4JGPA

The crystal structure of sporulation kinase d sensor domain from bacillus subtilis subsp in complex with pyruvate at 2.0a resolution
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
206
structure length
206
Chain Sequence
EKDTIAAEHKQEASVLLNLHRNKINYLIGETMARMTSLSIAIDRPVDIKKMQSILEKTFDSEPRFSGLYFLNAKGDVTASTTELKTKVNLADRSFFIKAKETKKTVISDSYSSRITGQPIFTICVPVLDSKRNVTDYLVAAIQIDYLKNLINLLSPDVYIEVVNQDGKMIFASGQASHAEDQKPVSGYLDDISWNMKVYPNPVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insight into the sporulation phosphorelay: Crystal structure of the sensor domain of Bacillus subtilis histidine kinase, KinD.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Transferase
molecule keywords Sporulation kinase D
total genus 55
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4jgpA02
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4jgpA01
4RQ9A 2I9VA 4PKYA 1T1AA 4HQAA 1TS6A 5F6AA 3VE3A 3MJQA 2Z6CA 3PHYA 1OT6A 2OOLA 1DRMA 2QWSA 2ZOIA 1XFQA 3C8CA 2HV1A 3HJIA 4WN5A 3HJKA 2M1CA 2OWHA 3CAXA 1V9ZA 4WF0A 4YWZA 2D01A 4EEPA 3RTYA 3LUQA 4L9FA 3PYPA 4BBVA 1XJ3A 1XJ2A 1S1ZA 4I3JA 1XJ4A 2A24A 2VV7A 4HJ4A 2WKPA 5TBMA 3OLOA 1LSVA 3F1NB 5HWWA 1LSXA 5HDDA 2KX6A 1G28A 3LIFA 1OTDA 3LICA 4LPZA 2PD7A 2YKHA 3MQOA 1WA9A 4HH3A 4BBUA 4KUOA 3H9WA 3ZQ5A 3F1NA 5DJUA 5IS1A 2B02A 5HZHA 2A24B 4NXFA 4EEUA 3IS2B 1GSWA 4LRYC 4GW9A 3UB6A 4HNBA 3E4QA 4R38A 3F1PA 3F1PB 4K08A 4LRXC 1VB6A 3CLOA 5AVFA 5DKLA 3B33A 2L4RA 4HJ3A 1BYWA 3BY8A 3VE4A 4BBTA 2QJ5A 3BWLA 4M4XA 2CMNA 2V1AA 3MXQA 1S1YA 4MN6A 3K3DA 4PKYG 2VV8A 3H7WA 2D02A 1N9OA 2VEAA 4B9OA 3UB8A 3IBRA 3E4OA 3MFXA 5HWVA 1DP9A 1N9NA 4F3LB 3NHQA 2PHYA 4NXBA 4JGRA 3FC7A 4HJ6A 5A8BA 3UB9A 2L0WA 2KDKA 4R3AA 1D06A 1T1BA 2PDRA 3LYXA 2V9AA 4GS9A 4I5SA 4KUKA 3H82B 5F68A 1Y28A 1EW0A 2PYRA 3LIAA 4WL9A 3A0SA 2QHKA 1S67L 3IS2A 4H6JB 5G4YA 4DJ2A 3FG8A 3NOUC 4HP9A 4EESA 3F1OA 5F5YA 1LT0A 2EA9A 3T50A 1F98A 1OT9A 3MQQA 1TS7A 3E4PA 4HHDA 4GHIA 4HI4A 1LSWA 1S4SA 3BY9A 4R6LA 5F69A 3LI9A 4GS9B 5I5LA 4EETB 1S66L 5TBMB 1OTIA 2H28A 2BASA 2VLGA 3F1OB 3ICYA 4HY8A 2V0UA 4I3IA 4L9EA 3UB7A 5J4EA 1UWPX 1D7EA 1TS0A 1OJ5A 3A0VA 4L9GA 5DJTA 3UMDA 1N9LA 4MN5A 4NXGA 5IU1A 3RH8B 3UMEA 4EXOA 4JGPA 4EERA 3NOTC 2PR5A 4HOIA 4LLOB 1JNUA 2W0NA 1UWNX 4EQ1A 1UGUA 2V1BA 3UE6A 2PYPA 2YKFA 3EWKA 3K3CA 3LIDA 5HD3A 2ZBBA 4LRZE 2QKPA 3C2WA 5J7EA 1S4RA 2J80A 1T1CA 2P7JA 5J3WA 1OTAA 2K7SA 2QJ7A 4JGQA 1OTBA 5EFWA 1OJGA 4I39A 1XJ6A 5HSQA 2L1MA 1ODVA 3H82A 4HP4A 3H7WB 2PR6A 3EEHA 5KIZA 3LIEA 3NOPC 4GCZA 1P97A 1T19A 2JHEA 3LI8A 3VOLA 3MR0A 4HH2A 1KOUA 3GECA 4XT2A 5HDSA 4R70A 4WLAA 4DJ3A 4I3AA 1F9IA 2WKQA 3A0RA 1MZUA 2V0WA 1NWZA 1DP6A 4H6JA 4HIAA 5HDCA 4EW7A 4F3LA 3SW1A 2INWA 3NJAA 1X0OA 5G4ZA 1DP8A 1TS8A 2GJ3A 2WKRA 2W27A 2Z6DA 4I38A 4WUJA 1OTEA 1V9YA 2OWJA 4KQDA 1LL8A 3KX0X 4XT2B 5HD5A 3ULFA 4NXEA 2VV6A 4JGOA 2PD8A 5DKKA 5AVEA 2JN7A 1GSVA 2R78A 4GHIB 5HWTA 1P0ZA 2ZOHA 3P7NA 3GDIA 1XFNA 1GSXA 3CWFA 3LIBA 4E04A 3D72A 3G6OA 1T18A
chains in the Genus database with same CATH superfamily
2DCFA 3ISGA 2H10A 4HQAA 4BQMA 5TR7A 2ZOIA 5AQ9A 4E6WA 1K6RA 4WN5A 5HX9A 4BBVA 3Q7VA 3S7NA 4P0MA 1LSXA 3BRMA 3DAVA 4UQIM 3EEAA 1HTZA 4HNBA 3T1XA 2GNXA 3ZVWA 5JYOA 5EVIC 1PI4A 1SZVA 5FEFA 1SKOA 5DFYA 3GR2A 2Q9MA 2V9AA 3S7PA 2EFUA 4OOYA 4GKUA 3T4LA 1ONHA 3VP0A 1JWPA 5F5YA 3MQQA 5GLAA 3T4TA 3JVUA 1NZUA 2Y79A 4NXGA 2PR5A 1PZOA 3DW0A 4U0TA 2UV0E 3Q7ZA 4Y0OA 1PI5A 3N6IA 4X53A 2ZMAA 3H7WB 3HLBA 3HCYA 3IWIA 2X01A 4I3AA 1DJAA 3SW1A 3IX8A 1KVLA 5E43A 1DP8A 1PWCA 5M18A 4Y5FA 1GHPA 3OZHA 4JXGA 2ZOHA 1XGIA 2J3TD 4B88A 1AWIA 3VE3A 3TOIA 4EQIA 2W3DA 1BT5A 1XKZA 1XJ2A 1IKGA 1LSVA 5HWWA 1OTDA 2BG1A 1YSPA 4Y15A 4KQRA 5FATA 1BULA 1GA9A 5C5KA 3NDGA 2J7VA 3NHQA 4BD0A 2XA7M 2XH9A 1T1BA 5FQKA 2W3HA 2KOIA 4NG2A 2M7UA 1EW0A 2IWDA 4S2KA 4Y0UA 4H6JB 5FQQA 1PW1A 3UDIA 5EPHA 5EOOA 4DKIA 2P08A 3V3SA 4DE0A 4EETB 3MZDA 4O7DA 3ZDJA 4ETXA 3C7VA 2ZD8A 2Y4AA 2ZMVA 5GHXA 4JBFA 3IWOA 1O7EA 1N9LA 1MWTA 3IX3A 3IH9A 4JF5A 3SH8A 4WMCD 3LIDA 2ZBBA 4QHCA 1FCNA 4HP4A 1P9WA 3H82A 4QY5A 2JKTM 5JYPA 3IHBA 5CEBA 2VZWA 4EBNA 4MBHA 3WS4A 2ZC7A 1LL8A 5IHVA 1K57A 4DXBA 2VV6A 2Y2MA 1BSGA 2A49A 2O99A 1FQGA 4WEJA 2NUPC 2B18A 4N9KA 3IHAA 3WS0A 4K91A 2PU4A 1A0KA 3RXWA 3LUQA 4L9FA 3CHWP 1K54A 3Q81A 5TBMA 1NYMA 3LIFA 3LICA 4N9LA 1LHYA 5A93A 5AQBA 5DJUA 3NI9A 2B02A 2W3FA 1GSWA 3KSFA 3E0YA 4HJ3A 1HZOA 4UQIS 2VV8A 5CGXA 3MKFA 4NXBA 3W4QA 5AQ7A 2L0WA 1FOFA 5CX7A 3UPOA 4KZ3A 3C4PA 4KZ6A 3T4OA 3OCLA 2VX8A 3PAGA 3B3XA 4HI4A 3BY9A 2JKRI 4R6LA 4JXSA 4P87A 2J9OA 4UEYA 1ERQA 2XK1A 1ESUA 3NCKA 3UMDA 1ALQA 3UMEA 2MJ6A 1F2KA 4EERA 1ZHHB 4KZ9A 1JNUA 4MBKA 1WE4A 4KENB 3UE6A 5HD3A 2PBDP 1T1CA 1O07A 5HFOA 4IVKA 3NIAA 3MR0A 2XEPA 1ACFA 5FI6A 2INWA 2PRFA 1X0OA 2DMWA 4I38A 4X6TA 4WUJA 4KQDA 4NXEA 5HARA 1MKIA 3P09A 3GDIA 3UY6A 5F6AA 5EE8A 3HUMA 1DRMA 4DRTA 4GLQA 3BFCA 4WBGA 3BECA 3CAXA 3A3JA 5E2EA 1W8QA 3PYPA 3IBJA 1XJ3A 5CHJA 3G30A 1FCOA 2JC7A 3A3EA 3QHYA 2YKHA 2ZL1A 3GSGA 3JYIA 2ZC6B 4P85A 4QJGA 3UB6A 3F1PA 5CTNA 4E3IA 1K55C 1Z09A 1W63Q 4LCMA 4N92A 3DWKA 1N9NA 5HAQA 2PHYA 1DY6A 1GA0A 2HJEA 4ZJ1A 4G3KA 3NY4A 3MXRA 3OPLA 3R4KA 3MZEA 4Z9QA 5EVEA 4WL9A 1TD5A 3FPVA 4LGWA 3C38A 3E98A 5G4YA 3TRCA 1STZA 4GOGA 3CPTB 3E4PA 4PM8A 1QMFA 3LI9A 4YINA 5TBMB 5FQIA 2VGLS 3Q07A 2XFSA 5DJTA 1KGGA 3BJNA 3HLWA 1IOUA 4XUXA 1RGZA 4R3JA 4X68A 2O9AA 1E3UA 3VSKA 4HEFA 4I39A 2HPBA 4OPRA 3EEHA 2J3TC 3HLEA 4MCWA 5HDSA 2WYXA 3EGXC 3IQAA 1KGEA 3W4PA 2Q0OA 1XX2A 3KX0X 5DKKA 4YOFA 5CGSA 4OP8A 1NY0A 3TJZC 4ZBEA 4RQ9A 2RCXA 1K6SA 5FI2A 3IXDA 5FDSA 1ESIA 2X02A 5A92A 4MN7A 4GNUA 5HPFA 2Y2NA 4HJ4A 3B42A 3CI6A 3AGDA 2PD7A 1WA9A 4O01A 4QU3A 3HUOA 4JF6A 4EEUA 3F1PB 4M3KA 3V67A 2Y2OA 5CGWA 1BYWA 1J9MA 2OSUA 2VJWA 2VGKA 3IBRA 4LCLA 3FC7A 3E2LA 4IHQA 1CF0A 1FSYA 5F1FA 1NJ4A 5F68A 3O87A 4QB8A 3AGEA 3EQUA 3HREA 3A0SA 4IBRA 1S67L 2WK0A 3F1OA 1BZAA 3BFEA 5I5LA 4BENA 1D1JA 1EWZA 2V0UA 3G4PA 1GHMA 3O5YA 3KYEA 3LGOA 3LY3A 5EM1A 1PRQA 1H5XA 1K55A 3SS4A 3SOIA 4GB7A 1YMSA 5J3WA 4DE3A 5AQAA 1OTBA 1EROA 2KLIA 1JTGA 1MWRA 4N1XA 3T4SA 3LI8A 3M2KA 4KZBA 2X71A 4NEED 5FAOA 1RGYA 2WKRA 5DTTA 5TGFA 2LB9A 5F82A 3DTKA 4JGOA 2I72A 1WYCA 1SKFA 2C6WB 4L0LA 4CJNA 5TFQA 4FH4A 1H8ZA 3EGDC 1MBLA 1W8YA 4NETA 2Z6CA 1LI9A 2XSSA 3C8CA 1W63M 5F83A 1XA1A 1XXMA 2JBFA 3VP4A 1NLZA 1V9ZA 1GCEA 1K57C 2G7UA 3CUEC 3P01A 5DF8A 4KUOA 1MKMA 4GW9A 2EWWA 3W2ZA 1FCMA 4R23A 1PW8A 2L4RA 3VE4A 2WGWA 4M4XA 2V1AA 4YNRA 1L2SA 3K3DA 3MBZA 3UB8A 5L09A 3BQ8A 3U4LP 2RL3A 3LR4A 1XP4A 4S2MA 4DE2A 1D06A 3GVBA 4WELA 1KE4A 1K25A 4EWFA 4IEDA 2W3EA 4JKTA 3IS2A 4KG2A 4EESA 4S2NA 1LT0A 2EA9A 3T50A 4ID4A 4GDBA 4QY6A 1VM1A 3FZCA 4GS9B 3SH9A 4BJPA 2JKTI 2EWVA 3GV9A 2ZM0A 4RX3A 3BEBA 3Q1FA 5DTKA 2WUQA 1UGUA 3T12B 3K3CA 2XDMA 2OAQ1 4PMAA 4B4ZA 2JCHA 5FL3A 3OPHA 4CLCE 1P97A 2CC1A 1KOUA 5M19A 1F9IA 2GZAA 2R9XA 1MZUA 2V0WA 4HIAA 4Y17A 2GX5A 1PIOA 3G2YA 3NJAA 4MLLA 4Y3IA 2EXBA 1CK3A 2OWJA 5GLBA 2H0YA 5AVEA 4XUZA 2HZ5A 1W5DA 2J8YA 3RH8B 2PU2A 1T1AA 3QP1A 2QWSA 3UO9A 3JPUA 4K0WA 4BD1A 3ZG7B 1CI8A 1MXOA 4ZRRA 4I3JA 1XJ4A 2PT7A 2WZXA 5FAQA 4E3LA 4E3KA 3UPNA 4EUZA 4ZTKA 1PZPA 3QP4A 1LL9A 3WS5A 2A24B 5HAIA 2WKEA 4G3VA 3QNBA 5EOEA 2Y2HA 2WAEA 1YLWA 4OQIA 4B9OA 4C3QA 2Y2QA 1ERMA 1ES2A 3V3RA 3LYXA 1NZOA 1K4EA 2DRWA 2XD5A 1G6OA 1YSQA 3MXSA 5EV0A 2B5RA 2WADA 1L0FA 5EM0A 2XD1A 3GRJA 4IVIA 4HBUA 1L3LA 5J4EA 2O9CA 5IU1A 1H8YA 2FFYA 4E3NA 2YKFA 4KZ5A 2IA2A 1H8MA 3L7HA 2WGIA 4HH2A 4Y7PA 1YLYA 3UPPA 2V2FF 4EW7A 2ZMFA 1I2WA 3NULA 1PYYA 4GJ4A 3PAEA 4P6ZS 4Z1WA 5HD5A 3S7QA 1MWSA 2LB5A 2XLNA 1TDLA 1GSVA 2JN7A 4LV3A 2FFFB 1VETA 1GSXA 2WKHA 3LR3A 3LR5A 3IH8A 3BM6A 3PHYA 2HP5A 4P6ZM 2ZQ7A 4OVDA 3S7OA 4Q0IA 3EQVA 4KG6A 4B93A 5FA7A 4E3OA 2HDRA 5FSRA 2J9PA 5IS1A 4WZ5C 2Y2LA 1PFLA 3ZNYA 1JTDA 4D60A 5AVFA 5GL9A 1XGJA 4ZJ3A 3O3VA 4LV2A 2V8FA 3G32A 4QWOA 1N9OA 4GD6A 2ZC4B 3MFXA 1ONGA 4JGRA 4EUVA 3K2NA 3PBRA 1BLHA 4UA9A 1FIKA 1Y28A 2W1RA 3LIAA 1XPBA 4R1GA 3FV7A 1MWUA 4UA6A 3HUNA 1PWDA 2V20A 4OPZA 3QP2A 1CEGA 1HLUP 3L9KA 1OTIA 5FQMA 2HDUA 4MEZA 3FKWA 3UB7A 2BTFP 2A3UA 5EECA 4OKPA 3U2AA 2OLUA 3BLSA 5BOHA 3VP3A 1TVFA 3ZHHA 1Q2PA 1KDWA 4E6XA 1JVJA 1MY8A 4F3LA 1HD8A 2R9WA 2Y2GA 3MQ0A 2QZ6A 1OTEA 4XT2B 1YKDA 1ZG6A 4OQ0A 3P98A 3T4KA 1FR1A 2I9VA 3VV4A 1G5UA 1RP5A 1GHIA 1IELA 2HJ9C 3NDEA 3BW6A 2KX6A 1G28A 4MDZA 3M2JA 4BBUA 3CJMA 2ZQ9A 3IS2B 3WRZA 4LRYC 3IWQA 1KDSA 1VETB 3ZFZA 5GHZA 4BBTA 3MXQA 5CTMA 3C7UA 5E2FA 4R4RA 3N4IA 1DP9A 3OPRA 1ES5A 4IUKA 4O8GA 4ESPA 3MF0A 4Y13A 3ZVTA 4GS9A 2Y2JA 2PYRA 4KQOA 4X56A 5E2GA 4HHDA 2QPNA 1S66L 3RJUA 4U0XA 3T4JA 3KSHA 4CLCC 4JGPA 3GMWA 3NOTC 4S2PA 2J3WA 4FOFA 4HOIA 3MKEA 2PYPA 1LL5A 3DBAA 5J7EA 2P7JA 3W4OA 5M1AA 2PR6A 5KIZA 2ZC5B 1T19A 4S2NC 1YPRA 2JKRM 3TG9A 2ZLYA 2ZM2A 3FPWA 1DP6A 1L0DA 1CI9A 2GJ3A 1MC0A 4R3BA 3OPPA 3Q82A 4DDYA 3VMAA 4JXVA 4MMNA 3IF6C 4UHUA 1YLZA 2XROA 4LV0A 1JWZA 3HJIA 3CITA 2OWHA 4N1HA 2G2WA 3ZG0A 3PBNA 3F1NB 4B4XA 3CUEA 3CZDA 2JKFA 3MS6A 5KMWA 3MZFA 4XXRA 1PWGA 2VGJA 1LI0A 4K08A 2ZQAA 4PPRA 3PBTA 3DTIA 1I2SA 3PR6A 5GLDA 2B95A 2V1ZA 5DF7A 5A8BA 4DMZA 4MNRA 2IWCA 5CXWA 2DNSA 1Y4OA 2VKSA 1P9RA 3KSIA 1M6KA 4NKPA 4HP9A 1C3BA 2JE5A 3B47A 3LO7A 3BFGA 3IF6B 5AJGA 3G35A 4BL3A 4C75A 5FASA 2H0TA 1KE0A 3GTCA 3LFVA 3UN7A 2Y55A 4WZ4A 4FTXA 3LCEA 1Y54A 4PAUA 4EXOA 1BLCA 3WRTA 4ZJ2A 1VEUA 2JKGA 3EWKA 1K0KA 2QYBA 2ZQCA 4JGQA 3ZNTA 5E2HA 1KE3A 3VOLA 4C6YA 4PHTA 3VOZA 3UB5P 5G4ZA 2P74A 3FYZA 4PM6A 5DF9A 3G31A 3OBFA 4EV4A 3PBSA 2A2LA 4KZ4A 4E04A 3G6OA 3B33A 1S6RA 4DE1A 2OOLA 2VK3A 1IYOA 2XQZA 1YLTA 5HAPA 2M1CA 5DTSA 5CERA 4WZ5A 2O0YA 2Y91A 5FI7A 4KZ8A 3MQOA 3WS2A 3M6HA 1KGFA 3Q7VB 3UDFA 1K56A 5U47A 2WGVA 2HP9A 3DWZA 3BY8A 3G2ZA 3QP8A 1IKIA 2CMNA 2EX2A 2FZ0A 2G2UA 2OV5A 2XGNA 4HESA 4Q8IA 3H82B 5HW3A 4Y0TA 1KVMA 2PBYA 3FG8A 2HF6A 3NOUC 5LBRA 3D9YA 2HGVA 2W3GA 1YT4A 4I3IA 3RXXA 2ZL1B 2H5SA 1W79A 5EVIA 5KZHA 4X25A 3ZG8B 2M7VA 4BL2A 4ETZA 5KSHA 4S2IA 1YLJA 1L0GA 5HDCA 4RYEA 1ZKJA 1E3UD 5A91A 2V8CA 1DJBA 5FDHA 5CHUA 1SDEA 1E4DA 3CWFA 3IT9A 3PBOA 4FD8A 3UE0A 4GDNA 1VHMA 1XFQA 2HV1A 3KYQA 3M6BA 3HJKA 4OQGA 4OLGA 4WF0A 3D3OA 3RTYA 4CPKA 5EVLA 1U60A 5DVAA 2IWBA 2XRNA 4IBXA 4MBFA 3F1NA 5G18A 2EX8A 4GZBA 4R38A 4X1MA 2XA7S 3CLOA 3KO6A 2WKIA 3T1QB 2EX6A 3BWLA 3V39A 3S1YA 5F1GA 4HJ6A 4HBTA 4UAAA 1E25A 1N9BA 1ES4A 5CRFA 2ZM8A 3BYDA 3T1RA 3G34A 1TDGA 5GLCA 3UNWA 3TE8A 3IXBA 5L2FA 3S4XA 1LLBA 3HL9A 4GHIA 4IUHA 3S22A 3A3DA 1K56D 3WWXA 3FKVA 2VLGA 4ZAMA 3BFFA 5FEGA 5D3OA 2XF3A 4CQHA 2W0NA 4F94A 4EQ1A 1BUEA 3N8RA 4R0QA 3C30A 4FUWA 3VP2A 1VQQA 3OOVA 2XR0A 3QP5A 3HBRA 3CPTA 2JHEA 4KZ7A 4WLAA 2VGLM 3IX4A 1J3WA 3JVVA 4ARZA 4GHIB 4BMWA 4PKYA 5EVIB 1YQSA 1OT6A 4E3MA 4Y2FA 1ZG4A 2EFXA 4II7A 4YWZA 2EXAA 1G68A 2A24A 2WKPA 3BQAA 5HDDA 2ZQ8A 3V5MA 4HH3A 1DJCA 1NXYA 4LFUA 5DKLA 1S1YA 4MN6A 4BLMA 3BFDA 5CHMA 4F3LB 1NLYA 2KDKA 4R3AA 4I5SA 3SS3A 4JLFA 3ZG5A 2EX9A 1ZTUA 2QHKA 3BLMA 1F98A 2Y8HA 1FSWA 2H28A 4R4SA 3ICYA 5CEDA 4L9EA 5HL1A 3KYZA 2P04A 1SHVA 4FSFA 1IYPA 5HPIA 3PXPA 3VFFA 3D4FA 3AGFA 1TEMA 5EFWA 4A5RA 3IXHA 3C5AA 1NRFA 1WYBA 3A0RA 2WKQA 3O88A 3VSLA 5L10A 1MPLA 2W27A 5HWVA 3ULFA 3MSHA 5HWTA 2AVXA 1IFQA 1IEMA 5EVID 1K4FA 4OPYA 4WM9A 3TSGA 1VEUB 3VP1A 2HP6A 5L07A 3A3FA 5EUAA 1NYYA 5FQJA 2D01A 3SZTA 1ZC2A 4OOLA 2Y2KA 3OLOA 4BWIA 4X69A 4U3TA 5A90A 3H9WA 4ARZB 5HZHA 3E4QA 4LRXC 1N4OA 4YFMA 2QJ5A 4PKYG 3H7WA 2D02A 3A3IA 4OONA 3UB9A 3N8LA 2E8JA 1YAXA 4KUKA 1IYSA 3DTMA 3TW8A 1SKOB 1W7FA 1OT9A 1TS7A 2WGWB 3LEZA 1LSWA 1S4SA 3VFHA 2W1TB 3LY4A 3NBLA 4HY8A 1UWPX 3A0VA 2Z2MB 4E3JA 4WEKA 4MN5A 4PM9A 5HL6A 3ZGAB 1CQAA 3C2WA 1S4RA 2QJ7A 4ZDXA 2L1MA 4GCZA 2K31A 3I7JA 4WYYA 4XT2A 4R70A 1NWZA 4H6JA 3UE1A 1ES3A 2K2NA 4OH0A 1TS8A 2XFTA 1JWVA 1BLSA 3W8KA 2C5WB 2PD8A 2QMIA 3N7WA 4AFIA 4KG5A 3HVFA 3MJQA 2UWXA 4UA7A 2FH5A 4Q0JA 1I5QA 3QP6A 3C4OA 2WAFA 5J8XA 4DN0A 4Q0HA 4GN2A 4S2JA 4OOMA 1Q2QA 1S1ZA 3ZG9B 3VOYA 4P6BA 1YM1A 3IF5A 4LPZA 4LENA 5FQ9A 3ZQ5A 4NXFA 3ITBA 3HLDA 2Y59A 2Y2IA 5I94A 1VB6A 3T1SA 4DDSA 4FH2A 2E8IA 4LV1A 3GQZA 2ACGA 3NC8A 4FCFA 2P9VA 4RX2A 3E4OA 3MFDA 4DF6A 1NRJA 5L8MA 1TF1A 1OMEA 2PDRA 4CLCA 1XA7A 3HLCA 2OAP1 4OPQA 3V50A 1SDNA 3WS1A 2GDNA 1FR6A 4KZAA 3MMHA 4JXWA 4DJ2A 4NK3A 5MC7A 3LEQA 4QPRA 4DXCA 2BLSA 5F69A 4O0PA 1S0WA 4G3WA 2BASA 4ME4A 4PM5A 3F1OB 2ZQDA 4OP5A 1D7EA 1OJ5A 1K54C 4LLOB 3R7WA 1UWNX 1PNEA 1AXBA 4LRZE 4EBPA 2QKPA 2J80A 2K7SA 1CJFA 2W1TA 4JF4A 1OJGA 1ODVA 3LIEA 4CLCB 1H0MA 2HDSA 3UE3A 3E2KA 4OQHA 1SCWA 5CECA 2Z6DA 1V9YA 1EI5A 2Y2PA 3ZCZA 3ITAA 3CMZA 4X1LA 2R78A 4EBLA 1XFNA 1CEFA 4EU0A 3D72A 1BLPA 2Q9NA 1TS6A 1Z6FA 3OCNA 4S2LA 4WMCA 1YMXA 4PM7A 1F5MA 4OLDA 1QMEA 4EEPA 2VV7A 1L0EA 3HLGA 3ZYTA 3SS5A 3PBQA 3KSGA 4JPMA 4GD8A 5GHYA 3O86A 5DFXA 4RA7A 4S2OA 1BTLA 3QNCA 2VEAA 3OC2A 3SH7A 2O9BA 1YLPA 1FILA 2Z2LB 1K38A 3PTEA 5K5BA 4KQQA 3DTEA 2WZZA 2P9VB 1G6AA 3IXGA 4RVAA 3CG5A 5FAPA 3IF6A 2HDQA 4H8RA 2OLVA 4IJGA 1IYQA 2ZC3B 1M40A 3N8SA 5IT5A 4L9GA 1TS0A 3T4QA 4D2OA 3NECA 2V1BA 3EOIA 1OTAA 1OPXA 3RFBA 1XJ6A 4CLCD 5TJJA 5HSQA 2VA0A 3NOPC 4X55A 5KSCA 3GECA 4DJ3A 2NUTC 3FWLA 4QD4A 2PAVP 3R7WB 1HVBA 2ZJ9A 1P0ZA 3P7NA 1H3QA 3UDXA 3LIBA 1RCJA 3HLFA 1T18A 4K0XA 3LR0A
chains in the Genus database with same CATH topology
4RQ9A 2I9VA 4PKYA 4HQAA 3VV4A 1OT6A 2ZOIA 4Y2FA 4WN5A 4II7A 2HJ9C 4MN7A 4YWZA 5HPFA 4BBVA 2A24A 4HJ4A 3S7NA 2WKPA 3B42A 1LSXA 3BQAA 5HDDA 3BW6A 2KX6A 1G28A 3CI6A 4MDZA 4UQIM 3EEAA 2PD7A 1WA9A 4HH3A 4BBUA 4O01A 4EEUA 3IS2B 4LRYC 4HNBA 2GNXA 3F1PB 3V67A 5DKLA 1BYWA 4BBTA 3MXQA 1S1YA 2VJWA 4MN6A 3IBRA 5DFYA 1DP9A 4F3LB 1NLYA 4IUKA 3FC7A 4O8GA 3MF0A 4IHQA 2KDKA 4R3AA 4I5SA 4GS9A 2V9AA 3S7PA 5F68A 2PYRA 4KQOA 1ZTUA 3EQUA 3A0SA 2QHKA 1S67L 3T4LA 3F1OA 5F5YA 1F98A 3MQQA 2Y8HA 4HHDA 3T4TA 5I5LA 1S66L 2H28A 3T4JA 3JVUA 3KSHA 4CLCC 3ICYA 2V0UA 4L9EA 3KYZA 2P04A 2Y79A 4FSFA 3O5YA 4NXGA 4JGPA 3NOTC 2PR5A 2J3WA 4FOFA 4HOIA 2PYPA 5HPIA 3DBAA 3PXPA 5J7EA 2P7JA 5J3WA 1OTBA 5EFWA 2KLIA 3H7WB 2PR6A 5KIZA 1T19A 3T4SA 3LI8A 3HCYA 2JKRM 4I3AA 3A0RA 2WKQA 3FPWA 1DP6A 3SW1A 4NEED 1DP8A 2GJ3A 2WKRA 5HWVA 1MC0A 2W27A 4Y5FA 3ULFA 2LB9A 4JGOA 5HWTA 2ZOHA 2J3TD 4MMNA 4L0LA 1IFQA 3EGDC 3VE3A 2Z6CA 2XROA 2W3DA 2XSSA 3C8CA 1W63M 3HJIA 3CITA 2OWHA 1NLZA 1V9ZA 2D01A 4OOLA 1XJ2A 3OLOA 1LSVA 3F1NB 3PBNA 5HWWA 2G7UA 3CUEA 3CUEC 4BWIA 1OTDA 3P01A 4KUOA 3H9WA 4ARZB 5HZHA 1MKMA 4GW9A 3E4QA 1YSPA 4K08A 2EWWA 4LRXC 3W2ZA 3PBTA 2L4RA 3VE4A 2QJ5A 4M4XA 2V1AA 4YNRA 3PR6A 4PKYG 3K3DA 3H7WA 2D02A 3UB8A 5C5KA 3BQ8A 3LR4A 3NHQA 5A8BA 4DMZA 3UB9A 2XA7M 1D06A 1T1BA 4WELA 1YAXA 2W3HA 4KUKA 2KOIA 2M7UA 1EW0A 2VKSA 2W3EA 1P9RA 3KSIA 3TW8A 4H6JB 3IS2A 4EESA 4NKPA 4HP9A 3B47A 1LT0A 2EA9A 3T50A 1OT9A 2P08A 5AJGA 1TS7A 1LSWA 1S4SA 4GS9B 4EETB 2W1TB 4BJPA 3LFVA 4ETXA 2JKTI 2EWVA 2ZMVA 4HY8A 1UWPX 3A0VA 4WEKA 4PAUA 1N9LA 4MN5A 4EXOA 1UGUA 5HL6A 3EWKA 3K3CA 3LIDA 2ZBBA 2QYBA 3C2WA 1S4RA 2OAQ1 2QJ7A 4JGQA 2L1MA 1P9WA 3H82A 4HP4A 5FL3A 4CLCE 2JKTM 4GCZA 1P97A 2K31A 3VOLA 1KOUA 4XT2A 4R70A 2VZWA 1F9IA 2GZAA 1MZUA 2V0WA 1NWZA 4HIAA 4H6JA 2GX5A 4PHTA 2K2NA 3NJAA 4Y3IA 5G4ZA 1TS8A 5DF9A 2OWJA 1LL8A 3OBFA 2VV6A 2PD8A 5AVEA 3PBSA 2O99A 4AFIA 4WEJA 2A2LA 4E04A 3G6OA 3B33A 2NUPC 3RH8B 1T1AA 3MJQA 2B18A 2FH5A 2OOLA 2QWSA 4Q0JA 4DN0A 4Q0HA 2M1CA 4OOMA 4ZRRA 3LUQA 4L9FA 1S1ZA 2O0YA 1XJ4A 4I3JA 2PT7A 5TBMA 3LIFA 3LICA 4LPZA 3MQOA 3ZQ5A 5DJUA 2B02A 2W3FA 2A24B 4NXFA 1GSWA 3KSFA 3E0YA 4G3VA 1VB6A 4HJ3A 3BY8A 2CMNA 4UQIS 2VV8A 4B9OA 3E4OA 2FZ0A 1NRJA 4NXBA 5L8MA 1TF1A 2L0WA 2PDRA 3LYXA 4CLCA 2OAP1 5CX7A 3H82B 1G6OA 1YSQA 3MMHA 4DJ2A 3FG8A 3NOUC 2HF6A 5LBRA 3T4OA 5MC7A 3OCLA 2VX8A 4QPRA 2HGVA 4HI4A 3BY9A 2W3GA 2JKRI 4R6LA 5F69A 4UEYA 4O0PA 4G3WA 2BASA 4ME4A 3F1OB 4I3IA 5J4EA 1D7EA 1OJ5A 3UMDA 2O9CA 5IU1A 3UMEA 2MJ6A 4EERA 4LLOB 3R7WA 1ZHHB 1JNUA 1UWNX 3UE6A 2YKFA 5HD3A 4LRZE 2QKPA 2J80A 1T1CA 2K7SA 2W1TA 2IA2A 1H8MA 1OJGA 2M7VA 1ODVA 4ETZA 5KSHA 3LIEA 4CLCB 3MR0A 4HH2A 3UE3A 4EW7A 2ZMFA 5HDCA 2INWA 1X0OA 2DMWA 4I38A 2Z6DA 4GJ4A 4WUJA 1V9YA 4P6ZS 4KQDA 5HD5A 4Z1WA 3S7QA 4NXEA 2LB5A 2JN7A 1GSVA 2R78A 3GDIA 1XFNA 1GSXA 3CWFA 3LR3A 3LR5A 4EU0A 3D72A 3PBOA 1TS6A 5F6AA 3PHYA 1DRMA 1VHMA 3OCNA 1XFQA 4P6ZM 2HV1A 3KYQA 4GLQA 3S7OA 1F5MA 4Q0IA 3HJKA 3EQVA 3CAXA 4WF0A 3D3OA 4B93A 4EEPA 3RTYA 3PYPA 3IBJA 1XJ3A 2VV7A 2YKHA 3ZYTA 2XRNA 3F1NA 5IS1A 3PBQA 3KSGA 3UB6A 4R38A 3F1PA 2XA7S 3CLOA 3KO6A 5AVFA 5DFXA 3BWLA 1W63Q 2VEAA 1N9OA 3OC2A 2O9BA 3MFXA 1N9NA 2PHYA 4JGRA 4HJ6A 3K2NA 4EUVA 2HJEA 3PBRA 4G3KA 3R4KA 1Y28A 3LIAA 3FPVA 1TD5A 2W1RA 4WL9A 5K5BA 3C38A 3E98A 5G4YA 3TRCA 1STZA 3TE8A 3E4PA 4GHIA 4IUHA 3LI9A 5TBMB 1OTIA 2VLGA 4IJGA 2VGLS 5IT5A 3UB7A 4L9GA 1TS0A 5DJTA 3T4QA 3BJNA 1IOUA 4CQHA 2W0NA 4EQ1A 3U2AA 2V1BA 3C30A 3EOIA 2O9AA 1OTAA 3OOVA 1OPXA 3RFBA 4I39A 1XJ6A 4CLCD 5TJJA 5HSQA 2VA0A 3EEHA 2J3TC 3NOPC 4MCWA 2JHEA 5HDSA 3GECA 4WLAA 2VGLM 3EGXC 4DJ3A 2NUTC 4F3LA 3MQ0A 1OTEA 4XT2B 3KX0X 3JVVA 1YKDA 4ARZA 5DKKA 3T4KA 4GHIB 4YOFA 3R7WB 1P0ZA 3P7NA 1H3QA 4BMWA 3LIBA 3TJZC 1T18A 3LR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RQ9 A;  2I9V A;  4PKY A;  1T1A A;  4HQA A;  1TS6 A;  5F6A A;  3VE3 A;  3MJQ A;  2Z6C A;  3PHY A;  1OT6 A;  2OOL A;  1DRM A;  2QWS A;  2ZOI A;  1XFQ A;  3C8C A;  2HV1 A;  3HJI A;  4WN5 A;  3HJK A;  2M1C A;  2OWH A;  3CAX A;  1V9Z A;  4WF0 A;  4YWZ A;  2D01 A;  4EEP A;  3RTY A;  3LUQ A;  4L9F A;  3PYP A;  4BBV A;  1XJ3 A;  1XJ2 A;  1S1Z A;  4I3J A;  1XJ4 A;  2A24 A;  2VV7 A;  4HJ4 A;  2WKP A;  5TBM A;  3OLO A;  1LSV A;  3F1N B;  5HWW A;  1LSX A;  5HDD A;  2KX6 A;  1G28 A;  3LIF A;  1OTD A;  3LIC A;  4LPZ A;  2PD7 A;  2YKH A;  3MQO A;  1WA9 A;  4HH3 A;  4BBU A;  4KUO A;  3H9W A;  3ZQ5 A;  3F1N A;  5DJU A;  5IS1 A;  2B02 A;  5HZH A;  2A24 B;  4NXF A;  4EEU A;  3IS2 B;  1GSW A;  4LRY C;  4GW9 A;  3UB6 A;  4HNB A;  3E4Q A;  4R38 A;  3F1P A;  3F1P B;  4K08 A;  4LRX C;  1VB6 A;  3CLO A;  5AVF A;  5DKL A;  3B33 A;  2L4R A;  4HJ3 A;  1BYW A;  3BY8 A;  3VE4 A;  4BBT A;  2QJ5 A;  3BWL A;  4M4X A;  2CMN A;  2V1A A;  3MXQ A;  1S1Y A;  4MN6 A;  3K3D A;  4PKY G;  2VV8 A;  3H7W A;  2D02 A;  1N9O A;  2VEA A;  4B9O A;  3UB8 A;  3IBR A;  3E4O A;  3MFX A;  5HWV A;  1DP9 A;  1N9N A;  4F3L B;  3NHQ A;  2PHY A;  4NXB A;  4JGR A;  3FC7 A;  4HJ6 A;  5A8B A;  3UB9 A;  2L0W A;  2KDK A;  4R3A A;  1D06 A;  1T1B A;  2PDR A;  3LYX A;  2V9A A;  4GS9 A;  4I5S A;  4KUK A;  3H82 B;  5F68 A;  1Y28 A;  1EW0 A;  2PYR A;  3LIA A;  4WL9 A;  3A0S A;  2QHK A;  1S67 L;  3IS2 A;  4H6J B;  5G4Y A;  4DJ2 A;  3FG8 A;  3NOU C;  4HP9 A;  4EES A;  3F1O A;  5F5Y A;  1LT0 A;  2EA9 A;  3T50 A;  1F98 A;  1OT9 A;  3MQQ A;  1TS7 A;  3E4P A;  4HHD A;  4GHI A;  4HI4 A;  1LSW A;  1S4S A;  3BY9 A;  4R6L A;  5F69 A;  3LI9 A;  4GS9 B;  5I5L A;  4EET B;  1S66 L;  5TBM B;  1OTI A;  2H28 A;  2BAS A;  2VLG A;  3F1O B;  3ICY A;  4HY8 A;  2V0U A;  4I3I A;  4L9E A;  3UB7 A;  5J4E A;  1UWP X;  1D7E A;  1TS0 A;  1OJ5 A;  3A0V A;  4L9G A;  5DJT A;  3UMD A;  1N9L A;  4MN5 A;  4NXG A;  5IU1 A;  3RH8 B;  3UME A;  4EXO A;  4JGP A;  4EER A;  3NOT C;  2PR5 A;  4HOI A;  4LLO B;  1JNU A;  2W0N A;  1UWN X;  4EQ1 A;  1UGU A;  2V1B A;  3UE6 A;  2PYP A;  2YKF A;  3EWK A;  3K3C A;  3LID A;  5HD3 A;  2ZBB A;  4LRZ E;  2QKP A;  3C2W A;  5J7E A;  1S4R A;  2J80 A;  1T1C A;  2P7J A;  5J3W A;  1OTA A;  2K7S A;  2QJ7 A;  4JGQ A;  1OTB A;  5EFW A;  1OJG A;  4I39 A;  1XJ6 A;  5HSQ A;  2L1M A;  1ODV A;  3H82 A;  4HP4 A;  3H7W B;  2PR6 A;  3EEH A;  5KIZ A;  3LIE A;  3NOP C;  4GCZ A;  1P97 A;  1T19 A;  2JHE A;  3LI8 A;  3VOL A;  3MR0 A;  4HH2 A;  1KOU A;  3GEC A;  4XT2 A;  5HDS A;  4R70 A;  4WLA A;  4DJ3 A;  4I3A A;  1F9I A;  2WKQ A;  3A0R A;  1MZU A;  2V0W A;  1NWZ A;  1DP6 A;  4H6J A;  4HIA A;  5HDC A;  4EW7 A;  4F3L A;  3SW1 A;  2INW A;  3NJA A;  1X0O A;  5G4Z A;  1DP8 A;  1TS8 A;  2GJ3 A;  2WKR A;  2W27 A;  2Z6D A;  4I38 A;  4WUJ A;  1OTE A;  1V9Y A;  2OWJ A;  4KQD A;  1LL8 A;  3KX0 X;  4XT2 B;  5HD5 A;  3ULF A;  4NXE A;  2VV6 A;  4JGO A;  2PD8 A;  5DKK A;  5AVE A;  2JN7 A;  1GSV A;  2R78 A;  4GHI B;  5HWT A;  1P0Z A;  2ZOH A;  3P7N A;  3GDI A;  1XFN A;  1GSX A;  3CWF A;  3LIB A;  4E04 A;  3D72 A;  3G6O A;  1T18 A; 
#chains in the Genus database with same CATH topology
 2DCF A;  3ISG A;  2H10 A;  4HQA A;  4BQM A;  5TR7 A;  2ZOI A;  5AQ9 A;  4E6W A;  1K6R A;  4WN5 A;  5HX9 A;  4BBV A;  3Q7V A;  3S7N A;  4P0M A;  1LSX A;  3BRM A;  3DAV A;  4UQI M;  3EEA A;  1HTZ A;  4HNB A;  3T1X A;  2GNX A;  3ZVW A;  5JYO A;  5EVI C;  1PI4 A;  1SZV A;  5FEF A;  1SKO A;  5DFY A;  3GR2 A;  2Q9M A;  2V9A A;  3S7P A;  2EFU A;  4OOY A;  4GKU A;  3T4L A;  1ONH A;  3VP0 A;  1JWP A;  5F5Y A;  3MQQ A;  5GLA A;  3T4T A;  3JVU A;  1NZU A;  2Y79 A;  4NXG A;  2PR5 A;  1PZO A;  3DW0 A;  4U0T A;  2UV0 E;  3Q7Z A;  4Y0O A;  1PI5 A;  3N6I A;  4X53 A;  2ZMA A;  3H7W B;  3HLB A;  3HCY A;  3IWI A;  2X01 A;  4I3A A;  1DJA A;  3SW1 A;  3IX8 A;  1KVL A;  5E43 A;  1DP8 A;  1PWC A;  5M18 A;  4Y5F A;  1GHP A;  3OZH A;  4JXG A;  2ZOH A;  1XGI A;  2J3T D;  4B88 A;  1AWI A;  3VE3 A;  3TOI A;  4EQI A;  2W3D A;  1BT5 A;  1XKZ A;  1XJ2 A;  1IKG A;  1LSV A;  5HWW A;  1OTD A;  2BG1 A;  1YSP A;  4Y15 A;  4KQR A;  5FAT A;  1BUL A;  1GA9 A;  5C5K A;  3NDG A;  2J7V A;  3NHQ A;  4BD0 A;  2XA7 M;  2XH9 A;  1T1B A;  5FQK A;  2W3H A;  2KOI A;  4NG2 A;  2M7U A;  1EW0 A;  2IWD A;  4S2K A;  4Y0U A;  4H6J B;  5FQQ A;  1PW1 A;  3UDI A;  5EPH A;  5EOO A;  4DKI A;  2P08 A;  3V3S A;  4DE0 A;  4EET B;  3MZD A;  4O7D A;  3ZDJ A;  4ETX A;  3C7V A;  2ZD8 A;  2Y4A A;  2ZMV A;  5GHX A;  4JBF A;  3IWO A;  1O7E A;  1N9L A;  1MWT A;  3IX3 A;  3IH9 A;  4JF5 A;  3SH8 A;  4WMC D;  3LID A;  2ZBB A;  4QHC A;  1FCN A;  4HP4 A;  1P9W A;  3H82 A;  4QY5 A;  2JKT M;  5JYP A;  3IHB A;  5CEB A;  2VZW A;  4EBN A;  4MBH A;  3WS4 A;  2ZC7 A;  1LL8 A;  5IHV A;  1K57 A;  4DXB A;  2VV6 A;  2Y2M A;  1BSG A;  2A49 A;  2O99 A;  1FQG A;  4WEJ A;  2NUP C;  2B18 A;  4N9K A;  3IHA A;  3WS0 A;  4K91 A;  2PU4 A;  1A0K A;  3RXW A;  3LUQ A;  4L9F A;  3CHW P;  1K54 A;  3Q81 A;  5TBM A;  1NYM A;  3LIF A;  3LIC A;  4N9L A;  1LHY A;  5A93 A;  5AQB A;  5DJU A;  3NI9 A;  2B02 A;  2W3F A;  1GSW A;  3KSF A;  3E0Y A;  4HJ3 A;  1HZO A;  4UQI S;  2VV8 A;  5CGX A;  3MKF A;  4NXB A;  3W4Q A;  5AQ7 A;  2L0W A;  1FOF A;  5CX7 A;  3UPO A;  4KZ3 A;  3C4P A;  4KZ6 A;  3T4O A;  3OCL A;  2VX8 A;  3PAG A;  3B3X A;  4HI4 A;  3BY9 A;  2JKR I;  4R6L A;  4JXS A;  4P87 A;  2J9O A;  4UEY A;  1ERQ A;  2XK1 A;  1ESU A;  3NCK A;  3UMD A;  1ALQ A;  3UME A;  2MJ6 A;  1F2K A;  4EER A;  1ZHH B;  4KZ9 A;  1JNU A;  4MBK A;  1WE4 A;  4KEN B;  3UE6 A;  5HD3 A;  2PBD P;  1T1C A;  1O07 A;  5HFO A;  4IVK A;  3NIA A;  3MR0 A;  2XEP A;  1ACF A;  5FI6 A;  2INW A;  2PRF A;  1X0O A;  2DMW A;  4I38 A;  4X6T A;  4WUJ A;  4KQD A;  4NXE A;  5HAR A;  1MKI A;  3P09 A;  3GDI A;  3UY6 A;  5F6A A;  5EE8 A;  3HUM A;  1DRM A;  4DRT A;  4GLQ A;  3BFC A;  4WBG A;  3BEC A;  3CAX A;  3A3J A;  5E2E A;  1W8Q A;  3PYP A;  3IBJ A;  1XJ3 A;  5CHJ A;  3G30 A;  1FCO A;  2JC7 A;  3A3E A;  3QHY A;  2YKH A;  2ZL1 A;  3GSG A;  3JYI A;  2ZC6 B;  4P85 A;  4QJG A;  3UB6 A;  3F1P A;  5CTN A;  4E3I A;  1K55 C;  1Z09 A;  1W63 Q;  4LCM A;  4N92 A;  3DWK A;  1N9N A;  5HAQ A;  2PHY A;  1DY6 A;  1GA0 A;  2HJE A;  4ZJ1 A;  4G3K A;  3NY4 A;  3MXR A;  3OPL A;  3R4K A;  3MZE A;  4Z9Q A;  5EVE A;  4WL9 A;  1TD5 A;  3FPV A;  4LGW A;  3C38 A;  3E98 A;  5G4Y A;  3TRC A;  1STZ A;  4GOG A;  3CPT B;  3E4P A;  4PM8 A;  1QMF A;  3LI9 A;  4YIN A;  5TBM B;  5FQI A;  2VGL S;  3Q07 A;  2XFS A;  5DJT A;  1KGG A;  3BJN A;  3HLW A;  1IOU A;  4XUX A;  1RGZ A;  4R3J A;  4X68 A;  2O9A A;  1E3U A;  3VSK A;  4HEF A;  4I39 A;  2HPB A;  4OPR A;  3EEH A;  2J3T C;  3HLE A;  4MCW A;  5HDS A;  2WYX A;  3EGX C;  3IQA A;  1KGE A;  3W4P A;  2Q0O A;  1XX2 A;  3KX0 X;  5DKK A;  4YOF A;  5CGS A;  4OP8 A;  1NY0 A;  3TJZ C;  4ZBE A;  4RQ9 A;  2RCX A;  1K6S A;  5FI2 A;  3IXD A;  5FDS A;  1ESI A;  2X02 A;  5A92 A;  4MN7 A;  4GNU A;  5HPF A;  2Y2N A;  4HJ4 A;  3B42 A;  3CI6 A;  3AGD A;  2PD7 A;  1WA9 A;  4O01 A;  4QU3 A;  3HUO A;  4JF6 A;  4EEU A;  3F1P B;  4M3K A;  3V67 A;  2Y2O A;  5CGW A;  1BYW A;  1J9M A;  2OSU A;  2VJW A;  2VGK A;  3IBR A;  4LCL A;  3FC7 A;  3E2L A;  4IHQ A;  1CF0 A;  1FSY A;  5F1F A;  1NJ4 A;  5F68 A;  3O87 A;  4QB8 A;  3AGE A;  3EQU A;  3HRE A;  3A0S A;  4IBR A;  1S67 L;  2WK0 A;  3F1O A;  1BZA A;  3BFE A;  5I5L A;  4BEN A;  1D1J A;  1EWZ A;  2V0U A;  3G4P A;  1GHM A;  3O5Y A;  3KYE A;  3LGO A;  3LY3 A;  5EM1 A;  1PRQ A;  1H5X A;  1K55 A;  3SS4 A;  3SOI A;  4GB7 A;  1YMS A;  5J3W A;  4DE3 A;  5AQA A;  1OTB A;  1ERO A;  2KLI A;  1JTG A;  1MWR A;  4N1X A;  3T4S A;  3LI8 A;  3M2K A;  4KZB A;  2X71 A;  4NEE D;  5FAO A;  1RGY A;  2WKR A;  5DTT A;  5TGF A;  2LB9 A;  5F82 A;  3DTK A;  4JGO A;  2I72 A;  1WYC A;  1SKF A;  2C6W B;  4L0L A;  4CJN A;  5TFQ A;  4FH4 A;  1H8Z A;  3EGD C;  1MBL A;  1W8Y A;  4NET A;  2Z6C A;  1LI9 A;  2XSS A;  3C8C A;  1W63 M;  5F83 A;  1XA1 A;  1XXM A;  2JBF A;  3VP4 A;  1NLZ A;  1V9Z A;  1GCE A;  1K57 C;  2G7U A;  3CUE C;  3P01 A;  5DF8 A;  4KUO A;  1MKM A;  4GW9 A;  2EWW A;  3W2Z A;  1FCM A;  4R23 A;  1PW8 A;  2L4R A;  3VE4 A;  2WGW A;  4M4X A;  2V1A A;  4YNR A;  1L2S A;  3K3D A;  3MBZ A;  3UB8 A;  5L09 A;  3BQ8 A;  3U4L P;  2RL3 A;  3LR4 A;  1XP4 A;  4S2M A;  4DE2 A;  1D06 A;  3GVB A;  4WEL A;  1KE4 A;  1K25 A;  4EWF A;  4IED A;  2W3E A;  4JKT A;  3IS2 A;  4KG2 A;  4EES A;  4S2N A;  1LT0 A;  2EA9 A;  3T50 A;  4ID4 A;  4GDB A;  4QY6 A;  1VM1 A;  3FZC A;  4GS9 B;  3SH9 A;  4BJP A;  2JKT I;  2EWV A;  3GV9 A;  2ZM0 A;  4RX3 A;  3BEB A;  3Q1F A;  5DTK A;  2WUQ A;  1UGU A;  3T12 B;  3K3C A;  2XDM A;  2OAQ 1;  4PMA A;  4B4Z A;  2JCH A;  5FL3 A;  3OPH A;  4CLC E;  1P97 A;  2CC1 A;  1KOU A;  5M19 A;  1F9I A;  2GZA A;  2R9X A;  1MZU A;  2V0W A;  4HIA A;  4Y17 A;  2GX5 A;  1PIO A;  3G2Y A;  3NJA A;  4MLL A;  4Y3I A;  2EXB A;  1CK3 A;  2OWJ A;  5GLB A;  2H0Y A;  5AVE A;  4XUZ A;  2HZ5 A;  1W5D A;  2J8Y A;  3RH8 B;  2PU2 A;  1T1A A;  3QP1 A;  2QWS A;  3UO9 A;  3JPU A;  4K0W A;  4BD1 A;  3ZG7 B;  1CI8 A;  1MXO A;  4ZRR A;  4I3J A;  1XJ4 A;  2PT7 A;  2WZX A;  5FAQ A;  4E3L A;  4E3K A;  3UPN A;  4EUZ A;  4ZTK A;  1PZP A;  3QP4 A;  1LL9 A;  3WS5 A;  2A24 B;  5HAI A;  2WKE A;  4G3V A;  3QNB A;  5EOE A;  2Y2H A;  2WAE A;  1YLW A;  4OQI A;  4B9O A;  4C3Q A;  2Y2Q A;  1ERM A;  1ES2 A;  3V3R A;  3LYX A;  1NZO A;  1K4E A;  2DRW A;  2XD5 A;  1G6O A;  1YSQ A;  3MXS A;  5EV0 A;  2B5R A;  2WAD A;  1L0F A;  5EM0 A;  2XD1 A;  3GRJ A;  4IVI A;  4HBU A;  1L3L A;  5J4E A;  2O9C A;  5IU1 A;  1H8Y A;  2FFY A;  4E3N A;  2YKF A;  4KZ5 A;  2IA2 A;  1H8M A;  3L7H A;  2WGI A;  4HH2 A;  4Y7P A;  1YLY A;  3UPP A;  2V2F F;  4EW7 A;  2ZMF A;  1I2W A;  3NUL A;  1PYY A;  4GJ4 A;  3PAE A;  4P6Z S;  4Z1W A;  5HD5 A;  3S7Q A;  1MWS A;  2LB5 A;  2XLN A;  1TDL A;  1GSV A;  2JN7 A;  4LV3 A;  2FFF B;  1VET A;  1GSX A;  2WKH A;  3LR3 A;  3LR5 A;  3IH8 A;  3BM6 A;  3PHY A;  2HP5 A;  4P6Z M;  2ZQ7 A;  4OVD A;  3S7O A;  4Q0I A;  3EQV A;  4KG6 A;  4B93 A;  5FA7 A;  4E3O A;  2HDR A;  5FSR A;  2J9P A;  5IS1 A;  4WZ5 C;  2Y2L A;  1PFL A;  3ZNY A;  1JTD A;  4D60 A;  5AVF A;  5GL9 A;  1XGJ A;  4ZJ3 A;  3O3V A;  4LV2 A;  2V8F A;  3G32 A;  4QWO A;  1N9O A;  4GD6 A;  2ZC4 B;  3MFX A;  1ONG A;  4JGR A;  4EUV A;  3K2N A;  3PBR A;  1BLH A;  4UA9 A;  1FIK A;  1Y28 A;  2W1R A;  3LIA A;  1XPB A;  4R1G A;  3FV7 A;  1MWU A;  4UA6 A;  3HUN A;  1PWD A;  2V20 A;  4OPZ A;  3QP2 A;  1CEG A;  1HLU P;  3L9K A;  1OTI A;  5FQM A;  2HDU A;  4MEZ A;  3FKW A;  3UB7 A;  2BTF P;  2A3U A;  5EEC A;  4OKP A;  3U2A A;  2OLU A;  3BLS A;  5BOH A;  3VP3 A;  1TVF A;  3ZHH A;  1Q2P A;  1KDW A;  4E6X A;  1JVJ A;  1MY8 A;  4F3L A;  1HD8 A;  2R9W A;  2Y2G A;  3MQ0 A;  2QZ6 A;  1OTE A;  4XT2 B;  1YKD A;  1ZG6 A;  4OQ0 A;  3P98 A;  3T4K A;  1FR1 A;  2I9V A;  3VV4 A;  1G5U A;  1RP5 A;  1GHI A;  1IEL A;  2HJ9 C;  3NDE A;  3BW6 A;  2KX6 A;  1G28 A;  4MDZ A;  3M2J A;  4BBU A;  3CJM A;  2ZQ9 A;  3IS2 B;  3WRZ A;  4LRY C;  3IWQ A;  1KDS A;  1VET B;  3ZFZ A;  5GHZ A;  4BBT A;  3MXQ A;  5CTM A;  3C7U A;  5E2F A;  4R4R A;  3N4I A;  1DP9 A;  3OPR A;  1ES5 A;  4IUK A;  4O8G A;  4ESP A;  3MF0 A;  4Y13 A;  3ZVT A;  4GS9 A;  2Y2J A;  2PYR A;  4KQO A;  4X56 A;  5E2G A;  4HHD A;  2QPN A;  1S66 L;  3RJU A;  4U0X A;  3T4J A;  3KSH A;  4CLC C;  4JGP A;  3GMW A;  3NOT C;  4S2P A;  2J3W A;  4FOF A;  4HOI A;  3MKE A;  2PYP A;  1LL5 A;  3DBA A;  5J7E A;  2P7J A;  3W4O A;  5M1A A;  2PR6 A;  5KIZ A;  2ZC5 B;  1T19 A;  4S2N C;  1YPR A;  2JKR M;  3TG9 A;  2ZLY A;  2ZM2 A;  3FPW A;  1DP6 A;  1L0D A;  1CI9 A;  2GJ3 A;  1MC0 A;  4R3B A;  3OPP A;  3Q82 A;  4DDY A;  3VMA A;  4JXV A;  4MMN A;  3IF6 C;  4UHU A;  1YLZ A;  2XRO A;  4LV0 A;  1JWZ A;  3HJI A;  3CIT A;  2OWH A;  4N1H A;  2G2W A;  3ZG0 A;  3PBN A;  3F1N B;  4B4X A;  3CUE A;  3CZD A;  2JKF A;  3MS6 A;  5KMW A;  3MZF A;  4XXR A;  1PWG A;  2VGJ A;  1LI0 A;  4K08 A;  2ZQA A;  4PPR A;  3PBT A;  3DTI A;  1I2S A;  3PR6 A;  5GLD A;  2B95 A;  2V1Z A;  5DF7 A;  5A8B A;  4DMZ A;  4MNR A;  2IWC A;  5CXW A;  2DNS A;  1Y4O A;  2VKS A;  1P9R A;  3KSI A;  1M6K A;  4NKP A;  4HP9 A;  1C3B A;  2JE5 A;  3B47 A;  3LO7 A;  3BFG A;  3IF6 B;  5AJG A;  3G35 A;  4BL3 A;  4C75 A;  5FAS A;  2H0T A;  1KE0 A;  3GTC A;  3LFV A;  3UN7 A;  2Y55 A;  4WZ4 A;  4FTX A;  3LCE A;  1Y54 A;  4PAU A;  4EXO A;  1BLC A;  3WRT A;  4ZJ2 A;  1VEU A;  2JKG A;  3EWK A;  1K0K A;  2QYB A;  2ZQC A;  4JGQ A;  3ZNT A;  5E2H A;  1KE3 A;  3VOL A;  4C6Y A;  4PHT A;  3VOZ A;  3UB5 P;  5G4Z A;  2P74 A;  3FYZ A;  4PM6 A;  5DF9 A;  3G31 A;  3OBF A;  4EV4 A;  3PBS A;  2A2L A;  4KZ4 A;  4E04 A;  3G6O A;  3B33 A;  1S6R A;  4DE1 A;  2OOL A;  2VK3 A;  1IYO A;  2XQZ A;  1YLT A;  5HAP A;  2M1C A;  5DTS A;  5CER A;  4WZ5 A;  2O0Y A;  2Y91 A;  5FI7 A;  4KZ8 A;  3MQO A;  3WS2 A;  3M6H A;  1KGF A;  3Q7V B;  3UDF A;  1K56 A;  5U47 A;  2WGV A;  2HP9 A;  3DWZ A;  3BY8 A;  3G2Z A;  3QP8 A;  1IKI A;  2CMN A;  2EX2 A;  2FZ0 A;  2G2U A;  2OV5 A;  2XGN A;  4HES A;  4Q8I A;  3H82 B;  5HW3 A;  4Y0T A;  1KVM A;  2PBY A;  3FG8 A;  2HF6 A;  3NOU C;  5LBR A;  3D9Y A;  2HGV A;  2W3G A;  1YT4 A;  4I3I A;  3RXX A;  2ZL1 B;  2H5S A;  1W79 A;  5EVI A;  5KZH A;  4X25 A;  3ZG8 B;  2M7V A;  4BL2 A;  4ETZ A;  5KSH A;  4S2I A;  1YLJ A;  1L0G A;  5HDC A;  4RYE A;  1ZKJ A;  1E3U D;  5A91 A;  2V8C A;  1DJB A;  5FDH A;  5CHU A;  1SDE A;  1E4D A;  3CWF A;  3IT9 A;  3PBO A;  4FD8 A;  3UE0 A;  4GDN A;  1VHM A;  1XFQ A;  2HV1 A;  3KYQ A;  3M6B A;  3HJK A;  4OQG A;  4OLG A;  4WF0 A;  3D3O A;  3RTY A;  4CPK A;  5EVL A;  1U60 A;  5DVA A;  2IWB A;  2XRN A;  4IBX A;  4MBF A;  3F1N A;  5G18 A;  2EX8 A;  4GZB A;  4R38 A;  4X1M A;  2XA7 S;  3CLO A;  3KO6 A;  2WKI A;  3T1Q B;  2EX6 A;  3BWL A;  3V39 A;  3S1Y A;  5F1G A;  4HJ6 A;  4HBT A;  4UAA A;  1E25 A;  1N9B A;  1ES4 A;  5CRF A;  2ZM8 A;  3BYD A;  3T1R A;  3G34 A;  1TDG A;  5GLC A;  3UNW A;  3TE8 A;  3IXB A;  5L2F A;  3S4X A;  1LLB A;  3HL9 A;  4GHI A;  4IUH A;  3S22 A;  3A3D A;  1K56 D;  3WWX A;  3FKV A;  2VLG A;  4ZAM A;  3BFF A;  5FEG A;  5D3O A;  2XF3 A;  4CQH A;  2W0N A;  4F94 A;  4EQ1 A;  1BUE A;  3N8R A;  4R0Q A;  3C30 A;  4FUW A;  3VP2 A;  1VQQ A;  3OOV A;  2XR0 A;  3QP5 A;  3HBR A;  3CPT A;  2JHE A;  4KZ7 A;  4WLA A;  2VGL M;  3IX4 A;  1J3W A;  3JVV A;  4ARZ A;  4GHI B;  4BMW A;  4PKY A;  5EVI B;  1YQS A;  1OT6 A;  4E3M A;  4Y2F A;  1ZG4 A;  2EFX A;  4II7 A;  4YWZ A;  2EXA A;  1G68 A;  2A24 A;  2WKP A;  3BQA A;  5HDD A;  2ZQ8 A;  3V5M A;  4HH3 A;  1DJC A;  1NXY A;  4LFU A;  5DKL A;  1S1Y A;  4MN6 A;  4BLM A;  3BFD A;  5CHM A;  4F3L B;  1NLY A;  2KDK A;  4R3A A;  4I5S A;  3SS3 A;  4JLF A;  3ZG5 A;  2EX9 A;  1ZTU A;  2QHK A;  3BLM A;  1F98 A;  2Y8H A;  1FSW A;  2H28 A;  4R4S A;  3ICY A;  5CED A;  4L9E A;  5HL1 A;  3KYZ A;  2P04 A;  1SHV A;  4FSF A;  1IYP A;  5HPI A;  3PXP A;  3VFF A;  3D4F A;  3AGF A;  1TEM A;  5EFW A;  4A5R A;  3IXH A;  3C5A A;  1NRF A;  1WYB A;  3A0R A;  2WKQ A;  3O88 A;  3VSL A;  5L10 A;  1MPL A;  2W27 A;  5HWV A;  3ULF A;  3MSH A;  5HWT A;  2AVX A;  1IFQ A;  1IEM A;  5EVI D;  1K4F A;  4OPY A;  4WM9 A;  3TSG A;  1VEU B;  3VP1 A;  2HP6 A;  5L07 A;  3A3F A;  5EUA A;  1NYY A;  5FQJ A;  2D01 A;  3SZT A;  1ZC2 A;  4OOL A;  2Y2K A;  3OLO A;  4BWI A;  4X69 A;  4U3T A;  5A90 A;  3H9W A;  4ARZ B;  5HZH A;  3E4Q A;  4LRX C;  1N4O A;  4YFM A;  2QJ5 A;  4PKY G;  3H7W A;  2D02 A;  3A3I A;  4OON A;  3UB9 A;  3N8L A;  2E8J A;  1YAX A;  4KUK A;  1IYS A;  3DTM A;  3TW8 A;  1SKO B;  1W7F A;  1OT9 A;  1TS7 A;  2WGW B;  3LEZ A;  1LSW A;  1S4S A;  3VFH A;  2W1T B;  3LY4 A;  3NBL A;  4HY8 A;  1UWP X;  3A0V A;  2Z2M B;  4E3J A;  4WEK A;  4MN5 A;  4PM9 A;  5HL6 A;  3ZGA B;  1CQA A;  3C2W A;  1S4R A;  2QJ7 A;  4ZDX A;  2L1M A;  4GCZ A;  2K31 A;  3I7J A;  4WYY A;  4XT2 A;  4R70 A;  1NWZ A;  4H6J A;  3UE1 A;  1ES3 A;  2K2N A;  4OH0 A;  1TS8 A;  2XFT A;  1JWV A;  1BLS A;  3W8K A;  2C5W B;  2PD8 A;  2QMI A;  3N7W A;  4AFI A;  4KG5 A;  3HVF A;  3MJQ A;  2UWX A;  4UA7 A;  2FH5 A;  4Q0J A;  1I5Q A;  3QP6 A;  3C4O A;  2WAF A;  5J8X A;  4DN0 A;  4Q0H A;  4GN2 A;  4S2J A;  4OOM A;  1Q2Q A;  1S1Z A;  3ZG9 B;  3VOY A;  4P6B A;  1YM1 A;  3IF5 A;  4LPZ A;  4LEN A;  5FQ9 A;  3ZQ5 A;  4NXF A;  3ITB A;  3HLD A;  2Y59 A;  2Y2I A;  5I94 A;  1VB6 A;  3T1S A;  4DDS A;  4FH2 A;  2E8I A;  4LV1 A;  3GQZ A;  2ACG A;  3NC8 A;  4FCF A;  2P9V A;  4RX2 A;  3E4O A;  3MFD A;  4DF6 A;  1NRJ A;  5L8M A;  1TF1 A;  1OME A;  2PDR A;  4CLC A;  1XA7 A;  3HLC A;  2OAP 1;  4OPQ A;  3V50 A;  1SDN A;  3WS1 A;  2GDN A;  1FR6 A;  4KZA A;  3MMH A;  4JXW A;  4DJ2 A;  4NK3 A;  5MC7 A;  3LEQ A;  4QPR A;  4DXC A;  2BLS A;  5F69 A;  4O0P A;  1S0W A;  4G3W A;  2BAS A;  4ME4 A;  4PM5 A;  3F1O B;  2ZQD A;  4OP5 A;  1D7E A;  1OJ5 A;  1K54 C;  4LLO B;  3R7W A;  1UWN X;  1PNE A;  1AXB A;  4LRZ E;  4EBP A;  2QKP A;  2J80 A;  2K7S A;  1CJF A;  2W1T A;  4JF4 A;  1OJG A;  1ODV A;  3LIE A;  4CLC B;  1H0M A;  2HDS A;  3UE3 A;  3E2K A;  4OQH A;  1SCW A;  5CEC A;  2Z6D A;  1V9Y A;  1EI5 A;  2Y2P A;  3ZCZ A;  3ITA A;  3CMZ A;  4X1L A;  2R78 A;  4EBL A;  1XFN A;  1CEF A;  4EU0 A;  3D72 A;  1BLP A;  2Q9N A;  1TS6 A;  1Z6F A;  3OCN A;  4S2L A;  4WMC A;  1YMX A;  4PM7 A;  1F5M A;  4OLD A;  1QME A;  4EEP A;  2VV7 A;  1L0E A;  3HLG A;  3ZYT A;  3SS5 A;  3PBQ A;  3KSG A;  4JPM A;  4GD8 A;  5GHY A;  3O86 A;  5DFX A;  4RA7 A;  4S2O A;  1BTL A;  3QNC A;  2VEA A;  3OC2 A;  3SH7 A;  2O9B A;  1YLP A;  1FIL A;  2Z2L B;  1K38 A;  3PTE A;  5K5B A;  4KQQ A;  3DTE A;  2WZZ A;  2P9V B;  1G6A A;  3IXG A;  4RVA A;  3CG5 A;  5FAP A;  3IF6 A;  2HDQ A;  4H8R A;  2OLV A;  4IJG A;  1IYQ A;  2ZC3 B;  1M40 A;  3N8S A;  5IT5 A;  4L9G A;  1TS0 A;  3T4Q A;  4D2O A;  3NEC A;  2V1B A;  3EOI A;  1OTA A;  1OPX A;  3RFB A;  1XJ6 A;  4CLC D;  5TJJ A;  5HSQ A;  2VA0 A;  3NOP C;  4X55 A;  5KSC A;  3GEC A;  4DJ3 A;  2NUT C;  3FWL A;  4QD4 A;  2PAV P;  3R7W B;  1HVB A;  2ZJ9 A;  1P0Z A;  3P7N A;  1H3Q A;  3UDX A;  3LIB A;  1RCJ A;  3HLF A;  1T18 A;  4K0X A;  3LR0 A; 
#chains in the Genus database with same CATH homology
 4RQ9 A;  2I9V A;  4PKY A;  4HQA A;  3VV4 A;  1OT6 A;  2ZOI A;  4Y2F A;  4WN5 A;  4II7 A;  2HJ9 C;  4MN7 A;  4YWZ A;  5HPF A;  4BBV A;  2A24 A;  4HJ4 A;  3S7N A;  2WKP A;  3B42 A;  1LSX A;  3BQA A;  5HDD A;  3BW6 A;  2KX6 A;  1G28 A;  3CI6 A;  4MDZ A;  4UQI M;  3EEA A;  2PD7 A;  1WA9 A;  4HH3 A;  4BBU A;  4O01 A;  4EEU A;  3IS2 B;  4LRY C;  4HNB A;  2GNX A;  3F1P B;  3V67 A;  5DKL A;  1BYW A;  4BBT A;  3MXQ A;  1S1Y A;  2VJW A;  4MN6 A;  3IBR A;  5DFY A;  1DP9 A;  4F3L B;  1NLY A;  4IUK A;  3FC7 A;  4O8G A;  3MF0 A;  4IHQ A;  2KDK A;  4R3A A;  4I5S A;  4GS9 A;  2V9A A;  3S7P A;  5F68 A;  2PYR A;  4KQO A;  1ZTU A;  3EQU A;  3A0S A;  2QHK A;  1S67 L;  3T4L A;  3F1O A;  5F5Y A;  1F98 A;  3MQQ A;  2Y8H A;  4HHD A;  3T4T A;  5I5L A;  1S66 L;  2H28 A;  3T4J A;  3JVU A;  3KSH A;  4CLC C;  3ICY A;  2V0U A;  4L9E A;  3KYZ A;  2P04 A;  2Y79 A;  4FSF A;  3O5Y A;  4NXG A;  4JGP A;  3NOT C;  2PR5 A;  2J3W A;  4FOF A;  4HOI A;  2PYP A;  5HPI A;  3DBA A;  3PXP A;  5J7E A;  2P7J A;  5J3W A;  1OTB A;  5EFW A;  2KLI A;  3H7W B;  2PR6 A;  5KIZ A;  1T19 A;  3T4S A;  3LI8 A;  3HCY A;  2JKR M;  4I3A A;  3A0R A;  2WKQ A;  3FPW A;  1DP6 A;  3SW1 A;  4NEE D;  1DP8 A;  2GJ3 A;  2WKR A;  5HWV A;  1MC0 A;  2W27 A;  4Y5F A;  3ULF A;  2LB9 A;  4JGO A;  5HWT A;  2ZOH A;  2J3T D;  4MMN A;  4L0L A;  1IFQ A;  3EGD C;  3VE3 A;  2Z6C A;  2XRO A;  2W3D A;  2XSS A;  3C8C A;  1W63 M;  3HJI A;  3CIT A;  2OWH A;  1NLZ A;  1V9Z A;  2D01 A;  4OOL A;  1XJ2 A;  3OLO A;  1LSV A;  3F1N B;  3PBN A;  5HWW A;  2G7U A;  3CUE A;  3CUE C;  4BWI A;  1OTD A;  3P01 A;  4KUO A;  3H9W A;  4ARZ B;  5HZH A;  1MKM A;  4GW9 A;  3E4Q A;  1YSP A;  4K08 A;  2EWW A;  4LRX C;  3W2Z A;  3PBT A;  2L4R A;  3VE4 A;  2QJ5 A;  4M4X A;  2V1A A;  4YNR A;  3PR6 A;  4PKY G;  3K3D A;  3H7W A;  2D02 A;  3UB8 A;  5C5K A;  3BQ8 A;  3LR4 A;  3NHQ A;  5A8B A;  4DMZ A;  3UB9 A;  2XA7 M;  1D06 A;  1T1B A;  4WEL A;  1YAX A;  2W3H A;  4KUK A;  2KOI A;  2M7U A;  1EW0 A;  2VKS A;  2W3E A;  1P9R A;  3KSI A;  3TW8 A;  4H6J B;  3IS2 A;  4EES A;  4NKP A;  4HP9 A;  3B47 A;  1LT0 A;  2EA9 A;  3T50 A;  1OT9 A;  2P08 A;  5AJG A;  1TS7 A;  1LSW A;  1S4S A;  4GS9 B;  4EET B;  2W1T B;  4BJP A;  3LFV A;  4ETX A;  2JKT I;  2EWV A;  2ZMV A;  4HY8 A;  1UWP X;  3A0V A;  4WEK A;  4PAU A;  1N9L A;  4MN5 A;  4EXO A;  1UGU A;  5HL6 A;  3EWK A;  3K3C A;  3LID A;  2ZBB A;  2QYB A;  3C2W A;  1S4R A;  2OAQ 1;  2QJ7 A;  4JGQ A;  2L1M A;  1P9W A;  3H82 A;  4HP4 A;  5FL3 A;  4CLC E;  2JKT M;  4GCZ A;  1P97 A;  2K31 A;  3VOL A;  1KOU A;  4XT2 A;  4R70 A;  2VZW A;  1F9I A;  2GZA A;  1MZU A;  2V0W A;  1NWZ A;  4HIA A;  4H6J A;  2GX5 A;  4PHT A;  2K2N A;  3NJA A;  4Y3I A;  5G4Z A;  1TS8 A;  5DF9 A;  2OWJ A;  1LL8 A;  3OBF A;  2VV6 A;  2PD8 A;  5AVE A;  3PBS A;  2O99 A;  4AFI A;  4WEJ A;  2A2L A;  4E04 A;  3G6O A;  3B33 A;  2NUP C;  3RH8 B;  1T1A A;  3MJQ A;  2B18 A;  2FH5 A;  2OOL A;  2QWS A;  4Q0J A;  4DN0 A;  4Q0H A;  2M1C A;  4OOM A;  4ZRR A;  3LUQ A;  4L9F A;  1S1Z A;  2O0Y A;  1XJ4 A;  4I3J A;  2PT7 A;  5TBM A;  3LIF A;  3LIC A;  4LPZ A;  3MQO A;  3ZQ5 A;  5DJU A;  2B02 A;  2W3F A;  2A24 B;  4NXF A;  1GSW A;  3KSF A;  3E0Y A;  4G3V A;  1VB6 A;  4HJ3 A;  3BY8 A;  2CMN A;  4UQI S;  2VV8 A;  4B9O A;  3E4O A;  2FZ0 A;  1NRJ A;  4NXB A;  5L8M A;  1TF1 A;  2L0W A;  2PDR A;  3LYX A;  4CLC A;  2OAP 1;  5CX7 A;  3H82 B;  1G6O A;  1YSQ A;  3MMH A;  4DJ2 A;  3FG8 A;  3NOU C;  2HF6 A;  5LBR A;  3T4O A;  5MC7 A;  3OCL A;  2VX8 A;  4QPR A;  2HGV A;  4HI4 A;  3BY9 A;  2W3G A;  2JKR I;  4R6L A;  5F69 A;  4UEY A;  4O0P A;  4G3W A;  2BAS A;  4ME4 A;  3F1O B;  4I3I A;  5J4E A;  1D7E A;  1OJ5 A;  3UMD A;  2O9C A;  5IU1 A;  3UME A;  2MJ6 A;  4EER A;  4LLO B;  3R7W A;  1ZHH B;  1JNU A;  1UWN X;  3UE6 A;  2YKF A;  5HD3 A;  4LRZ E;  2QKP A;  2J80 A;  1T1C A;  2K7S A;  2W1T A;  2IA2 A;  1H8M A;  1OJG A;  2M7V A;  1ODV A;  4ETZ A;  5KSH A;  3LIE A;  4CLC B;  3MR0 A;  4HH2 A;  3UE3 A;  4EW7 A;  2ZMF A;  5HDC A;  2INW A;  1X0O A;  2DMW A;  4I38 A;  2Z6D A;  4GJ4 A;  4WUJ A;  1V9Y A;  4P6Z S;  4KQD A;  5HD5 A;  4Z1W A;  3S7Q A;  4NXE A;  2LB5 A;  2JN7 A;  1GSV A;  2R78 A;  3GDI A;  1XFN A;  1GSX A;  3CWF A;  3LR3 A;  3LR5 A;  4EU0 A;  3D72 A;  3PBO A;  1TS6 A;  5F6A A;  3PHY A;  1DRM A;  1VHM A;  3OCN A;  1XFQ A;  4P6Z M;  2HV1 A;  3KYQ A;  4GLQ A;  3S7O A;  1F5M A;  4Q0I A;  3HJK A;  3EQV A;  3CAX A;  4WF0 A;  3D3O A;  4B93 A;  4EEP A;  3RTY A;  3PYP A;  3IBJ A;  1XJ3 A;  2VV7 A;  2YKH A;  3ZYT A;  2XRN A;  3F1N A;  5IS1 A;  3PBQ A;  3KSG A;  3UB6 A;  4R38 A;  3F1P A;  2XA7 S;  3CLO A;  3KO6 A;  5AVF A;  5DFX A;  3BWL A;  1W63 Q;  2VEA A;  1N9O A;  3OC2 A;  2O9B A;  3MFX A;  1N9N A;  2PHY A;  4JGR A;  4HJ6 A;  3K2N A;  4EUV A;  2HJE A;  3PBR A;  4G3K A;  3R4K A;  1Y28 A;  3LIA A;  3FPV A;  1TD5 A;  2W1R A;  4WL9 A;  5K5B A;  3C38 A;  3E98 A;  5G4Y A;  3TRC A;  1STZ A;  3TE8 A;  3E4P A;  4GHI A;  4IUH A;  3LI9 A;  5TBM B;  1OTI A;  2VLG A;  4IJG A;  2VGL S;  5IT5 A;  3UB7 A;  4L9G A;  1TS0 A;  5DJT A;  3T4Q A;  3BJN A;  1IOU A;  4CQH A;  2W0N A;  4EQ1 A;  3U2A A;  2V1B A;  3C30 A;  3EOI A;  2O9A A;  1OTA A;  3OOV A;  1OPX A;  3RFB A;  4I39 A;  1XJ6 A;  4CLC D;  5TJJ A;  5HSQ A;  2VA0 A;  3EEH A;  2J3T C;  3NOP C;  4MCW A;  2JHE A;  5HDS A;  3GEC A;  4WLA A;  2VGL M;  3EGX C;  4DJ3 A;  2NUT C;  4F3L A;  3MQ0 A;  1OTE A;  4XT2 B;  3KX0 X;  3JVV A;  1YKD A;  4ARZ A;  5DKK A;  3T4K A;  4GHI B;  4YOF A;  3R7W B;  1P0Z A;  3P7N A;  1H3Q A;  4BMW A;  3LIB A;  3TJZ C;  1T18 A;  3LR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...