4JGQA

The crystal structure of sporulation kinase d mutant sensor domain, r131a, from bacillus subtilis subsp in co-crystallization with pyruvate
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
203
structure length
203
Chain Sequence
KDTIAAEHKQEASVLLNLHRNKINYLIGETMARMTSLSIAIDRPVDIKKMQSILEKTFDSEPRFSGLYFLNAKGDVTASTTELKTKVNLADASFFIKAKETKKTVISDSYSSRITGQPIFTICVPVLDSKRNVTDYLVAAIQIDYLKNLINLLSPDVYIEVVNQDGKMIFASGQASHAEDQKPVSGYLDDISWNMKVYPNPVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sporulation kinase D
publication title Insight into the sporulation phosphorelay: Crystal structure of the sensor domain of Bacillus subtilis histidine kinase, KinD.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Transferase
total genus 54
structure length 203
sequence length 203
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4jgqA02
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4jgqA01
3NOUC 4BBVA 1N9OA 2V1BA 1F98A 5HSQA 3F1OA 1D06A 4HP9A 3LI8A 5F69A 2INWA 5DJUA 4WL9A 2PHYA 5HDDA 1OTAA 4H6JA 2V1AA 3F1OB 5AVEA 4GS9B 2Z6DA 1V9ZA 2BASA 4L9EA 2Z6CA 3GDIA 4EERA 1LSWA 4H6JB 4HOIA 3OLOA 3MJQA 1EW0A 1OT9A 1F9IA 1S4SA 2V0WA 1UGUA 3LIFA 3NOTC 3C2WA 5DKKA 2VLGA 1XJ6A 2ZBBA 2L0WA 2D02A 2QJ7A 4RQ9A 1MZUA 2EA9A 3F1PB 3CAXA 3RTYA 4HJ6A 5F6AA 1DRMA 4XT2A 5DKLA 2KX6A 2ZOIA 3K3DA 3CWFA 4EESA 2P7JA 2K7SA 4PKYG 1S1ZA 4XT2B 3UB9A 1ODVA 2L4RA 3E4QA 4MN5A 1Y28A 3BY9A 3G6OA 3NOPC 1XJ4A 4WUJA 2M1CA 3LICA 3IBRA 5J7EA 2WKPA 5G4YA 2PYPA 4E04A 4HI4A 4MN6A 4EXOA 5IU1A 4EEUA 3ULFA 1TS0A 1P0ZA 1P97A 1OTEA 5EFWA 4GCZA 4I3IA 3ICYA 1WA9A 5HWVA 4GW9A 1VB6A 3EWKA 3MQOA 3RH8B 2PDRA 4HQAA 2OWHA 1LSVA 1N9LA 3K3CA 4I3JA 2R78A 4HH2A 4LRXC 4LPZA 3T50A 1T1AA 4HJ4A 1T19A 2QHKA 1S67L 4PKYA 3HJKA 3D72A 1OT6A 3EEHA 4LRZE 4L9FA 2A24A 2OOLA 3MQQA 3UB8A 1T18A 1D7EA 3H7WA 4B9OA 4HNBA 2A24B 1OJGA 4NXGA 3ZQ5A 3MFXA 1TS7A 2L1MA 4F3LA 3NHQA 2PD8A 2VV7A 3H7WB 4KUKA 4WN5A 1DP6A 2QKPA 5F68A 4F3LB 5HD5A 5TBMA 1V9YA 3E4PA 3PYPA 5AVFA 3UMDA 1X0OA 2OWJA 4R6LA 5HZHA 2PR5A 5TBMB 4KUOA 1KOUA 2B02A 3NJAA 1NWZA 2PD7A 4I3AA 4LLOB 4R38A 1LT0A 3MR0A 1OTBA 2HV1A 3SW1A 4NXFA 4BBUA 3FC7A 4NXBA 5DJTA 2VV8A 4WF0A 1GSVA 4EEPA 2I9VA 3MXQA 4DJ2A 2YKFA 3FG8A 5HD3A 3UB6A 2J80A 3H82A 3LIDA 2WKRA 2JN7A 4EQ1A 4BBTA 1DP9A 1LL8A 4KQDA 2V0UA 3H82B 3PHYA 4M4XA 3UE6A 3UMEA 2ZOHA 4I39A 3LYXA 3LIAA 5HDCA 3GECA 2VEAA 2W27A 1TS6A 1XFQA 4GS9A 4I38A 5I5LA 4DJ3A 2PYRA 2H28A 3E4OA 4HH3A 4HJ3A 2V9AA 4GHIA 4JGRA 4HHDA 5G4ZA 3VE3A 5J4EA 4HIAA 5HDSA 5HWTA 3LIBA 3A0VA 3KX0X 2VV6A 5KIZA 4GHIB 4HP4A 1UWPX 3VE4A 4LRYC 4HY8A 3H9WA 3F1PA 3LUQA 4EW7A 4R3AA 5A8BA 2YKHA 3P7NA 2JHEA 3LIEA 2D01A 1BYWA 4JGOA 1OJ5A 3HJIA 1T1BA 3LI9A 1GSWA 3BWLA 3CLOA 4NXEA 2PR6A 4I5SA 4YWZA 2GJ3A 1N9NA 1DP8A 4EETB 1JNUA 1XJ3A 1UWNX 1TS8A 5F5YA 4K08A 5J3WA 3B33A 2CMNA 1S66L 2WKQA 2QWSA 5HWWA 3F1NA 1OTDA 3A0SA 2KDKA 4L9GA 1S1YA 4JGQA 1OTIA 3VOLA 3F1NB 1GSXA 1T1CA 4JGPA 3IS2A 3C8CA 5IS1A 1LSXA 1S4RA 3A0RA 3BY8A 3UB7A 1XJ2A 4WLAA 1G28A 2W0NA 3IS2B 2QJ5A 1XFNA 4R70A
chains in the Genus database with same CATH superfamily
2BG1A 1PW8A 2OLVA 2J3TC 1SKOB 5EVIA 1CK3A 5GLDA 1D06A 3LI8A 3WS2A 1NLYA 3N8LA 4S2NA 4H6JA 3PBSA 1HD8A 1ES5A 2RL3A 3LR5A 4C6YA 1XA1A 3ZG0A 5FASA 5CGWA 4OP8A 5EVIC 1KGEA 4WM9A 4H8RA 3ITBA 3LIFA 3UPPA 2LB5A 4BD0A 3VP3A 4S2NC 2L0WA 2QJ7A 5FDHA 1O7EA 2Y2JA 1MWSA 4JLFA 1G5UA 4Z9QA 3RTYA 1MWRA 5JYPA 1ONHA 2XFTA 4EESA 5KSHA 2P7JA 2K7SA 1MKMA 4XT2B 3UB9A 4R3BA 2PBYA 2EX6A 5U47A 5GLBA 1GHMA 5EOOA 4UA9A 4JXGA 3IBRA 4IHQA 5G4YA 5CEBA 2JKFA 4E04A 4HI4A 3OCLA 5HPFA 3ULFA 3HLGA 3JVVA 2Y2LA 5EFWA 2VGLS 5HWVA 1YMSA 2XGNA 1NY0A 4IJGA 3GRJA 3MZFA 3SH7A 3QP1A 5GHXA 3Q7ZA 4I3JA 2JBFA 1K6SA 4HH2A 1YM1A 1G68A 2C6WB 3T50A 1T1AA 2ZMFA 3ZG9B 2HPBA 5FA7A 4E3LA 1H0MA 1FR1A 3KSFA 3O88A 4D2OA 1S67L 3OPRA 1SDNA 4PKYA 1L3LA 2H0TA 1ONGA 4O0PA 4EQIA 3EEHA 3LR4A 3T1RA 4NEED 4CLCE 3G34A 5F83A 1PNEA 2W3HA 3SH9A 2QZ6A 5F1FA 1CQAA 3H7WA 1KE3A 2PRFA 1PWCA 4NXGA 3DTIA 2L1MA 1FQGA 2Y2KA 5HW3A 2WUQA 4ZJ2A 3A3EA 2DRWA 4ZTKA 3QP4A 3CITA 4E3JA 3B42A 1RCJA 1ERMA 4OQIA 4X53A 5EVEA 3V5MA 4WELA 4R6LA 4DKIA 4MDZA 2WGWA 5A93A 1K57A 5CXWA 3NJAA 4RVAA 4X25A 4I3AA 4LLOB 2XLNA 4LCLA 1OTBA 4DXCA 5FAQA 3JPUA 3C38A 3FC7A 4X1MA 4NXBA 3V39A 4S2IA 4QJGA 1NYMA 1N9BA 3QP6A 4EEPA 4WMCA 4DJ2A 2W1TB 2YKFA 3K2NA 3FG8A 5HD3A 2XF3A 3S7OA 3VP0A 5CTNA 3PAGA 4LV1A 1K57C 1IEMA 4O8GA 3V50A 1XP4A 5FAPA 2WKRA 4S2KA 2BLSA 2HDSA 3OCNA 1G6AA 2V0UA 4CLCB 3H82B 3N7WA 4M4XA 3N8SA 4F94A 1JTDA 5M1AA 3MXRA 2Q9NA 5GHYA 2B5RA 3HBRA 5TGFA 3IQAA 1BTLA 2GX5A 4UHUA 4KG6A 1YT4A 4MBHA 1Q2QA 1IYQA 3IF6A 2VEAA 2W27A 1TS6A 3EGXC 4FH4A 4GS9A 4IBRA 3LR3A 4LV2A 2XSSA 5HAQA 3IX4A 1K56D 4Y2FA 3R7WA 1VEUB 2PYRA 2P9VB 3LEZA 3IHAA 3OC2A 4S2JA 3ZGAB 2PAVP 4JXSA 4JGRA 4RA7A 3VE3A 3W4OA 3PR6A 3B47A 4KZ7A 3IF6C 4QU3A 5HWTA 1K55A 3RFBA 2Q0OA 4DE0A 5KIZA 1Z09A 4FUWA 1VM1A 5IHVA 3VE4A 4IVIA 3NDGA 3TOIA 3T1SA 3AGFA 4HY8A 3H9WA 1VHMA 4EW7A 4R3AA 2A2LA 2EWVA 2YKHA 1PI4A 3P7NA 2JKGA 3GSGA 3G32A 5HAIA 3LIEA 3NY4A 4WBGA 3UDXA 2WKHA 1OJ5A 3TG9A 2H10A 3BWLA 3GTCA 2NUPC 3CLOA 2PR6A 3UY6A 1K55C 3PTEA 4YWZA 1L2SA 4N1HA 1DP8A 2EFXA 1JNUA 3FKVA 3TSGA 5FQQA 1K54C 1VQQA 4PAUA 1UWNX 2VGLM 4MLLA 3GV9A 4O01A 5J3WA 4ZAMA 3WS4A 2CMNA 1S66L 4X56A 2QWSA 2V8FA 3NDEA 3F1NA 2G7UA 5L10A 3BECA 3T1QB 1S1YA 4OP5A 1H5XA 5J8XA 2JCHA 4JGQA 5FQMA 3C30A 2Y59A 4JGPA 2KLIA 1SHVA 5IS1A 1LSXA 2X01A 4GOGA 3A3DA 1W8YA 3DWKA 1PW1A 1FSYA 4UQIM 1XFNA 4R70A 2HZ5A 3NOUC 4KQQA 4PM7A 1QMFA 5HSQA 1E3UA 4BL2A 4MEZA 3ZYTA 2IWDA 3IWQA 5DTKA 5AQAA 5F69A 3SZTA 5DJUA 4WL9A 5HDDA 4S2MA 3HL9A 3M2JA 3UE3A 1YSQA 5HFOA 4Y3IA 3T4LA 3TW8A 5EVIB 3EEAA 4Y0UA 3PXPA 4U0XA 2B95A 3BYDA 1PWGA 1V9ZA 5A92A 1BULA 2BASA 5KMWA 4L9EA 1GA0A 2Z6CA 1LSWA 1KE0A 1YLWA 4H6JB 3MJQA 5JYOA 3LEQA 1F9IA 1S4SA 1PYYA 2P08A 2Z2LB 1LHYA 3ITAA 1FR6A 4UAAA 3NOTC 2JE5A 3C2WA 5E2EA 1GHPA 1ZG4A 2Y8HA 3VV4A 4CJNA 1FSWA 3BRMA 3ZVWA 4OOYA 1WE4A 4XUZA 1IOUA 1MZUA 1Z6FA 2FFFB 4K0XA 4P6ZS 3F1PB 4OVDA 4GDBA 5EOEA 5L07A 4ARZA 4WEKA 5DKLA 1ZHHB 3IXGA 3VP2A 3HREA 4FD8A 4PKYG 4N1XA 3E4QA 1YLZA 2OSUA 2ZQCA 3VFFA 5FQIA 3L7HA 1Y54A 3G6OA 3G2ZA 2M1CA 4X6TA 1E3UD 4R0QA 5C5KA 2WKPA 3BJNA 2EFUA 2A49A 1ES3A 2Q9MA 1L0EA 1RGYA 5AJGA 4Y0OA 1YLYA 1YLPA 2XD1A 3CMZA 3E2LA 4KZ9A 4EEUA 5I94A 4P87A 1P0ZA 1MKIA 1P97A 2W3GA 1SKFA 1HLUP 4RYEA 4IBXA 4EWFA 3IX8A 1SCWA 3WS1A 1HVBA 1CEFA 3Q81A 3D9YA 4GD6A 2IWCA 4CPKA 3LGOA 1G6OA 5AQ9A 4HJ4A 1PRQA 1L0GA 2QHKA 1KVLA 2HDQA 5TR7A 3BQAA 5BOHA 4PHTA 4DF6A 4L0LA 3MMHA 1TDLA 1E4DA 4L9FA 3RJUA 2A24A 3ZFZA 2AVXA 3MQQA 2VJWA 1D7EA 2ZQ7A 4P0MA 3KO6A 4JXVA 3LCEA 2Y2MA 3ZQ5A 3MFXA 1TS7A 4F3LA 2HP9A 3W4PA 3Q1FA 3H7WB 5FI7A 2P04A 4UA6A 3HVFA 2V8CA 4PM5A 2VGKA 2Y2NA 4Y5FA 2OAQ1 2X02A 2Y2OA 5KSCA 5HD5A 3TE8A 2PU4A 4WEJA 1JWPA 2XR0A 3MKEA 1RP5A 1CI8A 1V9YA 4MBKA 5F82A 3HCYA 1NRJA 3PYPA 2Z2MB 5AVFA 2CC1A 5L2FA 3UMDA 3LY3A 2EXAA 2PR5A 4KUOA 1S0WA 3T12B 3NULA 3C4OA 1DJCA 2EXBA 2P74A 1LT0A 3MXSA 3MR0A 3UDIA 4GZBA 1RGZA 4NXFA 2WGWB 3CG5A 1J9MA 5DJTA 4DE2A 2EX8A 1MBLA 5L8MA 3UB6A 4FH2A 2J80A 2ZQ8A 4FSFA 4QHCA 2ZMVA 3FZCA 2JC7A 3LIDA 2RCXA 2GDNA 3IXHA 4OH0A 2QYBA 1U60A 4BD1A 4E6XA 3EQUA 3BFGA 2ZM8A 1FILA 5FEGA 1D1JA 2J3WA 3UE0A 1LL8A 3W8KA 4LGWA 3UE6A 3BFFA 3UMEA 3KYQA 4JPMA 3ZVTA 2XRNA 1XA7A 3E98A 5FATA 3GECA 3N4IA 2GZAA 3V67A 4BLMA 1QMEA 2J7VA 4QPRA 1DY6A 3IT9A 4I38A 3ZNTA 4UQIS 1KDSA 3IF6B 4DJ3A 4HH3A 4P6ZM 1PIOA 3OZHA 4HJ3A 4ZBEA 2V9AA 4GHIA 3IHBA 3IH9A 3BEBA 4U0TA 2ZQDA 5J4EA 1VETA 3N6IA 3HUNA 5HDSA 3R7WB 4S2PA 2KOIA 5DFXA 2O0YA 4DDYA 2VV6A 1EROA 1UWPX 2PBDP 4KZ8A 1TVFA 3UNWA 3FKWA 5FQ9A 3LUQA 4YFMA 2WYXA 3SS4A 4BJPA 1CJFA 2UV0E 4PM9A 1CEGA 3C7UA 5G18A 3PBQA 4PMAA 1YQSA 3LI9A 2ZQ9A 1K56A 1CF0A 4ME4A 4I5SA 2HGVA 1LL9A 2GJ3A 3GQZA 1PI5A 3T4JA 4OPRA 1FOFA 2M7UA 2IWBA 3ZNYA 1J3WA 1XJ3A 4UA7A 5DTSA 3WRZA 2WKQA 3SS5A 1PZOA 4BQMA 1OTDA 3A0SA 4MMNA 4LFUA 2HP5A 1YSPA 2X71A 1LLBA 1BSGA 3CPTA 5D3OA 4DDSA 3F1NB 1L0FA 3FPVA 1GSXA 1Y4OA 4KZ5A 3P01A 4HBUA 4ID4A 4GNUA 4OQGA 3C8CA 3A0RA 1XJ2A 3PBRA 1G28A 1H3QA 1KDWA 4QD4A 5K5BA 3NECA 4GJ4A 5FQJA 4A5RA 3VP4A 4EBPA 1XKZA 1NZOA 4HEFA 1ACFA 5E2HA 4R1GA 1N9OA 2K2NA 2V1BA 1F98A 3B3XA 4KG2A 5M18A 3F1OA 4IVKA 4HP9A 3Q7VB 2INWA 4DXBA 2PHYA 4ZDXA 1OTAA 2QMIA 3IWIA 3HLBA 3BFDA 4XUXA 3G2YA 2Z6DA 4NG2A 2XROA 5EM0A 4O7DA 3ZG7B 5EV0A 1K4FA 3ZG8B 4Q8IA 1NRFA 4IUHA 1EW0A 5HAPA 5DVAA 3VSKA 4EV4A 5A90A 1UGUA 4GB7A 3HUOA 2WKEA 5DKKA 3RXXA 3GR2A 2OAP1 2IA2A 3C7VA 3MBZA 3EOIA 2H0YA 1I2WA 4KZ4A 1H8YA 1XPBA 3CAXA 4HJ6A 1FCOA 1SDEA 3P09A 2R9XA 2KX6A 4B88A 4B4ZA 1S6RA 3L9KA 1S1ZA 4ARZB 3HLEA 5CECA 4MN5A 2W3DA 1N4OA 1STZA 2O99A 3NOPC 2ZM2A 1XJ4A 3FYZA 2WAFA 2Y2PA 3IH8A 4JKTA 3BW6A 2WADA 2PU2A 3HLFA 1AWIA 4MN6A 4OOLA 3MKFA 5IU1A 1JVJA 1GCEA 1XXMA 1GHIA 1TS0A 4ETXA 1ZTUA 4U3TA 4WZ5A 2VZWA 4I3IA 2FZ0A 4K91A 3EWKA 3HUMA 1IKGA 3MQOA 2XK1A 3M2KA 2PDRA 3QNBA 1K4EA 1W63Q 2HDUA 2OWHA 1LSVA 1A0KA 2EX9A 2R78A 3ZHHA 4PPRA 4LRXC 3S22A 4LPZA 3IWOA 1ESIA 2ZD8A 4WZ5C 1F2KA 2Y79A 3PBTA 2XQZA 2EX2A 3NIAA 1BUEA 4OPZA 3D72A 1OT6A 3T1XA 2Y91A 2ZMAA 1O07A 2ZL1A 3G31A 3IF5A 3S7PA 4B9OA 3D3OA 4HNBA 2A24B 3ISGA 3QNCA 4Q0JA 3PBNA 1MY8A 2WGVA 5E2GA 1GA9A 4DN0A 1WYCA 1IYSA 3QP2A 4IEDA 2J8YA 4WN5A 2ZC5B 1DP6A 2UWXA 2ZLYA 4F3LB 4PM6A 1LL5A 2V2FF 4KQRA 5TBMA 4YINA 2HP6A 5M19A 4CLCD 1BT5A 5DF9A 1YKDA 3NCKA 4EBLA 3SOIA 3VSLA 1X0OA 2OWJA 5HX9A 4NKPA 3HLWA 2B02A 1NWZA 2VKSA 2PD7A 4OLGA 4G3VA 4R38A 4B93A 1BLPA 2M7VA 3AGEA 2HV1A 5CHJA 3SW1A 3GVBA 1OMEA 3UDFA 3S7NA 2DCFA 1FCMA 2VV8A 3U4LP 4OLDA 4C75A 1K6RA 5GLCA 3HLDA 3C5AA 4LV3A 4FOFA 2XEPA 4X68A 3S7QA 2ZC6B 3NC8A 1YLTA 3S1YA 4RX3A 1NLZA 2XD5A 4N92A 1DP9A 5FI2A 1CI9A 3JYIA 3P98A 1M40A 2HJEA 4I39A 5GHZA 5DF8A 4YNRA 3O87A 3CHWP 4Y13A 4X1LA 3BFCA 3A3JA 1W63M 3MZEA 4FTXA 2JKTM 1XFQA 3O3VA 3FPWA 4LENA 3N8RA 2ACGA 4KZAA 1P9WA 2ZC3B 3E4OA 3W4QA 2LB9A 4MCWA 4KQOA 2VA0A 5G4ZA 2HF6A 4HIAA 3PAEA 4MBFA 4ZJ1A 2ZC4B 3OOVA 4GHIB 4E6WA 2WAEA 3IX3A 3T4KA 2B18A 4S2OA 3WS5A 3R4KA 1VETB 5FSRA 3F1PA 4DRTA 4MN7A 1KGFA 2D01A 1H8MA 1BYWA 2DNSA 3HJIA 3UPNA 1KE4A 1Q2PA 2JKRM 4HESA 4M3KA 2J3TD 3WWXA 4OPQA 1IKIA 1IYOA 2HDRA 1N9NA 3VP1A 5DTTA 4EETB 2WZXA 2WGIA 3TJZC 4DE1A 1TS8A 3I7JA 3B33A 5E2FA 3IXBA 3OPLA 2XDMA 4EUZA 4QB8A 4II7A 3D4FA 4XXRA 4L9GA 3M6BA 4N9LA 5EVID 4GD8A 3W2ZA 4QY6A 4FCFA 4Z1WA 4CQHA 4UEYA 1OTIA 3VOLA 2WK0A 2I72A 1T1CA 1K25A 1ZC2A 3CZDA 3IS2A 2WKIA 5CERA 5HL1A 1NJ4A 3BY8A 4LCMA 3CPTB 5HARA 3BM6A 5CGSA 3BLMA 1DJAA 2K31A 1SKOA 3A3FA 4KENB 4JXWA 4IUKA 4BBVA 3VOYA 5EPHA 3O5YA 3E0YA 3EGDC 1HZOA 2V1AA 2G2WA 4P6BA 3F1OB 5AVEA 4GS9B 1XGJA 3BLSA 4GN2A 4DMZA 3T4OA 1IELA 5FDSA 4DE3A 5KZHA 3GDIA 2NUTC 2ZM0A 4EERA 3HLCA 4HOIA 3OLOA 3OPHA 1OT9A 4BENA 2J9PA 2V0WA 4G3WA 2VLGA 1XJ6A 3KYEA 4BWIA 1YPRA 1BLCA 4C3QA 2ZBBA 5CGXA 1K0KA 2D02A 4NETA 3VMAA 1EI5A 4RQ9A 4ZJ3A 1HTZA 4Q0IA 2Y4AA 5CTMA 2EA9A 5MC7A 3V3SA 5F6AA 1DRMA 4XT2A 5EE8A 3LO7A 5FL3A 2ZOIA 3K3DA 4GDNA 4E3IA 3CWFA 4GLQA 2VX8A 2VGJA 1BLSA 1W7FA 4BL3A 1OPXA 3T4SA 1ODVA 2L4RA 2XFSA 3WS0A 5LBRA 2FFYA 5CHUA 1Y28A 3BY9A 4OPYA 3OBFA 5CX7A 4WUJA 1JTGA 3DTEA 1TD5A 4JF5A 2FH5A 3LICA 4YOFA 5DF7A 2E8JA 3BQ8A 4HBTA 3U2AA 5J7EA 4EUVA 4WZ4A 2PYPA 1LI9A 3Q07A 2XA7M 4EXOA 3MZDA 4KZ3A 5FAOA 2O9AA 5TJJA 1OTEA 2QPNA 4E3MA 5CEDA 4GCZA 3G35A 3T4TA 3ICYA 1WA9A 4GW9A 1DJBA 1P9RA 1FCNA 1VB6A 3RH8B 5CHMA 5FQKA 1BLHA 2EWWA 4HQAA 2O9CA 1K38A 1FIKA 1N9LA 2H5SA 3SH8A 3K3CA 1F5MA 1JWZA 3CI6A 4OKPA 3NBLA 3TRCA 2R9WA 4OONA 5L09A 1NYYA 3UE1A 1T19A 4QWOA 5EVLA 5A91A 3HJKA 1ZKJA 3WRTA 1E25A 1PWDA 1SZVA 4LRZE 3LY4A 2OOLA 1PZPA 1PFLA 2OLUA 2DMWA 2ZC7A 2W1RA 2Y2GA 3UB8A 1IFQA 1ES4A 1T18A 3CJMA 3G4PA 4EU0A 3KSHA 3CUEA 1OJGA 2ZL1B 5DFYA 3LR0A 1TDGA 3MQ0A 2MJ6A 3C4PA 3NHQA 5AQ7A 2PD8A 2VV7A 3DTMA 4KG5A 4ETZA 2J9OA 4KUKA 1KVMA 4JBFA 4R3JA 1K54A 4Y17A 4WMCD 2QKPA 5F68A 4Y0TA 2VK3A 1NZUA 2GNXA 4PM8A 3VOZA 3E4PA 4Y7PA 3O86A 3CUEC 2OV5A 5HPIA 4Y15A 3ZCZA 1M6KA 1MPLA 5GL9A 5HZHA 5TBMB 1KOUA 3KSGA 1AXBA 3QP8A 2JKTI 3V3RA 1TEMA 2W1TA 1JWVA 3KSIA 4BBUA 3FWLA 3MS6A 3BFEA 5EUAA 1MC0A 4WF0A 1GSVA 1I5QA 4KZBA 2I9VA 3MXQA 4N9KA 2A3UA 2V20A 3MSHA 3QHYA 1ERQA 1LI0A 4CLCA 3IBJA 4KZ6A 3H82A 2V1ZA 1W5DA 1EWZA 3ZDJA 5FEFA 1I2SA 1W79A 4OQHA 2Y2QA 3QP5A 4QY5A 2JN7A 4EQ1A 4BBTA 4KQDA 3KYZA 1MXOA 3PHYA 2ZOHA 1MWUA 4R4RA 3A3IA 2ZJ9A 3LYXA 4B4XA 3LIAA 2Y2IA 5HDCA 2C5WB 3AGDA 4GKUA 2JKRI 5EM1A 1NXYA 3Q7VA 1WYBA 4CLCC 3NI9A 4BMWA 1KGGA 4D60A 1VEUA 3G30A 2P9VA 2E8IA 3S4XA 2W3FA 3OPPA 1XX2A 3PBOA 5E43A 3UN7A 4OOMA 4OQ0A 1TF1A 5I5LA 4RX2A 4P85A 3DWZA 3E2KA 1L0DA 4G3KA 3VFHA 2H28A 4X69A 2ZQAA 2G2UA 5AQBA 3EQVA 5EECA 1ALQA 3RXWA 4NK3A 4HHDA 4X55A 1YLJA 2W3EA 5GLAA 3LIBA 3UO9A 3A0VA 3KX0X 3LFVA 2PT7A 4HP4A 3MFDA 4AFIA 1YAXA 3M6HA 2O9BA 3UB5P 4LRYC 4MNRA 1C3BA 3DBAA 3FV7A 5A8BA 1BZAA 2JHEA 4JGOA 3JVUA 3MF0A 1T1BA 1GSWA 4NXEA 5F1GA 2HJ9C 4Q0HA 4ESPA 5FI6A 2BTFP 5HL6A 3GMWA 2WZZA 2XH9A 1ZG6A 4E3NA 3T4QA 1IYPA 2Y55A 3ZG5A 4JF4A 5F5YA 4K08A 4E3KA 4JF6A 5HWWA 2Y2HA 3IXDA 2KDKA 4R23A 1ES2A 4S2LA 4E3OA 3Q82A 1YMXA 5CRFA 4WYYA 4LV0A 3DAVA 4R4SA 1S4RA 1H8ZA 1W8QA 3UB7A 3SS3A 4WLAA 5IT5A 3DTKA 4K0WA 5TFQA 2W0NA 1ESUA 4EBNA 3IS2B 2XA7S 3DW0A 1MWTA 4ZRRA 1XGIA 2QJ5A 3UPOA
chains in the Genus database with same CATH topology
3NOUC 4IUKA 4BBVA 1N9OA 2J3TC 2K2NA 2V1BA 1F98A 5HSQA 3F1OA 3O5YA 3E0YA 1D06A 4HP9A 3ZYTA 3LI8A 5F69A 2INWA 1NLYA 4WL9A 5DJUA 2PHYA 5HDDA 3UE3A 3EGDC 1YSQA 1OTAA 4H6JA 4Y3IA 2V1AA 3T4LA 3PBSA 3TW8A 3EEAA 3F1OB 3PXPA 5AVEA 4GS9B 2Z6DA 3LR5A 1V9ZA 4DMZA 3T4OA 2XROA 2BASA 4L9EA 2Z6CA 3GDIA 2NUTC 4EERA 1LSWA 4H6JB 4HOIA 3OLOA 3MJQA 4IUHA 1EW0A 1OT9A 1F9IA 1S4SA 2P08A 2V0WA 1UGUA 4G3WA 3LIFA 3NOTC 3C2WA 5DKKA 2VLGA 1XJ6A 4BWIA 2LB5A 2OAP1 2IA2A 2ZBBA 2Y8HA 2L0WA 2D02A 3EOIA 3VV4A 2QJ7A 4RQ9A 4Q0IA 1IOUA 1MZUA 4P6ZS 2EA9A 3F1PB 5MC7A 3CAXA 3RTYA 4HJ6A 5F6AA 1DRMA 4XT2A 4ARZA 4WEKA 5DKLA 1ZHHB 2KX6A 5FL3A 2ZOIA 3K3DA 3CWFA 4GLQA 4EESA 2VX8A 5KSHA 2P7JA 2K7SA 4PKYG 1S1ZA 1MKMA 1OPXA 4XT2B 3UB9A 3T4SA 1ODVA 2L4RA 3E4QA 4ARZB 5LBRA 4MN5A 2W3DA 1Y28A 1STZA 2O99A 3BY9A 3G6OA 3OBFA 3NOPC 5CX7A 1XJ4A 4WUJA 2M1CA 1TD5A 3BW6A 2FH5A 3LICA 4YOFA 5C5KA 3IBRA 3BQ8A 3U2AA 5J7EA 2WKPA 3BJNA 4EUVA 4IHQA 5G4YA 2PYPA 4E04A 4HI4A 4MN6A 3OCLA 2XA7M 4OOLA 5AJGA 4EXOA 5HPFA 5IU1A 4EEUA 3ULFA 1TS0A 2O9AA 3JVVA 5TJJA 4ETXA 1P0ZA 1P97A 1OTEA 1ZTUA 2W3GA 2VZWA 5EFWA 2VGLS 4GCZA 4I3IA 3T4TA 3ICYA 2FZ0A 1WA9A 5HWVA 4GW9A 1P9RA 1VB6A 3EWKA 3MQOA 3RH8B 2PDRA 1W63Q 2EWWA 4IJGA 4HQAA 2O9CA 2OWHA 1LSVA 1N9LA 3K3CA 1F5MA 4I3JA 3CI6A 2R78A 4HH2A 4LRXC 3TRCA 4LPZA 3T50A 1T1AA 2ZMFA 1G6OA 2Y79A 3PBTA 4HJ4A 1T19A 3KSFA 2QHKA 1S67L 4PKYA 3HJKA 4O0PA 3BQAA 3D72A 1OT6A 3EEHA 3LR4A 4NEED 4PHTA 4L0LA 3MMHA 4CLCE 4LRZE 4L9FA 2A24A 2OOLA 3MQQA 2DMWA 2VJWA 2W3HA 2W1RA 3UB8A 1IFQA 1T18A 1D7EA 4EU0A 3S7PA 3KSHA 3H7WA 4B9OA 3D3OA 4HNBA 2A24B 3CUEA 1OJGA 5DFYA 3KO6A 3LR0A 4NXGA 3ZQ5A 4Q0JA 3MQ0A 3MFXA 3PBNA 1TS7A 2L1MA 2MJ6A 4F3LA 3NHQA 2PD8A 4DN0A 2VV7A 3H7WB 2P04A 4ETZA 4KUKA 4Y5FA 2OAQ1 4WN5A 1DP6A 2QKPA 5F68A 4F3LB 5HD5A 3TE8A 4WEJA 5TBMA 2GNXA 1V9YA 4CLCD 3E4PA 3CITA 3CUEC 5HPIA 3B42A 5DF9A 1YKDA 3HCYA 1NRJA 3PYPA 5AVFA 3UMDA 1X0OA 2OWJA 4WELA 4R6LA 5HZHA 2PR5A 4KUOA 4MDZA 5TBMB 1KOUA 3KSGA 4NKPA 2JKTI 2B02A 3NJAA 1NWZA 2VKSA 2PD7A 4I3AA 4LLOB 4G3VA 4R38A 4B93A 1LT0A 3MR0A 1OTBA 2M7VA 2W1TA 3KSIA 2HV1A 3SW1A 4NXFA 4BBUA 3C38A 3FC7A 4NXBA 3S7NA 5DJTA 2VV8A 1MC0A 4WF0A 1GSVA 4EEPA 2I9VA 3MXQA 4DJ2A 2W1TB 4FOFA 2YKFA 3K2NA 3FG8A 5HD3A 3S7OA 5L8MA 3S7QA 3UB6A 2J80A 4CLCA 3IBJA 3H82A 4FSFA 2ZMVA 3LIDA 4O8GA 2QYBA 3EQUA 2WKRA 2JN7A 1NLZA 4EQ1A 4BBTA 1DP9A 2J3WA 1LL8A 3OCNA 4KQDA 4CLCB 2V0UA 3H82B 3KYZA 3PHYA 4M4XA 3UE6A 3UMEA 2ZOHA 2HJEA 3KYQA 4I39A 3LYXA 2XRNA 3LIAA 5HDCA 2JKRI 2GX5A 3E98A 4YNRA 4CLCC 4BMWA 3GECA 2GZAA 2VEAA 2W27A 1W63M 3V67A 2JKTM 1TS6A 2W3FA 3EGXC 1XFQA 4QPRA 3PBOA 4GS9A 3FPWA 4OOMA 4I38A 1TF1A 5I5LA 3LR3A 4UQIS 2XSSA 4DJ3A 1P9WA 4Y2FA 3R7WA 4G3KA 2PYRA 2H28A 3E4OA 4HH3A 4P6ZM 3OC2A 2LB9A 3EQVA 4HJ3A 4MCWA 2V9AA 4GHIA 4JGRA 4KQOA 2VA0A 4HHDA 5G4ZA 2HF6A 3VE3A 3PR6A 5J4EA 3B47A 4HIAA 2W3EA 5HDSA 5HWTA 3R7WB 3OOVA 3LIBA 3RFBA 3A0VA 2KOIA 3KX0X 5DFXA 2O0YA 2VV6A 3LFVA 5KIZA 2PT7A 4GHIB 4HP4A 1UWPX 3T4KA 4AFIA 2B18A 1YAXA 3VE4A 2O9BA 3R4KA 4LRYC 4HY8A 3H9WA 1VHMA 3F1PA 3LUQA 4R3AA 4EW7A 3DBAA 5A8BA 2A2LA 2EWVA 4BJPA 2YKHA 3P7NA 4MN7A 2JHEA 3LIEA 3PBQA 2D01A 1H8MA 1BYWA 4JGOA 3JVUA 1OJ5A 3MF0A 3HJIA 1T1BA 3LI9A 1GSWA 3BWLA 2JKRM 2NUPC 3CLOA 4NXEA 2J3TD 2PR6A 4ME4A 4I5SA 2HJ9C 2HGVA 4Q0HA 4YWZA 2GJ3A 5HL6A 1N9NA 1DP8A 4EETB 1JNUA 3T4JA 2M7UA 1XJ3A 4PAUA 3TJZC 1UWNX 3T4QA 2VGLM 1TS8A 5F5YA 4O01A 4K08A 5J3WA 3B33A 2CMNA 1S66L 2WKQA 4II7A 2QWSA 5HWWA 3F1NA 1OTDA 2G7UA 3A0SA 4MMNA 2KDKA 4L9GA 1S1YA 3W2ZA 1YSPA 4JGQA 4Z1WA 3C30A 4CQHA 4UEYA 1OTIA 3VOLA 3F1NB 3FPVA 1GSXA 1T1CA 3P01A 4JGPA 3IS2A 2KLIA 3C8CA 5IS1A 1LSXA 1S4RA 3A0RA 3BY8A 3UB7A 1XJ2A 4WLAA 3PBRA 5IT5A 1G28A 1H3QA 2W0NA 5K5BA 4GJ4A 2K31A 3IS2B 2XA7S 4UQIM 4ZRRA 2QJ5A 1XFNA 4R70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NOU C;  4BBV A;  1N9O A;  2V1B A;  1F98 A;  5HSQ A;  3F1O A;  1D06 A;  4HP9 A;  3LI8 A;  5F69 A;  2INW A;  5DJU A;  4WL9 A;  2PHY A;  5HDD A;  1OTA A;  4H6J A;  2V1A A;  3F1O B;  5AVE A;  4GS9 B;  2Z6D A;  1V9Z A;  2BAS A;  4L9E A;  2Z6C A;  3GDI A;  4EER A;  1LSW A;  4H6J B;  4HOI A;  3OLO A;  3MJQ A;  1EW0 A;  1OT9 A;  1F9I A;  1S4S A;  2V0W A;  1UGU A;  3LIF A;  3NOT C;  3C2W A;  5DKK A;  2VLG A;  1XJ6 A;  2ZBB A;  2L0W A;  2D02 A;  2QJ7 A;  4RQ9 A;  1MZU A;  2EA9 A;  3F1P B;  3CAX A;  3RTY A;  4HJ6 A;  5F6A A;  1DRM A;  4XT2 A;  5DKL A;  2KX6 A;  2ZOI A;  3K3D A;  3CWF A;  4EES A;  2P7J A;  2K7S A;  4PKY G;  1S1Z A;  4XT2 B;  3UB9 A;  1ODV A;  2L4R A;  3E4Q A;  4MN5 A;  1Y28 A;  3BY9 A;  3G6O A;  3NOP C;  1XJ4 A;  4WUJ A;  2M1C A;  3LIC A;  3IBR A;  5J7E A;  2WKP A;  5G4Y A;  2PYP A;  4E04 A;  4HI4 A;  4MN6 A;  4EXO A;  5IU1 A;  4EEU A;  3ULF A;  1TS0 A;  1P0Z A;  1P97 A;  1OTE A;  5EFW A;  4GCZ A;  4I3I A;  3ICY A;  1WA9 A;  5HWV A;  4GW9 A;  1VB6 A;  3EWK A;  3MQO A;  3RH8 B;  2PDR A;  4HQA A;  2OWH A;  1LSV A;  1N9L A;  3K3C A;  4I3J A;  2R78 A;  4HH2 A;  4LRX C;  4LPZ A;  3T50 A;  1T1A A;  4HJ4 A;  1T19 A;  2QHK A;  1S67 L;  4PKY A;  3HJK A;  3D72 A;  1OT6 A;  3EEH A;  4LRZ E;  4L9F A;  2A24 A;  2OOL A;  3MQQ A;  3UB8 A;  1T18 A;  1D7E A;  3H7W A;  4B9O A;  4HNB A;  2A24 B;  1OJG A;  4NXG A;  3ZQ5 A;  3MFX A;  1TS7 A;  2L1M A;  4F3L A;  3NHQ A;  2PD8 A;  2VV7 A;  3H7W B;  4KUK A;  4WN5 A;  1DP6 A;  2QKP A;  5F68 A;  4F3L B;  5HD5 A;  5TBM A;  1V9Y A;  3E4P A;  3PYP A;  5AVF A;  3UMD A;  1X0O A;  2OWJ A;  4R6L A;  5HZH A;  2PR5 A;  5TBM B;  4KUO A;  1KOU A;  2B02 A;  3NJA A;  1NWZ A;  2PD7 A;  4I3A A;  4LLO B;  4R38 A;  1LT0 A;  3MR0 A;  1OTB A;  2HV1 A;  3SW1 A;  4NXF A;  4BBU A;  3FC7 A;  4NXB A;  5DJT A;  2VV8 A;  4WF0 A;  1GSV A;  4EEP A;  2I9V A;  3MXQ A;  4DJ2 A;  2YKF A;  3FG8 A;  5HD3 A;  3UB6 A;  2J80 A;  3H82 A;  3LID A;  2WKR A;  2JN7 A;  4EQ1 A;  4BBT A;  1DP9 A;  1LL8 A;  4KQD A;  2V0U A;  3H82 B;  3PHY A;  4M4X A;  3UE6 A;  3UME A;  2ZOH A;  4I39 A;  3LYX A;  3LIA A;  5HDC A;  3GEC A;  2VEA A;  2W27 A;  1TS6 A;  1XFQ A;  4GS9 A;  4I38 A;  5I5L A;  4DJ3 A;  2PYR A;  2H28 A;  3E4O A;  4HH3 A;  4HJ3 A;  2V9A A;  4GHI A;  4JGR A;  4HHD A;  5G4Z A;  3VE3 A;  5J4E A;  4HIA A;  5HDS A;  5HWT A;  3LIB A;  3A0V A;  3KX0 X;  2VV6 A;  5KIZ A;  4GHI B;  4HP4 A;  1UWP X;  3VE4 A;  4LRY C;  4HY8 A;  3H9W A;  3F1P A;  3LUQ A;  4EW7 A;  4R3A A;  5A8B A;  2YKH A;  3P7N A;  2JHE A;  3LIE A;  2D01 A;  1BYW A;  4JGO A;  1OJ5 A;  3HJI A;  1T1B A;  3LI9 A;  1GSW A;  3BWL A;  3CLO A;  4NXE A;  2PR6 A;  4I5S A;  4YWZ A;  2GJ3 A;  1N9N A;  1DP8 A;  4EET B;  1JNU A;  1XJ3 A;  1UWN X;  1TS8 A;  5F5Y A;  4K08 A;  5J3W A;  3B33 A;  2CMN A;  1S66 L;  2WKQ A;  2QWS A;  5HWW A;  3F1N A;  1OTD A;  3A0S A;  2KDK A;  4L9G A;  1S1Y A;  4JGQ A;  1OTI A;  3VOL A;  3F1N B;  1GSX A;  1T1C A;  4JGP A;  3IS2 A;  3C8C A;  5IS1 A;  1LSX A;  1S4R A;  3A0R A;  3BY8 A;  3UB7 A;  1XJ2 A;  4WLA A;  1G28 A;  2W0N A;  3IS2 B;  2QJ5 A;  1XFN A;  4R70 A; 
#chains in the Genus database with same CATH topology
 2BG1 A;  1PW8 A;  2OLV A;  2J3T C;  1SKO B;  5EVI A;  1CK3 A;  5GLD A;  1D06 A;  3LI8 A;  3WS2 A;  1NLY A;  3N8L A;  4S2N A;  4H6J A;  3PBS A;  1HD8 A;  1ES5 A;  2RL3 A;  3LR5 A;  4C6Y A;  1XA1 A;  3ZG0 A;  5FAS A;  5CGW A;  4OP8 A;  5EVI C;  1KGE A;  4WM9 A;  4H8R A;  3ITB A;  3LIF A;  3UPP A;  2LB5 A;  4BD0 A;  3VP3 A;  4S2N C;  2L0W A;  2QJ7 A;  5FDH A;  1O7E A;  2Y2J A;  1MWS A;  4JLF A;  1G5U A;  4Z9Q A;  3RTY A;  1MWR A;  5JYP A;  1ONH A;  2XFT A;  4EES A;  5KSH A;  2P7J A;  2K7S A;  1MKM A;  4XT2 B;  3UB9 A;  4R3B A;  2PBY A;  2EX6 A;  5U47 A;  5GLB A;  1GHM A;  5EOO A;  4UA9 A;  4JXG A;  3IBR A;  4IHQ A;  5G4Y A;  5CEB A;  2JKF A;  4E04 A;  4HI4 A;  3OCL A;  5HPF A;  3ULF A;  3HLG A;  3JVV A;  2Y2L A;  5EFW A;  2VGL S;  5HWV A;  1YMS A;  2XGN A;  1NY0 A;  4IJG A;  3GRJ A;  3MZF A;  3SH7 A;  3QP1 A;  5GHX A;  3Q7Z A;  4I3J A;  2JBF A;  1K6S A;  4HH2 A;  1YM1 A;  1G68 A;  2C6W B;  3T50 A;  1T1A A;  2ZMF A;  3ZG9 B;  2HPB A;  5FA7 A;  4E3L A;  1H0M A;  1FR1 A;  3KSF A;  3O88 A;  4D2O A;  1S67 L;  3OPR A;  1SDN A;  4PKY A;  1L3L A;  2H0T A;  1ONG A;  4O0P A;  4EQI A;  3EEH A;  3LR4 A;  3T1R A;  4NEE D;  4CLC E;  3G34 A;  5F83 A;  1PNE A;  2W3H A;  3SH9 A;  2QZ6 A;  5F1F A;  1CQA A;  3H7W A;  1KE3 A;  2PRF A;  1PWC A;  4NXG A;  3DTI A;  2L1M A;  1FQG A;  2Y2K A;  5HW3 A;  2WUQ A;  4ZJ2 A;  3A3E A;  2DRW A;  4ZTK A;  3QP4 A;  3CIT A;  4E3J A;  3B42 A;  1RCJ A;  1ERM A;  4OQI A;  4X53 A;  5EVE A;  3V5M A;  4WEL A;  4R6L A;  4DKI A;  4MDZ A;  2WGW A;  5A93 A;  1K57 A;  5CXW A;  3NJA A;  4RVA A;  4X25 A;  4I3A A;  4LLO B;  2XLN A;  4LCL A;  1OTB A;  4DXC A;  5FAQ A;  3JPU A;  3C38 A;  3FC7 A;  4X1M A;  4NXB A;  3V39 A;  4S2I A;  4QJG A;  1NYM A;  1N9B A;  3QP6 A;  4EEP A;  4WMC A;  4DJ2 A;  2W1T B;  2YKF A;  3K2N A;  3FG8 A;  5HD3 A;  2XF3 A;  3S7O A;  3VP0 A;  5CTN A;  3PAG A;  4LV1 A;  1K57 C;  1IEM A;  4O8G A;  3V50 A;  1XP4 A;  5FAP A;  2WKR A;  4S2K A;  2BLS A;  2HDS A;  3OCN A;  1G6A A;  2V0U A;  4CLC B;  3H82 B;  3N7W A;  4M4X A;  3N8S A;  4F94 A;  1JTD A;  5M1A A;  3MXR A;  2Q9N A;  5GHY A;  2B5R A;  3HBR A;  5TGF A;  3IQA A;  1BTL A;  2GX5 A;  4UHU A;  4KG6 A;  1YT4 A;  4MBH A;  1Q2Q A;  1IYQ A;  3IF6 A;  2VEA A;  2W27 A;  1TS6 A;  3EGX C;  4FH4 A;  4GS9 A;  4IBR A;  3LR3 A;  4LV2 A;  2XSS A;  5HAQ A;  3IX4 A;  1K56 D;  4Y2F A;  3R7W A;  1VEU B;  2PYR A;  2P9V B;  3LEZ A;  3IHA A;  3OC2 A;  4S2J A;  3ZGA B;  2PAV P;  4JXS A;  4JGR A;  4RA7 A;  3VE3 A;  3W4O A;  3PR6 A;  3B47 A;  4KZ7 A;  3IF6 C;  4QU3 A;  5HWT A;  1K55 A;  3RFB A;  2Q0O A;  4DE0 A;  5KIZ A;  1Z09 A;  4FUW A;  1VM1 A;  5IHV A;  3VE4 A;  4IVI A;  3NDG A;  3TOI A;  3T1S A;  3AGF A;  4HY8 A;  3H9W A;  1VHM A;  4EW7 A;  4R3A A;  2A2L A;  2EWV A;  2YKH A;  1PI4 A;  3P7N A;  2JKG A;  3GSG A;  3G32 A;  5HAI A;  3LIE A;  3NY4 A;  4WBG A;  3UDX A;  2WKH A;  1OJ5 A;  3TG9 A;  2H10 A;  3BWL A;  3GTC A;  2NUP C;  3CLO A;  2PR6 A;  3UY6 A;  1K55 C;  3PTE A;  4YWZ A;  1L2S A;  4N1H A;  1DP8 A;  2EFX A;  1JNU A;  3FKV A;  3TSG A;  5FQQ A;  1K54 C;  1VQQ A;  4PAU A;  1UWN X;  2VGL M;  4MLL A;  3GV9 A;  4O01 A;  5J3W A;  4ZAM A;  3WS4 A;  2CMN A;  1S66 L;  4X56 A;  2QWS A;  2V8F A;  3NDE A;  3F1N A;  2G7U A;  5L10 A;  3BEC A;  3T1Q B;  1S1Y A;  4OP5 A;  1H5X A;  5J8X A;  2JCH A;  4JGQ A;  5FQM A;  3C30 A;  2Y59 A;  4JGP A;  2KLI A;  1SHV A;  5IS1 A;  1LSX A;  2X01 A;  4GOG A;  3A3D A;  1W8Y A;  3DWK A;  1PW1 A;  1FSY A;  4UQI M;  1XFN A;  4R70 A;  2HZ5 A;  3NOU C;  4KQQ A;  4PM7 A;  1QMF A;  5HSQ A;  1E3U A;  4BL2 A;  4MEZ A;  3ZYT A;  2IWD A;  3IWQ A;  5DTK A;  5AQA A;  5F69 A;  3SZT A;  5DJU A;  4WL9 A;  5HDD A;  4S2M A;  3HL9 A;  3M2J A;  3UE3 A;  1YSQ A;  5HFO A;  4Y3I A;  3T4L A;  3TW8 A;  5EVI B;  3EEA A;  4Y0U A;  3PXP A;  4U0X A;  2B95 A;  3BYD A;  1PWG A;  1V9Z A;  5A92 A;  1BUL A;  2BAS A;  5KMW A;  4L9E A;  1GA0 A;  2Z6C A;  1LSW A;  1KE0 A;  1YLW A;  4H6J B;  3MJQ A;  5JYO A;  3LEQ A;  1F9I A;  1S4S A;  1PYY A;  2P08 A;  2Z2L B;  1LHY A;  3ITA A;  1FR6 A;  4UAA A;  3NOT C;  2JE5 A;  3C2W A;  5E2E A;  1GHP A;  1ZG4 A;  2Y8H A;  3VV4 A;  4CJN A;  1FSW A;  3BRM A;  3ZVW A;  4OOY A;  1WE4 A;  4XUZ A;  1IOU A;  1MZU A;  1Z6F A;  2FFF B;  4K0X A;  4P6Z S;  3F1P B;  4OVD A;  4GDB A;  5EOE A;  5L07 A;  4ARZ A;  4WEK A;  5DKL A;  1ZHH B;  3IXG A;  3VP2 A;  3HRE A;  4FD8 A;  4PKY G;  4N1X A;  3E4Q A;  1YLZ A;  2OSU A;  2ZQC A;  3VFF A;  5FQI A;  3L7H A;  1Y54 A;  3G6O A;  3G2Z A;  2M1C A;  4X6T A;  1E3U D;  4R0Q A;  5C5K A;  2WKP A;  3BJN A;  2EFU A;  2A49 A;  1ES3 A;  2Q9M A;  1L0E A;  1RGY A;  5AJG A;  4Y0O A;  1YLY A;  1YLP A;  2XD1 A;  3CMZ A;  3E2L A;  4KZ9 A;  4EEU A;  5I94 A;  4P87 A;  1P0Z A;  1MKI A;  1P97 A;  2W3G A;  1SKF A;  1HLU P;  4RYE A;  4IBX A;  4EWF A;  3IX8 A;  1SCW A;  3WS1 A;  1HVB A;  1CEF A;  3Q81 A;  3D9Y A;  4GD6 A;  2IWC A;  4CPK A;  3LGO A;  1G6O A;  5AQ9 A;  4HJ4 A;  1PRQ A;  1L0G A;  2QHK A;  1KVL A;  2HDQ A;  5TR7 A;  3BQA A;  5BOH A;  4PHT A;  4DF6 A;  4L0L A;  3MMH A;  1TDL A;  1E4D A;  4L9F A;  3RJU A;  2A24 A;  3ZFZ A;  2AVX A;  3MQQ A;  2VJW A;  1D7E A;  2ZQ7 A;  4P0M A;  3KO6 A;  4JXV A;  3LCE A;  2Y2M A;  3ZQ5 A;  3MFX A;  1TS7 A;  4F3L A;  2HP9 A;  3W4P A;  3Q1F A;  3H7W B;  5FI7 A;  2P04 A;  4UA6 A;  3HVF A;  2V8C A;  4PM5 A;  2VGK A;  2Y2N A;  4Y5F A;  2OAQ 1;  2X02 A;  2Y2O A;  5KSC A;  5HD5 A;  3TE8 A;  2PU4 A;  4WEJ A;  1JWP A;  2XR0 A;  3MKE A;  1RP5 A;  1CI8 A;  1V9Y A;  4MBK A;  5F82 A;  3HCY A;  1NRJ A;  3PYP A;  2Z2M B;  5AVF A;  2CC1 A;  5L2F A;  3UMD A;  3LY3 A;  2EXA A;  2PR5 A;  4KUO A;  1S0W A;  3T12 B;  3NUL A;  3C4O A;  1DJC A;  2EXB A;  2P74 A;  1LT0 A;  3MXS A;  3MR0 A;  3UDI A;  4GZB A;  1RGZ A;  4NXF A;  2WGW B;  3CG5 A;  1J9M A;  5DJT A;  4DE2 A;  2EX8 A;  1MBL A;  5L8M A;  3UB6 A;  4FH2 A;  2J80 A;  2ZQ8 A;  4FSF A;  4QHC A;  2ZMV A;  3FZC A;  2JC7 A;  3LID A;  2RCX A;  2GDN A;  3IXH A;  4OH0 A;  2QYB A;  1U60 A;  4BD1 A;  4E6X A;  3EQU A;  3BFG A;  2ZM8 A;  1FIL A;  5FEG A;  1D1J A;  2J3W A;  3UE0 A;  1LL8 A;  3W8K A;  4LGW A;  3UE6 A;  3BFF A;  3UME A;  3KYQ A;  4JPM A;  3ZVT A;  2XRN A;  1XA7 A;  3E98 A;  5FAT A;  3GEC A;  3N4I A;  2GZA A;  3V67 A;  4BLM A;  1QME A;  2J7V A;  4QPR A;  1DY6 A;  3IT9 A;  4I38 A;  3ZNT A;  4UQI S;  1KDS A;  3IF6 B;  4DJ3 A;  4HH3 A;  4P6Z M;  1PIO A;  3OZH A;  4HJ3 A;  4ZBE A;  2V9A A;  4GHI A;  3IHB A;  3IH9 A;  3BEB A;  4U0T A;  2ZQD A;  5J4E A;  1VET A;  3N6I A;  3HUN A;  5HDS A;  3R7W B;  4S2P A;  2KOI A;  5DFX A;  2O0Y A;  4DDY A;  2VV6 A;  1ERO A;  1UWP X;  2PBD P;  4KZ8 A;  1TVF A;  3UNW A;  3FKW A;  5FQ9 A;  3LUQ A;  4YFM A;  2WYX A;  3SS4 A;  4BJP A;  1CJF A;  2UV0 E;  4PM9 A;  1CEG A;  3C7U A;  5G18 A;  3PBQ A;  4PMA A;  1YQS A;  3LI9 A;  2ZQ9 A;  1K56 A;  1CF0 A;  4ME4 A;  4I5S A;  2HGV A;  1LL9 A;  2GJ3 A;  3GQZ A;  1PI5 A;  3T4J A;  4OPR A;  1FOF A;  2M7U A;  2IWB A;  3ZNY A;  1J3W A;  1XJ3 A;  4UA7 A;  5DTS A;  3WRZ A;  2WKQ A;  3SS5 A;  1PZO A;  4BQM A;  1OTD A;  3A0S A;  4MMN A;  4LFU A;  2HP5 A;  1YSP A;  2X71 A;  1LLB A;  1BSG A;  3CPT A;  5D3O A;  4DDS A;  3F1N B;  1L0F A;  3FPV A;  1GSX A;  1Y4O A;  4KZ5 A;  3P01 A;  4HBU A;  4ID4 A;  4GNU A;  4OQG A;  3C8C A;  3A0R A;  1XJ2 A;  3PBR A;  1G28 A;  1H3Q A;  1KDW A;  4QD4 A;  5K5B A;  3NEC A;  4GJ4 A;  5FQJ A;  4A5R A;  3VP4 A;  4EBP A;  1XKZ A;  1NZO A;  4HEF A;  1ACF A;  5E2H A;  4R1G A;  1N9O A;  2K2N A;  2V1B A;  1F98 A;  3B3X A;  4KG2 A;  5M18 A;  3F1O A;  4IVK A;  4HP9 A;  3Q7V B;  2INW A;  4DXB A;  2PHY A;  4ZDX A;  1OTA A;  2QMI A;  3IWI A;  3HLB A;  3BFD A;  4XUX A;  3G2Y A;  2Z6D A;  4NG2 A;  2XRO A;  5EM0 A;  4O7D A;  3ZG7 B;  5EV0 A;  1K4F A;  3ZG8 B;  4Q8I A;  1NRF A;  4IUH A;  1EW0 A;  5HAP A;  5DVA A;  3VSK A;  4EV4 A;  5A90 A;  1UGU A;  4GB7 A;  3HUO A;  2WKE A;  5DKK A;  3RXX A;  3GR2 A;  2OAP 1;  2IA2 A;  3C7V A;  3MBZ A;  3EOI A;  2H0Y A;  1I2W A;  4KZ4 A;  1H8Y A;  1XPB A;  3CAX A;  4HJ6 A;  1FCO A;  1SDE A;  3P09 A;  2R9X A;  2KX6 A;  4B88 A;  4B4Z A;  1S6R A;  3L9K A;  1S1Z A;  4ARZ B;  3HLE A;  5CEC A;  4MN5 A;  2W3D A;  1N4O A;  1STZ A;  2O99 A;  3NOP C;  2ZM2 A;  1XJ4 A;  3FYZ A;  2WAF A;  2Y2P A;  3IH8 A;  4JKT A;  3BW6 A;  2WAD A;  2PU2 A;  3HLF A;  1AWI A;  4MN6 A;  4OOL A;  3MKF A;  5IU1 A;  1JVJ A;  1GCE A;  1XXM A;  1GHI A;  1TS0 A;  4ETX A;  1ZTU A;  4U3T A;  4WZ5 A;  2VZW A;  4I3I A;  2FZ0 A;  4K91 A;  3EWK A;  3HUM A;  1IKG A;  3MQO A;  2XK1 A;  3M2K A;  2PDR A;  3QNB A;  1K4E A;  1W63 Q;  2HDU A;  2OWH A;  1LSV A;  1A0K A;  2EX9 A;  2R78 A;  3ZHH A;  4PPR A;  4LRX C;  3S22 A;  4LPZ A;  3IWO A;  1ESI A;  2ZD8 A;  4WZ5 C;  1F2K A;  2Y79 A;  3PBT A;  2XQZ A;  2EX2 A;  3NIA A;  1BUE A;  4OPZ A;  3D72 A;  1OT6 A;  3T1X A;  2Y91 A;  2ZMA A;  1O07 A;  2ZL1 A;  3G31 A;  3IF5 A;  3S7P A;  4B9O A;  3D3O A;  4HNB A;  2A24 B;  3ISG A;  3QNC A;  4Q0J A;  3PBN A;  1MY8 A;  2WGV A;  5E2G A;  1GA9 A;  4DN0 A;  1WYC A;  1IYS A;  3QP2 A;  4IED A;  2J8Y A;  4WN5 A;  2ZC5 B;  1DP6 A;  2UWX A;  2ZLY A;  4F3L B;  4PM6 A;  1LL5 A;  2V2F F;  4KQR A;  5TBM A;  4YIN A;  2HP6 A;  5M19 A;  4CLC D;  1BT5 A;  5DF9 A;  1YKD A;  3NCK A;  4EBL A;  3SOI A;  3VSL A;  1X0O A;  2OWJ A;  5HX9 A;  4NKP A;  3HLW A;  2B02 A;  1NWZ A;  2VKS A;  2PD7 A;  4OLG A;  4G3V A;  4R38 A;  4B93 A;  1BLP A;  2M7V A;  3AGE A;  2HV1 A;  5CHJ A;  3SW1 A;  3GVB A;  1OME A;  3UDF A;  3S7N A;  2DCF A;  1FCM A;  2VV8 A;  3U4L P;  4OLD A;  4C75 A;  1K6R A;  5GLC A;  3HLD A;  3C5A A;  4LV3 A;  4FOF A;  2XEP A;  4X68 A;  3S7Q A;  2ZC6 B;  3NC8 A;  1YLT A;  3S1Y A;  4RX3 A;  1NLZ A;  2XD5 A;  4N92 A;  1DP9 A;  5FI2 A;  1CI9 A;  3JYI A;  3P98 A;  1M40 A;  2HJE A;  4I39 A;  5GHZ A;  5DF8 A;  4YNR A;  3O87 A;  3CHW P;  4Y13 A;  4X1L A;  3BFC A;  3A3J A;  1W63 M;  3MZE A;  4FTX A;  2JKT M;  1XFQ A;  3O3V A;  3FPW A;  4LEN A;  3N8R A;  2ACG A;  4KZA A;  1P9W A;  2ZC3 B;  3E4O A;  3W4Q A;  2LB9 A;  4MCW A;  4KQO A;  2VA0 A;  5G4Z A;  2HF6 A;  4HIA A;  3PAE A;  4MBF A;  4ZJ1 A;  2ZC4 B;  3OOV A;  4GHI B;  4E6W A;  2WAE A;  3IX3 A;  3T4K A;  2B18 A;  4S2O A;  3WS5 A;  3R4K A;  1VET B;  5FSR A;  3F1P A;  4DRT A;  4MN7 A;  1KGF A;  2D01 A;  1H8M A;  1BYW A;  2DNS A;  3HJI A;  3UPN A;  1KE4 A;  1Q2P A;  2JKR M;  4HES A;  4M3K A;  2J3T D;  3WWX A;  4OPQ A;  1IKI A;  1IYO A;  2HDR A;  1N9N A;  3VP1 A;  5DTT A;  4EET B;  2WZX A;  2WGI A;  3TJZ C;  4DE1 A;  1TS8 A;  3I7J A;  3B33 A;  5E2F A;  3IXB A;  3OPL A;  2XDM A;  4EUZ A;  4QB8 A;  4II7 A;  3D4F A;  4XXR A;  4L9G A;  3M6B A;  4N9L A;  5EVI D;  4GD8 A;  3W2Z A;  4QY6 A;  4FCF A;  4Z1W A;  4CQH A;  4UEY A;  1OTI A;  3VOL A;  2WK0 A;  2I72 A;  1T1C A;  1K25 A;  1ZC2 A;  3CZD A;  3IS2 A;  2WKI A;  5CER A;  5HL1 A;  1NJ4 A;  3BY8 A;  4LCM A;  3CPT B;  5HAR A;  3BM6 A;  5CGS A;  3BLM A;  1DJA A;  2K31 A;  1SKO A;  3A3F A;  4KEN B;  4JXW A;  4IUK A;  4BBV A;  3VOY A;  5EPH A;  3O5Y A;  3E0Y A;  3EGD C;  1HZO A;  2V1A A;  2G2W A;  4P6B A;  3F1O B;  5AVE A;  4GS9 B;  1XGJ A;  3BLS A;  4GN2 A;  4DMZ A;  3T4O A;  1IEL A;  5FDS A;  4DE3 A;  5KZH A;  3GDI A;  2NUT C;  2ZM0 A;  4EER A;  3HLC A;  4HOI A;  3OLO A;  3OPH A;  1OT9 A;  4BEN A;  2J9P A;  2V0W A;  4G3W A;  2VLG A;  1XJ6 A;  3KYE A;  4BWI A;  1YPR A;  1BLC A;  4C3Q A;  2ZBB A;  5CGX A;  1K0K A;  2D02 A;  4NET A;  3VMA A;  1EI5 A;  4RQ9 A;  4ZJ3 A;  1HTZ A;  4Q0I A;  2Y4A A;  5CTM A;  2EA9 A;  5MC7 A;  3V3S A;  5F6A A;  1DRM A;  4XT2 A;  5EE8 A;  3LO7 A;  5FL3 A;  2ZOI A;  3K3D A;  4GDN A;  4E3I A;  3CWF A;  4GLQ A;  2VX8 A;  2VGJ A;  1BLS A;  1W7F A;  4BL3 A;  1OPX A;  3T4S A;  1ODV A;  2L4R A;  2XFS A;  3WS0 A;  5LBR A;  2FFY A;  5CHU A;  1Y28 A;  3BY9 A;  4OPY A;  3OBF A;  5CX7 A;  4WUJ A;  1JTG A;  3DTE A;  1TD5 A;  4JF5 A;  2FH5 A;  3LIC A;  4YOF A;  5DF7 A;  2E8J A;  3BQ8 A;  4HBT A;  3U2A A;  5J7E A;  4EUV A;  4WZ4 A;  2PYP A;  1LI9 A;  3Q07 A;  2XA7 M;  4EXO A;  3MZD A;  4KZ3 A;  5FAO A;  2O9A A;  5TJJ A;  1OTE A;  2QPN A;  4E3M A;  5CED A;  4GCZ A;  3G35 A;  3T4T A;  3ICY A;  1WA9 A;  4GW9 A;  1DJB A;  1P9R A;  1FCN A;  1VB6 A;  3RH8 B;  5CHM A;  5FQK A;  1BLH A;  2EWW A;  4HQA A;  2O9C A;  1K38 A;  1FIK A;  1N9L A;  2H5S A;  3SH8 A;  3K3C A;  1F5M A;  1JWZ A;  3CI6 A;  4OKP A;  3NBL A;  3TRC A;  2R9W A;  4OON A;  5L09 A;  1NYY A;  3UE1 A;  1T19 A;  4QWO A;  5EVL A;  5A91 A;  3HJK A;  1ZKJ A;  3WRT A;  1E25 A;  1PWD A;  1SZV A;  4LRZ E;  3LY4 A;  2OOL A;  1PZP A;  1PFL A;  2OLU A;  2DMW A;  2ZC7 A;  2W1R A;  2Y2G A;  3UB8 A;  1IFQ A;  1ES4 A;  1T18 A;  3CJM A;  3G4P A;  4EU0 A;  3KSH A;  3CUE A;  1OJG A;  2ZL1 B;  5DFY A;  3LR0 A;  1TDG A;  3MQ0 A;  2MJ6 A;  3C4P A;  3NHQ A;  5AQ7 A;  2PD8 A;  2VV7 A;  3DTM A;  4KG5 A;  4ETZ A;  2J9O A;  4KUK A;  1KVM A;  4JBF A;  4R3J A;  1K54 A;  4Y17 A;  4WMC D;  2QKP A;  5F68 A;  4Y0T A;  2VK3 A;  1NZU A;  2GNX A;  4PM8 A;  3VOZ A;  3E4P A;  4Y7P A;  3O86 A;  3CUE C;  2OV5 A;  5HPI A;  4Y15 A;  3ZCZ A;  1M6K A;  1MPL A;  5GL9 A;  5HZH A;  5TBM B;  1KOU A;  3KSG A;  1AXB A;  3QP8 A;  2JKT I;  3V3R A;  1TEM A;  2W1T A;  1JWV A;  3KSI A;  4BBU A;  3FWL A;  3MS6 A;  3BFE A;  5EUA A;  1MC0 A;  4WF0 A;  1GSV A;  1I5Q A;  4KZB A;  2I9V A;  3MXQ A;  4N9K A;  2A3U A;  2V20 A;  3MSH A;  3QHY A;  1ERQ A;  1LI0 A;  4CLC A;  3IBJ A;  4KZ6 A;  3H82 A;  2V1Z A;  1W5D A;  1EWZ A;  3ZDJ A;  5FEF A;  1I2S A;  1W79 A;  4OQH A;  2Y2Q A;  3QP5 A;  4QY5 A;  2JN7 A;  4EQ1 A;  4BBT A;  4KQD A;  3KYZ A;  1MXO A;  3PHY A;  2ZOH A;  1MWU A;  4R4R A;  3A3I A;  2ZJ9 A;  3LYX A;  4B4X A;  3LIA A;  2Y2I A;  5HDC A;  2C5W B;  3AGD A;  4GKU A;  2JKR I;  5EM1 A;  1NXY A;  3Q7V A;  1WYB A;  4CLC C;  3NI9 A;  4BMW A;  1KGG A;  4D60 A;  1VEU A;  3G30 A;  2P9V A;  2E8I A;  3S4X A;  2W3F A;  3OPP A;  1XX2 A;  3PBO A;  5E43 A;  3UN7 A;  4OOM A;  4OQ0 A;  1TF1 A;  5I5L A;  4RX2 A;  4P85 A;  3DWZ A;  3E2K A;  1L0D A;  4G3K A;  3VFH A;  2H28 A;  4X69 A;  2ZQA A;  2G2U A;  5AQB A;  3EQV A;  5EEC A;  1ALQ A;  3RXW A;  4NK3 A;  4HHD A;  4X55 A;  1YLJ A;  2W3E A;  5GLA A;  3LIB A;  3UO9 A;  3A0V A;  3KX0 X;  3LFV A;  2PT7 A;  4HP4 A;  3MFD A;  4AFI A;  1YAX A;  3M6H A;  2O9B A;  3UB5 P;  4LRY C;  4MNR A;  1C3B A;  3DBA A;  3FV7 A;  5A8B A;  1BZA A;  2JHE A;  4JGO A;  3JVU A;  3MF0 A;  1T1B A;  1GSW A;  4NXE A;  5F1G A;  2HJ9 C;  4Q0H A;  4ESP A;  5FI6 A;  2BTF P;  5HL6 A;  3GMW A;  2WZZ A;  2XH9 A;  1ZG6 A;  4E3N A;  3T4Q A;  1IYP A;  2Y55 A;  3ZG5 A;  4JF4 A;  5F5Y A;  4K08 A;  4E3K A;  4JF6 A;  5HWW A;  2Y2H A;  3IXD A;  2KDK A;  4R23 A;  1ES2 A;  4S2L A;  4E3O A;  3Q82 A;  1YMX A;  5CRF A;  4WYY A;  4LV0 A;  3DAV A;  4R4S A;  1S4R A;  1H8Z A;  1W8Q A;  3UB7 A;  3SS3 A;  4WLA A;  5IT5 A;  3DTK A;  4K0W A;  5TFQ A;  2W0N A;  1ESU A;  4EBN A;  3IS2 B;  2XA7 S;  3DW0 A;  1MWT A;  4ZRR A;  1XGI A;  2QJ5 A;  3UPO A; 
#chains in the Genus database with same CATH homology
 3NOU C;  4IUK A;  4BBV A;  1N9O A;  2J3T C;  2K2N A;  2V1B A;  1F98 A;  5HSQ A;  3F1O A;  3O5Y A;  3E0Y A;  1D06 A;  4HP9 A;  3ZYT A;  3LI8 A;  5F69 A;  2INW A;  1NLY A;  4WL9 A;  5DJU A;  2PHY A;  5HDD A;  3UE3 A;  3EGD C;  1YSQ A;  1OTA A;  4H6J A;  4Y3I A;  2V1A A;  3T4L A;  3PBS A;  3TW8 A;  3EEA A;  3F1O B;  3PXP A;  5AVE A;  4GS9 B;  2Z6D A;  3LR5 A;  1V9Z A;  4DMZ A;  3T4O A;  2XRO A;  2BAS A;  4L9E A;  2Z6C A;  3GDI A;  2NUT C;  4EER A;  1LSW A;  4H6J B;  4HOI A;  3OLO A;  3MJQ A;  4IUH A;  1EW0 A;  1OT9 A;  1F9I A;  1S4S A;  2P08 A;  2V0W A;  1UGU A;  4G3W A;  3LIF A;  3NOT C;  3C2W A;  5DKK A;  2VLG A;  1XJ6 A;  4BWI A;  2LB5 A;  2OAP 1;  2IA2 A;  2ZBB A;  2Y8H A;  2L0W A;  2D02 A;  3EOI A;  3VV4 A;  2QJ7 A;  4RQ9 A;  4Q0I A;  1IOU A;  1MZU A;  4P6Z S;  2EA9 A;  3F1P B;  5MC7 A;  3CAX A;  3RTY A;  4HJ6 A;  5F6A A;  1DRM A;  4XT2 A;  4ARZ A;  4WEK A;  5DKL A;  1ZHH B;  2KX6 A;  5FL3 A;  2ZOI A;  3K3D A;  3CWF A;  4GLQ A;  4EES A;  2VX8 A;  5KSH A;  2P7J A;  2K7S A;  4PKY G;  1S1Z A;  1MKM A;  1OPX A;  4XT2 B;  3UB9 A;  3T4S A;  1ODV A;  2L4R A;  3E4Q A;  4ARZ B;  5LBR A;  4MN5 A;  2W3D A;  1Y28 A;  1STZ A;  2O99 A;  3BY9 A;  3G6O A;  3OBF A;  3NOP C;  5CX7 A;  1XJ4 A;  4WUJ A;  2M1C A;  1TD5 A;  3BW6 A;  2FH5 A;  3LIC A;  4YOF A;  5C5K A;  3IBR A;  3BQ8 A;  3U2A A;  5J7E A;  2WKP A;  3BJN A;  4EUV A;  4IHQ A;  5G4Y A;  2PYP A;  4E04 A;  4HI4 A;  4MN6 A;  3OCL A;  2XA7 M;  4OOL A;  5AJG A;  4EXO A;  5HPF A;  5IU1 A;  4EEU A;  3ULF A;  1TS0 A;  2O9A A;  3JVV A;  5TJJ A;  4ETX A;  1P0Z A;  1P97 A;  1OTE A;  1ZTU A;  2W3G A;  2VZW A;  5EFW A;  2VGL S;  4GCZ A;  4I3I A;  3T4T A;  3ICY A;  2FZ0 A;  1WA9 A;  5HWV A;  4GW9 A;  1P9R A;  1VB6 A;  3EWK A;  3MQO A;  3RH8 B;  2PDR A;  1W63 Q;  2EWW A;  4IJG A;  4HQA A;  2O9C A;  2OWH A;  1LSV A;  1N9L A;  3K3C A;  1F5M A;  4I3J A;  3CI6 A;  2R78 A;  4HH2 A;  4LRX C;  3TRC A;  4LPZ A;  3T50 A;  1T1A A;  2ZMF A;  1G6O A;  2Y79 A;  3PBT A;  4HJ4 A;  1T19 A;  3KSF A;  2QHK A;  1S67 L;  4PKY A;  3HJK A;  4O0P A;  3BQA A;  3D72 A;  1OT6 A;  3EEH A;  3LR4 A;  4NEE D;  4PHT A;  4L0L A;  3MMH A;  4CLC E;  4LRZ E;  4L9F A;  2A24 A;  2OOL A;  3MQQ A;  2DMW A;  2VJW A;  2W3H A;  2W1R A;  3UB8 A;  1IFQ A;  1T18 A;  1D7E A;  4EU0 A;  3S7P A;  3KSH A;  3H7W A;  4B9O A;  3D3O A;  4HNB A;  2A24 B;  3CUE A;  1OJG A;  5DFY A;  3KO6 A;  3LR0 A;  4NXG A;  3ZQ5 A;  4Q0J A;  3MQ0 A;  3MFX A;  3PBN A;  1TS7 A;  2L1M A;  2MJ6 A;  4F3L A;  3NHQ A;  2PD8 A;  4DN0 A;  2VV7 A;  3H7W B;  2P04 A;  4ETZ A;  4KUK A;  4Y5F A;  2OAQ 1;  4WN5 A;  1DP6 A;  2QKP A;  5F68 A;  4F3L B;  5HD5 A;  3TE8 A;  4WEJ A;  5TBM A;  2GNX A;  1V9Y A;  4CLC D;  3E4P A;  3CIT A;  3CUE C;  5HPI A;  3B42 A;  5DF9 A;  1YKD A;  3HCY A;  1NRJ A;  3PYP A;  5AVF A;  3UMD A;  1X0O A;  2OWJ A;  4WEL A;  4R6L A;  5HZH A;  2PR5 A;  4KUO A;  4MDZ A;  5TBM B;  1KOU A;  3KSG A;  4NKP A;  2JKT I;  2B02 A;  3NJA A;  1NWZ A;  2VKS A;  2PD7 A;  4I3A A;  4LLO B;  4G3V A;  4R38 A;  4B93 A;  1LT0 A;  3MR0 A;  1OTB A;  2M7V A;  2W1T A;  3KSI A;  2HV1 A;  3SW1 A;  4NXF A;  4BBU A;  3C38 A;  3FC7 A;  4NXB A;  3S7N A;  5DJT A;  2VV8 A;  1MC0 A;  4WF0 A;  1GSV A;  4EEP A;  2I9V A;  3MXQ A;  4DJ2 A;  2W1T B;  4FOF A;  2YKF A;  3K2N A;  3FG8 A;  5HD3 A;  3S7O A;  5L8M A;  3S7Q A;  3UB6 A;  2J80 A;  4CLC A;  3IBJ A;  3H82 A;  4FSF A;  2ZMV A;  3LID A;  4O8G A;  2QYB A;  3EQU A;  2WKR A;  2JN7 A;  1NLZ A;  4EQ1 A;  4BBT A;  1DP9 A;  2J3W A;  1LL8 A;  3OCN A;  4KQD A;  4CLC B;  2V0U A;  3H82 B;  3KYZ A;  3PHY A;  4M4X A;  3UE6 A;  3UME A;  2ZOH A;  2HJE A;  3KYQ A;  4I39 A;  3LYX A;  2XRN A;  3LIA A;  5HDC A;  2JKR I;  2GX5 A;  3E98 A;  4YNR A;  4CLC C;  4BMW A;  3GEC A;  2GZA A;  2VEA A;  2W27 A;  1W63 M;  3V67 A;  2JKT M;  1TS6 A;  2W3F A;  3EGX C;  1XFQ A;  4QPR A;  3PBO A;  4GS9 A;  3FPW A;  4OOM A;  4I38 A;  1TF1 A;  5I5L A;  3LR3 A;  4UQI S;  2XSS A;  4DJ3 A;  1P9W A;  4Y2F A;  3R7W A;  4G3K A;  2PYR A;  2H28 A;  3E4O A;  4HH3 A;  4P6Z M;  3OC2 A;  2LB9 A;  3EQV A;  4HJ3 A;  4MCW A;  2V9A A;  4GHI A;  4JGR A;  4KQO A;  2VA0 A;  4HHD A;  5G4Z A;  2HF6 A;  3VE3 A;  3PR6 A;  5J4E A;  3B47 A;  4HIA A;  2W3E A;  5HDS A;  5HWT A;  3R7W B;  3OOV A;  3LIB A;  3RFB A;  3A0V A;  2KOI A;  3KX0 X;  5DFX A;  2O0Y A;  2VV6 A;  3LFV A;  5KIZ A;  2PT7 A;  4GHI B;  4HP4 A;  1UWP X;  3T4K A;  4AFI A;  2B18 A;  1YAX A;  3VE4 A;  2O9B A;  3R4K A;  4LRY C;  4HY8 A;  3H9W A;  1VHM A;  3F1P A;  3LUQ A;  4R3A A;  4EW7 A;  3DBA A;  5A8B A;  2A2L A;  2EWV A;  4BJP A;  2YKH A;  3P7N A;  4MN7 A;  2JHE A;  3LIE A;  3PBQ A;  2D01 A;  1H8M A;  1BYW A;  4JGO A;  3JVU A;  1OJ5 A;  3MF0 A;  3HJI A;  1T1B A;  3LI9 A;  1GSW A;  3BWL A;  2JKR M;  2NUP C;  3CLO A;  4NXE A;  2J3T D;  2PR6 A;  4ME4 A;  4I5S A;  2HJ9 C;  2HGV A;  4Q0H A;  4YWZ A;  2GJ3 A;  5HL6 A;  1N9N A;  1DP8 A;  4EET B;  1JNU A;  3T4J A;  2M7U A;  1XJ3 A;  4PAU A;  3TJZ C;  1UWN X;  3T4Q A;  2VGL M;  1TS8 A;  5F5Y A;  4O01 A;  4K08 A;  5J3W A;  3B33 A;  2CMN A;  1S66 L;  2WKQ A;  4II7 A;  2QWS A;  5HWW A;  3F1N A;  1OTD A;  2G7U A;  3A0S A;  4MMN A;  2KDK A;  4L9G A;  1S1Y A;  3W2Z A;  1YSP A;  4JGQ A;  4Z1W A;  3C30 A;  4CQH A;  4UEY A;  1OTI A;  3VOL A;  3F1N B;  3FPV A;  1GSX A;  1T1C A;  3P01 A;  4JGP A;  3IS2 A;  2KLI A;  3C8C A;  5IS1 A;  1LSX A;  1S4R A;  3A0R A;  3BY8 A;  3UB7 A;  1XJ2 A;  4WLA A;  3PBR A;  5IT5 A;  1G28 A;  1H3Q A;  2W0N A;  5K5B A;  4GJ4 A;  2K31 A;  3IS2 B;  2XA7 S;  4UQI M;  4ZRR A;  2QJ5 A;  1XFN A;  4R70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...