4FXGC 5KVEE 5CKGA 1GZPB 5C07D 2XVKA 4PWFA 1J1OL 4NT6B 4P4KC 3ASNB 3D06A 3F84A 5JZ7C 3KHQA 5DEGB 5I73B 1SOQA 4QRQB 4DZBB 3WKNA 3IFOB 3VFMA 3D0VA 3BUBA 4PHXA 5E1HB 4PY8I 2FO8A 2NY2D 4GSUA 4JKNA 4WI9A 4ESKA 1QRNE 2ZT9C 1U42A 2GITA 3VXMB 2W8CA 4P3CL 1WPCA 2XWDA 4MGXA 1I4FA 2OR9L 1T03H 2A9BA 4OKDA 5EULV 1UQSA 1AVAA 2AVGA 3HAEA 3REWA 1FFOB 3UMTA 1LQBC 2BOLA 4GO9A 4W6XB 2DB8A 3LV3B 4F3FB 3CVIL 5I66A 1U8OB 4FQPA 4GY4A 4E9QA 3QQ3A 2V4LA 3KPNB 4HFWB 4E5XB 2VUKA 3GI8H 1FN4B 3KLLA 3PHSA 5ITBH 3V6FB 4AGNA 4ZUSA 4MDRA 2DW5A 2R23A 3P9MA 2X4RB 3LHAA 1JWMB 1KB5A 1T7XA 4WO4B 3MLTA 3PWPE 2UX6A 4B5ZA 4Y2OB 1AG0A 1D5ZB 1DVZA 2JE8A 1FNHA 2X1XR 1C9SA 3VWJA 4J6RH 1QLFA 1Q9OA 2DLFL 3FO0H 1BVKB 2YK1L 4JFEA 1EWHA 3PDOB 2A74B 1HHHA 1NH6A 3FU9A 3GXTA 1H15A 3U30C 1P5VB 3GNML 2MCMA 4OGYL 1YAZA 2Q76B 2JIXA 4JN2A 2AJYH 2AXGA 3MFFB 3BVXA 3EHBD 4WI4A 1B90A 3GMPA 2NZIA 3Q1SH 4M6AA 4Q4EA 4DP5X 1UXLA 2JKTM 3QHZL 1HZKA 1S7TB 3ARVA 3MV8D 2KYIA 2ITCB 4Y2DD 2YSTA 1P53A 4M9OA 3L3HA 5E99H 1KF9B 3N04A 4UWQB 5DVOA 4MJHA 2VAJA 3MCKB 1PG7X 4KKLC 4KZCA 4HWBA 2E5EA 4WO4C 3JVFC 3MAWA 3BEWA 1MHCA 3G6JF 4Z7WA 2WZ6A 1I9RH 1T0PB 2XFXB 3CVDA 4MA8H 3CFKA 3RTQC 3ZE1B 3VFSB 1OSEA 5T1DL 4ZAKB 3UEQA 4ZK8A 3Q8BA 1KTDA 3QYCA 3CH1A 4Z7WB 1NCDH 3QARA 3IS1X 1W0WA 3NRQA 1QATA 3LHPH 1BA9A 2XZQH 2GK0A 3BFWA 2HT2C 2HB0A 1NLDL 3OHXB 3QEHA 5IT2H 3UYRL 4X50A 4M61A 2DIJA 3LZOA 4JPVL 1DVYA 43CAA 5J9PA 3BWZA 3H7LA 3KPRE 4PV8B 4FYSA 1FSKC 3OKOA 3UJTL 1JTPA 5AYUL 4S1SL 5LBSL 3QUZD 3KXFB 1Y1DA 4QHMA 3D4YA 5I71C 3OKEB 3C5SB 2O61A 4P59L 3SZKC 4NQVA 4AK1A 1N8ZB 4PJBA 1OB1B 2PWHA 4GSQA 4MQ7B 3EYFA 4BQBA 4CGUB 2X2YA 1IM9B 4NRZB 5T3ZE 1AFVH 3VX0A 4D9LH 2B1HL 1HIMH 3I84A 4Y5VB 2GFBA 4HGWB 4LLAA 5IIEB 3WNLA 4DZ8B 3ZKMC 4LKXB 3MV7A 1E6JL 1GAFH 2VSDA 4XCYA 4LCWD 4Q52A 3DHPA 2QBWA 3EDFA 3FUNA 3BRFA 3HKFA 4QOKB 3SYAA 2VB5A 1LEKA 4PJBF 2Z8WC 4HWZA 4W1TA 2F74B 5F1KC 2YSSA 2QR0A 4JY4B 1QMUA 3BIAX 3TZVA 3T1FA 4WVRA 4WV1A 5GGRY 5JW5A 2KDGA 3BGMB 1CE1H 3L3GA 3SYCA 5F8RC 4R3SB 5EIQA 4UOJA 2CKBH 1MCWW 1D6VL 2K3TA 2H2SD 3MRNB 3LN5A 3EXJA 1BF2A 1G7MB 2ZZUT 5DA0B 1TZGL 5F9OH 5F89A 4JX0A 1JZ8A 1I7ZB 5E8DH 1CFVH 2EE9A 2IGFH 4A7QA 1QBMH 4PRHD 1MI5A 2VL5B 4PP2A 4MAUH 4RBPK 3ML9A 4U2YA 2CIKA 3SE8L 3BVUA 4MBOA 2XN0A 4HV8A 2X10A 1TG8A 1F13A 1G9NL 4W9GC 1WFNA 4P57B 4L3AA 4BFNA 3QDHA 5KUMA 1TQVA 5K59E 4QY8A 5C0CD 1W15A 3WFCH 3AVEA 4HS8H 5AW1B 1Q94B 3EGSB 1HZLA 3WG7B 1NFIA 4U1JB 5J1AA 3VI4E 1LO4L 1OQOA 1I3RB 3WD5L 3QEGH 4XNBA 1KNOB 4HLEA 1UH4A 1TT6A 1FRGH 1A4KB 2VAAA 3BX7C 4UOQA 5C0AE 3TO4C 2XTJB 3HBZA 4JM2F 5I6XC 3IYLW 5MI0C 2J6EA 1R24A 4S1QL 5BO1H 3K1KC 1IFHH 1XZWA 1T0MA 1L7IH 2R0WH 2O4EA 4WSKA 5I15L 4P5KA 3AQDA 2MKWA 4Z77A 5IF0A 4N4YB 2DM7A 1H0DA 1J7VR 3DIVA 2IAMC 1OP5H 5I16A 2VKXA 2NPLX 3L17A 4CMMB 2ZP0T 5F7UA 1GW0A 1EJ6A 4OI7A 2V3DA 2FQDA 5D96C 3U7WL 5JHDB 2RB8A 5CEZE 4GQQA 1ETZB 2P8MA 3N1FC 1VERA 3S37X 4GAGH 1IFRA 2X38A 3N0PB 1DSFH 3HE7C 2EKJA 4NN5B 4YDKH 3BVTA 4NCC1 4ZQKA 4YDLB 4FFZL 2G0KA 3D4ZA 2K9UA 3W56A 1TCRB 3BSGA 3L54A 4UTAA 2LOEA 1ED3A 3M8OH 4OD2A 3I6KA 2WZAA 4PRHE 3ULVE 3NUKA 5DO8A 1BQHA 3FN0L 5HI4D 3RA7L 3C8KA 4EXKA 3TO4B 4QHKI 4FXLA 3WJLC 5D71H 4YHKL 3FQNB 1GC1C 3H0TA 5BMFL 2UWEF 4IEFA 4NFDA 4KX8A 1IAIL 3OR7A 3HS0C 4FNLH 1F3DH 1CZ8H 3H56A 3ZL4H 4XRCA 2WIMA 4UV4L 3ESVF 4DP1X 3HE6D 2V0AA 2VSKB 5JYMA 2V7NA 3II3A 5TGBA 2VXTL 5E0QA 4YWGH 5MP6L 1NAMA 1ASPA 1BZ9A 5DJYA 1CICB 1RZKH 4TOYH 3QDMD 5HPMA 2XVLA 3DTUB 2KLSA 2IOMA 4C54A 2Q7YA 5BV7C 3AACA 3VXUD 4JG0H 4F9LC 1PLGL 2ZG2A 1HCZA 4A6YL 2KDYA 1MFDL 1HN1A 3L4XA 5JPMC 3DDGA 3UJIH 1U8LB 2PPFA 4K8RH 4YE4L 5EBMB 2XVGA 4ZAKC 3SPCA 4PP1D 4AZUA 3HG5A 2VH5L 5IR1B 1U0QA 5KSBF 4BKSC 3NGBC 1SMAA 3NN8A 3LEXA 1DE4A 1E5BA 3QB7C 2BJMH 3RNQB 1GYWA 3EHBB 4JPQA 5D1XC 5F9AC 3SDCD 1G9EA 1TQCB 2XTSA 1THAA 2WNKA 4XZUB 2UZIH 3T0VA 1X5XA 4PTTB 4U1LA 2E76C 5EZLB 5F7KC 5DZPA 2VLKD 4X4KA 1R19A 3ZE1E 1OF0A 4LHQB 4X6BA 1ZT4A 1HHKB 4AV5A 1MHHB 3IAPA 5DI8B 1G0XA 1OCWL 3FTXA 3LIZL 4YVUA 3RY4A 2IVFC 2XSKA 4EI5B 5EA0H 4MQTB 2YO3A 2EDEA 1G7IB 1QSEA 1HHHB 1BF5A 5DLML 2I9TB 1TZAA 3PGFH 2JKSA 1IGTB 5KAQF 3KWWB 4XXDA 2G4EA 1UC6A 3HZMB 3WTVA 5GZOA 1OP3K 1TTAA 2XTJD 1YMHA 1H3XA 4JKPH 4EOWH 2DQUL 3DOIA 1WTGT 5HYEA 3HNVL 1NGYB 3QIWB 2CD0A 5F7YC 4BZ2H 2FX7H 3GMPB 2XV0A 4JFYA 5BS0A 3ZR6A 3EGDA 4XO9A 3VFVA 1SLXA 2DTMH 4AM0Q 1U41A 4K3EH 1YMMD 5JW4M 3MLXH 5ES4B 1BBJB 4MX7A 4P05A 1HOEA 3JWDC 4LNRA 3PWLA 1FFNA 2GVYA 1B9ZA 1FZOB 1RAMA 2WYIA 1GJWA 2G3XA 2ZOWA 2UVEA 5I19L 4P07A 5A1AA 4OKVA 3I6GA 1MCOH 3V9EA 2PW2B 2QQNL 2HA1A 2OMTA 4IRJB 4N5ED 2E6JA 4OIAA 4P2RE 3AROA 2IBBA 3MO1B 4O4YH 3GMQA 3E0GA 3Q13A 5J13B 2HMID 2YQGA 2ED7A 4DEUA 1F1GA 3HMWH 3FQUA 3NVQA 3ZYIA 5IFAH 5C0NC 4Z3EA 2PWGA 5HJDA 5KEZA 3OJDA 3QJFA 3NRPA 1PQZB 4EF3A 1KEMH 1C7TA 3DXAD 4NB7A 3B7UX 3FQUB 1PD6A 4PG2A 1VAHA 5E8OA 3FC8A 3SKJH 5LNGA 1NWPA 3GMLB 2P7TB 4N3UA 2OMTB 3WJJC 1QBLL 2NY5H 3VFUB 1AP2A 3SKUD 1J5HA 3QQDB 2YFNA 5CSGA 4WI5A 3ZDWA 3SOTA 1XCQB 1TETH 3V6ZB 1DJGA 1BEYL 15C8L 3O4OB 4PJDF 2OQJB 3VFWB 2BSCA 2GHZA 1OK0A 2Z31C 4NPYB 3HI5H 1OHQA 4FFYA 1CWVA 2DM3A 5TFSH 3ECVA 3VUAA 1F86A 4TPRH 4G3YL 2IAMB 1KGCD 3L3OA 1HHJB 4WUKL 2X0VA 1XH2A 2VXQL 2V5YA 1JF6A 4HPHA 2AEWA 3QPKA 3PIQB 3OX8B 2C3XA 1MCLA 4FXTA 4HGKC 4X4ME 4XHJC 3NFNB 1GZPA 2HAZA 4ODVH 1DFXA 5DRXB 3T1WA 2HMIC 2AEQH 2Q3ZA 2DOCA 3FH8A 1M71B 3RTQD 4GXVH 3FQXA 1JZ6A 3UIZA 3MKKA 1INDL 2FYYB 4XN1A 3QZWB 3V0HA 4N8VG 1A7NL 4KK9C 2PP7A 1JZ2A 4LEXH 3KWUA 3GSNB 1J0IA 5DJZB 5EZIL 1KIRA 1P6AB 2CHNA 1J11A 5B4MD 1SM3L 3HPJA 5E1AA 2NOYA 2WCPA 3HE7A 3CVCA 5EPMA 2BOCB 2VDNB 3BWAA 3S98A 5E9DE 3WIHH 3ZHLA 5I30L 3FTZA 1T3FB 4KX7A 5AD0A 2PXYB 4HD5A 3SKNA 1NMBH 3GJFA 3K74B 3P4OA 5B4MC 3UTZA 4HUMB 4YDVB 1BXUA 2O5ZL 2JH2A 5E00B 3LRSB 2PYEE 1YEWA 4WEEA 2TAAA 4YHLH 5D1XA 5AFAA 3FTWA 3QJXA 1PNCA 1XGQB 2A83A 1D5MA 2BOCA 4RFOH 1BW8A 4H4NA 2CJUL 4XP4H 3HE7D 2HRLA 3R7RA 2PTTA 4UAOB 1OAZH 3RWIB 4S10A 1CU4L 3NIFB 3B34A 1AANA 1JL8A 1PG7W 3KLKA 1CQYA 1RQ5A 1DCLA 1KTLA 5KSUB 4CVUA 2EDWA 3LRSA 3PP3H 4WW2B 3HG3A 3IJEA 1JFQH 5D5MB 2VIRB 3PCYA 5AEAA 3BH9A 3UADA 3FHEA 3CSPA 3HJ0A 3GBEA 4G7VL 2D0GA 3FCUB 2ZTBA 3IDMB 4LCYA 3OTTA 4FQLH 2FEDD 3T77B 1NBQA 5C2BH 1OARH 2BNRE 3C09C 4LLMA 4EIZC 3LKPA 1QABA 3MBWB 4H8HA 3GFUA 3BZDA 4J3WA 2A9ML 4IGBD 3T2QA 5I1HL 3C75A 1E0OB 1YEIH 3MBXH 5JZ7D 4I3SH 4K94L 4OCYH 2EIZA 3B37A 3IGAA 2DYSB 1LNUB 5SX4H 4HCRH 1G7HB 2BVOB 1NUDA 1TCRA 4JKPL 1U8KA 1PFCA 2YGNA 4CAGA 4CN6A 4LVHC 4MAYB 2Z64C 3BN9C 4NGHL 3MLYH 2WMPB 5F1SA 3AREB 1CFQA 2EE0A 2IF7A 4A04A 3RE0A 5AVTB 3BWUF 3IMRA 1W72H 5AKSA 1IEBB 2WVVA 3CSYB 1UACH 1ZPLA 5KJRL 5TDNB 3U48A 4JHAH 1MVYA 4Z3FA 1AG6A 1E90A 2IH3B 2Y6TE 4KJYA 4WWKA 3WE6B 5D4JA 2MCAA 4C57C 3GPEA 1XH3B 1UVQA 1Z5HA 1OCRB 2CUAA 3L4UA 4MNGB 4D9RE 4U1GC 3RZCB 1JAEA 5FUOH 4BGLA 5IBTH 5IOPB 3V6ZA 4UM8A 3W9EB 4FA7B 2BMKA 2ENSA 4JR9H 2NTFA 4M5ZL 4JQIH 2VN3A 3CN0A 1B0GB 2D3LA 1P9MA 3DMMA 2FGWL 5K39A 5E2WH 1MFAL 1BOYA 4LESA 5GGUA 2UZYB 3BD3A 3V95A 5C07B 3O3AA 1HEJC 2IDSA 1L3WA 1H8OA 4RAVA 3EYFB 2NT0A 1LK3H 5KBLA 2HLAB 3RYMA 4JDEB 5CINH 1PAMA 2ORBH 3LZRA 4XOBA 3GSRB 5I1EL 2BWIA 2APSA 3I50H 5EWIL 2BWQA 5ABDE 2WLHA 5D2NE 3SOBH 4W9LC 5HGDB 3SJVE 1OAQH 4H40A 1IT9L 5HVFB 3VD3A 1N2RB 2CO4A 5GQBA 4ZXBD 3VWKA 3X1GA 4DVRH 4POUB 4OZIF 4UOW1 5C0BE 2GI7A 2PETA 4C59B 1A6UL 5TE4L 3S96B 3OKKB 4OUUA 1XGPB 4L23A 4PW9A 1X6LA 4ELMA 2Z0UA 4L4VE 4NO2B 1KB5H 3WUWA 1F2QA 3QZNA 2FT7A 4Y1AE 3JWDL 5D2LF 3HZVA 2BSSA 4C4KT 2F2HA 1MHHA 3NK3A 3QISA 1IAIH 1EO7A 1KTCA 4BBWA 1NBZA 3KCWA 4ZMVA 3VXRB 2F8VA 1GYAA 3O2WL 1VFUA 1C1EL 2VKWA 3QSKB 3FN0H 2OL3L 3FUMA 1JNNH 4S1RH 4KOCA 1IO4C 5I17B 3ARFB 4HIHA 4F2ME 1PNDA 1PDKA 4G6FB 5CLZA 2C3VB 2AXGB 5E8EB 1WAPA 4XP9L 2UXVA 3WS3B 3WNKA 3QORD 3VH8A 1TYJA 5DTFB 3OLEA 5CEYA 1REIA 3U7WH 3WDHA 3BGAA 4XMTA 5J1TC 3RPBA 4PRDB 2HRGA 5ANHA 3IU3A 2IDUA 3VCLA 3DGCR 3FZUC 4GUCA 2QGCA 2GTWA 2ZCHL 3RGVC 4YBQC 1PDKB 3BJLA 3K2MC 1XWVA 3VXUA 4FE9A 5L4MA 3HI1A 1RZQA 3QEUB 3TCTA 2R0WL 3E1F1 3PFUA 1AQMA 1BLNA 1XB3A 3D9AL 5IV2B 2RJMA 1CS6A 1TJHL 5BS0E 4MCZA 4U1IB 3RI5K 3SDXE 3SKOA 4AX3A 2EC9U 4M8UA 5D7SH 3VFOA 1FDLH 1AZNA 3AITA 1J0KA 5GPRA 1AZVA 4Q6YA 3U82B 4DEPC 3N41F 5HGHA 3EH3B 2W9EH 2PWDA 2GABA 1AXSA 2IANE 3O6MH 4Y16C 5DJ6A 4AEFA 1M05A 1MZZA 1PKQA 1QP1A 3BT2H 1BOGB 1MEXL 2K7QA 4FKEA 5EN2A 3D7PA 4X5QA 1ZJAA 4KDWA 1T2QH 4TTGA 1J8HE 4QJ4B 5B22A 3W0WA 3TJEH 2UZPA 5CCGE 2VLRA 2QV4A 2NDFA 2J25A 4LLUB 4NWUL 6TAAA 4ZQKB 3B2UD 3QRGL 5GGTL 5AZEH 3AG1B 3OL2A 4PM1A 2OSLA 4EVNA 4HJEA 1XF3B 5I73C 2R29L 3DV4A 4JKLA 5BQDA 2IH3A 3DGDA 5CJ5A 3JWDH 3EO9H 3BKYL 1J0JA 4JE0A 1D6VH 4PRPA 4MJIE 3PP4L 4Z5RA 3I3EA 4XPTL 3Q9QA 1RUPL 3OB8A 2Q6WA 1S7UA 1JHTB 2UZYA 1TZHB 5SV4A 1IT9H 1DQVA 1U8CA 3WHE1 4IBLT 3TT3H 2C26A 4O2FA 3W11D 3CMGA 4J3OH 3W9DA 4EN3B 2GJRA 5I1EH 1QKZL 2M2DA 4IM8A 1ZSHA 4JHWH 1AJ7L 4Y0GA 4TSBL 3MRQA 5A2BA 4FNUA 4B9CA 1E4XL 2HJFA 3JTBA 1CLCA 3WI9A 3AWFA 2GC7C 2AXFB 2BVEA 2EUXA 4JR9L 1HL4A 2CLZB 3V4PH 4F80A 2GSMB 2WUCH 3KPNA 2ZF8A 4HFWA 2XZCH 2IAAC 4HLJA 3VRLE 4BQCA 4DEWA 1CFQB 5EF1A 2KUTA 3FBQA 3RAJL 1EXHA 3MJ8B 1AXTL 1II4E 1SZNA 5F7MC 1YMMA 3MNDA 5HD8D 3EFDH 2NY1D 1Z9MA 4AYFB 5AOZA 3TBYB 5FWRA 1H8NA 5BVJB 3MJ8A 2H0PA 1SBSL 3M07A 3NPSC 2HUHA 5HVHB 2A6DA 5J1AB 1EMTH 3PDGA 4JY6A 4O51B 2FWSA 4AIXA 3F8UB 4LRIC 2ENJA 2IOIA 3TCLB 4NN7C 5HD8C 5F7DA 1CXLA 1BQRA 1HK6A 3TO4D 2AZUA 2LU7A 4UNVA 3EYVA 4I3SL 3BAYA 2XXGA 3F04A 4I2XE 3V0IA 5I1IH 3MHZA 2WXFA 4WENB 2Z34A 5A2AA 1HH9B 2A6KA 8FABA 1KLGA 5BRPA 3GZKA 5E99L 3ZHKA 2C9RA 1FP5A 1N12A 1MVUA 1E9OB 1NC2B 1NIBA 1Z66A 3O8XD 5D6CB 4KROC 5KUKA 3KPTA 1AKJD 2WQ8A 1USZA 2FQEA 3FAWA 3OXSA 1YPZF 1HEHC 5FB8B 3VW3L 4IQHA 1OGTA 1RZIA 2AV1B 3QFJA 2I60L 4XC3L 3FRPA 4MJIB 2WXOA 1L3NA 4UTAL 3ULUE 1ZGLA 1IGFL 1TZIA 2A6KB 3T8XA 4HISA 1MN4A 1IM3D 1MCRA 1PCSA 3BPCA 4PRAA 5C86A 4RFEB 2QFRA 4NZUL 2OMYA 5F7WC 3HG1B 1HI6B 2EEFA 4L3CA 2YN3A 4JFFB 1MLBB 2W81C 2MCG1 2DRUA 4F15B 1FO0H 5IROA 3TFKD 4HYTB 1FPTH 4ZXBC 1BP3B 4MNGE 1EXUA 2DWTA 3GSXA 3QIUC 5BV7B 3CFMA 1JJUA 1J9TA 2Q8BL 5DVPA 2Y7QB 4MAYC 4QXUH 3F12A 4R4FL 3FQXB 1F4XL 4K23L 5TDOA 3AREC 4O5LL 4HHWA 3BYYA 3LXCA 2OP4L 4Z3GA 2CUHA 4G8GD 4NQED 2YRZA 1XF2A 4BZYA 3CPUA 1QA9B 1SM3H 4ES8A 1CBJA 2NY4D 3OKOB 4TUJB 1B4LA 2R56H 4NQCB 4W9KC 3A6BL 3QZMA 4IRSD 4L3EE 5EBWA 1HNYA 4JQXC 4XPGH 3VXOA 4JMXA 3VA2C 3ZOAA 4YHZL 4AH2A 5GSRB 4HU2A 4ZZFA 5T1JA 4MB5A 5HHOE 1N5AA 4IIZA 1JBJA 5H2BA 1G1YA 4XCNB 4LSSH 1TZ8A 4W93A 5AVQB 4PP2B 3V4LA 5IMLA 3WENA 4PBDA 5HYFA 1KIUA 5KG9B 2Q1EA 4WKZB 3TEYA 3EYUH 1KIRB 4MRBA 2DMHA 4AGOA 2HP4A 4W9FC 4HBCL 2AJVL 2XC8A 4H25B 3VWKD 3MA7B 4ZXBA 5D6DA 4KKZA 4Y1AB 3VM5A 2X2JA 2AXJA 1BFSA 4YVNA 3ASWA 4JFED 1HDMA 3MREA 4K15A 2OULB 1I7RA 2VN6A 1SXAA 1EERB 3E6FA 1GPOH 5DQ9A 3DSNA 2HSIA 5G4NA 1SF3A 1J5IA 1IQDB 2QR0B 4JY4A 4J3VA 2R23B 1VZIA 4OM1H 1EZLA 5I18H 1AO7E 4NC0B 1OTSD 1PQZA 2F53B 4X5WA 5DQ9B 4U3SB 3VGDA 3HR5A 4KXAA 1ZWIB 3LZPA 2P3YA 4FQJL 5HHNA 3U25A 3E3QE 1G87A 2GJ6D 2OZ4A 5F7NC 3M17A 2OR8A 3HN3A 3GO1L 2V8MA 2YC1A 3UC0H 1SDDA 4ODHL 1OB0A 2EXWC 4NO0A 4Y1AD 2WZPA 2IH1B 5I82A 2DQFA 4H13C 3S35X 4BK5A 5C0JB 4K5OA 3IJSB 3IXTB 1G0DA 4BKLB 2IFFL 1RHFA 4LP8A 3KDPB 1BMGA 4LLWB 5DK2A 2Q6WB 3HR5B 1NFDF 4ZQTA 5HY9B 4LNRB 4M4RA 3EGXB 4ATWA 3V0WL 3EJUA 1BXAA 3DPBA 4GAFB 4AQEA 1YPZB 4DH2A 1A3QA 4JZJC 4JM2D 1G84A 4M03A 4P5SA 3UTQB 5I19H 1IB5A 1NLBH 1K9TA 3VACA 1VEOA 3E6FB 4E36A 5CZVL 3U0TA 3JWNE 4G9FD 3X3FH 1NINA 4NLAA 3ZKNC 4RAUB 4MCZB 3SKOB 3ECBA 3TV3H 4NUGH 1DSWA 4Z7VA 2VERA 1C5CL 1JD9A 2TRYA 3Q8FA 1FFOA 3J07A 1JK9B 1H3PH 3P2DA 3PL6B 4JS7A 1E27B 4N68A 5FYLH 5C0ND 1FFPA 2CHZA 1OY3B 4FP8H 4LP4A 4HH8A 2ICWI 3BI9X 4XBPA 3A4AA 5DRWB 4PBWD 4RMWA 2FBJL 2Z7WA 4H26A 3HW7A 2VLRB 1KUMA 3I6LE 4C83B 3OZ9L 4R6UA 2QKIA 4U7SA 3RVXD 4I9WE 2DZEA 3RY6C 5HPOA 4XXWC 4EUPH 3H42L 2PW1A 2J88H 2ZXBA 3O6FD 3QRLA 4FQIL 2IEPA 4NERA 5L88L 4MDIB 1E9PB 4GG6B 4LCYB 3T77A 2HVBA 5EA0L 4OLXH 4WSJA 4OZHE 4OCWH 4M8RA 3I02A 1A25A 1QSFA 3L3IA 4QTFA 1J87A 1I7UA 4FCHA 1YAIA 3TU6A 3IDXH 1DUYA 3GF8A 4IEFB 2Z8SA 3L4VA 5DJCB 4XN4A 2XKUA 5J12B 2MHAB 1SN5A 1DN2A 3QP3A 2ZCKL 1KIQB 1BYOA 1R75A 1S7XA 2ZOUA 5D5ME 4DN3L 4MSWA 1MLCA 1TNMA 3ULUC 2JIXB 4ZS7L 4M6NH 3EUDA 3AW5A 1U8MA 2W07B 3VQ1C 5GS3A 4NS0A 1ZT1A 1GHFH 1OWWA 4ABQA 1VPOL 5IROD 2CIIB 1YC8A 4NC1C 4UTBL 5FKPA 5KJ7E 2VITB 2BJML 1U8IB 3BKML 1PBYA 2RQ8A 3VW3H 3IDMA 4LLYB 4PMEA 4P06A 5AALA 1EVTC 4Y16D 1CDYA 1NOLA 1SLVA 3OZLA 3BH9B 5L4JA 4ZNCD 2F7PA 1XT5A 4D3CL 5HGDA 4JFEE 2XPGA 1MFDH 3BPCB 3FQNA 3K46A 3NCWA 1RIHL 1WZLA 4LLDA 4N24A 3O9WC 1DE4B 3VI3A 3KW7A 1KJ2H 4DP9X 1YYCA 4QMEA 2Z93B 4I77L 4TOYL 2X6BA 4QLRA 3UO1H 4HOWA 1J05A 4FXKC 1HAUA 2G3ZA 3CZUB 4HKXA 1XH1A 5B1JC 3FPYA 3CFBB 2J6EL 1VGKB 3MRCB 4R97B 3SGKC 3T6QC 1ETB1 3RIFF 1YPZE 1YMMB 4BK5C 4WHTA 1HH9A 3GMMA 3ZE2B 2H4EA 5K5YA 2FL5B 3TO2A 1KLGB 4NUQA 2OTUA 2V2WA 5IROC 4ONOA 5BW7A 3Q6GH 2QADD 3NQIA 1SBSH 1AR1D 1A14H 1JV2A 2UYLB 4PJ9A 4EUPA 1NJ9A 3K72B 4MNQB 1OGAD 2ADIB 2HRPH 3GSQA 1PW3A 1AXTH 2FECL 1O7SA 2A4CA 1S9WB 1EVUA 2BY1A 4HUWA 4UT9H 3ZDZE 3TS8A 4AUJA 3UP6A 2GJ6E 1P7KA 1RUMH 2AQ3A 1QX1A 4N85A 4YIQA 5DQJA 3SPHA 1X4YA 3V4PL 4U49A 1S3KH 2A6DB 4Y5YC 5F8QC 4OGAC 2Y1AA 4GO8A 1CK0H 2PR4L 2W0FA 3C6SB 5IB4B 2NXYD 1U2CA 2UZXB 4YHPB 4D0CA 3C2SA 1SHMA 1CD1B 2K6WA 1CGXA 4G1EA 1CYGA 2AV7A 3KVQA 4CSZA 1T1XA 3TBSB 1RSYA 2P5WA 1MFBL 1PZDA 1ZMYA 4PTUB 3RNKA 3P0VL 5KAQG 1UM6H 1CIUA 3N43B 4B9PA 4PFEA 4DO5A 4NFBA 1RIVH 3FULA 4JL1A 3RUGB 1MHPH 3ROOA 1M53A 1TKWA 1XF3A 4RISH 4LHUB 1UA7A 3HFFA 4P5KB 4Z77B 1U4FA 3QUYB 3CSBA 4P5RA 1RI8A 3PAZA 1GOHA 2BHUA 1T4KA 4DKFL 4HEPG 3IDGA 4D7BA 5F3FA 1KJ2A 2MQ0A 4IJ3B 4RNRB 5F9WC 5INDA 3WGUB 4E41D 4R90H 3ZZLA 1IM9A 3BXNB 3FCBA 3H85A 4NRZA 4RGMB 3QCVH 4RMSA 1RKRA 1TTFA 3UXFA 5F1NB 4AC2A 4XO3A 2D7MA 1HNFA 3FUDA 3STLA 3DO7B 1B4RA 4IGBA 1Y18A 2AITA 4WU5A 3SDCC 1I1RA 3OXRB 5HSFA 3CU1A 3SN6N 2UV3A 3P30L 3MMEB 3DPBB 3S36X 1LLAA 3VXQB 3V6OE 4NZ8A 5H37H 1L9TA 2OSLB 4QRTB 4NAJA 2IWGA 4ONHB 4OZGE 4HZLA 4PJCF 5DF0A 3SD5A 3FB6B 3VYOA 1N9PA 5B1KA 1XGRA 4QHUB 3EZJB 3Q44A 4WTXA 2DBJA 3W0WD 1WBXA 5GGQH 3T2NL 2NZ1A 1RIVL 4UAOC 5EIIG 2OW6A 3QCTH 5GJSL 4UT9A 1UM6L 3MSPA 4IKJA 3IU3B 4XOAA 2F7RA 4OD1L 2AXWA 1OOWA 1XD1A 1MPAH 1KCLA 3D48R 4GQRA 4MMZB 2WZ0A 2VDKH 5KANI 3VSVA 1Z5LA 4CILA 1A22B 2WKGA 3ARQA 3QEQE 4A66A 1IQDA 3G6JB 1HIML 3BMVA 3MZGB 4M6OH 2VQ4A 3H3KA 3OX8A 4KO5A 5KJ4A 4I0PB 2C7UB 3GMOB 1TPXB 4GRLC 1RUML 4Z7VE 1FUNA 4D8PB 1B3JA 1T5KA 2IAMA 3AADB 4AXWB 2P1YA 2WWMC 3QG7L 4B53A 2EEBA 2UUDK 4NM8L 1N68A 1KFAH 4Z9KB 1DBJH 3BH4A 1RZFL 5EU3A 3GGWA 2VISA 1FYTD 4W9CC 1WHPA 4PSRA 4PH8A 5C0RH 5AOMA 4J5VA 1U8MB 2AJXL 1S9VB 4LPUA 4PWEA 2DLHA 1XAUA 5C0GA 2GK2A 4HT1L 1RP8A 4A2GA 1D5RA 5C0BB 5FCUH 2ZP9A 4GFTB 2XV6B 1D5ZA 2D2OA 2A9NL 3T0WA 4ZODA 3FRPG 3GSUA 4GQ9L 4HLZH 1AYOA 2YPLD 4G6ML 1MAMH 5T1DH 2GUYA 1KB5L 2WQVA 4ELMF 5DYFA 1TYRA 2ZX6A 3OB0H 2PLTA 4JFOA 2D31A 3VTAA 3T3MB 2KPWA 4L05A 5EU6A 5IR1A 5DS2A 1W0WB 2BVUA 3NJGA 5KANG 3O3DB 3N5AA 5DD5H 1J8HD 3TXAA 1J0HA 3R7QA 2P8PB 1NPUA 1FG2A 3WN5B 3Q3GB 3W57A 1SJHA 3ABZA 4B9IA 3U83A 4DQOL 4K9EL 1IJNA 3Q1SL 2GT9B 5LGKA 1WC7A 1X7SA 3NJIA 4N87A 5DEFA 1CJYA 1OD9A 4KKAD 1BQUA 1AIZA 1L9NA 5C3TA 2MOGA 1BG1A 3DSFH 1AGDA 1U93B 5DUMH 1G1KA 4ZUSB 1WFOA 3V7AG 4U33A 4AQ8A 1XTLA 5E4EB 2RALA 1GHFL 1S7TA 4PJ7F 1KB5B 4XHJD 3X3GH 5IW6A 3B2UC 3ZMRA 1KGYE 3WNPA 3IDUA 2E8YA 1QO3A 4NNYB 1QTSA 3WEXB 4PJAB 1BBDH 2H8PA 1YEJL 1NEUA 5CJQL 4AGQA 1FHNA 2GAZB 2PXYD 4NCC2 4R5TA 1RJZB 5KOVC 4P9HC 1G7HA 2BVOA 3IPEA 3V55A 3CVHH 3DMMB 5MEPA 4PS4L 3F58H 3IRCA 3L2LA 5JPNB 3L1OL 4GUOA 2BERA 3HMXL 4K7PX 1E2ZA 1UUSA 1IC4L 1VEMA 4RCAA 5SWZD 2YQ2A 3SY6A 3UTSB 2WNXA 3PDOA 3GI8L 3AU1A 5ITBL 2X1PA 1Z1WA 3OHXC 5D72H 3BP7A 3BEVA 5FOBA 3FDWA 3RKPA 5TDNA 4X4YA 5EUKB 4XB8A 3MJGX 3CLFH 4PY7B 1IEBA 2WVVB 2CMRH 3HS0B 4PRHA 2VABA 1UB6B 2OR9H 5FV1L 1SY6L 4QJ5B 2WLIB 1EAJA 5EF2A 4IKKA 2R69A 4P3CH 1KY6A 1CD1A 1WP6A 4OF8A 4TVSa 5FYLL 3VGHA 1QA9A 5CFHA 3AY4C 5EC2A 5KVDE 1T7YA 3X14B 2Z1PA 3JXAA 3LV3A 4F3FA 4MJ6B 3ARBB 4R26H 2IAND 4X2UA 5C07A 5HYSG 1CFTA 2JB6B 4MAYD 2HVKA 4EZMA 1RXLA 3X1NA 3QUGA 3DHMA 3U0WH 4YC2C 3JWNH 3UAJD 3O11B 1T4KB 4R3SA 4XN7A 1QYGH 1F18A 1XD0A 5EOTA 1NGPL 2NXYC 4S0SD 4KPHH 1W91A 3FQTA 4PJ7E 3VXTA 4FULA 3QXAA 4X7TB 1VEPA 3HIZA 2ZOLA 1NJ9B 1D9KA 3K72A 3MLZL 4MNQA 4QT5B 5GISL 3VFPA 5CILH 3LEYH 2OMZA 4E68A 1NBVH 2X3BA 3UTPE 4FYTA 2R15A 4F5CE 2JJSC 4ODHH 4QXVA 4NZFA 4AC4A 4DEPB 4DKEL 1RZKC 1HTYA 3WY4A 4PWHA 1RULL 4AV4A 1CYXA 3FT3A 5HDOA 2WGNB 1R47A 4L8SB 3X11B 4LHUD 5H94A 4ZG1A 2NDGA 3MRCA 3F12B 3L16A 1W80A 5DQDL 4ONGL 2BIQA 4JO5A 4G8GB 1E8XA 1UXMA 4NQEB 1X7QB 3ULVD 3TT1L 3V4UH 5MEND 1NDGA 5B1BB 1GMEA 2VMDA 4FC3E 3MDJA 4N8UA 2YZ8A 2FNWA 4FKKA 3GEFA 1CURA 1CB4A 3HR6A 4NBXB 4G72B 2YEQA 4JW3A 1KXQA 2FH6A 3NESA 5CN3A 3ZL2A 5L6YL 3APMA 4FYQA 2E86A 3ELQA 4JFSA 4P23B 4X7FC 4M3KB 1UWYA 2ZSVA 5C0EB 1K8IB 2EAEA 3CXDL 4XMWA 3RIFK 2EXSA 3WJMA 2D3NA 3F5WA 4P23A 4G80A 3CFCH 4A2EA 1N7MH 2YMTA 3R4RA 4WO0A 4X98B 4JK0D 1OAKH 3ZTJG 2EUVA 4HJSA 1GJIA 4NQTA 3U9PH 3JWNG 1VADA 3HZYB 3UTSE 5K9QG 1BAWA 4AQAA 1E3ZA 1A7OH 4L29B 3W0WB 4IKNA 5DO2D 4WK2B 4QGTA 3LB6D 3GHEL 4WTZG 4YSRA 1E7VA 3TWYA 3VO0A 4P5TC 4MXWL 3RWHB 2FE0A 2WLNA 2YGPA 3O0RH 1WEJL 4X6DF 2E0PA 1AHWB 3EOAA 1JRHH 1KXVC 5FYJD 2P48B 3F6LA 4OJFH 3ZQWA 4J8QA 4PP1C 4AEIH 5I2IA 1JGIA 4GG6E 1BJ8A 4X6CA 3SDAC 4A2DA 3S4SG 3OKNB 1F90L 4RDQG 2RQEA 1X5JA 2Q86A 1B6UA 3FFCD 3BC9A 1K6QH 3MUHL 5ISZE 5GGRA 4CJ0A 4W9IC 1OP9A 5EPMB 5GZNC 1ET7A 4NWTL 4OB5L 4C83A 1UM4H 1N8OE 3KM2A 5IB5B 1SQMA 2BRRL 2NXZC 4GBXD 3KEDA 1GTFA 5BXFA 1Z32X 1EJ8A 2RMNA 3LYRA 3L1GA 3OGCB 3EJYC 2I60H 2X05A 2X2IA 2ITDA 2QQNH 1BM3L 1IGMH 1U8NB 3MOAH 2M8XA 4YSUA 3BAWA 3W2DH 1QNZL 1YJDH 4KUCD 4A67A 3CFQA 3L3KA 1TXKA 5KYXB 3RPIB 1A6ZA 1WZMA 1N18A 1RK1B 1GYVA 3ARGB 4LSPL 5E7BA 2H1PL 4OLWH 1KBGL 5FHAH 4ZMPA 3H9SD 4JHZA 2LAAA 3MLXL 4P4RA 1DEDA 3HC0A 4KO9A 4ZRGA 3WIAA 3ZUNC 3LNFA 1P1ZA 3L95B 8CGTA 4WU7B 4NQDA 4BZ2L 1GS6X 3IMSA 4JG5A 1IJ9A 1EHAA 2H32H 1XXFC 2VR7A 5GZNA 3V5KA 4LQFL 3U30B 2NR6A 4Q2ZB 4HEMA 3QCUL 4FG2A 1S78D 3O3DA 3LH2H 2EH7L 4JPIB 3UACA 1LE5B 1W16A 1LD9A 1X5YA 3PLYA 1GXEA 3RL1A 2CO6B 4QYOA 2NUPB 2P5EE 5TPWL 3EFFB 5PAZA 2JTYA 3G5VA 4MVBC 2ZNXA 1LO0L 1NGYA 3QIWA 3GSUB 2AK1L 5DK0B 3DWTA 4PRPE 5DCCA 1MJUL 3CG8A 2YA1A 3BUYB 5CZXD 4OF7A 2VLLA 2UUDH 3VNZA 3SBWA 2EYRA 2QDVA 3NRFA 4QDGA 4R96B 3TTSA 3UL4A 3CHQA 4UANA 3IE4A 4JE4B 1SYSA 3TWCL 2D03H 3M45A 4GAAA 5PCYA 1EZVY 4PJFB 2FO1A 4JHWL 1A4CA 2J5LB 5TF1H 2ADJB 1S5IH 3RWCB 3D4GA 2VDQH 3CV5A 3EO0B 4LDEB 1IAOA 4PJ8B 2UXFA 1T66C 1WJ3A 1YNKH 4QWWC 2VLKB 1E5UI 5T1MA 4PLJD 3U2SB 3QDGA 3UP1A 2OTPA 4YQXH 3FTYA 2I07A 2JELL 1KPUA 2IDQA 4KKQA 5TQ2L 2NY4B 1Q0XL 5IQOA 1UEYA 1AC0A 4IU2A 5T1KD 5ID1B 4EI5A 4QRRE 3BKYH 2WYHA 35C8H 4H8WL 5K1JA 4FA6A 3NJHA 3SE9L 1MHCB 2BS8A 4U6VL 3WS3A 1AR1C 1MRCH 1TUPA 5T8IA 3V9FA 2OL3A 4MQXC 4K5NA 4QHUA 2F1BA 2VC2L 1M6OA 3CC1A 1IC5H 3U1SL 4HPOH 1D5IH 1NPJA 3UYPA 4YE0A 5C1MB 3MV7E 3QULA 4NQCA 3V2AR 3JTSA 1NMAL 5JIHA 1OTUC 3T65B 3FRPB 4MJIA 4W9HC 1XVSA 2FIKA 1Z5LB 3GYRA 1IC5L 3APCA 4HF5L 3NN8B 3ZDXF 1YEDB 3Q9PA 5J11B 3KPRA 3QG6B 4BSVA 3I3BA 3KYAA 1G94A 1O9ZA 2HPTA 3K2UL 4HJ0C 5DZNA 1I8MA 2PO6C 3FT3B 1NSNH 1XGRB 1EDYA 5EO0B 1XL4A 4HK0A 1R3HB 2DEWX 2BHZA 4U1MA 4FQHA 1Q94A 2QEJA 1H6EA 2EIMB 4RSVA 3CX5J 2K9FB 4OQ1A 2AJZA 3QEQB 2HH0L 4HJIA 5D7HA 4J3XA 5FWQA 1CXEA 1YNKL 4V2CB 4U3HA 1N5YH 1OSPH 3ARGC 4WJ5B 5I6KA 1J8HA 4RZKA 4E9WA 3BSHA 3FMGL 4RDQF 1UOLA 3D51A 1U3HC 3EFOB 4J3OF 1YECH 4JFQB 3WFCL 3VXUE 1M2VA 2DLEA 7FABH 3DVNB 3QFDB 3HG1D 4FQXA 3PF2A 1YJDC 1HCVA 1NWOA 3AS1A 1JGVH 1WFJA 1T6VN 5IESL 3L48A 3VA6A 3T1FB 1MIEH 4EN3C 4MZRA 4RWYL 2J8UA 3C60A 3DDFA 4JQIA 4UINL 4LVOB 1BQKA 1EJFA 1DQKA 2AK1H 2GC4C 2WKOA 3HB3D 4ALAC 1Z3GL 1T5WA 1SOSA 3L9EA 3ALXA 3UDWA 4JY5H 5JXEC 1E5ZA 4YR6B 4OZ4A 2AV7B 3WUZA 2DWXA 4EI5D 2JCCF 4Z3IA 2MPAH 2KQMA 4N2FA 1S8DB 1AGBA 1PKOA 3I3DA 3AMKA 2OXGB 3S36L 1QVOA 2HFEA 3D6GA 4E42A 5MENB 3Q05A 2X4UB 4XAKE 5EO1A 5D4QA 3B8YA 5JW4R 1A4KA 1WIOA 5ENWA 2R27A 3QFJE 1GAFL 2EO9A 4WI2A 2KZKA 3UZVA 3L8QA 4R7DA 2CCWA 3ARUA 5AKRA 4OJDH 2WYTA 3CXFA 1S7WA 3QUHA 1JHKH 2KLTA 3TPKA 2R9HC 2AABH 3LPFA 1MFAH 1BVNP 5E2WL 2WWMD 3VFOB 5GSVB 4OAWB 3VQLA 4ISVA 4MAZA 4PJDB 3TURA 2IDTA 3G5ZB 5JMRA 5CZKA 2DYRB 1UADC 3TN0D 3UTSD 4I1NB 4UUJB 3L4CA 4IJTA 1DVFD 4MNQD 4Y16B 1IGML 4DCQB 4MJ5B 3U6RB 4POZC 3VRJB 4WEBL 3RRQA 2DL9A 4S1SH 3CZNA 3CLWA 3KPMB 3FL7A 3NJFA 4G9DA 4HIEA 4YHMH 1NANH 3KXFE 4ZS6C 3V0EA 4X7EC 3ARBD 2DYPA 4MMXB 3LPOA 4LLVB 2H32A 4N2NA 2BVQB 3HNSH 3MCKA 3RVVC 4BCYA 2NZ9D 3CGTA 4QHMB 1X5IA 1KWGA 4DF9A 1TO4A 3C5ZA 3BDYL 5ISZA 2F53E 2NY6B 3DUSA 2DF3A 4MA8L 2JVUA 2WKLA 4IU3A 5D9SA 5GZND 1KDJA 3RZCC 3EZ8A 3GRWA 4GRLB 2V6HA 3K80A 2P80D 1EGJH 1YSOA 4HGMA 1INEL 3NA9H 4DW2L 5BJTA 5I5IA 5D70H 3O3BB 3CFKB 1W0VA 4JM0A 5JIQA 5E4AA 5T3ZH 1U91B 2YBRA 5CHNA 4UU9B 3THML 1KTDB 3F3HA 2VCOA 3GHEH 3MNVA 2CGRH 3ZKXB 2R2HB 5HHPB 1VZHA 2W1NA 1A6WL 5I1AA 4LNVA 4A7SA 3CX5K 4HMDA 3DNKA 1A7OL 3ZTNH 5HHOD 4OLZL 1UFGA 1K8DB 5DC4B 1K85A 4BUQA 3RVVD 4LT7A 3QUKB 5F21B 4XP4L 1A21A 3N42F 3ZE1F 3W2DL 1BGXH 3WHE0 2APWA 4JUTA 3NDYE 2GTWB 5D5MF 1MWOA 4H5SA 1R5WA 3VFRA 3H55A 4NO2A 3A3YB 4ANUA 2Z6FA 2RTTA 5C0CE 3IXTA 4DK5A 1BFOA 3HRZC 2XN9A 1MFVA 3B9KA 3VFUA 2NNRA 2G3MA 2OMBA 1UM4L 2AQPA 1C8PA 3CZKA 4OB5H 3D3VE 3S97C 4ZTOL 1M42A 3RVUD 2CPUA 4OZFA 3G5VB 1PLBA 3T6XA 1RULH 1YCSA 5EZIH 2BFVL 1I9IH 2EDFA 3VMPA 4HIJB 4LEXL 4DKEH 3LQAL 3MRLA 4JM4L 1EHLL 3OAWA 2ATPA 2J2ZB 2ZWKA 4N2CA 1NUGA 3O8XC 3BCFA 1CDJA 2Y36H 4LLWA 5DK2B 1JDAA 2DBLL 4U6VH 5HDBB 5IHWA 4XXDB 5DJAA 5CKAA 3VI3E 1AE6L 4V33A 1T20A 2ZIDA 3TVMC 2NNAB 1FZJB 4CMHB 1GC1H 4Z7OF 5KBNC 43C9A 4QCIA 2X09A 1FFNB 3QJHB 4WNQB 4PLKD 3N1MC 1B0RA 3U0WL 1MFNA 1J1OH 4LCWE 1MCJA 2EO7A 3ZRSA 3KH4A 3RU8L 4KJYB 1LO5A 1VACA 4GAJL 1YEHL 3GXPA 5IQLA 3BZEA 5H2BB 1DO6A 4J7RA 1R5IA 3RNKB 3QFGA 1TETL 4XPHH 2D0FA 1IBDA 5IEHB 1E3XA 1AIFA 5GRWA 5KSAA 2PYED 5B3NA 1DQQA 4CC1A 1F41A 1S5IL 2FJGA 3DO4A 5CSZA 1ZCRA 1F1DA 2JKJA 2ITDB 2A38A 5DD6B 3TZVD 4QRRA 4XNDA 5DC2A 3VFTB 3QK0A 5E0FA 3IBOA 3OPZH 1MFMA 5ACZB 1FHGA 4LPTA 4LVNB 3DGGB 1F8TH 1YEGL 1XGUA 3M1CA 1NDTA 4K3DL 4N2BA 1RFDL 4TL5A 3M1BA 4F33A 5HHME 1ZA3A 4XAWH 5HDLA 4O9HL 1LWJA 5JMOC 1WIUA 3KJ4C 3ME0B 3GBMH 4LCVA 4Q56A 1OPGH 3V0DA 5C9JB 1RMFL 4M02A 3HC3H 4Z76A 1AQ8A 4W81A 1JYNA 4HK3J 5BUAA 2G75A 2HUEA 4UNIA 1A3LL 3SKNB 1PPIA 5CD3A 4OZIA 4HETA 4JL2A 4L0YA 3QT2A 3ARDC 2O93L 5I71B 4PLNC 3ZKQD 2PYEA 4LQFH 3H0TB 4HJ0D 1G5GA 1B0WA 4JPWL 4M7KL 4QIRA 4PV9A 5FO7B 2D4FA 1BXVA 4FQ1L 4TQEH 4ANVA 3X1FA 1QFWM 2OCCB 3X13B 4ZFFA 3MLWL 4PJGB 5DJZA 4HSAC 4NDMB 5KVGH 1QW8A 4DP7X 4DQOH 3BGMA 3WSQL 2VN7A 4CVXA 3S3DB 5D7LA 3QBTB 3TA3D 3L9RB 3E80A 2EVJA 1ZK5A 4YPGB 5AOKA 1ZRUA 3KLAB 3OHMB 1FE8L 2VT0A 4GXFA 2X6AA 2D7TH 4LIQL 1RP9A 2YPVA 2V7NB 3GJFB 4MB3A 5E4EC 3IGLA 4NNPH 4HX1B 2A4ZA 3SB3A 1UA3A 5J0BA 4ZUTB 1MAML 4OZHF 3UZEA 4OCXL 3LB6C 4JFXB 3QHFL 4Y4HC 4Z8FH 2CIIA 3WAKA 3QRFM 1DJXA 4KKCD 3K1DA 2YPVH 3E8VA 5JQ6L 3N85H 1IC4H 3C6LA 3RWIA 3DX6B 4LOEA 2OCFD 4R9HA 1XGZA 1KCRL 1MVUB 2E7HA 1A7PH 4NRYB 4NI3A 4XP5L 4WW1A 5I8KL 4AYEC 1NCAH 3IFPA 3GI9H 2D7OA 4R2GB 2VDNH 1KCVH 3QG7H 2YAHA 3FQYA 2DDQH 1AHWC 4U1SB 4OQTL 1S7RA 1NIFA 4Q7DA 5ESVB 5SWZB 4AEIL 4ICWA 3DX9A 2IG2H 1HWGB 1G7LA 2XWXA 4J28A 2ALWA 4MDIA 3VE0B 2MNUA 1QUNA 5I16B 4NUPA 5B7MA 4PJ9D 4J3OG 1JS4A 1WEJH 4FQ2L 4UTBA 1GOFA 4GRLD 5DYOA 1HH6A 3TP4A 1XR8B 3NPZB 1YEFH 4I18A 4MD5B 1NOAA 2HVKB 2J12B 2YXWA 2ZG1A 4H8VA 5HVGB 2B20A 4ZPTB 3DRTA 1FGVL 1LM8V 4YHKH 3DA0A 3V0GA 2PR9A 3ZK0A 5CF3A 5JA9A 2N7AA 4ZSOA 1JI1A 1NCBH 3MRRA 3TBWA 2E9JA 1XGYH 1RJYA 2YSSB 4UT7H 3A24A 4TVPH 3JWOL 5L6YH 1HHJA 2JFCA 3TH3T 1NEZA 5GJTL 4P23D 3G5XB 1OO2A 1KOAA 1P2CB 1ZSDB 1EZUA 1EQWA 3P69A 4AGPA 3QIUB 3DROB 5EG6C 4BWTA 3WLBB 5CCHE 3NABH 2IPTL 2OQJA 3VFWA 4ZSOB 4QHPA 4DZ8A 1ORQB 3Q5OA 2AJXH 2EVHA 1OT1A 4GIOA 2APBA 4QUOA 3NZHL 1CN4A 4RZCA 3PWJB 5JDSB 4CU8A 5DJ8B 4JRXB 4OIIH 2QPFA 2XWZA 4YSSA 4M5SA 5IQMA 3W39A 3KWVA 3MLRH 2DL2A 3HZ3A 4X4MA 1F2XK 1NGWA 2BWDA 2XACC 3P9MB 4DPRA 4XVUD 3B2MA 1NUNB 3EUUA 4GAYB 4PG2C 3RVUC 1BMZA 3B8SA 1YN7B 3BN3B 5CP3H 1QSFD 4LDCA 4UQAA 4LPVA 4PJ8D 3E9UA 3T09A 4RGNC 5IFJA 3BUIA 4F2MA 1MFBH 1G6RA 1IGIL 3FZUD 3GIZH 2ZD0A 4HGWA 4KAQH 4LCWB 1B4TA 1Q8MA 3V10A 1I31A 1PTZA 2AANA 3VXSB 4LKCA 2LTQB 3QUXD 1UH3A 3HB3B 1MIMH 1MKFA 1WIPA 4M7ZC 3ZKMD 1BBJA 4MX7B 1OB1A 4MAUL 4OCRL 5FDYA 2WYZA 3D39B 3MJWA 5FYJL 4WHCA 1CFVL 3NGBB 3Q0HA 5SWSA 4JHBA 1ECYA 2FIKB 4Q6IA 3V6OA 1H6TA 5FGSA 1QAWA 4OZGF 4PJCE 4Z7UA 4LHUG 5AOLA 2CRMA 1Z0NA 3JTSB 1YMHB 3MJ6A 5AWNH 4ABVA 1J5OH 1TU2A 1CD0A 2LU3A 2XXFA 5FYJH 5FM5O 2QGDA 2R2EB 4PCSA 2YA0A 4B7LA 1NBZB 4ODUA 5T1LB 3BUDA 3K7UA 1K5NA 1A5FH 1WUNT 4AWJC 5DWUH 4O00A 2CKBA 1JZ7A 5JW3L 4HFUH 4LSTL 3IN2A 4JDVA 4Y5YB 5FGCE 1U58A 1FJ1B 2FD6H 2X3CA 4K73A 5DMKB 3TIDA 3O6KH 1AKPA 4PVNA 4FI7A 1I53A 5FKAB 5D55A 2LTQC 4KRLB 2C3VA 1CBVL 4JVPA 3WELA 3R0NA 1P69B 4F8TA 4YUEH 4RIRA 3MV8A 3ISYA 2BC4B 4H1LH 4YDNA 1LO2H 1ZLVH 3ULVL 4N2GA 2Y9RT 4LXFA 2QLVB 2I7SA 2P46B 3HLAB 4TNEA 4OGQC 1IKNA 1FVDB 4ZSOE 3HS9A 3DSFL 4B60A 2QQKH 3OMZA 4X9BA 5I1GL 2HX8A 2C1OB 3BPNC 1L6PA 5LXGL 1H8LA 1NGZB 4RMRA 1BQHB 4GBXA 2RR3A 5D8JL 3ZGHA 2BSTA 1QHQA 2HFGL 5L2KE 3JUYA 1YYML 5J11C 2YUXA 1ZA3B 2R7EA 4AYBA 1BECA 2JKIS 1ML0A 4DIXA 5LKNA 2GTZA 2X4PA 3LDBB 3IVKA 1A4JB 2IPTH 1ECZA 3GUTB 4Z3JA 2RCSH 1U8HB 5HI4C 4ZS7H 1BG9A 2F54E 2QTEA 4UT9L 1GS8A 3WKML 3BP6B 4KXZI 2G5RA 3OG4B 4ODTH 4PJBE 4A2LA 4G11A 4ORZC 1IIIA 4QRRB 1U3HD 1QFPA 1ZHLB 5TQ0L 1U3YA 2PTVA 1A7BA 3MI6A 1HQRB 3MX0B 1L0PA 4WFHE 5CP7B 5FECA 3FB8B 3UFIA 5DD3L 2OTWB 5E9DB 4FLQA 5I76B 2WMPA 1G43A 4OCMC 4ZUVA 1GW6A 3WJLA 2MKLC 2OBGA 1KENL 3REWB 4ENZA 1RUKH 4L2LA 3X12A 2X28A 2VDPL 2VMFA 4NO3B 1F56A 1LE9B 1LDSA 3VTTA 3PWNB 3Q6FA 4XH2B 1YUHA 1C5DB 2VR5A 2G2RA 2GIYA 2ZAHA 3E2HB 3VXMA 1RZGB 1DLFL 1D5BB 1SPDA 3HI6H 3UERA 1UD6A 1XH3A 2XKNA 4TLUA 1EHXA 3QNYA 2N01B 5F44A 5D1QB 3WLWC 3D0VB 3CBKB 2TSAA 1ZT7A 1FNSL 1OAXL 2E9WA 3IK2A 3L9BA 3BZ5A 5A16A 4GMTL 4ALAH 3LQZB 5E6ZA 2I26N 4L8BA 3MACL 2XT1B 3A0OA 3Q43A 3KYNB 4EUPG 1K2DB 2APVA 5J6GA 1T0OA 4XP1L 1Z9LA 1F4WH 2VWEC 5IG7B 1R24B 4P5TA 5L2JB 4BZ1A 1VPOH 2P24B 5GGQL 3RDTA 5E1QA 4L0PB 3RGVD 2VMJA 5B39B 3CLEL 5LGHH 2W92A 2EILB 2JCCA 1AKJA 3DI2B 2PTTB 2FT6A 3PXLA 1TJMA 4WI7A 1R3IH 2FJFB 5KVMC 3DJ9A 3QPQD 5EZJA 4F1SA 1S9WA 2NY3B 4OCXH 2AC0A 1RJCA 2FDBP 3BVNA 4NHCL 4PG9A 4QRUA 3ZKSD 4HXBH 1T5XB 1MREL 3BP5A 4YZWA 2IXQA 4NNPL 3UGUA 5ICXA 3VE0A 4BZ2A 1F45A 2FB4L 2FX8H 1LGVA 4KQ4H 5T1KB 4P3DA 4R8WL 5FR3A 2DJ4A 1FG9C 4GYBA 3IPBA 5DMYA 1UASA 2MCPH 3CDZB 3QCVL 3T0EB 1N6UA 3CDCA 3ZE2F 2VJ8A 1N0XL 1LMIA 4HC1H 2AHIA 4WW1B 2WWNA 4DPCX 4AIZA 4PJAE 1NFDB 3UPCA 1ORSA 3P73A 1B4JH 4ORGB 4G59C 2FBJH 4JO4H 5IMKB 1J05B 3PRZA 2IANB 3U4EA 4XOCA 2DQCH 3D4CA 4OT1H 4P3WA 2R1YB 4JM2A 4K0OA 2B4CC 3CDZA 4ZW7A 5JIMA 2WAHA 4B9YA 4YLCA 4TUOB 3P0VH 1KYUA 3PWUB 3TN0B 3NFSH 4AITA 2YUVA 3I2CL 2F54A 1MCIA 2K0RA 4MD4A 1R46A 3NIDF 1TVBB 1XIWD 4OGXL 3TF4A 5IZ7A 3HFML 5F7HA 1AHKA 1U8IA 3GLEA 4N0CD 4NFCA 4KOBA 4W9ZA 3ILPB 5H4YA 5GGSY 1MZYA 2FWLB 1KFGA 3K4DA 2R69L 1LEIA 3B3IB 2CA3A 1KN4H 1EH9A 4QOKD 4D9QE 1SDAB 3BZ4B 3EYOA 2UY6A 4N22A 5D1ZA 2JI2A 4NHUA 1KLFA 4UDTA 4C4KO 4WAFA 3HRPA 4BZ1H 2O6CA 4AI7A 1KYFA 2EDRA 2P5ED 5FK9B 4OCSH 3SDCB 2EXYD 3VSQA 3IETB 1MAJA 1JZDC 2DWEA 4BHUA 2XBTA 2PP8A 4N2KA 5E8OB 4N8PA 5F97E 4DP0X 2XQBH 1F58L 4XNMA 3VXME 4CNIA 4C55A 3Q6GL 1WD8A 3L3OB 4ODXA 3P3TA 3OJDB 3RFRA 2AGJL 1GPOL 3N50A 3LN9A 4E5XA 1I85A 4WFEE 1ZIAA 5EUOA 4L9LB 1NAKH 3OWRA 5E94A 4FTVD 1V3LA 4NSKB 5E8PB 4PPTA 3INUH 3U9WA 4AEHH 1YUHB 4EJ1C 4NDMA 4PREA 2BZDA 3DOSA 3ULUD 1OGSA 3O11A 1D6EB 2HRHA 3QAZC 3QQDA 3ZR5A 3UABA 5FO8A 1AQKH 2PYEB 1F3RB 1T80A 4G6AD 4NUJA 4OM0H 2EDQA 2P7TA 4BRVA 2WLYA 2LQRA 1FCCA 2Y36L 3UDWC 3G7TA 3ZO9A 4UAHA 2VDRH 4WY7H 1TQCC 4Y9EA 5AW4B 3T6WA 3TYGH 1MF2H 2O5XH 2WQSA 4YXLL 5J3HD 2V37A 2FECI 2KQNA 5DZJA 5EUOF 1I8KB 4LASL 3C2AH 2YHGA 4C47A 1X5HA 2NY3D 1BYNA 5I8OH 2OP4H 2GBAA 4FZ8H 4G83A 1VRSA 2NY7H 4FJ6A 4HKBA 1F4XH 4K23H 3MCLH 4X0KA 3WNOA 3VMOA 2DIBA 5LJYH 4KY2A 5C0JA 4QTIH 1PG7L 2I27N 2WTRB 1XGUB 4ES9A 2JMRA 1E5AA 3PV7A 1G9MC 4N2AA 4MMYA 3TVMB 3U79A 3TOPA 5E6IA 3D50A 4PN6A 1LEGA 3H54A 2EIEA 2Y07L 4AQ1A 3E2HC 3ES6A 4JG1H 3MRBB 3WGVB 3DK0A 1FV1A 4OD3H 3DVGB 2WUBH 2OS7A 5D2LB 4ZUVB 5AW7B 3RAJH 4HH9B 5F0PB 3OKLA 4X80L 4P46D 3W11C 4OLXL 1YZZA 4EXPX 2JLPA 4NZUH 1ASOA 2FWOA 2PTUA 32C2B 2FSEA 5JUEL 4HWEH 5AKTA 2J88L 1IZKA 1A1MB 1QFUH 4F9PA 1T0NA 2VQ1A 3C09B 3WTYA 3V9CA 2DKSA 3CZEA 3BP6A 4ZUUB 2EUWA 3GKWL 1AJ7H 3DX7A 3B4NA 5AW2B 3DYMA 2CGRL 3JSSA 1IARB 4U3CA 1IM3B 3NCFB 4YSOA 4CJ1A 2GTZB 2X4PB 3WHXB 3KYKH 3KYOB 2WN2A 5F9JB 5IY5B 4PJXF 4P49A 1KTRL 1EK3A 5CD5D 5ILTL 4ATTA 4HD9A 3WE1A 2XYBA 3ET9F 3OJVC 3ZDXB 1KCUH 1NAMB 4LL1A 4JFOB 1VLXA 2OJZH 4R83A 1JV5B 1BV8A 1OTTC 2J8UE 4G7YL 2ZOKB 5EDSA 5L2KA 2XWTA 1BHGA 1WT5C 1IM9D 1UWFA 2VRQA 4I4WB 5EC1A 1NCGA 2JKXA 2K8QA 5I5JA 5C0FB 4Y19A 4EAEA 4CVZB 1JGDA 1IC7H 3P11L 3QQNA 3ZGIA 3IJ9A 4ETQB 4JFWA 4NHUB 2X40A 2LABA 3AAZB 3ZKXC 3I74A 4CADA 5D1ZD 1KB3A 5IHLB 2Y5TB 3D2UB 4ZPVA 1AZUA 1U3ZA 3S3PA 2DI9A 3BUQA 3LS4H 1DN0B 4YHOH 1G6RB 2OK0H 4QHKJ 4XNZC 2YUZA 3KGRA 4F37F 5BPPA 3RWEB 5ID0B 2OKMA 4PCKA 3HG1A 2I07B 3O6ML 1N0LA 1R5VA 3AXHA 5DEZA 1GVIA 5HP5A 3SYQA 5DHYA 5CWSA 4FDWA 2X0WA 1MDTA 3P2TA 4TSBH 4JPKH 4EQ3A 3GSVA 3ATBA 1AI1H 1BFVL 4M9PA 2ZPKH 4WI6A 4APQD 4NBZB 5HHPA 5DR5H 3RWDA 4L1SA 2YARA 2OMWB 3F00A 2WJ5A 4FQCL 2C4FU 3GRBA 1OW0C 4M5YH 1P5UA 1JI2A 5T1LD 1SYSB 2OMUA 3T4AA 2PYFA 1LP9A 3B5GA 4JDZA 5CLTA 2KC0A 5JW4N 2WBJC 1P0SE 4ODUB 3QC6X 1M7XA 1RHHA 5EORL 3MBED 3CDGB 2WQXA 3BLBA 5KS9A 4FX5A 3PNWB 3R06B 4LEOA 3DJSA 3G5XA 3Q01A 2WQUA 2ESVB 1FSKB 4ZW6A 2EP6A 1AZCA 4BFJA 1JXDA 4N2IA 1QLEB 5JHLL 3KPRD 2CHDA 1URIA 1CGSH 4APQB 4XMZA 4RWYH 4NQQA 2ICEC 4CU7A 2QFPA 4HA1A 1V55B 3TEUA 4YSEA 3O2WH 4HIQA 5AZEL 5I8EA 2VQUA 3PJSA 1HILB 5C09E 4A55A 4AM0B 4IMLB 4AJWA 4LL4A 5EF0A 5IFHH 5KBPA 1G6VK 1GKEA 3UTOA 2QHRH 4PRIE 4QHNB 3LEVH 1ILSA 5CSBA 3VGBA 5TF0A 3SE3A 3V6BR 4AT6A 5TE7L 5DYOB 3BVDB 4P23C 5J6SA 2ERJC 5TE4H 2QELA 4FL4B 3D2UD 4WIQA 5FYKE 3FOLB 2IFGA 1MCEA 3NEEA 4N2HA 3ROOB 1CLOH 1QRKA 5INCB 5EBLA 1FDLL 5B3SB 1SJMA 1N64L 2W65B 4ENED 3ARFC 4M5YL 4UZSA 3RZCD 3VAEA 2WY3B 2H3XC 2GI0A 3B7SA 4DGIL 3ALWA 4XC3H 1YQVH 3MV7B 4P9HL 4AT6B 3TBWB 4YO0A 4HVBA 4LKXA 3D1MC 1NSNL 2AQTA 4I48A 4N6QA 1DZ0A 3TLRA 1KIPB 3ZDYF 2JK5A 3PE9A 2GBVA 1KLFB 4OVVA 4AM0A 5C0DB 1Y7VA 4O02B 4OGZA 5JLZA 4QHNA 1A0QH 4WV1B 4M5ZH 2XIBA 3RZWA 3LCYA 4F7MA 3O3EB 2GSIA 3GTVA 3ARWA 4MQSB 1LDPL 3BYTA 4I13B 5EZPA 4PJIB 1X9LA 5DVMA 3MRJB 4KTDL 4UIMB 2ARWA 3LS4L 2RAMA 5LBGA 2ZXEB 4K9EC 4PRNA 4OJCA 4R2GD 3WEAA 2AJZB 3QEQA 3HC4H 1FIGL 4HPOL 5INCA 3U1SH 2CH8A 3MROA 1GJUA 3D85A 4PJ5A 1K4CB 5LG1A 5D7IF 2C9XA 4HJUA 1JZHA 1QFHA 1JNLL 5LLIC 2ATAA 5E8NB 5MEOB 3QUMB 5FXCH 4K5MA 4W9JC 4J8RA 5CGMA 4NGHH 1GZHC 3O41A