4JGNA

Crystal structure of rna silencing suppressor p19 with 1nt-5'-overhanging double-helical rna 20mer puug(cug)5cu
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
125
structure length
125
Chain Sequence
HMTSPFKLPDESPSWTEWRLHNDETNSNQDNPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFFGFDQIGCTYSIRFRGVSITVSGGSRTLQHLCEMAIRSKQELLQLAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA silencing suppressor p19
publication title Procrustean bed of RNA silencing suppression
rcsb
source organism Tomato bushy stunt virus
molecule tags Rna binding protein/rna
total genus 39
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2013-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1810 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4jgnA01
1RPUA 4KQ0A 1R9FA 4JK0D 4KNQA 4J39A 4KTGA 4JNXA 4J5VA 4JGNA
chains in the Genus database with same CATH superfamily
4KNSA 3TLRA 2D3JA 1TQBB 4TQEL 5FO7A 3T8XA 3LKSB 4DPRA 2IGFL 4K7PH 3QWRA 2KZWA 4LL4A 2G3MA 5AVRB 3Q1EA 2HMID 2BOLA 3MV7D 4X0NA 4L0PB 4EIUA 4KTGA 3MCYA 4U1LB 4UAHA 4YSRA 4PS3A 1WEJH 2NYKA 3P11H 4PGBB 5T3ZE 1NCCL 1N0XH 1AC6A 5BJTA 3T3MF 1KBPA 5D1ZC 5MI0C 2CWRA 2DYRB 3GMRA 1LK3L 2MCMA 3I2CL 1R3HB 4Y4KA 3RKDD 2AJYL 2BIIA 1GGUA 1BD2A 4M7KH 1LILA 2XXCB 1B90A 1PEWA 2DH2A 1SEQL 1C16B 3ATBA 3I6KA 3TV3H 4IBUA 2CHWA 4X4XB 4X7TA 3RQ3A 1HJCA 4B0MB 4OZHE 4FQPA 2UWEA 3DSNA 2K4AA 1NMBL 3GJFB 4FJ6A 2GPZA 5IR1A 2VSCA 4B95C 2J57A 1JXFA 5AQ0A 3LH9A 3QWNA 2HFEB 1QSEA 3KL5A 4K55A 2YPKB 4XB7A 1MIML 4NQVB 1YECL 3QRLA 4L2LA 4XCFL 4XCYB 5D7IA 3MFFB 5DMKA 1WC7B 4OQTL 4AVIA 3NRPA 4FJYA 4YXKH 4BEIA 2F54A 1F58H 1NOLA 2OYLA 1RUKH 4GT7A 1NAMB 1NANH 5EOTB 5C0JB 5SWSE 1NGPH 3ARGD 3B2VH 3X1GA 2EIMB 1ETJA 1MCEA 3IN0A 2B08A 3RNKA 1V10A 3T8VA 1OCWH 3ZKSD 2O6FA 1G6RB 1QRNE 1NAMH 4Q9QL 1L5GB 4P2QD 3KPQB 4PUBH 4Z0BH 3P73A 1DR9A 4YSOA 1G6RH 5A2AA 1MCRA 4NPJA 1B0IA 3S3BB 1CXEA 2A0LD 3RBSA 1TJMA 3LPGA 3O4LD 3QK0A 1SEBA 1AQMA 3U48A 1CBVL 1MCHA 1CDHA 4M1GH 4WJKB 4DP4X 5MEOA 4W9LC 1TZIB 1ASOA 1U95A 5HD8D 4D7PA 3CZUB 32C2A 1NL0H 2HFTA 3QNXB 1XT5A 2IF7A 1UACH 2WJ5A 4ABVA 2YXMA 4Y9BA 4EOWH 4P2QB 4N28A 3L3IA 1DSYA 3N85L 2RA1A 4IEFB 5BO0D 1MCQA 1HWHB 4F91B 1YO4A 3L2LA 5JW5B 1KY6A 1WICA 2WIIA 4FS0A 4OM1H 4UDTA 3CGTA 3O4LB 4PW3A 3AZUA 3L5WA 4HPYH 4OLXL 3LEVL 3QO0A 5CD5C 2R1YA 3ABMB 1S5HA 5A2BA 2VQUA 2YAMA 4LFHD 4OIIH 4JX0A 2NYYC 3MA7A 4GP8B 4PJ5E 4PTTB 3DVGA 4QY8B 1BQHB 1AJ7L 3T3PE 2LU5A 4HXBL 4JFQA 1A5FL 2R0WH 4JZJC 4P4KC 3QI9A 1I7TA 3VDBA 4BWTA 1Z3GH 1JPTL 3DTDA 3LEXB 5IBTL 4Z0XA 3IGFA 2GTWB 3EOTH 2W59A 3BVTA 3K91A 1KJ2B 4WTZG 1HKFA 3ZE0F 3TH3T 2ZG2A 5FO8A 2MHAB 2EDYA 1YEJH 1DO5A 4GP5B 3VFGH 3VFMA 2EO9A 3CH1B 1IGFL 5HYQB 3VFOB 4GRLC 5DGRA 1NMAH 2OR7A 2QGCA 4QRRE 3DBSA 1HH9A 5LG1A 2FQFA 1R3IL 1UOKA 4PJFE 1D5RA 4F8OA 3WE6A 4C58B 1NCJA 2OMYB 5E95B 1CI3M 2YS4A 3BVNA 4UOQA 3UBXG 2IO5A 1T0NA 2NY3C 2XZCH 4QXGL 2X1WL 4HLZG 4GBXB 2KHAA 1J1OH 2AFNA 4NFCA 1J9RA 3KXFA 4TQHA 5C6TH 2NUPA 4OCRL 1XBDA 5D1XA 3UBHA 2VLRA 2EXWD 2CK0H 2EEAA 3C60D 3KM2A 1S7TA 3PGFH 3AABA 1SUJA 2I85A 1E8YA 3GKZA 4FADA 1A6TA 1UT1A 2XPYA 2CHZA 3CHOA 3ZYOA 2ETWA 1XIWC 4LOUD 1T0PB 2BVEA 2MSPA 4U3HA 2APXA 2X4TA 5AEAA 4LHUD 2C3VA 2BNRD 4G9FE 1PG7X 3KJ6H 4WJ5A 5JXED 3EH2A 6FABH 3JUYA 4X9IA 4ZMQA 1K8DA 1V3MA 4MMZA 2RQ8A 4BUQA 2XV3A 2NXYD 3QXAA 2X5PA 1A7NH 4KVNL 4AKOA 1SNRA 5DD3H 2DWYA 1ZVSA 4F20A 2EYTA 3NUKA 4MMXC 5ABAA 4PP1C 4TSCL 1X5KA 3O4OB 1J8HB 4NZDA 2TRYA 3NCMA 4UU9A 2PO6B 3LV3B 4DP1X 2O72A 4FQJH 1S7RB 2VR6A 2RHEA 4PJHE 4K5PA 3VYPA 4A2LA 1W0WA 2BNRB 3F85A 5C08A 1EBPA 1FP5A 3HEIB 2EH7L 2NY7H 2CLVB 1UXSB 3ZRSA 1QTSA 1MCDA 4K73A 3U4BL 4ZS7L 4J8RB 1LDPL 1TQCB 5FWRA 3HG4A 2B4CH 2NXYB 4TUJA 4P4RB 4AXWB 1DTUA 1JN6A 3CSFA 3S48A 4HUWA 2MCAA 3X11B 1RAMA 3FF7A 4YDLC 1LEIA 2BIHA 5KVEH 4NQDD 1JV5A 3T2PA 2DIJA 3T1FA 1P7HL 4NT6B 3MV9A 5DRZB 3BSZL 1Z32X 4MD0A 1BLNB 3E80A 4ONOA 4K0OA 5I1JH 2WSDA 4WW2A 3GPEA 4EI6B 5MERA 3Q6FA 1JCVA 2YIHA 3SDDA 1UADC 5E2VH 3ZKNC 4YOKA 3HN3A 1I7ZB 1IFHL 4HSAC 1GZQB 1OSPH 5C6WH 4HLJA 4E9TA 3MRGA 4HGKC 4RBPH 1ZTXE 2VQ1A 5AALA 4AYGA 2XVLA 1OB0A 4Z7OF 4NP4H 3NJHA 3ZZLA 3UABA 5IW1B 2KPNA 4AZ8B 2V5SA 2A7BA 4K3DH 3VYNA 2XJLA 1VA9A 1AZZC 4TL4A 3ZTEA 1FE8L 3ZDYF 4HK3J 4K5LA 5K93A 3L5XL 2FO1A 2V2TB 1CQYA 5CBAB 2YHGA 1LP9A 2DEWX 2YSTA 5IB4A 5B3SB 4W9JC 5CILL 4YGAB 5DZAA 4HC1H 1T1XA 1DFBH 2XV0A 1KT2B 1AP2B 3BUBA 3FTZA 3D18B 1K9TA 2WAHA 3PREA 3RWFB 4NZTH 4YHLH 5KYYB 5JO5A 1HEZB 1HWWA 4KXCA 4BFIA 4XGZA 4FNRA 4KKBD 3HUJA 5C0AE 4HZLA 5A6IA 4RRPG 4S0HA 3PE9A 1D5MA 5LVEA 1C5BL 5LGJB 2EILB 1EMTH 2UWEF 3QQXA 3ARDD 4MYWB 1X5XA 4ZDHB 3KBFA 1RZ8B 4Z5RB 3EGSB 4XMUA 4YLCA 3KMDA 3PWNB 4E5XB 4OCWH 4YJZL 3L3JA 1OLLA 3FSOA 1EXUA 3S4SG 4RAVA 2P5WD 4WU7A 4HT1H 4KXZI 4LIQL 4Z3IA 3BWAA 4PJEE 3F2LA 2GCYA 4OGXL 1R3KA 5D7IF 4PU2A 3R18A 3UJTL 4MDJB 3VXSB 2FEEI 2AC0A 4R7NB 4BKLB 4DUXA 1D9KB 2IMMA 1RK0A 4KTYA 3D69A 2F5AH 4LRNL 4MHHI 4H1LG 2CRZA 2OJZH 4U3CA 2ZXBA 3LZFL 4JZJB 1A1OA 5HGAA 3VWJD 3DV6B 1QEWA 4ZSOB 4KV5F 3IU4H 1JWMB 5AW4B 3BSGA 1L9PA 4HUVA 4QTHA 1CIUA 1IAOB 1M42A 1M3JA 2YN5A 5GRUL 2CKBA 4OGQC 5AB2A 2BSTB 4NKDA 2NQDA 3FUFA 4PW9A 4J3TA 1KGWA 4RX4D 1CXFA 4ZRGA 2YOCA 5I18L 5JIKA 5ID0A 1UURA 4NZFA 3EH4B 3MUHL 1BW8A 4XPFH 1SDAB 1AFVH 5CZVL 1OTTD 4BRVA 4PN6A 5D6DA 4BDVA 1D7FA 2G5RA 2W9DH 3LOWA 5L8KB 1KC5H 3VWJB 3LKQA 35C8H 5E4EB 1EEZB 2R23A 4O2FA 4QLWA 3PAZA 1TMCB 4IRJB 2RGSA 3C6LC 1AY1L 1GJWA 3CC5A 1VENA 2F7IA 3BMWA 5I2IA 1UGNA 2EYSA 1CE1H 1N5AB 1QACA 4EUPB 3P9MA 3EYFA 4Y16D 4AJYV 3MV8D 2OQJA 4JJOA 4AX3A 1UJ3C 4AYFA 1EDHA 1QPXA 2EVFA 2X0WA 5HHNA 4TL5A 1HHIA 3WJJC 3LSOA 4C54A 2H3NB 4KX7A 1C08B 1J0YA 3VQMA 3DX6A 3QIUB 3K6SB 2ZWKA 2HT2C 3S5LA 1AZCA 1G7JA 4Z7NE 1F8TH 4EKXA 3MRPB 2A9BA 5ALBL 3BDBA 1KTLB 2VT0A 3Q2VA 5E9DD 1A7QL 4H20L 1SLUA 4KK5C 3IGKA 1BLIA 3CIAA 5LDUA 3FUJA 4AYID 4MA8H 1A3RH 2ZKHL 4RFOL 3V5DB 1RKRA 4LHQB 2H32A 1U41A 2N4IA 3KW8A 4URKA 2XWDA 3LXUX 2IQ9H 3PPSA 2FWOA 2E8ZA 3MV8B 4NQCD 4AT6A 1CTNA 4FQQA 5I9QC 3ZPDA 1XGYL 3QRBA 2HSIA 4GNKB 1OAZH 2WGXA 4MJIA 5A2LH 3QR0A 4FXKB 4YC2C 2D7NA 1BZ7A 1RCYA 3DC0A 1FL6A 3L5JA 4AK1A 2XKNB 1BAFH 4LVEA 4NENB 4WVRA 3KDMA 5E8NB 1XF2B 4X80L 1TETH 1F1AA 4N0CD 1FFPB 4X6DA 3VUAA 4KXAA 2JJVA 1YEEH 1NGWB 1YYLL 3PL6B 3MOAL 1WIOA 5G5DA 2Q8BL 2AXJA 1SDDA 1E6JH 1JTPA 4JY4B 4HCRL 5H2BB 1R5IA 4MAYD 4RQQB 4NN6B 2G2NA 3GMNA 2PMZA 5BXFB 3RWHA 2ADIA 4M00A 1A22B 1MHPL 5FYJL 2Q2LA 4RGOH 4Z3FA 1WBYB 1JXJA 2P80D 4H25B 4YHOL 2WSKA 2E7HA 4ELKB 5I66B 4FP8L 3KCWA 3MRQA 1KPRA 3NABL 1R5VA 5HVWA 1A0QL 1F00I 5A7EA 3S35H 4E9RA 4EN3A 3S36L 2B77A 1JXGA 4N2KA 5IVOA 3FT9A 3LHPH 3NJGA 3EGDB 2YD9A 1K6QL 4OZHB 4Y5VC 1F41A 3CCHA 3GBML 4KUZL 5LCVA 3ERXA 1QFOA 3O45B 4N2NA 1S7SA 3U4EB 2I9TB 4YDJA 3ARQA 4MAYB 4WI0A 4PREA 2VLKD 1NLBH 2DLEA 1G7MB 1ZKAA 3FN3A 4Y2DD 5DJAA 1JF5A 3H9SA 4UQCA 4V11A 3M86A 2VR7A 1B6DA 2HFGH 1E5ZA 2XPGB 2V8LA 1F1DA 2GJZA 1NCDH 1U8QB 2XYBA 1RHHA 2IOOA 1DSWA 2ZXEB 2DQFB 4OBRA 1LWJA 4N9GB 5MP6H 1ZJBA 3FCTA 4GXUM 4RISL 4A7VA 4F7MB 5DUJA 3RVTC 2QTVA 1QRNB 4QRSA 1YEGL 4F9LA 5DFWH 4AG4L 1BFOA 2VLKB 1RZ7H 3MQIA 4QXTA 4Y2DB 1ZAGA 1VAHA 3MXWL 4HXAH 2OX5B 2QADD 3GBEA 4RZCB 4WW2F 5AW7B 3FMGH 5HHVH 2B9BA 4M6NH 3QA3A 2LGNA 3DPDA 2FATL 1PKQE 2YPLA 4TQ8A 3NCEB 2NW3A 2YKLL 2J72A 3V5HA 3NFNB 1UJTA 2A99A 1B0RA 3ECWA 1BG1A 4PJ5D 2DH3A 2Y69B 1S8DA 1JGLH 2C1PB 3DO7A 3N2JA 1T03L 4JKMA 1OD9A 2VDQB 3D0LB 4N3UA 2BRRL 4PJXA 4Z76A 5CEXB 5I16B 1GA2A 1ORQB 4BSVA 2R0KH 1WBXB 4J4PD 3SQOL 1TTAA 5IW6B 2B8OT 4JHBA 3WJLC 4JM4L 2YWYA 4WK2B 3D39A 3QHZL 4ZODA 1ZHLB 3DBXB 1URZA 3N1PC 1ZV9A 1NOAA 1FZOA 2Y1YA 3QVAA 1FVCA 4OZIA 2IPKA 5HYFA 1Z9SB 3OXRB 4LP4A 1Q94A 4KPHL 4YR6B 4MJ2A 5TQ0H 2QV4A 2YD6A 4NNXB 3QB7C 1H3GA 3O9WD 2X2JA 4PJ5B 5LGHH 4ALAL 4B7IA 3SKNB 2AQPA 3C12A 1CB4A 1UATA 2WYZA 1I7RB 1JZIA 2WQ8A 3HUJF 3QHFL 2FL5B 5DEGA 4Y4KC 1MRFH 4AH2B 4PSRA 1MQ8A 3SN6N 2BNQD 5J6HA 2BIOA 3QUYB 1AGCB 1IBDA 2HUEA 4L8SB 3ZHNA 1PCSA 2W38A 1E9OB 2Y06H 4MX7A 4HUUA 3SKOB 2GSGB 3PABB 1BF8A 2WY3B 3QORA 3REWB 3ARPA 3KPTA 4MDIB 4NO0B 4TVPE 4P23A 5C7ZA 1BVKA 2HWZH 4PJFB 3QQ4B 4NQXB 5EO0A 4QRBA 2G5BB 5GRZA 1MPAH 5D4IA 3O9WB 1BJ8A 4Z7WE 3N3EA 1YPZF 3V79C 3VD1A 1YJDC 2E9WA 3HLAA 4F2FA 3UEQA 1S7XB 3CZLA 5T5NG 4C59B 2PP9A 4ZUTA 4L05A 2IWKA 1ND0B 4MZ2A 3DXAA 1ET5A 1EHXA 1AE6H 4MVBC 2AJZA 4NQUA 3QDHA 1KGUA 5L7XL 4PY8J 4IOSD 5EBGA 4CSPA 1KBBA 3HE7D 4AYEC 1EH9A 3FO0L 4Y2NA 4Y2LA 5E00A 5D2NA 4XBEL 3WFBL 2APVA 3G04B 1KFAL 6PCYA 4X2UA 1ZD6A 4HGWB 3AU1A 4UZGA 5LN4A 3ZO9A 3RGBA 4M4RA 4ONFH 2BDNH 1JF6A 4ZUWB 3II1A 4OJDH 4UT7L 1NOFA 3NZUA 1O5PA 4POZD 1YEHL 5HI5C 3DX9B 1PDKB 4LSPH 4ANXA 4LLQB 3TONA 3O0LA 4K7FA 1M2OA 2EIZA 4HHAA 4TLKA 4XC1L 1KTDB 2P24B 4FQHA 4PVNA 1PQZA 1TZOA 1MZYA 1CFNB 5GRWA 3WKYA 1H3PH 1UXWA 3NIFF 2OMBA 1AACA 1IQWL 4YQXL 3DOIA 5B39B 3LZRA 3S3JA 4XT1C 2KPWA 4XPGL 3EHBD 5EEXA 1ZT4A 2AJXH 2NZ1A 4F8TA 1UZ6E 1JDAA 1D5IH 1RJZB 4I3RH 4KDWA 5FM5M 4P46B 1SVCP 1KPVA 4PJ8D 2PCPA 5B4MC 1TVHB 3NOIA 1GMIA 3WFHB 5DJYB 5C0EB 4XN2A 1Q0YH 3BGMA 4EDWL 4FG6D 4YFDB 1EAPB 2GAZB 2Y24A 4P57B 1Z5YD 3O2DH 4X6BB 5K33A 4PRHE 1S2EA 4AE0A 1ZA6B 2D31B 3LS5H 1E4WH 3WNKA 4HZAA 3T6ZA 1I8LA 1HYSC 4FNQA 3MJ9L 1EDQA 1X5YA 3EFFB 3LJ3A 1Q9OB 2CE6A 4YWGL 3EHBB 1HHGB 4E42A 1NBYA 2WUBL 4WWKD 4DWHA 2FR4B 5C8JB 4JRXE 3EUUA 4PRPD 1BVNT 4AYSA 1TG8A 1FRGH 2ZPKH 4HPOL 4PJ8B 5C1MB 2VQTA 2YEVB 3S88H 3Q1SH 1BAGA 4PJGE 1IT9H 4U1JB 4YHPB 4PQXA 3S36X 3V5KB 1H6FA 5T1LD 4BRJA 4R4BB 2WP3T 4RMTA 4UQ2B 3CLEH 3RAJL 1QPPA 2XBDA 4XB3A 4M7JL 1QFWI 5DU7A 2YPVL 1NGXB 5CGYC 3FTUA 1VACA 3GS4A 1OOWA 1ZLVK 1DVTA 4W6XB 2WXPA 2OK0H 4M1CC 5D1XC 1UFUA 3EZ8A 1GY1A 3FXIC 4DGIH 4WGVB 4PY8I 3JSSA 2OMWB 3GDCA 4UV4H 1BCIA 4S1SL 4WWKB 2X10A 1UQSA 4PRPB 3R19A 5CP3H 5CZXD 3WFEH 4JPIB 2UYLA 5SV4A 4M7LL 2FH6A 4XH2A 1IKOP 1A7PH 1Q9WA 1LK2B 2CM6A 3O8XD 5C0AB 5KANI 3HA0A 5T1LB 3N44B 4JRWA 3BZ4A 1J5OH 4IGBA 4PJ7A 2JXMB 1KLGA 2K8QA 2GC7C 4FI7A 1MRCH 5EOQL 5KVDH 3QNYA 4MMZC 4OT1H 4JHVA 4NO2A 1QD0A 2VZUA 4MZIA 1BF5A 4BFGA 2KI6A 3H42L 1X4ZA 3ME0A 1U8PB 2PYEE 3UAJC 1OE3A 2WANA 4KFMA 3NSCA 3X1NA 1AC0A 1P5VB 1ZVHA 2N56A 4C56D 4D0CB 3HKZA 3GK8H 3FSVA 4LLVA 3WL9A 2R1XB 2LTQC 2E6JA 3T1WA 1NKRA 4Y88A 4NNPH 5AZ2H 1AO7E 3OR7A 3BPNB 3CVCA 5D1QD 1AGBA 4P59L 5HHOA 4DZBB 4F57L 2VSMB 2XHNA 5I76B 2F5BH 5IJCC 1DUYB 4OVUA 4XXCA 1WVZA 4NQTA 4CADA 3BKJL 4K8RD 1G0XA 5BVPH 3IFOB 2YD0A 1QBAA 3LZQA 3GBNH 3COOA 3TBTA 2CO3A 2W88A 3BOVA 3GMQB 2BSBA 1DHKA 4RGNC 3BDYH 2YUZA 5EWIH 4FLQA 4ZXBD 5F88B 5AW9B 5EF3A 2E75C 1BX2B 3IFPA 3RGVB 1E4XH 3CPLB 2MRYA 3ZKMD 2WCGA 5C0DA 2QLYA 5FF6A 3GSWB 3SDDC 3ECQA 3P77A 4GAGH 2KUTA 4FD0A 4ISVB 3EG9A 4QTIL 4JO2H 1T7VA 4LLMB 3BH8B 4F7EA 1SPDA 5E8DH 3IXAB 4O2EA 2ESVE 2DMKA 5I5RA 3ULUE 3S6CA 4OCSH 3SBWA 2YJLA 3DDFA 4FQ2L 2V2XB 5IHBA 1CGSH 3Q2LA 2Y7NA 3QP3A 1B4JH 5K9KB 3BP5B 4JZNA 5L2KE 4H26B 4K8RH 4TLUA 3F58H 3NJLA 2X38A 1FNFA 2RFXA 3RNQA 4Y9GA 3RFZA 1FPTL 4OZIF 1K8IB 1XWVA 4KRPC 2DQUH 2GTZA 3HHSA 4ERSL 4QHLA 1ZS8A 2KQMA 3MRMB 3PWLB 2ICWA 4I8DA 3KPRD 4A67A 1SLXA 3CDGB 4MJ6B 2XWEA 4DGWC 2P8PA 2YQBA 4KVPA 2J4WH 3K0YA 3CMOH 2W60B 1RP9A 1GRWA 3WUZA 3GZKA 2Q86A 2CBPA 3WS6A 4Z7NB 1H9DA 3ELQA 4NWUL 2L7JA 4OF0A 1AXTL 4KI5F 3MJ9A 1FNEB 4AGMA 1UFGA 1ZT1B 4KQ3H 2UXFA 3QPQC 3ZHFA 3QEHA 4L3CA 5EUOA 3ZRCC 2UV3A 1MVYA 4XXDB 5BRZD 1TKWB 2YQ2A 4HSQA 5HSFA 1FDLL 2GI0A 2YXVA 1IL1B 2IAND 1FFNA 2Q20A 5LWYL 1JTTA 1U91B 1KCRL 1L9TA 1UEMA 3AROA 1U3HD 4JY5H 4TULH 5L4IA 1BA9A 3VXUA 3D9AL 1FZMA 2NX5A 3QQNA 3FL7A 3FO2A 4IK6A 1OE1A 4PJAE 4NOFA 3VD7A 2YPVA 3DURB 2Y6TE 4HEMA 4LPYA 5H94B 3VQLA 4DAGL 4JANB 3VG9B 2FJSA 3R0NA 1XVSA 3KPNA 4UIKL 4K23H 2V5TA 3UTPE 4L1LA 4DK6A 4LKXA 5ACLA 3K1DA 3VFTB 4M7LT 3O6MH 5A43C 2ATAA 5BRZB 2FB4H 1P4IL 4EI0A 5IHHA 1NUFA 3OGCB 4YHIB 5DD0H 1DBKH 2X9YA 4LLUB 5IVZB 4LAJH 5IFAL 1U3HB 5IHZB 1BEYH 2PCXA 4QNPF 4D9QD 3KPLA 4XWGH 2GITA 5LXVA 4JHZA 4K4KA 3ROLB 4W9ZA 1HIML 2VXQH 2HVBA 4Y5YB 3W0WE 2E5EA 5AG9A 4F92B 1VFAA 5JHLH 3FO9B 3BEWA 3TO2A 1NAKL 3RI5F 5JMOC 1RJLA 3MJWA 4ZZKA 1U58A 2BOCA 4E2OA 3IFLL 5D6DC 3L3OB 5IJDC 1BM7A 3K3QA 2WCSA 5SX5H 1IO4C 2OSXA 3B9KD 4HIEA 5GRVK 4ENEC 2X9ZA 1TFPA 4JB9H 1LQSR 5DQJA 3KGSA 3DX8A 3FQRA 4QRUA 1XR9A 3V8CA 2N01B 1KXQE 3HJ0A 4G6AC 4IM8A 2CPUA 3LHAA 3UZQB 5ERWB 1ZEAH 3V6ZA 5DK2B 1M6OA 3N5AA 5KUMA 4GRMB 5EU5A 4O02L 2BSED 3C09C 3ZZQA 3ZL1A 3BUDA 2YMXL 1EJOL 4JRFA 3STLB 5FOJA 2HTLD 3D4YA 4JKLA 1T0MA 2ZXQA 4QAMB 1F11B 5E1HB 1W8EA 2BVYA 3QWOA 4L2YA 5GJTH 4EIGB 5IB2B 1GSMA 1FAIL 2B0SL 2WTRA 5B3JF 4Q0XH 3PCYA 4YH6A 5A2JH 2VAAB 1MHHA 2XG5A 2Q7YA 3LQAH 1OAUH 1R46A 1YNTB 5K9JL 2H6OA 5JW4M 3PWUA 2F08A 4UT9L 5FUOL 4LDEB 3X12B 4RFNB 3D7PA 4PW4A 5BVJA 1ZLDA 2B1HH 1OARH 4DKAA 4NDMB 1JZ8A 3VSQA 4U6VL 2UZPA 1PKQB 2I07A 5F96L 3K2UL 2Q3XA 2OW7A 4FLRA 1IEHA 4XNQB 3HVNA 3VXRE 5DVLA 1ZLWK 3DIFB 1N19A 3V7MA 1A1NB 4UMGA 4MA7L 1I4FB 3DV4B 4WTWA 5LQBH 5C2BL 2FTAA 3RWIB 2EDKA 3OPUA 3SJVD 1P84K 4BFEA 5DRNA 4ZFFB 4N8CL 3QRGH 3ULSA 4G8GA 4LOVA 2JIXB 4FEIA 2WBJA 2DJ4A 2XN9E 3KLDA 2XQYA 3IU3B 1Q9KB 3H9HB 4HG4K 1CDCA 1ZA3B 4Y5XA 2J8UA 2R2HB 4N26A 1LMIA 3ELAT 4DW2L 1MW2A 1QATA 4GRWE 4UTAL 1EHAA 5DJ2A 1KN2H 5DR5H 3RX7A 2FUQA 2K7QA 3DX0A 4X7SH 3QXDA 2X4UA 4FNSA 5DFAA 1SOKA 3CAFA 3NP3A 1UB6B 1FFOB 3MJ8A 2YC1B 3TT1H 4Y9EA 3LN5A 5E8OA 4AYDC 2BZDA 5D93C 3V4VB 5CHNA 4BK4A 1J8SA 2GT9A 2RD0A 3EUDA 1TTBA 4HU2A 2ORBH 4PJ7F 3UC0H 3HS0B 2WIMA 2UY6B 4GEIA 4OJEH 1S7UA 1BOGA 5D70L 3MYJB 1HQ4B 1INEH 3D3VD 4P3WA 2FWUA 3V4VH 3FTWA 1H9VA 4J6RH 1WZ1H 3T08A 1DBBH 3HZMA 2CGZA 2FD6L 4X6EB 4JR9H 5E24E 3ULVE 1CR9L 3NESA 1K4CA 2XA3A 3FQWB 4E41D 1TYRA 2D0GA 4WO4A 4FQIH 4YBQC 1J8KA 1V5JA 4P2OB 3VFRA 5FX3A 5ABZA 5KYWB 2XNAB 3GI8H 4UUJB 4LBAA 3V9EA 3MRKA 5DURB 3MNWB 5I0YA 5J9PB 4MA3A 4L5FL 1P7BA 4NS0A 1XR8B 2HRGA 2VJXA 3QEGL 4Z3TA 4L18A 2FJFB 7FABH 4JPKL 1WTGT 3NFPA 4JMXA 3S37L 1ILSA 1GGYA 4X8JB 3ZVVA 2KZKA 2E74C 3QEUA 3D05A 5IEKA 1N6QH 2ZAIA 5F89A 4WWID 4HFWA 3F7QA 3H3KA 4X5XB 1QFWH 3MBWB 4WJG3 3E6HA 2CIIB 2H45A 1BFSA 4XCCH 5F71A 4KK8C 3KZ8A 3NP4A 1DVFA 2V5MA 4G82A 1EFXA 5MEQB 3IPBA 4I1RA 4WV1B 4JGJA 4E9VA 1KZQA 3ILQD 5F1OB 1T5WA 5CFAA 4O02A 4JG5A 3FFCA 3ARFA 3RX9A 5DQDH 3BMVA 4JLRA 1B2WL 1G4RA 4IDJH 1EEUA 2VMEA 4LCIH 5ANHA 1Y6KR 5KG9B 4J39A 4LF3A 2IDCA 2VDLB 4XAKD 1UUNA 4LLWA 3BQUB 3Q2WA 1ZANL 5LAPA 3BIKA 1KTCA 2KZBA 3UYOD 4OV5B 3P3UA 3IBOA 3P2BA 4CMMB 2ERJB 3KR3L 5DUML 5J11B 1IE4A 4AQOA 5GZND 3V7AE 4NQEE 4ZOBA 4OZFG 5F9WB 2DWTA 4UT9A 4LPXA 1T4KB 4QJ5B 5C07D 1IAKA 3GB7A 1UZ8B 3U1QA 2D3VA 3Q9PA 1QA9B 1U93A 2NY1C 3MTXA 5A40E 1OTSD 2UZYB 4ODHH 2VRQA 3QZNA 4N5ED 1WFMA 3FT4B 4KI5C 2XV6B 1XFPA 1JPGA 2J3SA 3RL1B 4KROC 5D7LD 1I1RA 4LSUH 1G7QA 4PMEA 5B1JA 1MXDA 1KLUA 3GSQA 3QFJE 4PVMA 3PWPE 4XMTA 2Y5TA 4X42A 1OY3B 4PVLA 5JOFB 2ED7A 5DWUL 2X4PA 4I18B 3F64A 4JRXB 1MHCA 2VO8A 5DHEA 1IJ9A 1DLFH 2AI0L 2CR0A 2NR6D 2OTPA 3PAVA 4DCQB 2V2WB 1IM9A 1S78C 2NY5H 2VN7A 3L4CA 4K2UH 4WSGA 5DD1L 4YHKH 4JO3H 2AJSL 4IU3B 3BN9D 1C8QA 1XXFC 1YY9D 3N40P 4OCXL 1GGIL 2APWA 2DM4A 1E9PB 4JFED 5JMRA 1XCQA 2AAAA 2E6QA 3E1ZA 1IIKA 3Q8BA 5E2TH 2Y4SA 3V6FA 5KBLA 3WKPA 3IMUA 4TTDC 4YDIL 3SDYL 2GHZA 2I26N 1Q1JH 1XMEB 4K9JA 4WDIB 4BZ2H 2DW5A 4YAQA 2F53D 1ES0B 2G75A 1MREL 1C1EH 3FB5A 3L81A 3LIUA 3CNKA 4L4TA 4MJ5A 4D94A 4CRPA 3L3GA 5ANMA 2HAZA 4M62H 4DGVL 4NZJA 4WTZA 1FLTX 1AXIB 3QARA 2VW4A 2WLJA 2DLFH 3TBWA 4FZEH 4I9XA 4OI9A 2R0ZL 3FB8B 4P5RA 1FO0L 4JFEB 4WFED 5DC4B 2WQXA 4GQ9L 3IJHA 4QRPD 4KI1A 5DJ8B 3BPLB 3E3QC 4JHWH 4AM0A 5L88L 3UBXA 1BIHA 4OI7A 1MWAB 4AYBA 5D7JA 4F7CB 1VERA 3FQTB 3RA7L 1FBIH 4D7BA 1I1YA 2X1QA 2EZ0C 4PWKA 1ET7A 4LAQL 3IJYA 3C2AH 2F53B 5E2JA 2YGVA 1IBYA 1MWAH 4XMPH 1I9JH 4APQD 3MA9L 1UGKA 4I9WD 2L04A 2R29H 3U0WH 2YUWA 4ZT1A 2VLMD 3LD8B 2DYSB 4OJFH 3FSZA 5T1KD 4ICWA 3NH7L 1AAJA 3GHEL 5B1BB 2BS9A 3DX4A 5CJXA 3O3AB 3ZQXA 2HVKB 3PWVA 3GSNL 2XJKA 3V6OA 1HFUA 1USQA 1O6SA 4QRPB 4LASH 5CJBA 5E2WL 1MFCL 2WXHA 4XPAH 5FCUL 2X4RB 4XNDA 1SHSA 4OLEA 1MNUL 3PHQA 2V17H 1R4XA 2BMKA 2W92A 2WN2A 4ELME 3ISRA 4ORGA 2CDFB 1I8LC 3WNPA 3F7PC 2X53A 1B4LA 1XF4B 4APQB 4Q4IA 2DLTA 1BFVH 5LBVA 2M2DA 2PTTA 2MKLC 4S10A 1GGBL 1L0QA 2Y3NA 3WKMH 1TVBA 2VDKL 2C4XA 1NDGA 3IKCA 2ESVB 3HRZC 1D5ZA 3MBXH 4GKSA 2O6DA 2GI7A 2ZT9C 3CSYA 5DI8B 5DK0A 4KC3B 5LHDA 3FZUD 1H8OA 4U1NA 1OAKL 4NZUH 4N0FA 4JDEB 3NAAL 4PRDB 5FK9B 5L2KB 2J8UF 3HCVA 3CDZB 4ONHA 4HW6A 5GSRB 4L0YA 5BO1L 4AYMC 1YC7A 5JR1L 2V9RA 3ULVC 3BP6A 3QUXC 1GHFL 4ALAC 3E9TA 3V10A 1KB9J 1OM3L 1JGEA 4TUKH 3L4WA 3P4OA 2AK1H 3B1UA 4CKVX 4G5ZH 4ZG1A 5ADPL 2A2QT 2OMZB 2PXYC 3WXVH 2D2OA 3KCPB 5CMAA 2DLGA 4MXWH 4XP9L 2JMRA 3P69A 1RLBA 2RCSH 1Z0NA 4J3BA 4RVBA 4V2CB 2GB2A 1KBGH 3MBEC 1VZIA 1E8WA 2Z35B 5GRJH 3MVSA 3GLAA 1R5WA 1D5XA 4X0KB 5DD6A 3OR6B 3FH7A 2A9DA 1VJSA 1KY7A 3KLSA 4IQHA 5EIQA 3S37X 1DVSA 2X1PA 3NGBC 2MKWA 4U0RB 1R3LB 2ZUXA 1KB3A 3CQQA 4LVHB 2DQEH 3NZSA 4OGYH 1Y7VA 4Y4HD 3WELA 5LKNA 1T80A 1ZSHA 3FRPG 3TA3B 1FL5A 1NCAL 4M8VA 4BH7B 1KIUB 2EDRA 4PJAB 2IBBA 1H3TA 1MCBA 3APNA 4P3CL 3VXME 2KERA 3D25A 5JIQA 5K39A 3RZCB 4O9HH 5ILTH 5SWZA 3W82A 4NCC2 3WIAA 3VH8B 2J1WA 4S1RH 5HHXH 2BSSA 2R9HD 4XXCC 5K9OA 4R8WH 1MEXL 4WI6A 1FC1A 3AQDA 2FX7H 4NKOA 2CG9X 4AE1A 2YBGA 3BH9B 5H35A 3O2WL 1MFDH 4ODUA 4B9CA 4BINA 4N8UA 1IC7L 1X7QB 4MS8C 3KPOA 5TGBB 4NSKA 3NIGE 3VB9A 1QUNA 3JWNE 3GXTA 4RRPA 3RE0A 3SB3A 1FO0A 3LX9A 1J11A 2BVPA 3W0WB 2R2EA 1WCBB 2AJUH 3IGUA 3T4AB 3HFMH 3R8BB 1N2RB 3SODB 2BFVL 3IEAA 5EBWB 3EYUL 1BG9A 3GGWB 4IK7A 3EJTA 5FYKL 1SBSH 2CPCA 1LNUB 1U3NA 4MJ4A 3ABGA 4FHBD 1HI6B 4I85A 2X1OA 1YY8B 5AG8A 4HF5L 5HDLA 4PG2A 4HVBA 1KGCE 5A2CA 3T0XA 5FECA 1M7IA 3NMEA 4I0KA 3KM1A 3VVWA 2OP4H 3QQDA 4YN3A 4MNQD 5I1HL 2VN6A 1EX0A 4GS7B 3OVUB 4KDTA 4EEEA 1N7MH 4AVJA 4XP6H 1RMFH 2DS4A 4OW6A 4X8GA 5I8EB 4S1DD 3LIZH 5LG6A 2IBZX 1F4HA 4PJ9B 5ESQA 4NJAH 4MQSB 3VMPA 2Z7WA 1URIA 5CIPH 3RIFF 2AEOA 1JMZA 4NC1E 4MSWA 4XVTH 1UA6H 4AKPA 4OLVH 4WW1B 1VKXB 3DRTA 3FW6A 4J1UB 4DKEH 3MCLL 1GR7A 3KS0J 5FHBH 5ICXB 2XN2A 4JCMA 5KSAA 3RWGA 2Z6FA 1PZUB 1RZIA 2VWEC 3UYRL 3WTYA 2D7TL 1L9NA 4ZW3A 4RDQG 2YFNA 1QLEL 3MLUL 4MNGA 4GW4A 3P4NA 3PFQA 4ZNCD 4N20A 4LNRA 4ZTPH 5HVFB 4NUMA 3H6JA 5HJ3B 2XN1A 5GGRY 1J18A 4ZFZB 1JNHA 3AREA 1JF1B 5EOCJ 2Z65C 3QUGA 3KLAB 4QEGA 4G80A 5J06A 3BLPX 3DO3A 4YBLC 4Q8BA 3N42F 5HGHB 2R4RH 1XEDA 2LVCA 4NAMA 4XNUH 2IFGA 1DBMH 4LDOB 3F8UB 2XVKA 1Z9LA 2Q5BA 4GW5A 2CLZA 1UKTA 4WFFD 2CM5A 4G8EA 3TZVA 1MUJA 2V8MA 3POCA 4NQDA 4AZUA 4DTGL 1T0OA 5DFVD 2XSKA 4N3TA 1CN4A 1IGCH 2VABB 2XYCA 1W15A 3ARBC 3NSFA 1W91A 3HRZB 4JFHD 2WXFA 5KSVA 4RNRB 1IZJA 3QCTL 3PGCA 3VGDA 1X9LA 4XI5C 3GPSA 1ZPUA 2B59A 2GJPA 4X6FB 5DA0B 1G7HA 1AR1D 1NDMB 1P4LB 2FBJH 2EJ1A 2PABA 1HHHA 1QVOB 2GK0B 3HNVH 4H8UA 1EXHA 3EYVA 3EIFA 2YBRA 3F6LA 2YD3A 3E2HB 1E5BA 2XVGA 1BPVA 5D2LF 3QIWD 3DRQB 3KPSE 2OKMA 3O6FC 1RVFL 3CXFA 4YPGA 1MCWM 3S96A 1NLDL 2IDUA 3CFCL 4GSQA 3X14A 5FLVA 1CG9A 2IXQB 4PM1A 4BQ8A 4OLUH 3CFUA 1H8NA 1A65A 4HS3A 2D8KA 2IEPA 5DHYB 1OGSA 1UWYA 4WUKH 3S0PA 5TFSH 1AR1B 2DTML 3D2UB 3RTQA 1IE5A 2ADGB 1ADQH 2D3NA 2LU7A 3CVBA 3VI4E 1AQDA 1PU0A 2AVGA 4W9CC 1YQVL 2GJ6A 1T5XB 1EZLA 1T1YB 3DPBB 3QZOA 4L4VE 1CVSC 3QIWB 3IGAA 3QULB 1E6OH 5DVNA 3FFDB 3QIBB 4JL1A 1X5FA 3ARDA 1BQHG 1S9KC 2ZP0T 2X2IA 2FSDA 4Z9KB 1M2VA 4BE6A 5CSGA 5AYUL 1KXTB 4X5LA 2DD8H 3IXTB 4P9MH 4TF4A 2P5WA 3O3BB 4X5PA 4QJ4B 3LY6A 3HFFA 4JRYD 4ZUSB 4N2GA 1B0GA 5CN3A 3B6SB 2K45A 4UMSA 4GUPA 4WY7L 4JG9A 3PXLA 5I1KL 1RURL 2DQDL 3I9GL 4NQQA 1TJHL 2YRBA 3FTXA 4Y5XC 3KPMA 1PLGL 2FX9H 1MHEA 1CIDA 3EOBB 2A4ZA 2X7LB 4JW3A 4IKIA 5F7NC 1U8LB 3CFBB 1JL8A 2NYYD 4NQEB 3MRIA 4CNIB 4LESA 4WF7A 1CK0L 5D71H 4P4KD 3BEVA 3TTSA 2QELA 2P43B 3JZ7A 1E43A 3UTTA 3OKEB 5E7FA 3ZGHA 2EP6A 3FFOA 4J2XA 1LO0L 1A6UL 3H0TA 5IGXH 2HJKA 5DJZA 5CN1A 4B9FA 1MG3C 2X4QA 3PWPB 2F0CA 3RWEB 4AV5A 2A9ML 5DUPL 1LLAA 3CVDA 3WHXB 4GI8A 4GRLD 4XCEB 1N0LA 3IMSA 2V5RA 5EFIA 2GFBA 4ZMLA 1BIIB 1CJYA 1OCCB 4LCUA 1E65A 3CSTA 4L8CA 1TJIL 1K5NA 4F15B 3VFPA 2NY3D 2P49B 4NPKA 4QHMA 3DGGB 4S1QL 2D4DA 3SGDI 2GEQA 4XN1A 2XTJC 2OMUA 2WP3O 1GW6A 4Y16A 3TO4A 4LCWD 1MSPA 1PCXA 3CJJA 4OJYA 4UOJA 4LSVL 5CKAA 5I26A 3OBAA 4Z7QF 1G9NL 3IF1A 4BFFA 3BZEA 3H2PA 4X9GA 2HLFC 1CCZA 3INUH 3MLXH 2BY3A 3K6OA 5AAMC 4XPTL 1IGIH 1U9KA 3LKOA 5H4ZA 4DEPC 1ZLVH 3PG2A 2DQTH 3OKLA 5ESAB 5IFHL 5FO2A 3IJ9A 3L1OH 1XIWD 4I0PA 5FUCC 4EXKA 5L9DH 1FL3B 3CIQA 4OD2B 1L6XA 3BUTA 3ZHLA 4QHUA 2IADA 2DKUA 5E5MB 2BXZA 2JKIS 4U6YA 2VIRB 5E51A 4KNUA 4HWEL 1DBJL 3B34A 2MNJB 4EAEA 1A4CA 1TCMA 3WNMA 3ZX1A 1IBZA 4P2RE 2F54E 1FGNL 4G42A 5DJCA 1AR2A 4YEEA 1DVFC 2HX9A 2CUAA 3TPUA 1JVLA 4M5ZL 4AQEA 2HJFA 2XXFA 1J86A 4PWFA 4JFOB 4JQIH 3CFEB 4AVHA 4HOXA 4LCYB 3JT2A 2Y2YA 4PP1D 4QAWA 2DQJL 3ORJA 2DAVA 4EVNB 2E46A 1BQLH 3VXTA 3OZ9L 3SE9H 3FOMB 2D03H 4RMSA 4IBWA 1CL7L 1G9MH 3KGRA 3A4FA 5J57B 1IVTA 3QQ3A 1DQDH 3HJEA 1VDGA 4AMKL 1I8MA 4OQ1A 2OULB 5BQ7B 1A6PA 1H0DB 4ODTL 4Y8AA 5ETUB 4HS6A 3BAJA 4ZMOA 4GSRA 1VPOL 4B41A 1CFBA 3SDCB 3GUTA 1SFDA 3U9UB 3NN8B 2JELL 3G6JF 1WO2A 2WPGA 4KO6A 2J12B 5HYJD 3QPXH 5BZDB 2R27A 1LJMA 3OX8B 3C5XA 4BH8B 4ELMB 4EJ1C 4KRLB 1HJBC 1I3GL 1OQOA 1Q0EA 5B1JC 5HPMB 1Z9NA 5F1SA 3EFDH 4MCNA 3JV4B 4KJPC 4FZ8L 5F1KC 4XVSL 4R9HA 3EYOA 3CVHH 4ZPVA 5T1DH 1FZKB 4DQOL 3V4PB 3Q6GH 1WFIA 4HK3N 1JGVH 4UIMA 3IE4A 2JLPA 4RH4A 5I73C 4NYLA 1PY9A 3ALWA 3BP7A 1T83C 4A68A 4W9HC 4IU2A 3OAUL 4PY7A 4AJ0A 1V3LA 5ACZA 2VDMB 2VR4A 3HZYA 3LKNA 4X99A 1HCFX 1UUSA 4BUGA 2J21A 4V1DA 4MLIA 2E59A 2JCCB 4E5XG 4LSRL 3UERA 4UM9B 5F3HA 3IVKB 2HB0A 4L9LB 2R2CA 2VDMH 1QAWA 2EADA 5TE6L 2R69L 2CMRL 4BELD 3WAKA 3SQBB 3AY2A 4GW1A 3PPEA 5AVSB 2ZOLB 4ZMTA 3WJMA 4JDVB 4OVVA 1G7PB 4WCYL 2DIEA 3EGXB 4E68A 3EYSL 1AHMA 1GOFA 4ES9A 2Q8AH 5C09E 2IPUG 3OLGA 4GUQA 4I3SL 4CVZA 2J2ZA 1IC4L 3T0EC 1J8RA 1ASQA 4EBQH 2MOQA 4MD5A 5SX4H 2XKUA 3CC1A 4TUOA 4AITA 4J27A 4A2GA 3IRZA 4Z3GA 4QLRA 2XY2A 4YO0A 3KXFE 4S0SD 3ZR6A 1JK9A 2R39A 4HJEA 5T3XE 3MGTA 2XWBA 2CLRB 4H8PA 5GSVB 5A1AA 3QS3A 5H37H 4JFXB 5AB1A 2AK4E 2H26B 2EUWA 1I53A 1UHVA 4CJ1A 2QEJA 2EXYC 5FYKU 3TYGH 3U36B 2KLTA 5TE7H 4QUOA 4RIRA 2CIKB 3UO1L 4F8QA 3TYFB 4XCNB 4GEJA 1CICC 2QFRA 3VXMB 2O5XH 5AYQA 3AWGA 3FHEA 2FECI 4N0YL 3T3MB 4A63A 2B16A 5L8JB 3ZKXB 1Q72H 1IBGH 3GMPB 1PZ5B 4HISA 1A6WH 1KEGH 5F9JA 1C5CL 2XQBH 4HKBA 3UZVA 1KN4L 5AOJA 2ZUTA 3RI5K 4JFFD 1DVZA 4JNXA 4XWOD 4HKZA 3FONA 3SOBH 3OHXC 4EUPG 4XNYL 4S2SA 1DDHA 3MCKA 4OUUB 3C08L 1HX0A 3NIGB 2VLJE 3DVNB 3GIVB 1Z5LA 2FQDA 4YUEL 4QRTB 1WDAA 1D6EA 3M45A 3QJOA 5EC1B 2MQGA 2NZIA 1TJGL 3NEOA 2ZX6A 3F6JA 4Y1AD 5C08E 1NFDF 4NZRH 4PJDA 3HG1E 3OQ3B 3BKMH 5KVGE 4JFFB 2Y7LA 4Z3EA 2ITCA 5F0MB 3ESMA 4UTBL 5FB8A 3ZZ1A 5FW8A 1GCYA 2WO4A 1OE2A 2Q3ZA 5HHPA 1NBZB 2CA3A 1M7DA 3GEWB 2VC2L 3U0PA 5IHUH 1IRAY 1GY2A 1WWCA 3BVUA 3V0DA 1W72L 4LEEA 3ARWA 2F8OA 1N8ZB 3TN0B 2HP4A 1QFUL 1QLFA 2A6JA 4U1KB 4AQAA 4G8FB 5FGBA 1HESA 3L4UA 1K3ZA 3FQYA 2HN7B 2HT2D 3SDAB 5JHDA 5IJVB 4WNQA 1OZUA 1PAMA 1N26A 5FW6A 3B83A 4MXVF 4EF3A 3P0YH 5AW8B 3ZE1F 1J10A 4OLYH 1E0OB 4Y1SA 4MCYB 2ITFA 4BKTC 4P07A 1IGJA 1T7ZA 4OCMC 2ICEC 5BOPA 2LFEA 1ETB1 1LP9E 3NTCL 4AUJA 3ULAB 2ZAHA 3N6YA 1MQKL 1N8OE 2GY7B 4G8AC 5JQHC 1JZJA 2C4FU 1M53A 3SE3A 2H6PB 2DIBA 4N2OA 2EDWA 4PV8A 3T2QA 4WAFA 5C9KA 3IJEA 2HRPL 3PIQB 2EDJA 3FB6A 4X9FA 1ZLWH 3IFNH 4J23A 3FAWA 3WMQA 5JPMA 1C5DB 3GKWH 3IJSB 4BA8A 1JBJA 1SJEA 5TH2B 1WIUA 4NLHA 3GEFA 4QT5A 5DTFB 5CR1A 5L2JA 2VR8A 4Y7MA 1DJSA 4PFEA 3VRLF 1SXBA 2O93L 3DK2A 2VDOB 3DX7B 4JFDA 2YSSB 3LNIA 1CD1A 4U1HB 4U2ZA 3VFVA 1O5DT 1R24A 3PQYD 2Q87A 1ECYA 4E9QA 3HB3C 3HBQA 4W9DC 4NRYA 4ZOCA 1NCHA 5KYXA 5J13C 2JJTA 1TQTA 4H5SA 4LQFH 4Q2ZB 3TWCL 4LVNC 4XODA 5DLML 2K78A 3OPZH 2YGPA 5IMMA 3TP4A 1FVDB 3ZL4H 4LBEB 3MJ6A 1OSZB 3HZKB 5CP3A 4PJBA 5I0ZA 3F62A 2OTWA 5ITFA 4L8DA 4X8CA 3CK0L 3K8LA 4ZUUA 4Y9CA 3QGVA 4XP5L 3VWKB 5B22A 3L4XA 2OL3L 4N1EA 3HPLA 4FXGB 5DMJB 3IPFA 5EV7A 4HIIA 4NPYB 1U6AL 1YNKH 5T5NF 3O81A 4L4VD 5LXGH 3W9DA 2HPTA 3Q0HA 3KPSB 3PQYB 1LO3L 2W07A 4XPHL 43C9A 1L4IA 4RFEA 2OTUA 2EQDA 3L7FB 1T3FA 3T9WA 4M93C 3ZDXE 2FHFA 2OXHA 5C0CA 1A4AA 4P5TB 1OQXA 5DHVB 5KJRH 2OS7A 2I27N 1XF3A 3DA0A 4N6QA 3QUZD 2ZF8A 4MNHA 1NUNB 4H8QA 4JDZA 4JPVH 3VI3A 1J88A 3RVTD 4ZFGH 1RZGA 5DHVH 2DYPD 5IMLA 1A7OL 5KN5B 3FQ2A 3MRJB 2NXZB 3QUML 5EU4B 5IJBC 3VI4B 4GG6E 2CDGB 1H5BB 3NSDA 4JO5A 1IC1A 5IM7B 3ZXAC 3OKDB 3OLDA 4UNIA 5F8QC 1CFQB 1M05B 2XXGA 3G6DL 4L4VB 3F6IA 1UZGA 4N6RA 3ZMRA 4Q52A 1OTUC 1SBBA 3DUSB 5GGTH 5KSAC 3S98A 3QDMA 1Q90A 2JJSA 2ZYIA 5DXWA 5EZJA 2E7LA 2P5EA 3I75A 4I87A 4I48A 4RLDA 3OG4B 1TTFA 2QL1A 3OQRA 4LE8A 2J6EH 1HL8A 4PV9B 1U92B 3QUZB 2HJLB 3RVWC 2WUCL 3QDJE 3LAFA 3TBSA 4C56A 4E0RB 4JQVA 1UCBH 1PPIA 3KYOA 3GT6A 1SYVA 2WNWA 1CU4H 1MIEH 1TCRA 1W72A 2AEIT 3GZOA 3LS4H 1JWUA 2ZJSL 2H8PB 3ZE2F 5I1AA 4ZS6C 3QAZB 1TQUA 3QWRD 4JFZH 1CLZH 1V7ML 1CFSB 3PLYA 4YHML 3Q44A 2ZWYA 1EEQA 1QQDB 2XETA 4GO8A 5DS8B 5F93C 2IV8A 4ZMZA 3D33A 2V3DA 1G1CA 3WEOA 4F37F 2Z92B 2ENPA 5FM5O 5DEFA 4N2DA 2VITB 2WVTA 4A7QA 1OVZA 3JV6A 1PZ3A 2KH2B 3EH5B 2BOBA 4G9DB 2AGJL 3AITA 1JVKA 1X3DA 4Y4KD 3GMMA 2WLYA 3MV11 1BD2D 5LLIC 5C0RH 4NIKB 2E0PA 5I15L 3BYYA 4BHUA 4X6DE 5BUPA 1PTZA 4R5XA 3RU8H 3ABKB 2EUXA 2ZX8A 5FO7B 3T8XB 5KS9A 5DYOB 5F9AC 4A38A 3NK3A 4JFYB 1KENH 2FX8L 5BRQA 5I6XC 3LB6C 1AGEA 3G5XA 4IOIB 3CSBA 5E6SB 1ZLUK 1T20A 3LXBA 3S7GA 1JERA 1QSED 2ZSWA 5F9OH 4GFTB 1M1XB 1XXDC 4MJHA 3GIZL 5I1LB 5C0IA 5D9SA 2NDGA 5BJTB 5AL8A 3GI9L 5IBUB 4GKNA 1DQLH 3GMRB 2IPTL 4X5QA 3BT2L 4KMTH 3DGDA 5TDNB 2R8SL 2DL2A 3BZFA 1BD2B 4HJUA 3MLYL 3I6KB 4LGRB 5C9JB 4R90L 5C0FA 3CZFB 4XVJL 5AWNL 1N5YL 4OAWA 4X7TB 3UZEC 3D51A 4KZEH 1JFQH 3KPRA 5AW3B 1CTOA 1UASA 4F7PA 3IBEA 2DQCH 3VM5A 4TLTA 5B39G 1NC2B 5IR1B 1EANA 2EDXA 4PJIF 1QSEB 5FYLL 3H9SE 3CLFH 2OZ4H 3G5YA 1R9FA 4LLDA 1HILA 4L1DA 4ODSH 1PD1A 5DMKB 5DUBA 3QXVA 4LT7A 2AJVH 2OL3A 4EO5A 4PJDF 5HXMA 3PJSA 4M1DH 2R1WA 4P2RB 2F54B 5CGBA 2Y6SC 4U3SA 2EVGA 1YJDH 3BW9A 2BVQA 4DK5A 1BJ1H 4MHHG 3JTSA 2MWCA 2QQKH 2DPKA 2VDNL 5JHLA 3HBZA 3RNKB 3BD5A 1RZFL 1Z1WA 2PPCA 2D0HA 5IOPB 4JDTL 3BN3B 4I3GA 1XTMA 2I9LA 1SFHA 2ALAA 5B8CC 2VUYA 1UD2A 4F2MA 4U1GC 2VXVL 1T04B 3EAKA 4JUTA 4LB8A 1DE4A 2QDVA 4DVRH 4DN4L 5B1AB 2PWHA 5CBEB 4ZYKA 3VG0L 3ZTNH 4ES8A 2JH2A 2YPLE 4OIAA 5B4MD 4A39A 2FZ3A 5JOPE 1KEMH 2N0KA 1IC5H 1WG3A 2MNWA 1J05A 1ZSDB 5MEOB 1U95B 2I7SA 3SO3C 3SYAA 4CDHA 7CGTA 1AGFA 4UT6L 1AYOA 4QXUL 3LVEA 32C2B 1HL5A 4KVCL 4PJXE 2XRAH 1A9VA 2JI3A 3HHMA 1IBBA 3S8GB 1XD1A 2QVTA 3CN2A 4XNXH 1D6VL 1MLBB 1HYSD 1CURA 1A47A 2XQYK 3I6SA 3L3IB 1F4YL 3OKMA 3ETBJ 1UCTA 5DDHA 3Q13A 1KB5L 3D4CA 2WIIB 2Y0SA 5DLLA 4UDTB 3RDTA 3B9KA 3WCYA 4ETQB 1PG7H 1S5HB 3CUPB 3OXSA 4KTDL 1FYTA 3MC0A 1DLHA 4G11A 4WKZA 2ADFH 1NC4A 3L08A 4JGUA 5ENWA 4ENZA 2EDBA 3L2MA 3QI9B 4FMVA 1X5IA 3TO4C 5CGYD 3ZIYA 1JGIA 5T33H 1LE5B 1KCUL 4M1CD 5D1XD 2VLRD 5I1EL 3I84A 4FQXA 1WUZA 3SY6A 4TNFA 4I13B 5CN2A 3QYCA 3VFMB 4FCAA 4U31A 3MKKA 5E6IB 3U30B 2X2HA 2DY2A 5C09B 2G2PA 1F6AA 3CFIC 4I0PC 4GUCA 1EZVX 2NNAB 4M03A 2APSA 1DN2A 2QZQA 5FS5A 3BVNB 4JAMA 5DJ6A 3T65A 4MZ3A 1RPQA 1PNDA 4PJBF 2CBQA 4FTVE 4DOHE 4WENB 1QHOA 1P7QA 1XL6A 3BFQG 1F4WL 1KBKA 3KXFB 5FDWB 4K71B 4TQEH 1LWRA 2IGFH 2J7LA 1UOLA 1PLCA 4ZMNA 4DZ8A 5IB1B 3ASOB 2WZPA 2AK4B 1PYWA 1F3DJ 1S7TB 1T1WA 2FEDD 3HC3L 3AM8C 3HE6A 1P1ZA 3ZOAA 1A6TB 4KNTA 4ELDA 5IVXA 3RTLA 3H4FA 1NCCH 1RHFA 1E42A 1UH2A 1YA5A 5KZCB 5AZEL 1LK3H 5TF1L 3I2CH 2AJYH 3D6GA 4WJ5B 1D3CA 3VD2A 1SEQH 2ZCZA 4M48L 1OAYL 2JQZA 1K8DB 3OB0K 3VI3F 3WKNA 4D8PA 2CRIA 2VJ0A 3AJ7A 3QXAB 4IJTA 3ILPA 5BV7C 5AKSA 1I9IL 1N64L 1NMBH 3OAWA 1P6WA 1ZVSB 4YHYC 3PHSA 5TE4L 5IB3A 2XWXA 1ZK5A 1G9EA 3TH2T 4Q6IA 1MIMH 3E8UL 2JKLA 1YECH 3MV9D 1MNNA 4TPRL 1FCCA 4XCFH 4Z95L 2ADYA 4H8VA 4OQTH 1I1FA 3SDDD 4IHOA 1MRDL 2CALA 5I0DA 2NY6C 3RVUC 2DEYX 3QCVL 5C08B 1CZ8L 3HG1B 3RX5A 3BLKA 2OR9L 3QCUL 3VXOA 2AMUA 1GAFL 2RR3A 2RQEA 3I6LE 3VXPA 4ONGL 2Q10A 4TUJB 1DQJA 4P06A 4BD4A 1JN6B 3X1BA 4Q9QH 4HUWB 5TD4A 1LEIB 1BQSA 3RIFK 2HKFL 2HT3C 1JV5B 3T1FB 4B6ZA 3E6FB 1FVEA 3PP4L 2ZG1A 5I17B 4BFOA 4MD0B 1GZHA 3FHQA 4KRPD 4B97A 3UIYA 2ATKB 1X5ZA 2ZWLT 2ZXGA 3CN0A 4WW2B 5JQ6L 1GCFA 1WS7A 5MERB 3C5JA 4P5KA 3Q6FB 4M3KB 3BKCL 3UH8A 4Q6KA 4UT6A 1E28B 4EDXA 3BSHA 5CEZL 2XCMC 1V8HA 1WZAA 1YCSA 4YEFA 5AVWB 1NCOA 2VQ1B 3R7QA 3QG7L 3CZJA 2B3RA 2IG2H 2ARJQ 1ZY9A 3TJEL 3VMOA 2CA4A 4PGDA 4Y9FA 2IDQA 4OSUL 3N9GL 4X6CA 1IAMA 5IG7B 2JI2A 3WSQL 4PGZA 5I8CB 5KS9F 3V52L 3BVXA 2WO3B 3N85H 1WA2X 1QBML 1MJ8L 4JG1L 4KQ0A 1LP9B 1H3WM 5IB4B 2VLLA 3W11D 3LKRA 3T77A 4OLXH 3LEVH 3TV3L 4N90D 5LJYH 3IDMB 3MLVL 3L13A 5DCCA 4WUUA 2BY2A 2E7BA 3HC0A 1AJ7H 4HXBH 1G9NC 5HY9A 1PZCA 4DP2X 4BFIB 3MRHA 3Q7JA 4LCCC 4MZRA 1JPTH 3IETA 3EDDA 3NJVA 3HUJB 1K2DA 4HZLB 5IBTH 1D5MB 4G7SB 2XWTA 3B1TA 1AZVA 3OKKA 5I8OL 3LZLA 5IIEA 1CDJA 1IGFH 4JN2B 5C07A 1L9MA 2BERA 5C2UB 2BO0A 1PF3A 3L3JB 3RPIA 5I6KA 2H47C 1RUKL 1QRKA 2P3YA 1EXUB 3BUQA 3IT8D 4RAVB 1MFMA 4WU7B 3OSVA 5HBBA 1R3IH 3ENEA 3T0AA 3K0WA 3MJ7B 3BWAB 2Z1KA 1NGYA 4QCIA 2JWYA 3TCLA 2OCJA 4NWTL 3E0GA 3PGDA 4I88A 2UY7A 4QXGH 5D7LA 4AGLA 3D69B 2KLSA 1HINL 1FF5A 3F5WA 4FJZA 3BP4A 4FG2A 1G6RL 4GQZA 5HGAB 1A1OB 1QEWB 4OCRH 1N3NA 1W6WA 1KYOK 3UL4A 4ENED 5CD3A 2WZ0A 3SYOA 2NR6A 4PJCA 1S9XB 4H44C 4OUOA 3CE1A 4FTDA 4M6OL 3BO8A 1O7SA 3IPEA 4XC3L 4YVNA 5L0QC 2R2BA 2CKBB 4FLSA 4N2LA 4HBCL 5E6RB 2P8LA 1XF5A 4NKDB 3V0VB 2AXGB 4AL8L 2NY4C 2UX7A 2EINB 3EJYC 5ALCL 3Q8EA 4U6XA 5ID0B 2VERA 1W8NA 1NMCB 1BXAA 5F7HA 4XMXA 5C0GA 5TPWL 1M7UA 2BJML 5HDBF 2OMVB 1XO8A 4BDVB 5FGBC 1U8HA 3REVB 2A74A 3NJIA 3WOVA 3IAQA 1NINA 4KVNH 5A2FA 2EUVA 2XIBA 4HK0B 3WTVA 1JD9A 2IALB 4OIFA 3CC5B 1JXDA 5I2IB 2BHUA 2EYSB 2R0WL 3T0WA 4LPTA 1WBZA 3P9MB 5CCJA 1HDMB 4IBTA 1PD6A 2OQJB 4AYFB 3QR2A 1X9RA 5FOBA 1MCFA 3EXLA 1BM3L 2O30A 5HHNB 1F4XL 5LBSL 1XH3A 2EH7H 5GGVL 4HH9B 3LSOB 3BCFA 3DJRA 5FA4A 3M17B 3SE3C 3UTSE 4MJID 3U4BH 4G7VL 1YEJL 2VZSA 3DX6B 4ZS7H 3QDJB 1LDPH 4ZX4A 1CGYA 4GAAA 4R0LC 4D0DB 1U2HA 4AENB 3NSYA 3S5LB 3JT0A 1G7JB 1KJ2L 2G5UA 3TESA 3KH3A 3AAZA 1K72A 1X7SA 4JZOA 5BV7B 2P46B 5F97E 4UQBA 3WNOA 3GLDA 4XAWL 3BSZH 3B9AA 2H32B 2JB6B 4GQPH 5EUOE 5T1KA 1I1AB 3P2TA 4NOBA 2DJSA 4HV8A 4MAZA 2FWOB 1WA1X 4AT6B 3HW7A 2H32H 3GM0A 1VFBB 3UFIA 1IFHH 3FB7A 4N85A 4NEHB 4IKLA 3VACA 4MJIB 3FQUA 3C6SB 4PGCA 1BZ7B 2UX6A 1RI8A 2BX5A 2JJTC 2YGNA 3KDMB 1IQDB 4EN3D 3MODL 4K5OA 3ESUF 4X6DB 2MPAL 2Z31C 1FE8H 2XTLA 4N5UA 3L5XH 1J5IA 1SDDB 1A9BB 2WBXA 1HK6A 3E8VA 5F6HI 5CILH 2AV1B 4PBWD 4P9HH 1C16A 1JP5A 2VAJA 1IGTB 2JK5A 4X4XA 5IVXF 1I82A 2QFPA 1BQUA 5C7XL 4OJAA 1FLRL 5AW6B 1A7NL 1OWRM 2VZ1A 2OSWA 3QZWB 3GJFA 4MGXA 4NRZA 3J2PA 2QGDA 3HG0A 3DUHA 1PY0A 4EN3B 4NQVA 1OF2A 3TOPA 2ID5A 5KANG 1C5BH 1LEGA 1A6VL 4PI0A 1M57B 4NUJB 5KAQG 5HHMD 3CCHB 3ZKQD 2YA1A 1RZJL 2QKIB 1S7SB 2E3VA 2G3ZA 2Y25A 1KTKE 2NNRA 1HOCB 5EOTA 1FNGB 2OJEA 3SGEI 5B38B 2ICWI 2IH9A 4LIQH 15C8L 3H9SB 2NY2C 1HSAB 3GUFA 3VAEA 2B4CL 4OGXH 3Q48A 1P5UA 5F0JB 2DMCA 2AF2A 3ESPA 1AHWB 1C8PA 4XMLL 3KPQA 5CO1A 3V4UL 4LRNH 5I0VA 5KVEL 4JO1L 4YSDA 5JIIA 3LZFH 1E4JA 4I2XA 1RHHB 1UKQA 4JN1H 5FWQA 3L5IA 4Y4HA 4MD4A 4GMTL 3DMMC 3FCTB 2DV6A 4IRSB 3L1GA 4L3ED 2VL4A 4QRSB 1KIQA 1JZ6A 4MRBA 1BFOB 1TZIA 3FUIA 3D39D 4JHAL 2CUMA 3DHJA 3C5ZC 2OCFD 2V9UA 4N22A 2DEXX 3QNXA 4QKXB 5I18H 4XO5A 5J4MA 2JB5L 2YPLB 2NW3B 1FNAA 2CJUL 4M61A 2AQ1A 1CFTB 1A7BA 4WI3A 1L3WA 5JW5A 3DO7B 4ABWA 3OZKA 2NY1D 4HUKB 1UA3A 3GS7A 4AM0Q 1YVLA 2G3XA 4PJXB 3WN5C 3K80A 4MKMA 1AY1H 2HUHA 4X6CF 1U3ZA 3NRFA 4KI5D 4BSVB 2F74B 1SY6A 4QY8A 5D96B 4PTTA 3RHWK 1BQHA 4KROD 5F3BB 4RBPK 3RWJA 3D39B 3KVDD 4AKQA 5EN3A 3UG3A 1KXHA 1HSBA 2ZKXA 2WQSA 3BX7C 3DKHA 1YC8A 3HAEB 4Z6AT 4YK4C 3LEXA 2Y1VA 5LNEA 4P23D 2GTWA 4OZIB 3KJ4B 1OGTA 3RZWA 4HJGA 4PB0L 1Q94B 1SHMA 1S78D 4ZO8A 1GYWA 4JFSA 4IBYA 4YZFF 5HYQA 1M4KA 3FSAA 2IAMA 3HTLX 3CN3A 1ED3A 1Z2KA 3S97C 3W39B 1OKEA 4BZYA 4R26L 1PX4A 4M9PA 4UDUA 1JFHA 1BVNP 1A7QH 2FK9A 4H20H 4MNQA 2OMYA 1HXKA 4DPCX 3DXAD 4NUPA 4F80A 1QI5A 5J6HB 2ZKHH 1KDJA 4RFOH 5FYJD 3CZSA 4TTDD 4HUUB 4LPCA 2I25N 2AHIA 3QORB 5ICUA 3QNFA 1NCGA 1PW3A 1TTRA 4W9GC 4P23B 1XGYH 1BVKB 4O58L 2E86A 4YSAA 2VMJA 5EO0B 5C0BD 3B9EA 1GGTA 4O4YL 3PU7A 3VU1A 1IV8A 1ID5I 4JGMA 3HLAB 1UWEL 4GKZB 1I7UB 2X6BA 4KTEL 4X80H 2FH8A 4FTVB 4QD2E 4DOHB 2AV7B 1MFNA 4ZUTB 2WINB 1TJXA 1YYLH 3MOAH 2VB5A 5CR8A 3FS9A 3WO4C 3FUHA 1NKGA 4PJCF 4HCRH 2XXMB 3TVMC 3JV5A 4WNJA 4WZ9A 3U7WL 4KKQA 3ZTJH 2L7UA 3Q8AA 2QPFA 4HWBA 1MHPH 4YSTA 5FYJH 2EICA 1BXUA 2A6KB 5E00B 5D2NB 4MDRA 4YHOH 3C9NB 1GVIA 4U05A 3AU1B 3NABH 4WSKA 3VSTA 2WZ5A 2LAGB 4BCYA 4M4RB 1JPSL 2WYHA 2E56A 4PCSA 1EERB 3S36H 1AKJB 3ZYJA 4FFYL 2FT6A 1J8HA 2PO6A 1TLMA 4BGLA 4DQAA 1SQMA 1CDIA 1K6QH 1S7RA 3GBMH 4K7FB 4KUZH 4HGMA 2EIZB 4HHAB 1U36A 4NB7A 1MW0A 3X1EA 4DEWA 5D1ZA 2CLVA 1I3VA 1PQZB 1XB8A 2I5YL 1NCWL 3US0A 3QNZA 3B2UC 1FHGA 4GXUN 4UYQA 4H8HA 1GKEA 2H4EA 2O6EA 2EDEA 4I7ZC 4XN7A 3RDTC 3BJ91 4NT6A 6PAZA 1KPVB 4BQ6A 2PCPB 3S8FB 3DJZA 1YMME 3GNML 2W94A 2G30A 2QSQA 4RISH 3WN6A 2JCWA 3BGMB 5DEJA 2VE6B 1YEGH 4IIQB 3SIKA 3HI5L 3U4AA 4AG4H 1GZQA 2E4FA 1WE5A 3WI9A 4YGVA 3MXWH 2PYFA 2LR4A 2QR0B 4AZ8A 4B9KC 4FQXC 3OB8A 2FATH 3QT2A 2EO1A 4PRID 1CF8L 1U3YA 4E42B 1UM6L 3LRGA 1NBYB 3M7FB 2NNXA 5ICYA 1CXIA 1IKNC 5FKPB 3TBYA 3MLWL 3AC0A 3D09A 1T7YA 1N4XH 5J6SA 3VH8G 1T03H 3WFZA 2EECA 2ICCA 1LDSA 1MFEL 1PY4A 2XICA 3WLWC 1U8KA 2BRRH 2LLLA 4B53A 1AP2A 1TITA 3D18A 3RWFA 3SQOH 5K59E 4MYPA 4NN7B 2WVUA 5I8KH 1HEZA 3C75A 4JM4H 3QHZH 3JV0A 3B56A 3TX4A 1IGML 1H19A 3S35L 1INDL 5T3ZL 3VSUA 1BBJA 2AQNA 7TAAA 1NBCA 2QT6A 2QHLA 3CFJB 4MWFA 4KPHH 5K69A 4JRYA 4OFIA 2OMTB 5IW3A 5CEZE 3FUMA 4ALAH 1UQSB 4G8IB 1U8IB 1O7DC 3BFOA 3PWNA 5EF0A 4E5XA 5GS2D 5F8RC 3FYEB 2UYLB 1JWSA 5ANME 3QHFH 3H7LA 2LFGA 4D9RE 5KTEL 1EHLL 5HHOD 3TEUA 3BZ4B 1MCKA 4UAOC 1S9YA 5JTWA 4IGBB 4PJ7B 4ZBJA 3GMOA 4ANUA 1KLGB 2WQVA 4WK4B 4GAFB 3QNYB 3NFSL 1WFTA 1D9KA 1E50A 2FJUB 4R2GC 3ME0B 4WFGE 5BZWB 5JW4Q 1SOQA 4H8WL 3VVVA 3GRGA 4JZJA 3O3UN 2FDBP 1KYOJ 1DJYA 4PVBA 1W0VA 1BYNA 5D7KD 2IH1A 1JWMA 1P53A 3FC8A 4U4BA 1MAML 1E67A 2XX1A 4LLVB 3WL9B 4AUYA 3F7RA 2K0RA 1S7WB 2Y3AA 1IAOA 1M9SA 3HBGA 2EDMA 5E6UB 2CH8A 2ZAGA 1QWHA 3OR7B 5TK4A 2BSTA 1AGBB 1PVHA 4RMQA 5IJKA 3NBNA 1KF9B 5GS2H 2AEPL 4R96B 3MV7E 5L7XH 3BGFB 3VNYA 1JPST 4N8VG 3V6OE 3GRWL 4F9PA 1IAIL 2DDQL 1OV8A 4L37A 4AQ8C 4BQBA 3QO1A 2JI1A 4OCLC 4XBEH 3DIDA 3WFBH 1EEZA 1KFAH 3B2XA 1XCTA 4FFYA 1MVUA 3PFUA 1TYJA 2YMTA 4LCWA 5T8IA 1RSYA 1F6FB 3VGAC 3WEXA 2ZX9A 4DPBX 1GS7A 2NQ3A 5KBKA 1WZMA 1WZLA 2F58L 3PHAA 4U49A 2ROXA 4YPJA 2GYSA 1FNHA 5C0DB 5MENA 4UT7H 4A7UA 3EXJA 4M3HA 4EUPA 3NCJL 3P77B 2VDQL 1YEHH 2F7QA 3EG9B 3CX5K 1RY7B 4Z7UA 3N91A 3LKPA 3MR9A 4ZMPA 4JQXC 1UENA 4IRZL 2AXFB 1XIWA 4XC1H 2C3XA 2ICES 2AJ3B 2KC0A 4R7DA 1UM5L 2YLKA 3NA4A 2H3NA 5TQ0L 4K3GA 1J9QA 3EO0A 3OF6A 3QIUA 2O1AA 2ZUQB 1NIAA 4M3JA 1IQWH 1XSJA 2YAOA 4PYGA 4XOBA 4YQXH 4CC1A 1F42A 3MRPA 2RFXB 3QZLA 3ARTA 1MJUL 1IEAA 4JBSA 4XPGH 3RFZB 3GSUA 3RY6C 3RVXC 4QHLB 2H9GB 3UTSB 3V5DA 2AITA 4PTUA 2ICWB 3VXUD 5I19L 2NX5D 2ZUYA 4Y4FB 1EFQA 4MMXA 4XN9A 1KCVL 3CVHA 4F37K 4XN4A 3D85A 3NYKA 4EDWH 4P2QE 3MRBB 3B5GA 1ZLSL 3RY5A 5CLYA 3UBXI 2ZD0A 1SMAA 4KWUA 5F7KC 1FNSL 1UD5A 2VL5A 4PPTA 1F6LL 3O4LE 1KLFB 4XTRC 5EUOB 1HH6A 5E8NA 3MJ9H 4GO9A 3HZVB 1T6BX 3A5VA 4YWGH 4CILA 2J8OA 2WUBH 1FFNB 4MQ7A 3GYRA 3PL6A 3RGHA 4FQ1L 3K8MA 1YEDA 2COQA 2NPLX 4UQAA 4JY4A 1FZMB 1QTPA 3B7SA 4HPOH 4IJ3C 4RQQA 4XE0A 3UTSD 1P6AB 1YDPB 1O9WA 3MFGB 3FT0A 4XBMA 2F8VA 3ARBD 5H4YA 1GTFA 2EVHA 1BP3B 1J7VR 4P2AA 3GBLA 3ROOB 2I60L 4M7JH 1M7XA 3CQPA 2ED9A 2YPVH 3VCLA 1UM4L 5D7SL 5DF0A 3X13B 5LNGA 1RIVL 2PW2A 4PG9B 2IWGA 2Y7QA 2DBLL 2YAHA 5C3IA 2CDEB 3EGDA 4S1SH 4LSPL 2VMFA 4M7ZC 3WKQA 1P2CA 4JE0A 4DFIA 1II4E 4XNZB 5H37A 3KPLB 4OKVA 3BAEH 4DN3L 1ZLUH 4F58L 5C0NC 2GITB 4TUUA 4M7LH 4MB4A 5LUMA 1G7MA 5D4HA 1BECA 2GK2A 4APXA 3K2KA 4R97B 1J9CT 3M1CA 1RIHL 3ZDZE 1RJLB 1B2YA 1GOHA 1U58B 2BOCB 5EOQH 2CO6A 3BPOC 4YS4A 1L0YA 2WBKA 5E5RB 3HI6L 2Q3AA 2J1XA 3H42H 5CF3A 1NIBA 1P4UA 3DX8B 3UTQB 2Q7NA 2X4SB 3UPAA 5SWSA 1XR9B 5E0QA 4N9GA 1QSFD 1PZAA 2C26A 1E2VA 4EI5B 1JSYA 4IOFC 2FO4B 1NGQL 1EGJL 1QRNA 3V7AG 3OMZA 4JFWA 3A67L 3D48R 1V3KA 3P0VH 4ZNEA 4XRCA 2FEEL 4F57H 4P59H 3ZJAA 2AQ2A 5CUSL 2NSMA 2OX5A 2DMGA 4LL9A 3BKJH 5GGSA 2WTRB 4KX8A 4M56A 5KBPA 3HR6A 3G08A 1MHHB 2XG5B 4G70B 2Q7YB 5GS1B 4P49A 4GT0A 4HDIB 4G8GD 3TBVB 1Z9PA 2WBJD 2C1PA 3D34A 1YHPA 2DQIL 2GG1A 5BVJB 3NPSB 2BNRE 4AWJC 5CEXA 5I16A 3VD0A 2DF3A 2Y1AA 4A2EA 1H15B 4OZGA 1ZTXL 2M26A 5HJBA 2A3TA 3P54A 3HRPA 1DQTA 2TRHA 2Y2WA 5KVEE 1BMWA 4HD9A 3DBXA 1TQBC 4KOCA 4MNGE 4QTIH 2XA8L 2VDPB 4EXPX 3J8F7 2VZTA 3CHPA 4RMRA 1WV7T 3DK0A 4W68A 3OXRA 4FQ2H 4PRNA 2DQHL 4NNXA 5DRNB 1D2PA 3SKJL 3ULSB 1VGEL 3HMXL 1AQHA 2KDGA 5F21B 2WBJB 1MH5B 1TEGA 4CW1A 5CNHA 3CD4A 1I7RA 3KEDA 3P9WB 4KUCF 3AT9A 2FL5A 1ERNA 2FT7A 2EE2A 1FPTH 4AH2A 4ERSH 3QUYA 1AGCA 5DJ2B 2F7OA 3C6LA 3BXNB 4JM2B 3QXDB 4G3YL 3D12B 4PD4K 4G7YL 4NO0A 3AY4A 4XBPA 4YDZA 4WO4D 2XTJD 1JZ4A 2HA1A 4NQDE 2QVFB 1U0QA 3L3HA 4QRRA 2X6VA 1AXTH 1YEFL 2YKKA 2GT9B 4PJFA 1UJ3A 4NQXA 2EDTA 2P5PA 2W9EH 2ZUUA 3OG6B 1S7UB 3A3YB 3WJJA 4NXKA 1DN0A 2ZYHA 3OHMB 1JVOA 1T21A 3QFGA 4NC2B 3CU7A 2ZONA 3U0TA 4AI7A 5EZLA 5CFHA 5DRWB 3MHZA 1FDLH 2W5PA 3HZMB 4OIBA 4IBSA 4ZAKB 3RKDC 5LWYH 2DTSA 4B9YA 1KCRH 3ZUNC 4B9IA 3OAYK 1KJVA 3SHSA 3WTUA 1L3NA 1G1OA 3RUGE 1F1GA 2ZNWA 3QZBA 1HYRC 1SXAA 4WO4B 4DAGH 3EJUA 3VDAA 3ML8A 4X4YB 1A9EA 3IDGB 3G04A 4UIKH 4WI4A 1G94A 3MRKB 2XZZA 1DVFD 4N25A 3LDBB 1EFXD 2WB1A 4PSPA 3W5NA 5EU3A 3CBJB 3GHBL 4G9FA 4NN5B 3WEMA 4BSJA 4S0TD 1P4IH 3NFPB 1M6UA 2IBZY 3FFCD 3TT3L 4L3AA 3V4LA 4AL8C 2X0UA 3ARFD 1PDKA 1HZHL 5IFAH 5AENA 4CN4A 2W91A 2GJJA 3RPKA 3QEUB 5GZOA 2Q2EB 4Y1TA 1G0DA 5F89B 1HIMH 4WTXA 4HFWB 1UC6A 3RWCB 2VXSL 3FOLA 3SCMB 2RIKA 5I5IA 5LDSA 1VGKA 3VXQA 1B4JL 4NC0B 1NAKH 4Z7UF 3L17A 1RJYA 3APMA 3UYPB 3ABLB 3IFLH 1ZGLA 2QGBA 3FT2A 3VU2A 4EQ2A 2X44D 5B39A 2HXAA 2ZCLL 3WMPA 3TH4T 4LMQE 4PJHA 3RB5A 2YK1L 2C9XA 2BZCA 2E27L 2P5WE 3Q2NA 1EGJA 3OB0H 4A7SA 3FFCB 3ARFB 3WNIA 1CLYL 1U30A 5DJYA 4DJMA 5C0EA 4K9EL 4QXWA 1EAPA 2GAZA 3SE4A 5HD8C 4O02H 4KJPD 4UQ9A 1MFAL 3AS3A 5AAWC 4Y5VA 4X6BA 2YGQA 1EJOH 2YMXH 2FJHA 4FXTA 5E7BA 5JW4N 3TCXA 2D31A 2LOEA 5F7FA 3CDFA 2VUOA 4IKNA 4P3DA 1IM9D 2B0SH 1FAIH 3ZT5A 3S34H 1EJFA 3VRJB 5C8JA 2E7DA 3FN0L 1T89C 4UQEA 5K9JH 2GUOB 4UT9H 5FUOH 3VFUB 3K74B 1S7QA 3ZE1E 4X7FC 3QJFB 4U1JA 1JPGB 3DOHA 4U1IB 5LNDA 3V5KA 1G7QB 4U6VH 1KLUB 2UVFA 4GBXC 1JZFA 5F96H 2PCFA 3K2UH 5IUCA 1A66A 1X5LA 2X4PB 1CYGA 1NGXA 1VF5C 4PRBA 5F6IB 3BC9A 3HPJA 1MHCB 4E9SA 2B5IB 3MUGA 2L8AA 4L4TD 4MA7H 3GDBA 4YXHL 3O6ML 1RK7A 3HMXA 1F5WA 2PP7A 3FDWA 4KH2A 1XAKA 3NCXA 5C2BH 1UH4A 7PAZA 1DBKL 2HH0H 3BAKA 3KWXA 4N8CH 5IUSA 5JIMA 2DQ6A 3BWZA 3MV8E 5ISZD 1XCQB 3L9RB 1D7DA 2Q6WB 2K4WA 3WMSA 5EULV 2VXQL 5ICZB 1LK2A 4JREB 5C71A 3OMAB 3ZGIA 3JWNG 3KHQA 2EXYD 3N42B 1LO2L 2EE0A 2WLIB 2WLMA 4OZHF 1OAXL 1FG2B 4I0CC 1LMKA 1YAIA 2G75B 4MJ5B 4L4TB 3WJLA 1CICD 3BVWA 1U8PA 2J44A 3F83A 5E9DE 2EXWC 5ANMB 3G5VA 1EO8L 1P5VA 3BZ5A 5CJ5A 3P4MA 4NERA 3TBWB 3QQ9C 4WSJA 4PJEA 4D0CA 1NWPA 1F2XK 1RZJC 3O4OC 5D70H 3NA9L 4LOUC 2PO6C 4LPUA 4NQCE 4Z7VE 3NIDE 3QJXA 2KL6A 2C7FA 5I6MA 4HWUA 1LO5A 4LLAA 1XGZA 2FD6H 2B4CC 4C4KT 3T2NL 1MFBL 1WFOA 5JXEC 3JWOL 5D7JB 5DZVA 1WT5C 1BBDL 1CR9H 1BGXL 5SX5K 1TQCC 3IJYB 3IFOA 2D7PA 3SGKA 4AIEA 1DVUA 2NXYC 5EU6D 3AXLA 1EXGA 3BPCB 3B8YA 4XP1L 3CFMA 1G43A 5EDSA 4HLZH 1KWGA 3CDYA 5IV2A 4RZKA 2OZ4A 4OJCA 2CGRL 4R6UA 4UB0H 1UXMA 4LCVA 1G7IA 3MV7B 1BX2A 4U7SA 5BW7C 4L5FH 3CPLA 3TU6A 3RVVC 3QEGH 3PWVB 3VYOA 1MAKA 4CBZA 4JPKH 1O6SB 3GSWA 3S37H 4BSWA 1RZQA 4ISVA 4Z78A 4F27A 5BRPA 3WGUB 4JO4L 5G55A 3BH8A 5LN8A 3DETC 4KMQA 1I8IA 1OCZB 3PHQB 2BMKB 1EZSA 2OM5A 1IGYA 2E47A 4ORGB 4OZGF 3BP5A 1ECZA 2HFFA 2ED6A 3RURA 1F3JB 2PTTB 3OM3B 3I3DA 3UGEA 1HKLL 2WSPA 1A7RL 2O61A 1NDGB 3IKCB 2VLKE 3GWJA 4AIOA 3SPIA 1D5ZB 1KN2L 4GKSB 4ZX3A 2ZOTA 3CSYB 3T3PF 1SYSA 4U1NB 1RPUA 1B2WH 1DQVA 4N0FB 2ZOWA 3QJHB 3FUEA 5B3NA 5J12B 4ONHB 2AP2A 5I1CL 2NSQA 1ZANH 1FNEA 2WM0A 3BP6B 3UC0L 1NEZA 3KR3H 1JZGA 3ARGB 3OJ2C 4NHCL 2PNDA 1RZPA 5DUMH 5GHWL 1CGUA 4XHJC 3ZIMA 1INEL 2HRHA 4IW4C 4D8OA 3V4VL 1TKWA 1KPUA 2AQQA 2BVOA 2G0LA 4JVPA 5ITBH 1ONQA 2V0AA 3NK4A 4BM7A 5L4FA 4PJFF 1JHLL 1EJ8A 2WN3A 1DVQA 5CMAB 5IY5B 2NLJA 3WIIL 5SWZD 3K2IA 3BHBB 4TVPL 4FYQA 3VW3L 5H94A 3LRSB 1EEYA 2RMNA 4FQIL 1K4DA 3H54A 4QR7A 3I02A 4CMHB 3K4ZA 3MX0A 3FT3B 1D9KC 1CFMA 5DWUH 5KSUA 5EEWA 4KKBC 5MEPA 3DYPA 4YHNB 2R4SL 1G0YR 1SLVA 1B6UA 2CR3A 4GXVL 3VFTA 3MGAA 1FL5B 3HB3D 2Z7YA 3DWTA 4J3OG 4BFNA 5DD1H 4L3FA 4TNGA 2AJSH 5CCHE 5IVZA 3D25B 5IHZA 1A14L 5K39B 4OCXH 4QYOB 3ZK0A 1GGIH 2BNUA 3ROLA 5IJKC 5IBLC 3SBRA 5EUKB 4Z7QB 5K9OB 5EZOL 2G3NA 3SDYH 2FGWL 4DKDC 3FAXA 5KYUA 4F9PC 3B5TA 2GSIB 3NEXA 3UXFA 3KPOB 3VWJC 1MREH 1XEUA 4JO8A 4NSKB 5E4EC 1QUNB 1A3QA 2H1XA 1HXYA 3H85A 4DGVH 1FO0B 1SF5A 1WZKA 1KACB 2PPEA 2BNQE 2BVPB 2R2EB 4IRJC 4KRMB 3FUKA 1Q0XL 1U8MB 1AGDB 5DSCB 3ZDZB 4KHTL 1FO0H 2WD0A 4GRMA 2PWDA 1CD0A 4PJHF 2YZ8A 3LZOA 4GQ9H 5GGUB 2EKJA 2C9UA 2QMJA 4P8QA 5L88H 3VD9A 2N59A 1SHWA 2VDLL 1F11A 2Y07L 4HLEA 4ATTA 3RA7H 1N59A 2QDWA 3DSFL 5LAXA 4DNLA 3QIUC 4LAQH 2JVUA 1XGQA 4DK3A 5FECB 1M7IB 5KSAD 3ZW3A 4X9YA 2C3HA 2DICA 2X4NB 5DJ0A 3X12A 3APCA 1L0XA 1DEEB 4UCFA 2I24N 3GFUA 4H1LH 2EKSB 1NCTA 4NDMA 3UAJA 2WB7A 3C60B 4OLWL <