4JGPA

The crystal structure of sporulation kinase d sensor domain from bacillus subtilis subsp in complex with pyruvate at 2.0a resolution
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
206
structure length
206
Chain Sequence
EKDTIAAEHKQEASVLLNLHRNKINYLIGETMARMTSLSIAIDRPVDIKKMQSILEKTFDSEPRFSGLYFLNAKGDVTASTTELKTKVNLADRSFFIKAKETKKTVISDSYSSRITGQPIFTICVPVLDSKRNVTDYLVAAIQIDYLKNLINLLSPDVYIEVVNQDGKMIFASGQASHAEDQKPVSGYLDDISWNMKVYPNPVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sporulation kinase D
publication title Insight into the sporulation phosphorelay: Crystal structure of the sensor domain of Bacillus subtilis histidine kinase, KinD.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Transferase
total genus 55
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4jgpA02
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4jgpA01
2WKPA 4B9OA 1DP6A 2ZBBA 5G4YA 5J4EA 3F1NA 3HJKA 4WN5A 1N9OA 3F1PB 2QKPA 4RQ9A 1LSWA 5IS1A 1X0OA 4EW7A 2D01A 4L9GA 3MXQA 3LICA 3MQQA 4GHIA 1XJ6A 3CLOA 4E04A 2PYPA 3LIBA 3NOUC 1TS7A 5DKLA 3RH8B 2YKFA 2QJ7A 4EESA 4HQAA 2CMNA 3E4PA 4NXEA 5HWTA 1F98A 4MN6A 1P0ZA 1S4SA 3C8CA 3UB8A 1S66L 3LI8A 3NHQA 2B02A 1ODVA 2V0UA 3H82B 5DKKA 4GCZA 4KUKA 3H7WB 2BASA 3UE6A 3IS2A 4JGQA 1OTIA 5HDDA 1LSXA 3MR0A 4I3IA 3F1NB 3MJQA 4WUJA 3RTYA 4LRZE 2OWHA 3PYPA 2I9VA 3OLOA 2PR6A 1T18A 1T1BA 5IU1A 3HJIA 4BBUA 4JGRA 1XFQA 1N9NA 1DRMA 4GHIB 3CAXA 5HDCA 3LIAA 4NXFA 4HIAA 3T50A 2A24A 3GECA 4I39A 2V1AA 3C2WA 4HJ6A 3ULFA 4WL9A 1Y28A 3ZQ5A 1VB6A 4EXOA 5TBMB 4NXBA 3NOTC 4LPZA 3EWKA 3A0SA 1OTAA 1V9YA 4BBTA 4WF0A 3E4OA 1GSXA 1WA9A 3IS2B 5F69A 1TS0A 2V0WA 4XT2A 1OTBA 1XFNA 1KOUA 2V1BA 3UB6A 3CWFA 1V9ZA 1GSVA 1JNUA 3A0RA 3LIEA 3VE3A 2D02A 1NWZA 1G28A 2VLGA 5HD5A 4EEPA 5DJUA 3BY8A 3F1OB 1EW0A 3LIDA 3LYXA 5HWWA 2A24B 2QWSA 1UGUA 2PR5A 3MQOA 4I3JA 2PD8A 2KDKA 1OTDA 4YWZA 1P97A 1LSVA 5AVFA 1XJ4A 5HWVA 2W27A 1OJGA 4HY8A 4HP4A 1T1AA 4EETB 4GW9A 4H6JA 3VOLA 2Z6CA 4JGPA 5DJTA 4HNBA 4PKYA 1GSWA 2HV1A 1LT0A 2H28A 3PHYA 2EA9A 4LLOB 3BWLA 2VV6A 1S1ZA 4DJ2A 3B33A 1XJ2A 3IBRA 2J80A 2WKQA 1DP8A 4M4XA 4HOIA 1S1YA 2Z6DA 2PYRA 3LIFA 4R38A 5AVEA 5HD3A 4HHDA 1T1CA 5KIZA 4I3AA 5F68A 3EEHA 3FC7A 4R70A 3UB9A 4KUOA 2PDRA 4PKYG 4F3LA 5HSQA 1DP9A 1OTEA 2VV8A 5I5LA 3P7NA 3GDIA 4R3AA 3A0VA 3D72A 4GS9A 4LRYC 4EERA 1TS8A 5HDSA 2QHKA 3NJAA 3KX0X 3ICYA 2VV7A 4H6JB 3UMDA 2VEAA 5J3WA 4HJ3A 4L9FA 2OWJA 4NXGA 4BBVA 2WKRA 1D06A 4WLAA 4I5SA 1UWPX 1XJ3A 2P7JA 5TBMA 4R6LA 3LUQA 5A8BA 2ZOHA 2QJ5A 2ZOIA 3UB7A 4EEUA 1LL8A 2OOLA 4LRXC 5J7EA 5F5YA 1OJ5A 2R78A 3F1PA 4JGOA 4L9EA 4HH2A 2V9AA 4MN5A 1OT9A 4KQDA 2W0NA 2K7SA 1UWNX 5F6AA 1N9LA 1TS6A 1BYWA 2PD7A 2JN7A 2L4RA 5EFWA 2M1CA 4F3LB 3K3CA 4HP9A 4HJ4A 2YKHA 2JHEA 4EQ1A 2PHYA 3MFXA 4HH3A 4XT2B 1S4RA 5HZHA 1OT6A 3E4QA 1S67L 4HI4A 4GS9B 1T19A 5G4ZA 1MZUA 4K08A 2KX6A 3UMEA 3NOPC 3LI9A 2GJ3A 3F1OA 3VE4A 3H82A 4DJ3A 3H7WA 3K3DA 2L0WA 2L1MA 3SW1A 2INWA 3G6OA 1F9IA 1D7EA 4I38A 3BY9A 3FG8A 3H9WA
chains in the Genus database with same CATH superfamily
5CTNA 3IF6A 1ALQA 1DP6A 5G4YA 3HJKA 3CUEA 2WGVA 3F1PB 2QKPA 1KE0A 2H0TA 3BRMA 3BLSA 4EWFA 3C38A 3ZNYA 1LSWA 1K55C 5IS1A 1AXBA 4GZBA 1X0OA 4EW7A 4FUWA 3ZG5A 4FTXA 3MXQA 3IQAA 5KMWA 2JKTM 3LICA 1SHVA 4E04A 2O99A 3OPHA 5DKLA 2QJ7A 4EESA 2XFTA 1FSYA 3Q7ZA 4HQAA 4DN0A 4ARZB 4NXEA 5HWTA 1QMEA 4S2LA 3T4TA 1RGZA 2Y4AA 5FAQA 2X01A 4ME4A 2QPNA 3ZVWA 5TGFA 2XD5A 5DTKA 2HZ5A 1I2WA 3H82B 1K54A 3H7WB 3VOYA 5GLBA 4OH0A 4OPYA 1XKZA 3S7NA 4OPRA 2XSSA 2I9VA 3OLOA 5FI7A 2ZMFA 2Y2JA 4P0MA 3UB5P 3JYIA 3PBRA 4OQ0A 3HJIA 2ZMVA 4LFUA 2HP5A 4BD1A 4JGRA 1YMXA 5DFXA 4LV3A 4ZJ1A 4X68A 1H0MA 4FH4A 1DRMA 4KQOA 1YLYA 2QYBA 3CAXA 5HDCA 3LIAA 2NUPC 4NXFA 5HW3A 3EEAA 2A24A 4MBFA 3GECA 5L10A 2V1AA 2P04A 2V20A 2W1RA 2W3EA 3ZQ5A 4U3TA 2A3UA 3HLFA 2JC7A 3HLGA 4OQGA 2VZWA 4UQIM 1ZG4A 4BBTA 5U47A 1DY6A 2K31A 3IF6C 1GSXA 1IEMA 1ES4A 3ZHHA 4JF6A 1K6SA 1LI0A 3CUEC 4BL3A 1CI9A 3PAGA 1RP5A 1TS0A 4G3KA 1MWTA 1A0KA 3SOIA 2JBFA 4PM7A 1PNEA 5CHJA 1ES5A 4FH2A 5FQIA 1S0WA 3UB6A 3CWFA 3VOZA 1PWGA 2GX5A 3D9YA 4H8RA 3CPTA 1JNUA 3VSKA 2D02A 3BW6A 1S6RA 4O8GA 4GDBA 5HPFA 1PIOA 2VLGA 1ZTUA 4KZ5A 3VFFA 3PBQA 3Q1FA 1L3LA 5EVID 1EW0A 5E43A 4KQQA 3HUMA 4ETXA 4GOGA 3MS6A 4ZJ3A 2A24B 2JKGA 3BECA 1UGUA 5EM1A 2J3TC 3MQOA 2Y91A 4I3JA 4X1MA 3MBZA 1U60A 4YWZA 1NLYA 3HBRA 2PRFA 1K54C 4S2OA 2BG1A 3MFDA 4GJ4A 5HWVA 1K6RA 1FCOA 2W27A 3IT9A 3EGXC 2DCFA 1KGFA 1VEUB 4HY8A 3T1SA 4KZ7A 3IXGA 4GW9A 4WMCA 4O7DA 2ZC6B 3W4QA 2EX2A 3BFCA 4H6JA 3SS4A 1PI4A 4Y7PA 5CRFA 4JGPA 1Y4OA 1YQSA 2Y8HA 4D60A 5AQBA 1Q2QA 2JKRI 3UPPA 4YOFA 3IWIA 1DJAA 1CEGA 2X71A 3LY4A 3UPOA 4YNRA 5HARA 1VHMA 3UO9A 4DJ2A 1ONHA 3CPTB 1GA9A 5KSCA 4RA7A 1O7EA 5M1AA 4Q0HA 1ERMA 3E2KA 2WKQA 4HBTA 4HOIA 2Z6DA 5CX7A 4S2PA 1XPBA 4FOFA 3KO6A 4Y15A 3MZDA 1DJBA 4X56A 1JWPA 4Y2FA 3V5MA 3LCEA 2VKSA 5K5BA 5CECA 3MXSA 3P7NA 3E98A 3T1QB 3A0VA 1TS8A 4OVDA 2H0YA 3KX0X 5CGWA 4B4ZA 2JKFA 4H6JB 2ZQ9A 4ID4A 4N9KA 5F1FA 5GL9A 3OPPA 3DWKA 4L9FA 3T12B 2Y79A 4BBVA 1LI9A 4S2NA 1XGJA 2B95A 1PWCA 1IOUA 1NRFA 3BEBA 2PT7A 3HL9A 4WLAA 3GR2A 1W5DA 5TBMA 4ZTKA 2ZOHA 1G68A 2IWDA 3LFVA 4EEUA 5F5YA 1OJ5A 1FCNA 4HH2A 3AGDA 5D3OA 1YKDA 5F6AA 2ZM0A 4QPRA 1TS6A 2B18A 5CHMA 5F83A 1TEMA 2JN7A 3ZYTA 5EFWA 5A93A 3NY4A 4L0LA 3K3CA 1YSPA 3CHWP 2XH9A 3C7VA 4MCWA 1FR1A 2YKHA 3Q81A 1MC0A 3U2AA 4XT2B 3ZNTA 3G35A 1OT6A 1NRJA 2ZM2A 1ZC2A 2XEPA 1KE4A 1T19A 5EPHA 2E8JA 3UMEA 1HTZA 3DW0A 3NOPC 2VGLS 5BOHA 1BLPA 4N92A 3QP2A 1NZOA 3G4PA 1CK3A 5FQQA 1QMFA 1D7EA 4JXWA 2Z2MB 3PBSA 3H9WA 2ZL1B 3QP5A 4Y3IA 4B9OA 3BM6A 1K25A 4DF6A 1YLTA 3EQVA 2J9PA 5J4EA 5IHVA 5EOEA 4DE3A 4EBLA 1H8YA 2M7UA 2XR0A 3MF0A 4LCLA 4Z1WA 1PWDA 1YLWA 3MQQA 2Y2GA 4GHIA 3ZVTA 4DDYA 3LIBA 3OBFA 2EX8A 4E3MA 4OPZA 2ZLYA 1YM1A 1FSWA 2CMNA 1YPRA 5DVAA 3HLCA 3KSGA 3QHYA 4JXVA 4E6WA 3UB8A 1S66L 4ZAMA 2B02A 4S2NC 1ODVA 4QJGA 5HFOA 2V0UA 3IH8A 3B42A 4B88A 2WADA 5DKKA 4Y0TA 1K0KA 2HDSA 4GCZA 5HPIA 2Y2MA 1YMSA 3IS2A 3UDXA 5DTSA 3UN7A 4HEFA 4Y5FA 5L07A 5EVIA 5L2FA 5FSRA 4GB7A 4PHTA 1O07A 3FPVA 4OPQA 2NUTC 3MR0A 2W3HA 3HLDA 3IHBA 3ZCZA 3T4KA 1ES3A 2WAEA 3NI9A 1ZKJA 4LRZE 3PYPA 1KE3A 5CGSA 2PR6A 1DJCA 3B3XA 4R3JA 1K56D 3P98A 5EVLA 2H10A 3BFFA 4JKTA 3DTMA 1BULA 1XFQA 4GHIB 4BQMA 4FSFA 1L0DA 3T4JA 1ESIA 3MSHA 4I39A 1K4EA 3ULFA 4WL9A 1Y28A 1VB6A 4EXOA 5LBRA 3IWOA 1CJFA 4E3OA 3A3DA 5GLCA 5DF9A 3EWKA 3IWQA 4R0QA 4IUHA 1V9YA 4P87A 3LY3A 4PM9A 5E2EA 2EFUA 3E4OA 3VFHA 2JCHA 2UV0E 1WA9A 1GHMA 3IS2B 4KZ9A 3TJZC 1KVLA 2AVXA 3S4XA 1IYPA 1OTBA 3FKWA 2VGJA 4MBHA 4EV4A 1PFLA 4MMNA 4UA6A 1GSVA 3LIEA 2Y2LA 1BLHA 2BTFP 3WS1A 1G28A 3T4QA 1YLJA 2XLNA 4OLDA 4EEPA 5DJUA 2LB9A 2V8CA 5A91A 3BY8A 3F1OB 1ZHHB 3LYXA 3HREA 1NLZA 2Y2IA 2UWXA 2PR5A 4BL2A 3M2JA 1OTDA 2KDKA 2BLSA 5M19A 2O0YA 3V3SA 5AVFA 3IF6B 1Q2PA 2XK1A 5A92A 2V2FF 2XA7M 1MKIA 4WEJA 3SZTA 5M18A 3RXXA 5EVIC 3EGDC 1T1AA 4EETB 2P9VA 1GHPA 1YLPA 2OSUA 3ZGAB 5EE8A 1NXYA 3OOVA 3MKEA 3IX4A 3VOLA 4DRTA 1LL5A 2Z6CA 3GTCA 5EUAA 3BLMA 4PKYA 1EI5A 1GSWA 2HV1A 1F2KA 3GSGA 3TG9A 3QNBA 2H28A 3PHYA 4CLCE 4LLOB 3BWLA 3ITAA 2VV6A 2HP9A 4GN2A 1M40A 2J3WA 3CG5A 4HESA 3B33A 1ZG6A 4BLMA 3LO7A 1FILA 1DP8A 2EXBA 3UDFA 4M4XA 4FCFA 3W4PA 1GHIA 5HD3A 5F68A 3JPUA 2V1ZA 4QU3A 4R70A 3C4OA 2KOIA 3BFEA 4KUOA 2PDRA 3L9KA 4PKYG 2EFXA 3LR0A 5EECA 5HSQA 4KZ8A 5F1GA 1DP9A 3S7OA 1CQAA 1ESUA 4S2IA 4CLCD 3BFGA 4R3AA 1OMEA 3WRZA 3VSLA 1H8MA 3VP1A 2XFSA 1ONGA 5FQKA 2WAFA 2Q0OA 3NJAA 2P9VB 3ICYA 2R9WA 3UMDA 3SH9A 2ZC3B 3N8LA 2VEAA 4HJ3A 2VGKA 2OWJA 4XXRA 4LV1A 4P6BA 5JYOA 4WM9A 4WEKA 1FOFA 3IBJA 3CZDA 5E2GA 3IX3A 2HJEA 4XUXA 2OLVA 2ZQ7A 2EWVA 2HPBA 3BYDA 4AFIA 1UWPX 1XJ3A 2Y55A 3HUOA 4R6LA 4WBGA 3TOIA 1IFQA 2QJ5A 4E3JA 3N8SA 1LL8A 4LRXC 5J7EA 3TRCA 3GRJA 4L9EA 4MN5A 5FDSA 1N4OA 1MPLA 1Z09A 1UWNX 1N9LA 3WS5A 3DTIA 3W8KA 2L4RA 1MKMA 1NYYA 2G7UA 2WKIA 1HD8A 2ZC5B 4MEZA 4Y17A 4UA7A 4HP9A 1BZAA 1OPXA 5FEGA 2JKTI 4EQ1A 3KYZA 4BENA 1S4RA 4WZ4A 5HZHA 5EOOA 1FIKA 5G4ZA 3VV4A 4DXBA 5HL6A 2XRNA 3VE4A 3VP3A 3DWZA 2JE5A 2P08A 4DJ3A 4MBKA 2XF3A 4UA9A 3RJUA 4IHQA 3SW1A 1I2SA 2ZD8A 3G6OA 4QY5A 1F9IA 4EU0A 2H5SA 3C5AA 2DRWA 4XUZA 3NDEA 2Y2OA 5FQ9A 2FFFB 3CMZA 3N6IA 2WKPA 5G18A 3R4KA 4GD8A 3ISGA 1C3BA 5AQ9A 4KZ3A 1MWRA 3F1NA 4OLGA 4K0XA 3O5YA 2J9OA 1PRQA 4ZBEA 4X55A 3T1RA 2FZ0A 4S2JA 3TW8A 2PU2A 4C3QA 4RVAA 5MC7A 5HAQA 3CLOA 1KDSA 2PYPA 3NOUC 4R3BA 3RH8B 4ZDXA 2YKFA 1K4FA 1G5UA 2ACGA 5E2FA 3E4PA 1BSGA 3W2ZA 1F98A 2WZZA 1P0ZA 1IYOA 3DAVA 3FZCA 3SS3A 1XA1A 3LI8A 5FQMA 1HZOA 1CEFA 2XDMA 2LB5A 3ZDJA 4OKPA 4CPKA 4KZAA 4UAAA 3PBOA 2ZC4B 4EBNA 4KUKA 1PW8A 3K2NA 2BASA 3ZG7B 4DE0A 3CJMA 4NEED 1OTIA 2HDUA 4OONA 1LSXA 2Y59A 4U0XA 2Y2NA 5CERA 4I3IA 4JXSA 5IT5A 3FKVA 3F1NB 5FI2A 3MJQA 4WUJA 4E3LA 4Q0JA 3N8RA 3WWXA 5FI6A 1T18A 2Q9MA 3ZG8B 2HF6A 2ZQ8A 5IU1A 2XROA 4X25A 4MDZA 4BBUA 4Y0OA 4S2MA 3AGEA 3CITA 1N9NA 3GMWA 2Q9NA 1E3UD 3OPLA 5GLDA 4ESPA 4NK3A 4JF5A 1IYQA 2QZ6A 4YFMA 2V8FA 4MLLA 4OOYA 1CI8A 4HJ6A 3OZHA 3QNCA 1W7FA 2OAP1 1K57A 2ZM8A 5TBMB 1KVMA 3NOTC 4LPZA 5C5KA 5AJGA 3FWLA 3JVVA 1SZVA 1SCWA 5F82A 4CQHA 2EWWA 1BT5A 2PBDP 5CHUA 2RCXA 4MN7A 3V39A 2GDNA 3QP4A 4F94A 1E4DA 2HP6A 2V0WA 5EVEA 2A49A 4JPMA 1MWSA 3O86A 4BWIA 3IF5A 3BQAA 4GD6A 3OCLA 2V1BA 1KOUA 3NBLA 1I5QA 2ZQCA 1V9ZA 4CLCA 2G2WA 3VE3A 1SDNA 1PZPA 1P9WA 4WELA 1FCMA 5HD5A 1MBLA 3MMHA 3LIDA 3A3JA 4DE2A 4JF4A 4JLFA 3G2YA 3O88A 4S2KA 2QWSA 4IBRA 3UPNA 3FV7A 4PM5A 3DTEA 3DTKA 1P97A 3Q7VA 4PM8A 4WMCD 4U0TA 3HLWA 1J9MA 3FYZA 1OJGA 3SS5A 4DE1A 2WYXA 2EX6A 3BJNA 1KDWA 1EWZA 2W1TA 5TR7A 3EQUA 5GLAA 3ZG9B 2RL3A 3JVUA 3O3VA 3IH9A 3U4LP 3HLEA 2VJWA 4X6TA 3MZFA 1STZA 4OOLA 3IX8A 1LT0A 1E25A 1S1ZA 2MJ6A 3NC8A 5CEDA 1MWUA 4K91A 3LGOA 3IHAA 2J80A 1WE4A 4RX3A 2C5WB 3NIAA 2OAQ1 3ZFZA 2PYRA 1MXOA 3LIFA 4R38A 5JYPA 3E0YA 4HHDA 5KIZA 3BQ8A 2IWBA 3DBAA 3EEHA 3FC7A 1K57C 4G3VA 3UB9A 4EUZA 3V3RA 3VP0A 4F3LA 4IUKA 1ACFA 5EVIB 1TF1A 3GVBA 3Q7VB 5I5LA 3GDIA 3V50A 4P6ZS 1NZUA 3D72A 4GS9A 4EERA 1H8ZA 4IVIA 1FQGA 3MZEA 2OLUA 5GHZA 2DMWA 3C7UA 1VM1A 5L8MA 2W3DA 2W1TB 3LEZA 4WZ5A 4IJGA 2JKRM 3WRTA 1M6KA 1Z6FA 4NXGA 1Y54A 1WYCA 4R4RA 4YINA 3KYQA 4CLCC 4KENB 1TDGA 3UE1A 4BMWA 1D06A 1YLZA 1BLSA 4JXGA 4QHCA 3A3IA 5A8BA 2ZOIA 3NCKA 5FA7A 1WYBA 3UB7A 1H5XA 2R78A 2EX9A 4LCMA 1VQQA 2V9AA 5EV0A 1TD5A 2W0NA 4WYYA 3WS2A 1BYWA 2A2LA 3OPRA 4LV0A 4EQIA 1W63Q 3SH8A 1TVFA 5L09A 2M1CA 2PAVP 4F3LB 1LLBA 4GNUA 2VA0A 3D3OA 4P85A 3LEQA 4HJ4A 3VP2A 2JHEA 4BJPA 2PHYA 3MFXA 4B4XA 4HH3A 2PU4A 4NETA 4EUVA 3E4QA 4HI4A 2WKHA 1KGEA 4GS9B 2HDRA 4JBFA 4N9LA 1MZUA 2M7VA 2WGWA 2Y2PA 1KGGA 3WS0A 3LI9A 3M6HA 3G31A 2VGLM 5DTTA 2GJ3A 1XX2A 5HAPA 3QP1A 3RFBA 3G34A 3K3DA 2ZC7A 2L1MA 3Q07A 4LGWA 2X02A 1XXMA 1JTDA 2KLIA 1E3UA 4I38A 3FG8A 3RXWA 4IVKA 1VETA 1PZOA 2ZBBA 2WK0A 4WN5A 4N1HA 1N9OA 3UY6A 4B93A 1VEUA 1EROA 4X1LA 2Y2KA 4HBUA 4RQ9A 3MKFA 4PPRA 1CF0A 2DNSA 2D01A 3KSIA 4L9GA 1IELA 4QB8A 5FL3A 3B47A 1XJ6A 3VP4A 4Q8IA 4OQHA 1TS7A 1BUEA 1D1JA 4RX2A 2HJ9C 2J7VA 3LR4A 1MY8A 4DKIA 3UE3A 1JWVA 3KSHA 4WZ5C 4OP8A 2QMIA 4DXCA 3AGFA 2Y2QA 3PBNA 4QY6A 4MN6A 1RGYA 1SKOA 2J8YA 4KG5A 2WGWB 1S4SA 3C8CA 5J8XA 2GNXA 4KG6A 3TSGA 3HLBA 3NHQA 3T4LA 1NYMA 4O0PA 2HDQA 3TE8A 1BLCA 3KSFA 1L0EA 4KZ6A 3E2LA 2WUQA 3UE6A 4DMZA 4O01A 5GHYA 4JGQA 5HDDA 4Q0IA 2WZXA 1HLUP 1XA7A 1VETB 3IXHA 3UNWA 1JWZA 3O87A 3RTYA 5DF7A 2OWHA 1H3QA 2GZAA 4EBPA 2ZQDA 3A3EA 5CGXA 1T1BA 3N4IA 4PAUA 1XP4A 3L7HA 1J3WA 4N1XA 1P9RA 1SKFA 5GHXA 1PYYA 1K56A 3PTEA 3NULA 4HIAA 3T50A 3T1XA 5AQ7A 3KYEA 5E2HA 3M6BA 3PXPA 3C2WA 2W3FA 4QWOA 4ZJ2A 1TDLA 1SKOB 3HVFA 4NXBA 3T4SA 4G3WA 3G30A 4Y13A 1W8QA 2B5RA 3A0SA 4ZRRA 5DFYA 3G2ZA 3W4OA 1OTAA 5KZHA 3GQZA 3LR3A 2HGVA 4WF0A 1GA0A 3D4FA 1ERQA 3NECA 4NG2A 4R4SA 3S7PA 5F69A 4RYEA 4KG2A 2O9CA 3ITBA 5FASA 1YT4A 2PBYA 5HX9A 5FDHA 4XT2A 2FFYA 2IWCA 5TJJA 4E3KA 4GDNA 4P6ZM 3IXBA 3QP8A 1XFNA 2J3TD 3I7JA 2O9BA 4LENA 4OP5A 4UHUA 3A0RA 4CJNA 1NWZA 3QP6A 3BFDA 5AQAA 3ZG0A 3PR6A 1IKIA 2XD1A 2XGNA 1IKGA 5FEFA 4R23A 2E8IA 5HWWA 1HVBA 4NKPA 3S7QA 4R1GA 2ZL1A 4X69A 2PD8A 1JTGA 2XQZA 3S22A 4II7A 3HCYA 1LSVA 1PI5A 4K0WA 4DDSA 3WS4A 1XJ4A 4IBXA 5FATA 4MNRA 2XA7S 3CI6A 3MXRA 4A5RA 3R7WA 3PAEA 5CTMA 4HP4A 5KSHA 3Q82A 2VK3A 4GLQA 5CEBA 1YAXA 4PMAA 4C75A 5DJTA 4HNBA 3GV9A 2CC1A 1GCEA 4FD8A 4Y0UA 4Z9QA 4PM6A 2OV5A 3MQ0A 5HL1A 2EA9A 3UDIA 1K38A 1XGIA 2I72A 1G6OA 1XJ2A 3IBRA 5TFQA 5I94A 1L0FA 2VX8A 3C30A 2Z2LB 2FH5A 2W3GA 1S1YA 1L2SA 3LR5A 5AVEA 4KZ4A 2K2NA 5DF8A 1T1CA 1SDEA 4I3AA 4UQIS 3A3FA 2ZQAA 1K55A 1OTEA 3M2KA 2IA2A 2VV8A 4IEDA 3VMAA 1YSQA 4LRYC 5HDSA 2QHKA 3S1YA 3R7WB 4ETZA 1N9BA 3IXDA 5A90A 2VV7A 3OCNA 3OC2A 3SH7A 1AWIA 5J3WA 1PW1A 3V67A 4OQIA 5EM0A 4QD4A 2O9AA 2WKRA 2Y2HA 1NJ4A 1W8YA 4M3KA 4I5SA 3P09A 1RCJA 2P7JA 4KQRA 3LUQA 2WGIA 4OOMA 1JVJA 2OOLA 1L0GA 2G2UA 5FAPA 3F1PA 4JGOA 3P01A 2P74A 1OT9A 4KQDA 4E6XA 1IYSA 3C4PA 2K7SA 1BTLA 5HAIA 2PD7A 1W79A 2C6WB 4LV2A 3UE0A 1W63M 3HUNA 4D2OA 2R9XA 3NDGA 1NY0A 4E3IA 4C6YA 1G6AA 2WKEA 4ARZA 4KZBA 1ES2A 1S67L 3G32A 4K08A 4X53A 2KX6A 5FQJA 4CLCB 4E3NA 5FAOA 3F1OA 3H82A 1LHYA 5CXWA 3H7WA 1F5MA 1FR6A 3FPWA 4BD0A 2L0WA 4UEYA 2INWA 2ZJ9A 2ZMAA 2EXAA 3PBTA 4GKUA 3EOIA 3N7WA 1LL9A 3BY9A 3T4OA
chains in the Genus database with same CATH topology
2WKPA 4Y3IA 4B9OA 3R4KA 1DP6A 3EQVA 2ZBBA 5G4YA 5J4EA 3F1NA 3HJKA 3CUEA 4WN5A 1N9OA 3F1PB 2QKPA 4B93A 3O5YA 2M7UA 3C38A 4RQ9A 3MF0A 1LSWA 5IS1A 1X0OA 4Z1WA 4EW7A 2FZ0A 2D01A 3KSIA 4L9GA 3MXQA 3TW8A 2JKTM 5FL3A 3B47A 3LICA 3MQQA 5MC7A 4GHIA 1XJ6A 3CLOA 4E04A 2PYPA 3LIBA 2O99A 3NOUC 1TS7A 3OBFA 5DKLA 2HJ9C 3RH8B 2YKFA 2QJ7A 3LR4A 4EESA 3UE3A 3KSHA 4HQAA 4DN0A 4ARZB 2CMNA 3E4PA 3PBNA 4NXEA 5HWTA 3W2ZA 1F98A 3KSGA 4MN6A 1P0ZA 1S4SA 3T4TA 3C8CA 3UB8A 1S66L 2GNXA 3LI8A 3NHQA 2B02A 4ME4A 3T4LA 1ODVA 4O0PA 2LB5A 2V0UA 3TE8A 3B42A 3H82B 5DKKA 3KSFA 3PBOA 4GCZA 5HPIA 4KUKA 3H7WB 3K2NA 2BASA 3UE6A 3IS2A 4NEED 4DMZA 4O01A 4Y5FA 4JGQA 1OTIA 5HDDA 4Q0IA 1LSXA 4PHTA 3FPVA 2NUTC 3MR0A 4I3IA 2W3HA 3T4KA 3S7NA 5IT5A 3F1NB 3MJQA 4WUJA 3RTYA 4LRZE 2OWHA 4Q0JA 3PYPA 1H3QA 2XSSA 2GZAA 2I9VA 3OLOA 2PR6A 2ZMFA 1T18A 1T1BA 2HF6A 3PBRA 5IU1A 3HJIA 2ZMVA 4PAUA 2XROA 4MDZA 4BBUA 1P9RA 4JGRA 5DFXA 1XFQA 3CITA 1N9NA 1DRMA 4KQOA 4GHIB 2QYBA 3CAXA 5HDCA 3LIAA 2NUPC 4NXFA 4HIAA 3EEAA 4FSFA 3T50A 2A24A 3T4JA 3GECA 4I39A 3PXPA 2V1AA 3C2WA 2P04A 4HJ6A 2W3FA 3ULFA 2W1RA 4WL9A 1Y28A 2OAP1 2W3EA 3ZQ5A 1VB6A 4EXOA 5TBMB 4NXBA 3NOTC 5LBRA 3T4SA 4LPZA 5C5KA 4G3WA 5DF9A 3EWKA 2VZWA 5AJGA 3A0SA 4ZRRA 5DFYA 1OTAA 4IUHA 1V9YA 4UQIM 4BBTA 3LR3A 2HGVA 3JVVA 4WF0A 3E4OA 2K31A 1GSXA 4CQHA 2EWWA 1WA9A 4MN7A 3IS2B 3S7PA 5F69A 3CUEC 3TJZC 2O9CA 1TS0A 4G3KA 2V0WA 4XT2A 1OTBA 5TJJA 4BWIA 3BQAA 4P6ZM 3OCLA 1XFNA 1KOUA 2J3TD 2V1BA 3UB6A 4MMNA 3CWFA 2O9BA 1V9ZA 2GX5A 1GSVA 1JNUA 3A0RA 3LIEA 4CLCA 3VE3A 1NWZA 2D02A 3BW6A 4O8GA 1G28A 3T4QA 1P9WA 4WELA 5HPFA 2VLGA 5HD5A 1ZTUA 3PR6A 4EEPA 5DJUA 2LB9A 3PBQA 3BY8A 3F1OB 1EW0A 3MMHA 3LIDA 4ETXA 1ZHHB 3LYXA 1NLZA 5HWWA 2A24B 4NKPA 2QWSA 3S7QA 1UGUA 2PR5A 2J3TC 3MQOA 4I3JA 2PD8A 2KDKA 1OTDA 4YWZA 1NLYA 4II7A 1P97A 1LSVA 2O0YA 3HCYA 5AVFA 1XJ4A 4GJ4A 5HWVA 2XA7S 3CI6A 2XA7M 2W27A 4WEJA 1OJGA 3EGXC 3R7WA 4HY8A 3EGDC 4HP4A 1T1AA 5KSHA 3BJNA 4EETB 2W1TA 4GLQA 4GW9A 3EQUA 4H6JA 3OOVA 1YAXA 3VOLA 3JVUA 2Z6CA 4JGPA 5DJTA 4HNBA 2Y8HA 4PKYA 1GSWA 2HV1A 2VJWA 2JKRI 4YOFA 1STZA 4OOLA 3MQ0A 1LT0A 2H28A 3PHYA 4CLCE 2EA9A 4LLOB 3BWLA 2VV6A 1S1ZA 2MJ6A 4YNRA 1VHMA 4DJ2A 2J3WA 3B33A 1G6OA 1XJ2A 3IBRA 2J80A 2VX8A 3C30A 4Q0HA 2FH5A 1DP8A 2OAQ1 2W3GA 2WKQA 4M4XA 4HOIA 1S1YA 2Z6DA 2PYRA 3LIFA 5CX7A 4R38A 3LR5A 3E0YA 5AVEA 2K2NA 5HD3A 4HHDA 1T1CA 4UQIS 4I3AA 5KIZA 3BQ8A 4FOFA 5F68A 3DBAA 3KO6A 3EEHA 3FC7A 4R70A 4G3VA 3UB9A 2KOIA 4KUOA 2PDRA 4PKYG 4F3LA 3LR0A 5HSQA 4IUKA 1DP9A 1OTEA 3S7OA 4Y2FA 1TF1A 2IA2A 2VKSA 2VV8A 4CLCD 5K5BA 5I5LA 3P7NA 3E98A 3GDIA 4R3AA 3A0VA 1YSQA 4P6ZS 3D72A 1H8MA 4GS9A 4LRYC 4EERA 1TS8A 5HDSA 2QHKA 3R7WB 4ETZA 2DMWA 3NJAA 5L8MA 2W3DA 3KX0X 2W1TB 3ICYA 2VV7A 3OCNA 4H6JB 3UMDA 4IJGA 2JKRM 3OC2A 2VEAA 5J3WA 4HJ3A 4L9FA 2OWJA 3V67A 4NXGA 2Y79A 3KYQA 4BBVA 4WEKA 4CLCC 2O9AA 2WKRA 3IBJA 2HJEA 1IOUA 2PT7A 4BMWA 1D06A 2EWVA 4AFIA 4WLAA 4I5SA 1UWPX 1XJ3A 2P7JA 5TBMA 4R6LA 3LUQA 5A8BA 2ZOHA 1IFQA 2QJ5A 2ZOIA 3UB7A 3LFVA 4OOMA 1LL8A 4EEUA 2OOLA 4LRXC 5J7EA 5F5YA 3TRCA 1OJ5A 2R78A 3F1PA 4JGOA 4L9EA 3P01A 4HH2A 2V9AA 4MN5A 1OT9A 4KQDA 1TD5A 2W0NA 2K7SA 1YKDA 1UWNX 5F6AA 1N9LA 1TS6A 4QPRA 1BYWA 2PD7A 2B18A 2A2LA 1W63M 2JN7A 2L4RA 1MKMA 1W63Q 3ZYTA 2G7UA 5EFWA 2M1CA 4F3LB 4L0LA 3K3CA 1YSPA 4HP9A 2VA0A 3D3OA 1OPXA 4MCWA 4HJ4A 2YKHA 2JHEA 2JKTI 4BJPA 4EQ1A 2PHYA 3KYZA 1MC0A 3MFXA 4HH3A 3U2AA 4XT2B 1S4RA 5HZHA 4ARZA 4EUVA 1OT6A 3E4QA 1S67L 1NRJA 4HI4A 4GS9B 1T19A 5G4ZA 3VV4A 1MZUA 4K08A 2M7VA 2KX6A 3UMEA 4CLCB 5HL6A 3NOPC 3LI9A 2XRNA 2VGLS 2VGLM 2GJ3A 3F1OA 3VE4A 3H82A 2P08A 4DJ3A 3RFBA 3H7WA 1F5MA 3K3DA 3FPWA 2L0WA 2L1MA 4UEYA 2INWA 4IHQA 3SW1A 3PBTA 2KLIA 3G6OA 1F9IA 4EU0A 1D7EA 3EOIA 4I38A 3BY9A 3FG8A 3PBSA 3T4OA 3H9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WKP A;  4B9O A;  1DP6 A;  2ZBB A;  5G4Y A;  5J4E A;  3F1N A;  3HJK A;  4WN5 A;  1N9O A;  3F1P B;  2QKP A;  4RQ9 A;  1LSW A;  5IS1 A;  1X0O A;  4EW7 A;  2D01 A;  4L9G A;  3MXQ A;  3LIC A;  3MQQ A;  4GHI A;  1XJ6 A;  3CLO A;  4E04 A;  2PYP A;  3LIB A;  3NOU C;  1TS7 A;  5DKL A;  3RH8 B;  2YKF A;  2QJ7 A;  4EES A;  4HQA A;  2CMN A;  3E4P A;  4NXE A;  5HWT A;  1F98 A;  4MN6 A;  1P0Z A;  1S4S A;  3C8C A;  3UB8 A;  1S66 L;  3LI8 A;  3NHQ A;  2B02 A;  1ODV A;  2V0U A;  3H82 B;  5DKK A;  4GCZ A;  4KUK A;  3H7W B;  2BAS A;  3UE6 A;  3IS2 A;  4JGQ A;  1OTI A;  5HDD A;  1LSX A;  3MR0 A;  4I3I A;  3F1N B;  3MJQ A;  4WUJ A;  3RTY A;  4LRZ E;  2OWH A;  3PYP A;  2I9V A;  3OLO A;  2PR6 A;  1T18 A;  1T1B A;  5IU1 A;  3HJI A;  4BBU A;  4JGR A;  1XFQ A;  1N9N A;  1DRM A;  4GHI B;  3CAX A;  5HDC A;  3LIA A;  4NXF A;  4HIA A;  3T50 A;  2A24 A;  3GEC A;  4I39 A;  2V1A A;  3C2W A;  4HJ6 A;  3ULF A;  4WL9 A;  1Y28 A;  3ZQ5 A;  1VB6 A;  4EXO A;  5TBM B;  4NXB A;  3NOT C;  4LPZ A;  3EWK A;  3A0S A;  1OTA A;  1V9Y A;  4BBT A;  4WF0 A;  3E4O A;  1GSX A;  1WA9 A;  3IS2 B;  5F69 A;  1TS0 A;  2V0W A;  4XT2 A;  1OTB A;  1XFN A;  1KOU A;  2V1B A;  3UB6 A;  3CWF A;  1V9Z A;  1GSV A;  1JNU A;  3A0R A;  3LIE A;  3VE3 A;  2D02 A;  1NWZ A;  1G28 A;  2VLG A;  5HD5 A;  4EEP A;  5DJU A;  3BY8 A;  3F1O B;  1EW0 A;  3LID A;  3LYX A;  5HWW A;  2A24 B;  2QWS A;  1UGU A;  2PR5 A;  3MQO A;  4I3J A;  2PD8 A;  2KDK A;  1OTD A;  4YWZ A;  1P97 A;  1LSV A;  5AVF A;  1XJ4 A;  5HWV A;  2W27 A;  1OJG A;  4HY8 A;  4HP4 A;  1T1A A;  4EET B;  4GW9 A;  4H6J A;  3VOL A;  2Z6C A;  4JGP A;  5DJT A;  4HNB A;  4PKY A;  1GSW A;  2HV1 A;  1LT0 A;  2H28 A;  3PHY A;  2EA9 A;  4LLO B;  3BWL A;  2VV6 A;  1S1Z A;  4DJ2 A;  3B33 A;  1XJ2 A;  3IBR A;  2J80 A;  2WKQ A;  1DP8 A;  4M4X A;  4HOI A;  1S1Y A;  2Z6D A;  2PYR A;  3LIF A;  4R38 A;  5AVE A;  5HD3 A;  4HHD A;  1T1C A;  5KIZ A;  4I3A A;  5F68 A;  3EEH A;  3FC7 A;  4R70 A;  3UB9 A;  4KUO A;  2PDR A;  4PKY G;  4F3L A;  5HSQ A;  1DP9 A;  1OTE A;  2VV8 A;  5I5L A;  3P7N A;  3GDI A;  4R3A A;  3A0V A;  3D72 A;  4GS9 A;  4LRY C;  4EER A;  1TS8 A;  5HDS A;  2QHK A;  3NJA A;  3KX0 X;  3ICY A;  2VV7 A;  4H6J B;  3UMD A;  2VEA A;  5J3W A;  4HJ3 A;  4L9F A;  2OWJ A;  4NXG A;  4BBV A;  2WKR A;  1D06 A;  4WLA A;  4I5S A;  1UWP X;  1XJ3 A;  2P7J A;  5TBM A;  4R6L A;  3LUQ A;  5A8B A;  2ZOH A;  2QJ5 A;  2ZOI A;  3UB7 A;  4EEU A;  1LL8 A;  2OOL A;  4LRX C;  5J7E A;  5F5Y A;  1OJ5 A;  2R78 A;  3F1P A;  4JGO A;  4L9E A;  4HH2 A;  2V9A A;  4MN5 A;  1OT9 A;  4KQD A;  2W0N A;  2K7S A;  1UWN X;  5F6A A;  1N9L A;  1TS6 A;  1BYW A;  2PD7 A;  2JN7 A;  2L4R A;  5EFW A;  2M1C A;  4F3L B;  3K3C A;  4HP9 A;  4HJ4 A;  2YKH A;  2JHE A;  4EQ1 A;  2PHY A;  3MFX A;  4HH3 A;  4XT2 B;  1S4R A;  5HZH A;  1OT6 A;  3E4Q A;  1S67 L;  4HI4 A;  4GS9 B;  1T19 A;  5G4Z A;  1MZU A;  4K08 A;  2KX6 A;  3UME A;  3NOP C;  3LI9 A;  2GJ3 A;  3F1O A;  3VE4 A;  3H82 A;  4DJ3 A;  3H7W A;  3K3D A;  2L0W A;  2L1M A;  3SW1 A;  2INW A;  3G6O A;  1F9I A;  1D7E A;  4I38 A;  3BY9 A;  3FG8 A;  3H9W A; 
#chains in the Genus database with same CATH topology
 5CTN A;  3IF6 A;  1ALQ A;  1DP6 A;  5G4Y A;  3HJK A;  3CUE A;  2WGV A;  3F1P B;  2QKP A;  1KE0 A;  2H0T A;  3BRM A;  3BLS A;  4EWF A;  3C38 A;  3ZNY A;  1LSW A;  1K55 C;  5IS1 A;  1AXB A;  4GZB A;  1X0O A;  4EW7 A;  4FUW A;  3ZG5 A;  4FTX A;  3MXQ A;  3IQA A;  5KMW A;  2JKT M;  3LIC A;  1SHV A;  4E04 A;  2O99 A;  3OPH A;  5DKL A;  2QJ7 A;  4EES A;  2XFT A;  1FSY A;  3Q7Z A;  4HQA A;  4DN0 A;  4ARZ B;  4NXE A;  5HWT A;  1QME A;  4S2L A;  3T4T A;  1RGZ A;  2Y4A A;  5FAQ A;  2X01 A;  4ME4 A;  2QPN A;  3ZVW A;  5TGF A;  2XD5 A;  5DTK A;  2HZ5 A;  1I2W A;  3H82 B;  1K54 A;  3H7W B;  3VOY A;  5GLB A;  4OH0 A;  4OPY A;  1XKZ A;  3S7N A;  4OPR A;  2XSS A;  2I9V A;  3OLO A;  5FI7 A;  2ZMF A;  2Y2J A;  4P0M A;  3UB5 P;  3JYI A;  3PBR A;  4OQ0 A;  3HJI A;  2ZMV A;  4LFU A;  2HP5 A;  4BD1 A;  4JGR A;  1YMX A;  5DFX A;  4LV3 A;  4ZJ1 A;  4X68 A;  1H0M A;  4FH4 A;  1DRM A;  4KQO A;  1YLY A;  2QYB A;  3CAX A;  5HDC A;  3LIA A;  2NUP C;  4NXF A;  5HW3 A;  3EEA A;  2A24 A;  4MBF A;  3GEC A;  5L10 A;  2V1A A;  2P04 A;  2V20 A;  2W1R A;  2W3E A;  3ZQ5 A;  4U3T A;  2A3U A;  3HLF A;  2JC7 A;  3HLG A;  4OQG A;  2VZW A;  4UQI M;  1ZG4 A;  4BBT A;  5U47 A;  1DY6 A;  2K31 A;  3IF6 C;  1GSX A;  1IEM A;  1ES4 A;  3ZHH A;  4JF6 A;  1K6S A;  1LI0 A;  3CUE C;  4BL3 A;  1CI9 A;  3PAG A;  1RP5 A;  1TS0 A;  4G3K A;  1MWT A;  1A0K A;  3SOI A;  2JBF A;  4PM7 A;  1PNE A;  5CHJ A;  1ES5 A;  4FH2 A;  5FQI A;  1S0W A;  3UB6 A;  3CWF A;  3VOZ A;  1PWG A;  2GX5 A;  3D9Y A;  4H8R A;  3CPT A;  1JNU A;  3VSK A;  2D02 A;  3BW6 A;  1S6R A;  4O8G A;  4GDB A;  5HPF A;  1PIO A;  2VLG A;  1ZTU A;  4KZ5 A;  3VFF A;  3PBQ A;  3Q1F A;  1L3L A;  5EVI D;  1EW0 A;  5E43 A;  4KQQ A;  3HUM A;  4ETX A;  4GOG A;  3MS6 A;  4ZJ3 A;  2A24 B;  2JKG A;  3BEC A;  1UGU A;  5EM1 A;  2J3T C;  3MQO A;  2Y91 A;  4I3J A;  4X1M A;  3MBZ A;  1U60 A;  4YWZ A;  1NLY A;  3HBR A;  2PRF A;  1K54 C;  4S2O A;  2BG1 A;  3MFD A;  4GJ4 A;  5HWV A;  1K6R A;  1FCO A;  2W27 A;  3IT9 A;  3EGX C;  2DCF A;  1KGF A;  1VEU B;  4HY8 A;  3T1S A;  4KZ7 A;  3IXG A;  4GW9 A;  4WMC A;  4O7D A;  2ZC6 B;  3W4Q A;  2EX2 A;  3BFC A;  4H6J A;  3SS4 A;  1PI4 A;  4Y7P A;  5CRF A;  4JGP A;  1Y4O A;  1YQS A;  2Y8H A;  4D60 A;  5AQB A;  1Q2Q A;  2JKR I;  3UPP A;  4YOF A;  3IWI A;  1DJA A;  1CEG A;  2X71 A;  3LY4 A;  3UPO A;  4YNR A;  5HAR A;  1VHM A;  3UO9 A;  4DJ2 A;  1ONH A;  3CPT B;  1GA9 A;  5KSC A;  4RA7 A;  1O7E A;  5M1A A;  4Q0H A;  1ERM A;  3E2K A;  2WKQ A;  4HBT A;  4HOI A;  2Z6D A;  5CX7 A;  4S2P A;  1XPB A;  4FOF A;  3KO6 A;  4Y15 A;  3MZD A;  1DJB A;  4X56 A;  1JWP A;  4Y2F A;  3V5M A;  3LCE A;  2VKS A;  5K5B A;  5CEC A;  3MXS A;  3P7N A;  3E98 A;  3T1Q B;  3A0V A;  1TS8 A;  4OVD A;  2H0Y A;  3KX0 X;  5CGW A;  4B4Z A;  2JKF A;  4H6J B;  2ZQ9 A;  4ID4 A;  4N9K A;  5F1F A;  5GL9 A;  3OPP A;  3DWK A;  4L9F A;  3T12 B;  2Y79 A;  4BBV A;  1LI9 A;  4S2N A;  1XGJ A;  2B95 A;  1PWC A;  1IOU A;  1NRF A;  3BEB A;  2PT7 A;  3HL9 A;  4WLA A;  3GR2 A;  1W5D A;  5TBM A;  4ZTK A;  2ZOH A;  1G68 A;  2IWD A;  3LFV A;  4EEU A;  5F5Y A;  1OJ5 A;  1FCN A;  4HH2 A;  3AGD A;  5D3O A;  1YKD A;  5F6A A;  2ZM0 A;  4QPR A;  1TS6 A;  2B18 A;  5CHM A;  5F83 A;  1TEM A;  2JN7 A;  3ZYT A;  5EFW A;  5A93 A;  3NY4 A;  4L0L A;  3K3C A;  1YSP A;  3CHW P;  2XH9 A;  3C7V A;  4MCW A;  1FR1 A;  2YKH A;  3Q81 A;  1MC0 A;  3U2A A;  4XT2 B;  3ZNT A;  3G35 A;  1OT6 A;  1NRJ A;  2ZM2 A;  1ZC2 A;  2XEP A;  1KE4 A;  1T19 A;  5EPH A;  2E8J A;  3UME A;  1HTZ A;  3DW0 A;  3NOP C;  2VGL S;  5BOH A;  1BLP A;  4N92 A;  3QP2 A;  1NZO A;  3G4P A;  1CK3 A;  5FQQ A;  1QMF A;  1D7E A;  4JXW A;  2Z2M B;  3PBS A;  3H9W A;  2ZL1 B;  3QP5 A;  4Y3I A;  4B9O A;  3BM6 A;  1K25 A;  4DF6 A;  1YLT A;  3EQV A;  2J9P A;  5J4E A;  5IHV A;  5EOE A;  4DE3 A;  4EBL A;  1H8Y A;  2M7U A;  2XR0 A;  3MF0 A;  4LCL A;  4Z1W A;  1PWD A;  1YLW A;  3MQQ A;  2Y2G A;  4GHI A;  3ZVT A;  4DDY A;  3LIB A;  3OBF A;  2EX8 A;  4E3M A;  4OPZ A;  2ZLY A;  1YM1 A;  1FSW A;  2CMN A;  1YPR A;  5DVA A;  3HLC A;  3KSG A;  3QHY A;  4JXV A;  4E6W A;  3UB8 A;  1S66 L;  4ZAM A;  2B02 A;  4S2N C;  1ODV A;  4QJG A;  5HFO A;  2V0U A;  3IH8 A;  3B42 A;  4B88 A;  2WAD A;  5DKK A;  4Y0T A;  1K0K A;  2HDS A;  4GCZ A;  5HPI A;  2Y2M A;  1YMS A;  3IS2 A;  3UDX A;  5DTS A;  3UN7 A;  4HEF A;  4Y5F A;  5L07 A;  5EVI A;  5L2F A;  5FSR A;  4GB7 A;  4PHT A;  1O07 A;  3FPV A;  4OPQ A;  2NUT C;  3MR0 A;  2W3H A;  3HLD A;  3IHB A;  3ZCZ A;  3T4K A;  1ES3 A;  2WAE A;  3NI9 A;  1ZKJ A;  4LRZ E;  3PYP A;  1KE3 A;  5CGS A;  2PR6 A;  1DJC A;  3B3X A;  4R3J A;  1K56 D;  3P98 A;  5EVL A;  2H10 A;  3BFF A;  4JKT A;  3DTM A;  1BUL A;  1XFQ A;  4GHI B;  4BQM A;  4FSF A;  1L0D A;  3T4J A;  1ESI A;  3MSH A;  4I39 A;  1K4E A;  3ULF A;  4WL9 A;  1Y28 A;  1VB6 A;  4EXO A;  5LBR A;  3IWO A;  1CJF A;  4E3O A;  3A3D A;  5GLC A;  5DF9 A;  3EWK A;  3IWQ A;  4R0Q A;  4IUH A;  1V9Y A;  4P87 A;  3LY3 A;  4PM9 A;  5E2E A;  2EFU A;  3E4O A;  3VFH A;  2JCH A;  2UV0 E;  1WA9 A;  1GHM A;  3IS2 B;  4KZ9 A;  3TJZ C;  1KVL A;  2AVX A;  3S4X A;  1IYP A;  1OTB A;  3FKW A;  2VGJ A;  4MBH A;  4EV4 A;  1PFL A;  4MMN A;  4UA6 A;  1GSV A;  3LIE A;  2Y2L A;  1BLH A;  2BTF P;  3WS1 A;  1G28 A;  3T4Q A;  1YLJ A;  2XLN A;  4OLD A;  4EEP A;  5DJU A;  2LB9 A;  2V8C A;  5A91 A;  3BY8 A;  3F1O B;  1ZHH B;  3LYX A;  3HRE A;  1NLZ A;  2Y2I A;  2UWX A;  2PR5 A;  4BL2 A;  3M2J A;  1OTD A;  2KDK A;  2BLS A;  5M19 A;  2O0Y A;  3V3S A;  5AVF A;  3IF6 B;  1Q2P A;  2XK1 A;  5A92 A;  2V2F F;  2XA7 M;  1MKI A;  4WEJ A;  3SZT A;  5M18 A;  3RXX A;  5EVI C;  3EGD C;  1T1A A;  4EET B;  2P9V A;  1GHP A;  1YLP A;  2OSU A;  3ZGA B;  5EE8 A;  1NXY A;  3OOV A;  3MKE A;  3IX4 A;  3VOL A;  4DRT A;  1LL5 A;  2Z6C A;  3GTC A;  5EUA A;  3BLM A;  4PKY A;  1EI5 A;  1GSW A;  2HV1 A;  1F2K A;  3GSG A;  3TG9 A;  3QNB A;  2H28 A;  3PHY A;  4CLC E;  4LLO B;  3BWL A;  3ITA A;  2VV6 A;  2HP9 A;  4GN2 A;  1M40 A;  2J3W A;  3CG5 A;  4HES A;  3B33 A;  1ZG6 A;  4BLM A;  3LO7 A;  1FIL A;  1DP8 A;  2EXB A;  3UDF A;  4M4X A;  4FCF A;  3W4P A;  1GHI A;  5HD3 A;  5F68 A;  3JPU A;  2V1Z A;  4QU3 A;  4R70 A;  3C4O A;  2KOI A;  3BFE A;  4KUO A;  2PDR A;  3L9K A;  4PKY G;  2EFX A;  3LR0 A;  5EEC A;  5HSQ A;  4KZ8 A;  5F1G A;  1DP9 A;  3S7O A;  1CQA A;  1ESU A;  4S2I A;  4CLC D;  3BFG A;  4R3A A;  1OME A;  3WRZ A;  3VSL A;  1H8M A;  3VP1 A;  2XFS A;  1ONG A;  5FQK A;  2WAF A;  2Q0O A;  3NJA A;  2P9V B;  3ICY A;  2R9W A;  3UMD A;  3SH9 A;  2ZC3 B;  3N8L A;  2VEA A;  4HJ3 A;  2VGK A;  2OWJ A;  4XXR A;  4LV1 A;  4P6B A;  5JYO A;  4WM9 A;  4WEK A;  1FOF A;  3IBJ A;  3CZD A;  5E2G A;  3IX3 A;  2HJE A;  4XUX A;  2OLV A;  2ZQ7 A;  2EWV A;  2HPB A;  3BYD A;  4AFI A;  1UWP X;  1XJ3 A;  2Y55 A;  3HUO A;  4R6L A;  4WBG A;  3TOI A;  1IFQ A;  2QJ5 A;  4E3J A;  3N8S A;  1LL8 A;  4LRX C;  5J7E A;  3TRC A;  3GRJ A;  4L9E A;  4MN5 A;  5FDS A;  1N4O A;  1MPL A;  1Z09 A;  1UWN X;  1N9L A;  3WS5 A;  3DTI A;  3W8K A;  2L4R A;  1MKM A;  1NYY A;  2G7U A;  2WKI A;  1HD8 A;  2ZC5 B;  4MEZ A;  4Y17 A;  4UA7 A;  4HP9 A;  1BZA A;  1OPX A;  5FEG A;  2JKT I;  4EQ1 A;  3KYZ A;  4BEN A;  1S4R A;  4WZ4 A;  5HZH A;  5EOO A;  1FIK A;  5G4Z A;  3VV4 A;  4DXB A;  5HL6 A;  2XRN A;  3VE4 A;  3VP3 A;  3DWZ A;  2JE5 A;  2P08 A;  4DJ3 A;  4MBK A;  2XF3 A;  4UA9 A;  3RJU A;  4IHQ A;  3SW1 A;  1I2S A;  2ZD8 A;  3G6O A;  4QY5 A;  1F9I A;  4EU0 A;  2H5S A;  3C5A A;  2DRW A;  4XUZ A;  3NDE A;  2Y2O A;  5FQ9 A;  2FFF B;  3CMZ A;  3N6I A;  2WKP A;  5G18 A;  3R4K A;  4GD8 A;  3ISG A;  1C3B A;  5AQ9 A;  4KZ3 A;  1MWR A;  3F1N A;  4OLG A;  4K0X A;  3O5Y A;  2J9O A;  1PRQ A;  4ZBE A;  4X55 A;  3T1R A;  2FZ0 A;  4S2J A;  3TW8 A;  2PU2 A;  4C3Q A;  4RVA A;  5MC7 A;  5HAQ A;  3CLO A;  1KDS A;  2PYP A;  3NOU C;  4R3B A;  3RH8 B;  4ZDX A;  2YKF A;  1K4F A;  1G5U A;  2ACG A;  5E2F A;  3E4P A;  1BSG A;  3W2Z A;  1F98 A;  2WZZ A;  1P0Z A;  1IYO A;  3DAV A;  3FZC A;  3SS3 A;  1XA1 A;  3LI8 A;  5FQM A;  1HZO A;  1CEF A;  2XDM A;  2LB5 A;  3ZDJ A;  4OKP A;  4CPK A;  4KZA A;  4UAA A;  3PBO A;  2ZC4 B;  4EBN A;  4KUK A;  1PW8 A;  3K2N A;  2BAS A;  3ZG7 B;  4DE0 A;  3CJM A;  4NEE D;  1OTI A;  2HDU A;  4OON A;  1LSX A;  2Y59 A;  4U0X A;  2Y2N A;  5CER A;  4I3I A;  4JXS A;  5IT5 A;  3FKV A;  3F1N B;  5FI2 A;  3MJQ A;  4WUJ A;  4E3L A;  4Q0J A;  3N8R A;  3WWX A;  5FI6 A;  1T18 A;  2Q9M A;  3ZG8 B;  2HF6 A;  2ZQ8 A;  5IU1 A;  2XRO A;  4X25 A;  4MDZ A;  4BBU A;  4Y0O A;  4S2M A;  3AGE A;  3CIT A;  1N9N A;  3GMW A;  2Q9N A;  1E3U D;  3OPL A;  5GLD A;  4ESP A;  4NK3 A;  4JF5 A;  1IYQ A;  2QZ6 A;  4YFM A;  2V8F A;  4MLL A;  4OOY A;  1CI8 A;  4HJ6 A;  3OZH A;  3QNC A;  1W7F A;  2OAP 1;  1K57 A;  2ZM8 A;  5TBM B;  1KVM A;  3NOT C;  4LPZ A;  5C5K A;  5AJG A;  3FWL A;  3JVV A;  1SZV A;  1SCW A;  5F82 A;  4CQH A;  2EWW A;  1BT5 A;  2PBD P;  5CHU A;  2RCX A;  4MN7 A;  3V39 A;  2GDN A;  3QP4 A;  4F94 A;  1E4D A;  2HP6 A;  2V0W A;  5EVE A;  2A49 A;  4JPM A;  1MWS A;  3O86 A;  4BWI A;  3IF5 A;  3BQA A;  4GD6 A;  3OCL A;  2V1B A;  1KOU A;  3NBL A;  1I5Q A;  2ZQC A;  1V9Z A;  4CLC A;  2G2W A;  3VE3 A;  1SDN A;  1PZP A;  1P9W A;  4WEL A;  1FCM A;  5HD5 A;  1MBL A;  3MMH A;  3LID A;  3A3J A;  4DE2 A;  4JF4 A;  4JLF A;  3G2Y A;  3O88 A;  4S2K A;  2QWS A;  4IBR A;  3UPN A;  3FV7 A;  4PM5 A;  3DTE A;  3DTK A;  1P97 A;  3Q7V A;  4PM8 A;  4WMC D;  4U0T A;  3HLW A;  1J9M A;  3FYZ A;  1OJG A;  3SS5 A;  4DE1 A;  2WYX A;  2EX6 A;  3BJN A;  1KDW A;  1EWZ A;  2W1T A;  5TR7 A;  3EQU A;  5GLA A;  3ZG9 B;  2RL3 A;  3JVU A;  3O3V A;  3IH9 A;  3U4L P;  3HLE A;  2VJW A;  4X6T A;  3MZF A;  1STZ A;  4OOL A;  3IX8 A;  1LT0 A;  1E25 A;  1S1Z A;  2MJ6 A;  3NC8 A;  5CED A;  1MWU A;  4K91 A;  3LGO A;  3IHA A;  2J80 A;  1WE4 A;  4RX3 A;  2C5W B;  3NIA A;  2OAQ 1;  3ZFZ A;  2PYR A;  1MXO A;  3LIF A;  4R38 A;  5JYP A;  3E0Y A;  4HHD A;  5KIZ A;  3BQ8 A;  2IWB A;  3DBA A;  3EEH A;  3FC7 A;  1K57 C;  4G3V A;  3UB9 A;  4EUZ A;  3V3R A;  3VP0 A;  4F3L A;  4IUK A;  1ACF A;  5EVI B;  1TF1 A;  3GVB A;  3Q7V B;  5I5L A;  3GDI A;  3V50 A;  4P6Z S;  1NZU A;  3D72 A;  4GS9 A;  4EER A;  1H8Z A;  4IVI A;  1FQG A;  3MZE A;  2OLU A;  5GHZ A;  2DMW A;  3C7U A;  1VM1 A;  5L8M A;  2W3D A;  2W1T B;  3LEZ A;  4WZ5 A;  4IJG A;  2JKR M;  3WRT A;  1M6K A;  1Z6F A;  4NXG A;  1Y54 A;  1WYC A;  4R4R A;  4YIN A;  3KYQ A;  4CLC C;  4KEN B;  1TDG A;  3UE1 A;  4BMW A;  1D06 A;  1YLZ A;  1BLS A;  4JXG A;  4QHC A;  3A3I A;  5A8B A;  2ZOI A;  3NCK A;  5FA7 A;  1WYB A;  3UB7 A;  1H5X A;  2R78 A;  2EX9 A;  4LCM A;  1VQQ A;  2V9A A;  5EV0 A;  1TD5 A;  2W0N A;  4WYY A;  3WS2 A;  1BYW A;  2A2L A;  3OPR A;  4LV0 A;  4EQI A;  1W63 Q;  3SH8 A;  1TVF A;  5L09 A;  2M1C A;  2PAV P;  4F3L B;  1LLB A;  4GNU A;  2VA0 A;  3D3O A;  4P85 A;  3LEQ A;  4HJ4 A;  3VP2 A;  2JHE A;  4BJP A;  2PHY A;  3MFX A;  4B4X A;  4HH3 A;  2PU4 A;  4NET A;  4EUV A;  3E4Q A;  4HI4 A;  2WKH A;  1KGE A;  4GS9 B;  2HDR A;  4JBF A;  4N9L A;  1MZU A;  2M7V A;  2WGW A;  2Y2P A;  1KGG A;  3WS0 A;  3LI9 A;  3M6H A;  3G31 A;  2VGL M;  5DTT A;  2GJ3 A;  1XX2 A;  5HAP A;  3QP1 A;  3RFB A;  3G34 A;  3K3D A;  2ZC7 A;  2L1M A;  3Q07 A;  4LGW A;  2X02 A;  1XXM A;  1JTD A;  2KLI A;  1E3U A;  4I38 A;  3FG8 A;  3RXW A;  4IVK A;  1VET A;  1PZO A;  2ZBB A;  2WK0 A;  4WN5 A;  4N1H A;  1N9O A;  3UY6 A;  4B93 A;  1VEU A;  1ERO A;  4X1L A;  2Y2K A;  4HBU A;  4RQ9 A;  3MKF A;  4PPR A;  1CF0 A;  2DNS A;  2D01 A;  3KSI A;  4L9G A;  1IEL A;  4QB8 A;  5FL3 A;  3B47 A;  1XJ6 A;  3VP4 A;  4Q8I A;  4OQH A;  1TS7 A;  1BUE A;  1D1J A;  4RX2 A;  2HJ9 C;  2J7V A;  3LR4 A;  1MY8 A;  4DKI A;  3UE3 A;  1JWV A;  3KSH A;  4WZ5 C;  4OP8 A;  2QMI A;  4DXC A;  3AGF A;  2Y2Q A;  3PBN A;  4QY6 A;  4MN6 A;  1RGY A;  1SKO A;  2J8Y A;  4KG5 A;  2WGW B;  1S4S A;  3C8C A;  5J8X A;  2GNX A;  4KG6 A;  3TSG A;  3HLB A;  3NHQ A;  3T4L A;  1NYM A;  4O0P A;  2HDQ A;  3TE8 A;  1BLC A;  3KSF A;  1L0E A;  4KZ6 A;  3E2L A;  2WUQ A;  3UE6 A;  4DMZ A;  4O01 A;  5GHY A;  4JGQ A;  5HDD A;  4Q0I A;  2WZX A;  1HLU P;  1XA7 A;  1VET B;  3IXH A;  3UNW A;  1JWZ A;  3O87 A;  3RTY A;  5DF7 A;  2OWH A;  1H3Q A;  2GZA A;  4EBP A;  2ZQD A;  3A3E A;  5CGX A;  1T1B A;  3N4I A;  4PAU A;  1XP4 A;  3L7H A;  1J3W A;  4N1X A;  1P9R A;  1SKF A;  5GHX A;  1PYY A;  1K56 A;  3PTE A;  3NUL A;  4HIA A;  3T50 A;  3T1X A;  5AQ7 A;  3KYE A;  5E2H A;  3M6B A;  3PXP A;  3C2W A;  2W3F A;  4QWO A;  4ZJ2 A;  1TDL A;  1SKO B;  3HVF A;  4NXB A;  3T4S A;  4G3W A;  3G30 A;  4Y13 A;  1W8Q A;  2B5R A;  3A0S A;  4ZRR A;  5DFY A;  3G2Z A;  3W4O A;  1OTA A;  5KZH A;  3GQZ A;  3LR3 A;  2HGV A;  4WF0 A;  1GA0 A;  3D4F A;  1ERQ A;  3NEC A;  4NG2 A;  4R4S A;  3S7P A;  5F69 A;  4RYE A;  4KG2 A;  2O9C A;  3ITB A;  5FAS A;  1YT4 A;  2PBY A;  5HX9 A;  5FDH A;  4XT2 A;  2FFY A;  2IWC A;  5TJJ A;  4E3K A;  4GDN A;  4P6Z M;  3IXB A;  3QP8 A;  1XFN A;  2J3T D;  3I7J A;  2O9B A;  4LEN A;  4OP5 A;  4UHU A;  3A0R A;  4CJN A;  1NWZ A;  3QP6 A;  3BFD A;  5AQA A;  3ZG0 A;  3PR6 A;  1IKI A;  2XD1 A;  2XGN A;  1IKG A;  5FEF A;  4R23 A;  2E8I A;  5HWW A;  1HVB A;  4NKP A;  3S7Q A;  4R1G A;  2ZL1 A;  4X69 A;  2PD8 A;  1JTG A;  2XQZ A;  3S22 A;  4II7 A;  3HCY A;  1LSV A;  1PI5 A;  4K0W A;  4DDS A;  3WS4 A;  1XJ4 A;  4IBX A;  5FAT A;  4MNR A;  2XA7 S;  3CI6 A;  3MXR A;  4A5R A;  3R7W A;  3PAE A;  5CTM A;  4HP4 A;  5KSH A;  3Q82 A;  2VK3 A;  4GLQ A;  5CEB A;  1YAX A;  4PMA A;  4C75 A;  5DJT A;  4HNB A;  3GV9 A;  2CC1 A;  1GCE A;  4FD8 A;  4Y0U A;  4Z9Q A;  4PM6 A;  2OV5 A;  3MQ0 A;  5HL1 A;  2EA9 A;  3UDI A;  1K38 A;  1XGI A;  2I72 A;  1G6O A;  1XJ2 A;  3IBR A;  5TFQ A;  5I94 A;  1L0F A;  2VX8 A;  3C30 A;  2Z2L B;  2FH5 A;  2W3G A;  1S1Y A;  1L2S A;  3LR5 A;  5AVE A;  4KZ4 A;  2K2N A;  5DF8 A;  1T1C A;  1SDE A;  4I3A A;  4UQI S;  3A3F A;  2ZQA A;  1K55 A;  1OTE A;  3M2K A;  2IA2 A;  2VV8 A;  4IED A;  3VMA A;  1YSQ A;  4LRY C;  5HDS A;  2QHK A;  3S1Y A;  3R7W B;  4ETZ A;  1N9B A;  3IXD A;  5A90 A;  2VV7 A;  3OCN A;  3OC2 A;  3SH7 A;  1AWI A;  5J3W A;  1PW1 A;  3V67 A;  4OQI A;  5EM0 A;  4QD4 A;  2O9A A;  2WKR A;  2Y2H A;  1NJ4 A;  1W8Y A;  4M3K A;  4I5S A;  3P09 A;  1RCJ A;  2P7J A;  4KQR A;  3LUQ A;  2WGI A;  4OOM A;  1JVJ A;  2OOL A;  1L0G A;  2G2U A;  5FAP A;  3F1P A;  4JGO A;  3P01 A;  2P74 A;  1OT9 A;  4KQD A;  4E6X A;  1IYS A;  3C4P A;  2K7S A;  1BTL A;  5HAI A;  2PD7 A;  1W79 A;  2C6W B;  4LV2 A;  3UE0 A;  1W63 M;  3HUN A;  4D2O A;  2R9X A;  3NDG A;  1NY0 A;  4E3I A;  4C6Y A;  1G6A A;  2WKE A;  4ARZ A;  4KZB A;  1ES2 A;  1S67 L;  3G32 A;  4K08 A;  4X53 A;  2KX6 A;  5FQJ A;  4CLC B;  4E3N A;  5FAO A;  3F1O A;  3H82 A;  1LHY A;  5CXW A;  3H7W A;  1F5M A;  1FR6 A;  3FPW A;  4BD0 A;  2L0W A;  4UEY A;  2INW A;  2ZJ9 A;  2ZMA A;  2EXA A;  3PBT A;  4GKU A;  3EOI A;  3N7W A;  1LL9 A;  3BY9 A;  3T4O A; 
#chains in the Genus database with same CATH homology
 2WKP A;  4Y3I A;  4B9O A;  3R4K A;  1DP6 A;  3EQV A;  2ZBB A;  5G4Y A;  5J4E A;  3F1N A;  3HJK A;  3CUE A;  4WN5 A;  1N9O A;  3F1P B;  2QKP A;  4B93 A;  3O5Y A;  2M7U A;  3C38 A;  4RQ9 A;  3MF0 A;  1LSW A;  5IS1 A;  1X0O A;  4Z1W A;  4EW7 A;  2FZ0 A;  2D01 A;  3KSI A;  4L9G A;  3MXQ A;  3TW8 A;  2JKT M;  5FL3 A;  3B47 A;  3LIC A;  3MQQ A;  5MC7 A;  4GHI A;  1XJ6 A;  3CLO A;  4E04 A;  2PYP A;  3LIB A;  2O99 A;  3NOU C;  1TS7 A;  3OBF A;  5DKL A;  2HJ9 C;  3RH8 B;  2YKF A;  2QJ7 A;  3LR4 A;  4EES A;  3UE3 A;  3KSH A;  4HQA A;  4DN0 A;  4ARZ B;  2CMN A;  3E4P A;  3PBN A;  4NXE A;  5HWT A;  3W2Z A;  1F98 A;  3KSG A;  4MN6 A;  1P0Z A;  1S4S A;  3T4T A;  3C8C A;  3UB8 A;  1S66 L;  2GNX A;  3LI8 A;  3NHQ A;  2B02 A;  4ME4 A;  3T4L A;  1ODV A;  4O0P A;  2LB5 A;  2V0U A;  3TE8 A;  3B42 A;  3H82 B;  5DKK A;  3KSF A;  3PBO A;  4GCZ A;  5HPI A;  4KUK A;  3H7W B;  3K2N A;  2BAS A;  3UE6 A;  3IS2 A;  4NEE D;  4DMZ A;  4O01 A;  4Y5F A;  4JGQ A;  1OTI A;  5HDD A;  4Q0I A;  1LSX A;  4PHT A;  3FPV A;  2NUT C;  3MR0 A;  4I3I A;  2W3H A;  3T4K A;  3S7N A;  5IT5 A;  3F1N B;  3MJQ A;  4WUJ A;  3RTY A;  4LRZ E;  2OWH A;  4Q0J A;  3PYP A;  1H3Q A;  2XSS A;  2GZA A;  2I9V A;  3OLO A;  2PR6 A;  2ZMF A;  1T18 A;  1T1B A;  2HF6 A;  3PBR A;  5IU1 A;  3HJI A;  2ZMV A;  4PAU A;  2XRO A;  4MDZ A;  4BBU A;  1P9R A;  4JGR A;  5DFX A;  1XFQ A;  3CIT A;  1N9N A;  1DRM A;  4KQO A;  4GHI B;  2QYB A;  3CAX A;  5HDC A;  3LIA A;  2NUP C;  4NXF A;  4HIA A;  3EEA A;  4FSF A;  3T50 A;  2A24 A;  3T4J A;  3GEC A;  4I39 A;  3PXP A;  2V1A A;  3C2W A;  2P04 A;  4HJ6 A;  2W3F A;  3ULF A;  2W1R A;  4WL9 A;  1Y28 A;  2OAP 1;  2W3E A;  3ZQ5 A;  1VB6 A;  4EXO A;  5TBM B;  4NXB A;  3NOT C;  5LBR A;  3T4S A;  4LPZ A;  5C5K A;  4G3W A;  5DF9 A;  3EWK A;  2VZW A;  5AJG A;  3A0S A;  4ZRR A;  5DFY A;  1OTA A;  4IUH A;  1V9Y A;  4UQI M;  4BBT A;  3LR3 A;  2HGV A;  3JVV A;  4WF0 A;  3E4O A;  2K31 A;  1GSX A;  4CQH A;  2EWW A;  1WA9 A;  4MN7 A;  3IS2 B;  3S7P A;  5F69 A;  3CUE C;  3TJZ C;  2O9C A;  1TS0 A;  4G3K A;  2V0W A;  4XT2 A;  1OTB A;  5TJJ A;  4BWI A;  3BQA A;  4P6Z M;  3OCL A;  1XFN A;  1KOU A;  2J3T D;  2V1B A;  3UB6 A;  4MMN A;  3CWF A;  2O9B A;  1V9Z A;  2GX5 A;  1GSV A;  1JNU A;  3A0R A;  3LIE A;  4CLC A;  3VE3 A;  1NWZ A;  2D02 A;  3BW6 A;  4O8G A;  1G28 A;  3T4Q A;  1P9W A;  4WEL A;  5HPF A;  2VLG A;  5HD5 A;  1ZTU A;  3PR6 A;  4EEP A;  5DJU A;  2LB9 A;  3PBQ A;  3BY8 A;  3F1O B;  1EW0 A;  3MMH A;  3LID A;  4ETX A;  1ZHH B;  3LYX A;  1NLZ A;  5HWW A;  2A24 B;  4NKP A;  2QWS A;  3S7Q A;  1UGU A;  2PR5 A;  2J3T C;  3MQO A;  4I3J A;  2PD8 A;  2KDK A;  1OTD A;  4YWZ A;  1NLY A;  4II7 A;  1P97 A;  1LSV A;  2O0Y A;  3HCY A;  5AVF A;  1XJ4 A;  4GJ4 A;  5HWV A;  2XA7 S;  3CI6 A;  2XA7 M;  2W27 A;  4WEJ A;  1OJG A;  3EGX C;  3R7W A;  4HY8 A;  3EGD C;  4HP4 A;  1T1A A;  5KSH A;  3BJN A;  4EET B;  2W1T A;  4GLQ A;  4GW9 A;  3EQU A;  4H6J A;  3OOV A;  1YAX A;  3VOL A;  3JVU A;  2Z6C A;  4JGP A;  5DJT A;  4HNB A;  2Y8H A;  4PKY A;  1GSW A;  2HV1 A;  2VJW A;  2JKR I;  4YOF A;  1STZ A;  4OOL A;  3MQ0 A;  1LT0 A;  2H28 A;  3PHY A;  4CLC E;  2EA9 A;  4LLO B;  3BWL A;  2VV6 A;  1S1Z A;  2MJ6 A;  4YNR A;  1VHM A;  4DJ2 A;  2J3W A;  3B33 A;  1G6O A;  1XJ2 A;  3IBR A;  2J80 A;  2VX8 A;  3C30 A;  4Q0H A;  2FH5 A;  1DP8 A;  2OAQ 1;  2W3G A;  2WKQ A;  4M4X A;  4HOI A;  1S1Y A;  2Z6D A;  2PYR A;  3LIF A;  5CX7 A;  4R38 A;  3LR5 A;  3E0Y A;  5AVE A;  2K2N A;  5HD3 A;  4HHD A;  1T1C A;  4UQI S;  4I3A A;  5KIZ A;  3BQ8 A;  4FOF A;  5F68 A;  3DBA A;  3KO6 A;  3EEH A;  3FC7 A;  4R70 A;  4G3V A;  3UB9 A;  2KOI A;  4KUO A;  2PDR A;  4PKY G;  4F3L A;  3LR0 A;  5HSQ A;  4IUK A;  1DP9 A;  1OTE A;  3S7O A;  4Y2F A;  1TF1 A;  2IA2 A;  2VKS A;  2VV8 A;  4CLC D;  5K5B A;  5I5L A;  3P7N A;  3E98 A;  3GDI A;  4R3A A;  3A0V A;  1YSQ A;  4P6Z S;  3D72 A;  1H8M A;  4GS9 A;  4LRY C;  4EER A;  1TS8 A;  5HDS A;  2QHK A;  3R7W B;  4ETZ A;  2DMW A;  3NJA A;  5L8M A;  2W3D A;  3KX0 X;  2W1T B;  3ICY A;  2VV7 A;  3OCN A;  4H6J B;  3UMD A;  4IJG A;  2JKR M;  3OC2 A;  2VEA A;  5J3W A;  4HJ3 A;  4L9F A;  2OWJ A;  3V67 A;  4NXG A;  2Y79 A;  3KYQ A;  4BBV A;  4WEK A;  4CLC C;  2O9A A;  2WKR A;  3IBJ A;  2HJE A;  1IOU A;  2PT7 A;  4BMW A;  1D06 A;  2EWV A;  4AFI A;  4WLA A;  4I5S A;  1UWP X;  1XJ3 A;  2P7J A;  5TBM A;  4R6L A;  3LUQ A;  5A8B A;  2ZOH A;  1IFQ A;  2QJ5 A;  2ZOI A;  3UB7 A;  3LFV A;  4OOM A;  1LL8 A;  4EEU A;  2OOL A;  4LRX C;  5J7E A;  5F5Y A;  3TRC A;  1OJ5 A;  2R78 A;  3F1P A;  4JGO A;  4L9E A;  3P01 A;  4HH2 A;  2V9A A;  4MN5 A;  1OT9 A;  4KQD A;  1TD5 A;  2W0N A;  2K7S A;  1YKD A;  1UWN X;  5F6A A;  1N9L A;  1TS6 A;  4QPR A;  1BYW A;  2PD7 A;  2B18 A;  2A2L A;  1W63 M;  2JN7 A;  2L4R A;  1MKM A;  1W63 Q;  3ZYT A;  2G7U A;  5EFW A;  2M1C A;  4F3L B;  4L0L A;  3K3C A;  1YSP A;  4HP9 A;  2VA0 A;  3D3O A;  1OPX A;  4MCW A;  4HJ4 A;  2YKH A;  2JHE A;  2JKT I;  4BJP A;  4EQ1 A;  2PHY A;  3KYZ A;  1MC0 A;  3MFX A;  4HH3 A;  3U2A A;  4XT2 B;  1S4R A;  5HZH A;  4ARZ A;  4EUV A;  1OT6 A;  3E4Q A;  1S67 L;  1NRJ A;  4HI4 A;  4GS9 B;  1T19 A;  5G4Z A;  3VV4 A;  1MZU A;  4K08 A;  2M7V A;  2KX6 A;  3UME A;  4CLC B;  5HL6 A;  3NOP C;  3LI9 A;  2XRN A;  2VGL S;  2VGL M;  2GJ3 A;  3F1O A;  3VE4 A;  3H82 A;  2P08 A;  4DJ3 A;  3RFB A;  3H7W A;  1F5M A;  3K3D A;  3FPW A;  2L0W A;  2L1M A;  4UEY A;  2INW A;  4IHQ A;  3SW1 A;  3PBT A;  2KLI A;  3G6O A;  1F9I A;  4EU0 A;  1D7E A;  3EOI A;  4I38 A;  3BY9 A;  3FG8 A;  3PBS A;  3T4O A;  3H9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...