4JGQA

The crystal structure of sporulation kinase d mutant sensor domain, r131a, from bacillus subtilis subsp in co-crystallization with pyruvate
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
203
structure length
203
Chain Sequence
KDTIAAEHKQEASVLLNLHRNKINYLIGETMARMTSLSIAIDRPVDIKKMQSILEKTFDSEPRFSGLYFLNAKGDVTASTTELKTKVNLADASFFIKAKETKKTVISDSYSSRITGQPIFTICVPVLDSKRNVTDYLVAAIQIDYLKNLINLLSPDVYIEVVNQDGKMIFASGQASHAEDQKPVSGYLDDISWNMKVYPNPVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insight into the sporulation phosphorelay: Crystal structure of the sensor domain of Bacillus subtilis histidine kinase, KinD.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Transferase
molecule keywords Sporulation kinase D
total genus 54
structure length 203
sequence length 203
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4jgqA02
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4jgqA01
3LIAA 4H6JB 1D06A 3OLOA 5AVEA 3T50A 2D01A 5HSQA 3KX0X 5DJUA 1OTIA 3UB8A 1S1ZA 1KOUA 1S67L 4EETB 3MFXA 4HP4A 4GHIA 3B33A 5J3WA 1OJGA 2K7SA 4JGOA 3CLOA 2V0UA 4HIAA 4R70A 4R3AA 2V0WA 2KX6A 4NXBA 1UWNX 3EWKA 2PD7A 4L9FA 1TS6A 4KUOA 3UB6A 1S4RA 2QKPA 1OT6A 1T19A 2D02A 3LIBA 1P97A 1F98A 4LRXC 2L0WA 2PHYA 3C2WA 1GSXA 4GS9B 1S1YA 2INWA 3CWFA 3P7NA 3F1OA 4PKYA 3H7WA 4L9EA 1XJ3A 3ICYA 3MR0A 4HJ3A 1P0ZA 4R6LA 3LI9A 3LUQA 3MQOA 4JGPA 4HOIA 4RQ9A 4HH2A 3H82A 4EEPA 2V1AA 3IS2B 3MQQA 2QWSA 3VOLA 5I5LA 1Y28A 3NOUC 1LSVA 2JN7A 2BASA 5KIZA 4EERA 3PYPA 5J4EA 5F68A 3VE3A 1DRMA 2H28A 4HQAA 4HH3A 2ZBBA 5DJTA 4F3LB 1EW0A 4EESA 1T1CA 2VV6A 2OWHA 1N9NA 3BY9A 3NJAA 1DP8A 2QHKA 4HJ6A 1ODVA 2PYPA 5F69A 3A0RA 3F1NA 3LI8A 4PKYG 1OTAA 5HZHA 1VB6A 1XJ2A 4GS9A 4LLOB 5AVFA 4DJ2A 3F1PB 1TS7A 4XT2A 1S66L 3HJIA 1NWZA 2B02A 2ZOHA 3E4PA 5HD5A 3LYXA 1LSWA 4BBVA 1OT9A 4NXEA 4WL9A 3RH8B 1TS0A 4HI4A 3FG8A 4NXGA 1T1AA 4MN6A 5HWVA 1XJ6A 2VLGA 2Z6CA 3BWLA 4L9GA 3PHYA 1S4SA 5F5YA 4GCZA 2WKRA 1OTBA 2CMNA 4MN5A 5HDSA 3SW1A 2HV1A 2L4RA 4H6JA 4HHDA 5G4ZA 2GJ3A 1BYWA 2PR6A 5A8BA 3IBRA 4BBUA 1LT0A 2KDKA 1OTDA 5TBMB 3UMEA 2VEAA 3CAXA 4HNBA 4I39A 3ZQ5A 5DKKA 1V9YA 5HD3A 2PD8A 4WLAA 3E4QA 3GDIA 2WKQA 4XT2B 4JGRA 4LRZE 5TBMA 3C8CA 5J7EA 4K08A 1DP9A 4KUKA 3LICA 1XFNA 2A24B 2OWJA 2P7JA 3K3CA 4NXFA 4EQ1A 4F3LA 4I3IA 3NOTC 3FC7A 1DP6A 4HY8A 4WF0A 1JNUA 5HDDA 3BY8A 1N9OA 5EFWA 3RTYA 2EA9A 2A24A 3GECA 3IS2A 2ZOIA 3G6OA 1G28A 1GSVA 4JGQA 3H82B 4BBTA 3F1PA 1OJ5A 1X0OA 4R38A 2I9VA 5G4YA 3F1OB 1V9ZA 2PR5A 3K3DA 3H7WB 4HP9A 3UMDA 2R78A 3EEHA 4M4XA 3A0SA 5IU1A 2OOLA 1UGUA 1XFQA 2M1CA 2Z6DA 1N9LA 3MJQA 4LPZA 2YKHA 1XJ4A 2JHEA 3H9WA 3HJKA 3E4OA 3UB9A 3LIDA 4YWZA 1GSWA 2W0NA 4KQDA 2PYRA 1WA9A 2QJ5A 1TS8A 5F6AA 3UE6A 4EEUA 5DKLA 4EXOA 5HWWA 1T18A 1LSXA 1LL8A 3A0VA 4WUJA 3LIFA 2L1MA 3D72A 5HWTA 2V9AA 4HJ4A 4I38A 4GW9A 1F9IA 2YKFA 4GHIB 5HDCA 4B9OA 1MZUA 4E04A 4EW7A 2W27A 3LIEA 3UB7A 2J80A 2PDRA 1T1BA 4I3AA 4I3JA 3NHQA 3F1NB 3VE4A 2WKPA 2QJ7A 5IS1A 4LRYC 3MXQA 2VV7A 2V1BA 4I5SA 1OTEA 4WN5A 3ULFA 4DJ3A 2VV8A 3NOPC 1D7EA 1UWPX
chains in the Genus database with same CATH superfamily
3LIAA 1YM1A 3FYZA 1S1ZA 4R4SA 4Q0IA 2RL3A 4ZJ3A 3O88A 2K7SA 3KYEA 3C4OA 1OT6A 4JKTA 1OMEA 5KMWA 5K5BA 2PHYA 4BLMA 4PKYA 4D2OA 4GN2A 5I5LA 4Y15A 1L0EA 2W1TA 2EX8A 1IKIA 1N9NA 4LCLA 5TJJA 3P01A 3IWOA 3TOIA 4DRTA 1H8MA 5CHMA 3M2KA 5AQBA 3BRMA 3Q07A 3BJNA 4O0PA 4HI4A 3S7QA 5M18A 2PBYA 1S4SA 4GCZA 2A3UA 2WADA 3MZFA 2O9BA 4DN0A 2LB5A 2VEAA 3WS4A 1PW8A 1V9YA 1L0FA 3T1QB 3BFCA 2ZL1B 1HVBA 1H8ZA 1XGIA 3FPVA 3T4QA 3E2KA 4UHUA 4S2NC 3H82B 3DTKA 1ZKJA 1XGJA 2YKHA 4ME4A 3UO9A 1W79A 4EXOA 3G32A 3A0VA 4F94A 5EPHA 1TEMA 4I3JA 2OAQ1 1OTEA 3A3FA 3HLBA 1HTZA 2PT7A 4KZ7A 3KX0X 2V8CA 2J8YA 1H5XA 3NCKA 5F1GA 4GKUA 1CI9A 3OOVA 4MBHA 5EOOA 2P9VA 1YLWA 5IHVA 4EU0A 2EX6A 2ZQ9A 2VGLM 3VP4A 5EV0A 3M6HA 3VSKA 2OV5A 3ZG8B 2HDQA 3ICYA 4IEDA 2JKGA 2HDUA 4EEPA 3VP1A 4E3MA 4HBUA 4Y0OA 5GHXA 4EERA 1ZHHB 2EWVA 3RJUA 1ACFA 1W7FA 1ZG6A 3NI9A 3V39A 3NY4A 3IQAA 3MZDA 3T4JA 3UE3A 2B02A 3UDFA 3C38A 1OT9A 3R7WB 5GL9A 4RVAA 1W8QA 4JBFA 3G35A 2ZQCA 1W5DA 4H6JA 1E3UA 3CAXA 1YT4A 1O07A 5HD3A 1IYOA 5FQMA 1LI0A 3ZG9B 3TW8A 3PBSA 4WF0A 1M40A 4S2PA 4UQIM 3S7OA 3RTYA 2BG1A 4LCMA 2P04A 4OPQA 4KG2A 2DCFA 4B4ZA 4Q8IA 1FCMA 4KZ6A 3V50A 2VZWA 3HLWA 2B5RA 2W1TB 5HWTA 1VEUB 5J8XA 1MZUA 2Y2PA 4WZ5C 1S0WA 4HHDA 1GA9A 3RXXA 1KOUA 1NYMA 4IVIA 3MFXA 3CPTA 3Q7VB 1PFLA 4G3KA 4X53A 2ZM0A 4FH4A 3QP1A 4DDYA 3C2WA 1GSXA 4ZBEA 2H0YA 4FOFA 4HJ3A 2IWBA 4IJGA 1XP4A 2V1AA 5GHZA 4DE1A 2JE5A 3IF5A 3VE3A 4HH3A 3Q82A 1PYYA 3BY9A 4DKIA 1ODVA 4B93A 3LI8A 4ZJ2A 5HW3A 3JVVA 3SH9A 5HZHA 3WS5A 2HDSA 1YKDA 1TS7A 5FDHA 3BYDA 4ESPA 2OLVA 4L9GA 3Q81A 4DF6A 3WWXA 2AVXA 4OOYA 5FA7A 2H0TA 2PR6A 1ZG4A 1TD5A 2PD8A 4ZTKA 5HL1A 4LRZE 4K08A 5EVIA 3ZDJA 4WMCD 1YLZA 3NOTC 3FC7A 1BZAA 2Y79A 1K56D 4X69A 4N9LA 3EGXC 1J9MA 2HF6A 1STZA 4S2LA 3CJMA 3FWLA 4DXBA 3IF6B 2V8FA 4XUZA 1PRQA 2QJ5A 5IT5A 1LL8A 1SHVA 1WE4A 4FSFA 3BFDA 2FZ0A 2I72A 3MKFA 3ULFA 3NOPC 5A8BA 3O86A 3UB8A 4UA6A 2ZD8A 4HESA 1VEUA 5A91A 3B3XA 1MKIA 5FQIA 3ZYTA 4L9FA 2XRNA 4Y13A 3O5YA 1JWZA 2KLIA 4Q0JA 2BLSA 3G2YA 3HLGA 4N1HA 4S2KA 4KZ9A 5HL6A 4RX3A 1GHPA 4RQ9A 2QWSA 3VOLA 2O0YA 2PBDP 4S2MA 3GSGA 2M7VA 5KZHA 4QHCA 1EW0A 1YMSA 4Y2FA 1E25A 3V3RA 3KYQA 2W3DA 1YSQA 3WRZA 2G2UA 4MN6A 4BL2A 3R7WA 5F5YA 4CLCA 4R23A 2HV1A 1Q2PA 2OSUA 4FH2A 1WYCA 1OTDA 3ZNYA 2OAP1 2JKTM 1PIOA 4ZAMA 2ZJ9A 5J7EA 3IHBA 2OWJA 4EQ1A 2W3HA 3QNBA 3HUNA 5AQAA 4JXSA 4S2JA 3TE8A 2VGJA 3A3IA 3WS1A 4UQIS 2C6WB 2OOLA 1XFQA 2XLNA 1N9LA 2PYRA 3O87A 1AWIA 4PM5A 3B42A 5U47A 3U2AA 4JPMA 2JBFA 2J7VA 3T1XA 4MLLA 4OQGA 3T4KA 3F1NB 2O9CA 4KQQA 1VQQA 3OLOA 2D01A 3VSLA 1QMFA 4ARZA 5TGFA 3NULA 3LR4A 1OJGA 5FAQA 5HAQA 4MBFA 4NXBA 1UWNX 2H5SA 1TS6A 3LGOA 2L0WA 3QP4A 5DVAA 3FPWA 3NIAA 3H82A 1FSWA 1FCOA 5FDSA 5FAOA 5FQ9A 1YLYA 2XSSA 4LV2A 4IHQA 1H8YA 3QP6A 1P9WA 2JKRI 1VB6A 4GS9A 4B88A 2X01A 1KDSA 1LI9A 3ZHHA 4JLFA 3BQAA 4CLCB 1JVJA 3ZFZA 4NXGA 3NBLA 2J3TC 4RX2A 4GD6A 5HDSA 5AJGA 3PBOA 3A3DA 3KSIA 2PU2A 1BYWA 4WZ5A 3E0YA 5EE8A 5CGWA 2HJEA 1XFNA 2P7JA 1Y54A 3K3CA 1IYPA 1NRJA 5FSRA 3BY8A 4PAUA 4KZ8A 3OZHA 2XGNA 4JF4A 1H3QA 5G18A 2R78A 3K2NA 2DNSA 5CECA 3LIDA 4NETA 1SKOB 1TS8A 5C5KA 2QMIA 5EUAA 3AGFA 5FI6A 4E04A 5DF7A 1W63Q 3QP8A 4ZRRA 1IKGA 3MMHA 3GRJA 3UN7A 4Y0TA 5EVEA 4GOGA 4XT2B 5D3OA 2ZQDA 2Y2MA 1L2SA 3CZDA 1MY8A 2OLUA 3IT9A 5M1AA 2V0WA 1BLHA 3GV9A 1S4RA 5AQ7A 3LIBA 3SS5A 5GLDA 1BSGA 4OH0A 3I7JA 1DY6A 1KE4A 4E3JA 4E6WA 4JGPA 4KZBA 3T4LA 3DW0A 2JN7A 1PNEA 1U60A 4KZ4A 2VV6A 2A49A 2WAEA 2ZMFA 3C30A 4RYEA 2ZQ7A 2WKIA 3Q7ZA 4QU3A 4YNRA 1YQSA 4QY5A 5E43A 1XJ6A 2VLGA 2Y8HA 3FKVA 1OTBA 2Y55A 1FQGA 2L4RA 2P08A 1IYSA 1K57C 5DFYA 2GDNA 2M7UA 3LEQA 4IBRA 3V5MA 3T1RA 5EM1A 2W1RA 4NXFA 1TF1A 1DP6A 3VP2A 1PW1A 1LL5A 2O99A 2JKRM 2A24A 1I2SA 2WKHA 2WZZA 4M4XA 1NZUA 3M6BA 2WGVA 3IX3A 3TRCA 4NKPA 3E4OA 3UB9A 2W0NA 3UE6A 2Y2KA 1YMXA 2L1MA 4K0XA 2B95A 3PAGA 3MXSA 3KSGA 1T1BA 3NHQA 5MC7A 2HZ5A 5IS1A 1KGEA 4I5SA 4DJ3A 2VV8A 5AVEA 4IVKA 2ZM8A 4JXGA 4EETB 3VMAA 5EVLA 2UWXA 4O01A 3OC2A 3CLOA 2V0UA 1E4DA 1K54A 4CPKA 2Q9NA 1NZOA 2PAVP 4GJ4A 4MCWA 1VM1A 4BMWA 2K31A 3IXGA 2Y2JA 3LI9A 5CERA 1JWVA 2Y2GA 1LSVA 1SDEA 3CUEC 3MFDA 2C5WB 2XROA 1ES5A 2H28A 5A93A 4E6XA 2ZC7A 3PBTA 1DP8A 1KE0A 5F69A 3VOZA 1CK3A 3G30A 5F1FA 3HL9A 4NXEA 3RH8B 1P9RA 3RFBA 4FTXA 2HPBA 3IBRA 1LT0A 1JWPA 5M19A 4MNRA 2XF3A 3E4QA 4JGRA 3SH7A 3LICA 2A24B 4I3IA 2Y2HA 1ONGA 4NEED 4OVDA 1DJBA 2Y91A 5I94A 5KSCA 4R38A 4DDSA 1K25A 3UMDA 3TG9A 2Z6DA 4FD8A 4OQIA 5FQKA 1N4OA 5F83A 5F6AA 3LIFA 2PU4A 4GW9A 1YLPA 5HAPA 1DJCA 2HDRA 2FH5A 3C4PA 1DJAA 1GHMA 4OLGA 2ZC4B 1K38A 3L9KA 3DTEA 4UA7A 1EROA 3T1SA 4CQHA 3A3JA 3NDGA 3UB6A 2RCXA 3G31A 1LLBA 4NG2A 1XXMA 4WMCA 3UY6A 2WK0A 3CUEA 3W4OA 4QPRA 2UV0E 1XX2A 4E3NA 2ZC3B 3T4OA 1FILA 4E3OA 5FASA 5CHUA 1Z6FA 3JYIA 1O7EA 4N1XA 3GR2A 1G68A 4WL9A 1ES2A 3S22A 5DTTA 3KSHA 4YOFA 5L09A 4X25A 2X71A 3C5AA 2HP6A 2V2FF 3IF6A 3SH8A 3CMZA 1SKFA 1DP9A 3D3OA 1GHIA 1MWSA 2HJ9C 2NUPC 3D9YA 5E2GA 1UGUA 4WEJA 3UE1A 3OPLA 4KQDA 4S2NA 3MZEA 4WUJA 5DFXA 3UPOA 3DBAA 1BUEA 4H8RA 2R9WA 4GB7A 3T4TA 3S7NA 3L7HA 1QMEA 4LV1A 5LBRA 3OPHA 4H6JB 1K57A 1L0GA 1S67L 4R4RA 5CHJA 4K0WA 5DF8A 3AGEA 5FATA 1YAXA 5E2HA 3B47A 3HVFA 4Q0HA 3IX4A 2WAFA 3HLDA 3PBQA 3MR0A 3LUQA 3UDXA 4HOIA 5CRFA 2Y2LA 3IS2B 1YPRA 2EX2A 4HQAA 3PTEA 4BD0A 1YLTA 4CLCE 2VA0A 3IX8A 1C3BA 3F1NA 3LFVA 4NK3A 1OTAA 2JC7A 1F2KA 3QP5A 4OPYA 3WS0A 3LR0A 1MBLA 2A2LA 5CX7A 4U3TA 4BBVA 1LSWA 1M6KA 3PHYA 4E3KA 4ZDXA 3ISGA 1KGGA 1FIKA 2Q0OA 3QP2A 4QWOA 4K91A 2GNXA 2HP5A 2ZMVA 1ZC2A 4S2IA 3FKWA 4HY8A 1KVLA 3T12B 2B18A 4WBGA 3RXWA 3N6IA 5G4YA 4MDZA 4YFMA 3BLSA 4KENB 1T18A 1W63M 4GLQA 3V67A 2JKTI 1F9IA 1K55C 3VE4A 3CHWP 3MBZA 3ITBA 4WN5A 1MC0A 3IBJA 5E2FA 4GDBA 1D06A 2QYBA 5BOHA 3BFGA 2XQZA 3S7PA 2ZMAA 1ES4A 3ZVWA 1KGFA 4BQMA 1CJFA 1P97A 1F98A 5JYPA 4LRXC 1MPLA 3HBRA 5AQ9A 4GS9B 1FR1A 3CWFA 4P6BA 1NJ4A 5J4EA 1MWUA 1MWTA 2ZQAA 2PYPA 1BLCA 2IA2A 4OQ0A 5EVID 4Y17A 1TS0A 5GLAA 2GX5A 3DWZA 2Z2LB 2R9XA 3IXBA 3VP3A 4HNBA 1LHYA 1MWRA 5DKKA 3HREA 3IH8A 4MEZA 3C8CA 3VP0A 2WYXA 3BECA 5HDDA 1ERMA 2XA7M 2KOIA 4OONA 2EX9A 4P85A 1G28A 4BBTA 3BLMA 2I9VA 4PM7A 2WGIA 5HAIA 4M3KA 4DMZA 5F82A 4OOLA 1K4FA 1KE3A 3A3EA 1IOUA 2ZL1A 3PAEA 4E3IA 5GHYA 4EEUA 5HWWA 2V20A 4G3WA 4HJ4A 3BEBA 4PMAA 2W27A 2W3GA 1FSYA 2PDRA 2WKPA 2QJ7A 2XA7S 2VV7A 2V1BA 2ACGA 2XDMA 4OLDA 5HFOA 1J3WA 2Y4AA 5A90A 2JCHA 3T4SA 4LV3A 4R70A 4MBKA 2WZXA 4L0LA 2KX6A 1I5QA 4KUOA 2QKPA 3GQZA 5EVIC 3IF6C 4YINA 3OBFA 4KQRA 3F1OA 1D1JA 3JPUA 2J9PA 2E8IA 2EWWA 3PYPA 3P09A 1OPXA 4X1MA 1CI8A 1FOFA 1NY0A 4F3LB 5EVIB 2OWHA 4OP8A 2QHKA 3A0RA 2G2WA 1RP5A 4EBLA 3UB5P 4N9KA 2W3EA 2ZOHA 2HGVA 3E4PA 4OPZA 1PWCA 5CTMA 4PHTA 3SZTA 3GMWA 3W4QA 2Y59A 4EBNA 4X56A 4WLAA 2Y2IA 3N8RA 5TBMA 2WKQA 2XFTA 1RGZA 4BL3A 1K0KA 5EM0A 1MKMA 4F3LA 1IFQA 2EA9A 1GSVA 1CQAA 3EQVA 3FZCA 5FAPA 3W4PA 1FCNA 3NDEA 2M1CA 5KIZA 4LPZA 3H9WA 2VJWA 4R3BA 3D72A 2YKFA 3CPTB 4ZJ1A 1PI4A 4ETXA 4B9OA 4EW7A 3LIEA 3UB7A 3S4XA 2J80A 1N9BA 4GNUA 1SDNA 3O3VA 1D7EA 4QJGA 5DJUA 1G6AA 5L07A 4X6TA 4CLCC 3CITA 3LR3A 4PM8A 5FEGA 4OKPA 4HP4A 4BD1A 4FCFA 3PBNA 2PD7A 2LB9A 4WELA 3ZGAB 5CXWA 3HCYA 3P7NA 5FQQA 2BTFP 2O9AA 2FFFB 2EFUA 4DE0A 1DRMA 5DJTA 3AGDA 4EQIA 4EBPA 4C75A 1BLSA 4GD8A 4LLOB 2EFXA 4O7DA 4Z1WA 1NWZA 3N7WA 4P6ZS 2VX8A 4Y0UA 3ZG7B 3FG8A 1BT5A 5GLCA 4CLCD 1PZOA 2KDKA 2XEPA 3UNWA 3GDIA 5DTSA 3CI6A 5TR7A 1A0KA 2J9OA 5E2EA 4O8GA 1ERQA 4BWIA 3GECA 1F5MA 4U0TA 1Q2QA 3LCEA 1PI5A 2ZM2A 2P74A 1SKOA 2H10A 4N92A 4YWZA 1GSWA 3GTCA 5DKLA 2EXBA 2QZ6A 2WGWA 4MN7A 3ZG0A 3QHYA 3GVBA 1KDWA 1Y4OA 5FI7A 1TVFA 3DWKA 3LY4A 5DTKA 2IWDA 2ZC5B 3HJKA 5HSQA 3T50A 4QY6A 1XA1A 1S6RA 2Q9MA 4A5RA 3LR5A 3P98A 3VOYA 1K4EA 4R3AA 3G2ZA 4B4XA 1GA0A 5CGXA 5HARA 1PZPA 3MQ0A 1S1YA 4G3VA 4L9EA 3LEZA 1P0ZA 4KG6A 1K6SA 2Y2OA 2ZLYA 3N4IA 2BASA 1AXBA 2XH9A 1E3UD 1ESIA 2VK3A 3LY3A 4JF5A 5CGSA 2X02A 3W2ZA 3WS2A 1TDGA 4IBXA 4OQHA 3HJIA 3LYXA 5CEDA 1T1AA 3HLEA 2Z6CA 1H0MA 4WYYA 4PPRA 3HLFA 3HUMA 2GJ3A 1L0DA 5TBMB 5DF9A 3ZQ5A 2HP9A 2FFYA 3MS6A 3SS4A 4KG5A 5A92A 4LFUA 4KUKA 4MMNA 4LENA 1W8YA 1EWZA 1VETA 5FEFA 3IS2A 2ZOIA 3G6OA 4JGQA 1NLYA 4ID4A 3EOIA 3N8SA 3R4KA 1JTDA 3H7WB 3EEHA 3BFFA 4IUHA 1XJ4A 4OOMA 4XXRA 3PR6A 4UA9A 4CJNA 5L2FA 5CEBA 5HDCA 3QNCA 3BW6A 1CEFA 2XK1A 4WZ4A 1K6RA 4AFIA 2CC1A 4WEKA 2J3WA 4P87A 2XD5A 3LO7A 3KYZA 1NLZA 5HPFA 1ONHA 4GHIA 4S2OA 5EECA 4JGOA 4HIAA 1IEMA 1T19A 1MXOA 4EUVA 3FV7A 2Y2QA 3E2LA 2INWA 4R0QA 1I2WA 3H7WA 2J3TD 4R6LA 1LL9A 4JXVA 4KZ3A 3IWIA 4X1LA 5L10A 1Y28A 3NOUC 1BLPA 2WKEA 5F68A 5L8MA 3EQUA 4EESA 4GDNA 1FR6A 1ES3A 4DJ2A 2ZC6B 4II7A 3F1PB 2XR0A 4XT2A 1S66L 5HD5A 3IH9A 2XD1A 1SZVA 3CG5A 3MXRA 3SOIA 4BENA 1HLUP 3BWLA 3OCNA 3MF0A 3OCLA 3SW1A 2VGKA 5FQJA 3DAVA 4GZBA 4Y7PA 3UMEA 1K55A 2E8JA 3Q7VA 3ZNTA 1GCEA 1YLJA 5GLBA 3JVUA 3VFFA 4R1GA 3ZCZA 5EFWA 5FI2A 3KO6A 1ZTUA 4KQOA 2NUTC 2K2NA 3F1PA 4WM9A 3F1OB 1V9ZA 4HP9A 3MJQA 3C7VA 4OP5A 2JHEA 5KSHA 4Y3IA 2V9AA 4ETZA 3HUOA 4HEFA 2V1ZA 4C3QA 3MXQA 4UAAA 3NECA 1Z09A 4U0XA 1OTIA 1G5UA 3EGDC 3B33A 5EOEA 3BFEA 3EWKA 4E3LA 3V3SA 1NRFA 3IXDA 4KZAA 2MJ6A 4X68A 4HH2A 2JKFA 3IHAA 3Q1FA 4DE2A 1KVMA 1IELA 3MSHA 2WGWB 2ZBBA 4QB8A 3UDIA 4ARZB 4HJ6A 4JF6A 4PKYG 4C6YA 1XJ2A 5AVFA 1HD8A 4Z9QA 3TSGA 2W3FA 4XUXA 2WKRA 2CMNA 4PM9A 4OPRA 3D4FA 4DXCA 4I39A 3MKEA 5CTNA 3G34A 3S1YA 3DTIA 1K54C 4QD4A 3TJZC 1CEGA 1NXYA 1XKZA 4X55A 1BULA 1OJ5A 1X0OA 3OPRA 2PR5A 1IYQA 5IU1A 3W8KA 2DRWA 3SS3A 1K56A 2G7UA 4HBTA 1XA7A 2ZQ8A 4KZ5A 3UE0A 1HZOA 2VKSA 4FUWA 4Y5FA 4PM6A 1EI5A 3BQ8A 3U4LP 2IWCA 3VV4A 4I3AA 4UEYA 1SCWA 1VHMA 5HPIA 4RA7A 4P6ZM 3NC8A 4D60A 3DTMA 5J3WA 3WRTA 1ALQA 2XFSA 4BJPA 2Y2NA 2D02A 1RCJA 2WUQA 3IXHA 5JYOA 1XJ3A 4LV0A 3MQOA 1PWDA 3MQQA 3ZVTA 1JTGA 1TDLA 4P0MA 1T1CA 3NJAA 5FL3A 3PBRA 2VGLS 4JXWA 4IUKA 1NYYA 2GZAA 5HWVA 2EXAA 2DMWA 2Z2MB 5TFQA 4MN5A 4EUZA 4LGWA 5G4ZA 4BBUA 1BTLA 3HLCA 3ITAA 3EEAA 3KSFA 1G6OA 1VETB 1CF0A 3M2JA 1PWGA 1JNUA 5HX9A 1L3LA 1N9OA 4EV4A 1WYBA 4EWFA 3K3DA 2PRFA 3E98A 3A0SA 1RGYA 4R3JA 3BM6A 3UPNA 3PXPA 1WA9A 4DE3A 1XPBA 1LSXA 3UPPA 2QPNA 4I38A 4GHIB 3G4PA 3ZG5A 2P9VB 3N8LA 3OPPA 1YSPA 1ESUA 4LRYC 3IWQA 3VFHA 3C7UA 1UWPX
chains in the Genus database with same CATH topology
3LIAA 4H6JB 5HSQA 3OLOA 3T50A 2D01A 1S1ZA 1S67L 4Q0IA 4ARZA 3LR5A 3LR4A 1OJGA 2K7SA 4R3AA 4NXBA 1UWNX 1YAXA 1TS6A 1OT6A 3B47A 4Q0HA 3MQ0A 2L0WA 2PHYA 5K5BA 1S1YA 4G3VA 3FPWA 4PKYA 4L9EA 3PBQA 3MR0A 1P0ZA 3LUQA 4HOIA 3H82A 3IS2B 5I5LA 2BASA 2W1TA 4HQAA 2XSSA 4CLCE 1N9NA 2VA0A 3W2ZA 4IHQA 5TJJA 3P01A 3F1NA 3LFVA 1OTAA 1P9WA 2JKRI 1VB6A 4GS9A 3LR0A 1H8MA 2A2LA 5CX7A 3HJIA 3LYXA 1LSWA 3BQAA 4BBVA 4CLCB 3BJNA 4O0PA 4HI4A 3S7QA 4NXGA 1T1AA 2Z6CA 3PHYA 1S4SA 2J3TC 4GCZA 5HDSA 5AJGA 3PBOA 3KSIA 2O9BA 2GJ3A 1BYWA 4DN0A 2LB5A 5TBMB 2VEAA 5DF9A 3ZQ5A 3E0YA 1V9YA 2GNXA 2ZMVA 4KUKA 2HJEA 1XFNA 2P7JA 3FPVA 3K3CA 4MMNA 3T4QA 4HY8A 1NRJA 3BY8A 4PAUA 2B18A 3IS2A 2ZOIA 3G6OA 4JGQA 1NLYA 3H82B 3EOIA 1H3QA 3R4KA 5G4YA 4MDZA 3H7WB 2R78A 3EEHA 4IUHA 2YKHA 1XJ4A 3K2NA 4OOMA 3LIDA 4ME4A 1TS8A 5C5KA 4EXOA 3PR6A 1T18A 3A0VA 1W63M 4GLQA 3V67A 2JKTI 1F9IA 5HDCA 4E04A 1W63Q 3BW6A 4ZRRA 4I3JA 3VE4A 2OAQ1 3MMHA 4WN5A 1OTEA 4AFIA 1MC0A 4XT2B 4WEKA 2PT7A 3IBJA 1D06A 2J3WA 2QYBA 3KX0X 3KYZA 1NLZA 5HPFA 3S7PA 3OOVA 4GHIA 4JGOA 4HIAA 4EU0A 2V0WA 2VGLM 1S4RA 1T19A 3LIBA 1P97A 1F98A 4EUVA 4LRXC 4GS9B 2INWA 3CWFA 3H7WA 3ICYA 2J3TD 4R6LA 4JGPA 4EEPA 3T4LA 1Y28A 3NOUC 2JN7A 4EERA 5J4EA 1ZHHB 2EWVA 5F68A 5L8MA 3EQUA 4EESA 2VV6A 2PYPA 2ZMFA 3C30A 2IA2A 4DJ2A 4II7A 3F1PB 4XT2A 3T4JA 1S66L 4YNRA 2B02A 5HD5A 3UE3A 3C38A 1OT9A 3R7WB 1TS0A 1XJ6A 2VLGA 2Y8HA 3BWLA 3OCNA 2GX5A 1OTBA 3MF0A 3OCLA 3SW1A 2L4RA 2P08A 4H6JA 5DFYA 3UMEA 2M7UA 3CAXA 4HNBA 5DKKA 5HD3A 3C8CA 2W1RA 4NXFA 3TW8A 3PBSA 1TF1A 1DP6A 4WF0A 5HDDA 3JVUA 4UQIM 3S7OA 2O99A 2JKRM 5EFWA 2XA7M 2A24A 3RTYA 2KOIA 3KO6A 2P04A 1ZTUA 1G28A 4KQOA 4BBTA 2NUTC 3F1PA 2K2NA 2I9VA 3F1OB 1V9ZA 4HP9A 4DMZA 4M4XA 3MJQA 4OOLA 2JHEA 5KSHA 3TRCA 4NKPA 3E4OA 3UB9A 1IOUA 2W0NA 3UE6A 4EEUA 5HWWA 4Y3IA 2VZWA 2L1MA 2W1TB 4G3WA 2V9AA 4HJ4A 5HWTA 1MZUA 4ETZA 2W27A 2W3GA 2PDRA 3KSGA 1T1BA 3NHQA 5MC7A 2WKPA 2QJ7A 5IS1A 2XA7S 3MXQA 2VV7A 2V1BA 4I5SA 4DJ3A 2VV8A 4HHDA 5AVEA 1OTIA 1KOUA 4EETB 3MFXA 3EGDC 3T4SA 3B33A 4O01A 3OC2A 4G3KA 3CLOA 2V0UA 4R70A 4L0LA 2KX6A 3EWKA 4KUOA 2QKPA 3C2WA 1GSXA 4GJ4A 4MCWA 3OBFA 2MJ6A 3F1OA 4BMWA 2K31A 4FOFA 4HJ3A 3LI9A 4IJGA 4HH2A 2V1AA 1LSVA 2EWWA 3CUEC 3PYPA 1OPXA 3VE3A 2XROA 2H28A 4HH3A 2ZBBA 4F3LB 3PBTA 2OWHA 3BY9A 4ARZB 1DP8A 2QHKA 4HJ6A 1ODVA 4B93A 5F69A 3A0RA 3LI8A 4PKYG 3JVVA 5HZHA 1XJ2A 5AVFA 1YKDA 1TS7A 2W3EA 2ZOHA 2HGVA 3E4PA 4NXEA 2W3FA 3RH8B 4L9GA 1P9RA 4PHTA 2WKRA 2CMNA 3RFBA 2PR6A 3IBRA 1LT0A 4I39A 1TD5A 2PD8A 4WLAA 3E4QA 5TBMA 2WKQA 4JGRA 4LRZE 4K08A 3LICA 2A24B 1MKMA 4F3LA 1IFQA 4I3IA 3NOTC 3FC7A 2Y79A 3TJZC 4NEED 2EA9A 1GSVA 3EGXC 1OJ5A 2HF6A 3EQVA 1X0OA 4R38A 1STZA 2PR5A 3UMDA 5IU1A 2Z6DA 2M1CA 5KIZA 4LPZA 3H9WA 2VJWA 2QJ5A 5F6AA 5IT5A 2G7UA 1LL8A 3LIFA 3D72A 2VKSA 4GW9A 4Y5FA 2YKFA 4ETXA 4B9OA 3BQ8A 4EW7A 3VV4A 3LIEA 3UB7A 2J80A 2FH5A 4I3AA 4FSFA 2FZ0A 4UEYA 3ULFA 3NOPC 5A8BA 1D7EA 1VHMA 5DJUA 5HPIA 3UB8A 4P6ZM 4CLCC 3CITA 3LR3A 4HP4A 5J3WA 4CQHA 3PBNA 4BJPA 3ZYTA 4L9FA 3UB6A 2PD7A 2XRNA 2LB9A 2D02A 3O5YA 4WELA 2KLIA 3HCYA 4Q0JA 3P7NA 5HL6A 1XJ3A 2O9AA 3MQOA 4RQ9A 3CUEA 3MQQA 2QWSA 3VOLA 2O0YA 4QPRA 3T4OA 1DRMA 5DJTA 2M7VA 1EW0A 1T1CA 3NJAA 5FL3A 4Y2FA 3PBRA 2VGLS 3KYQA 2W3DA 4LLOB 1YSQA 4IUKA 4Z1WA 1NWZA 4P6ZS 4WL9A 2VX8A 3FG8A 2GZAA 4MN6A 5HWVA 2DMWA 3R7WA 5F5YA 4CLCA 3KSHA 4MN5A 2HV1A 5G4ZA 4YOFA 4CLCD 4BBUA 2KDKA 1OTDA 2OAP1 2JKTM 3EEAA 3GDIA 5J7EA 3KSFA 1DP9A 1G6OA 2OWJA 4EQ1A 2W3HA 3CI6A 3D3OA 1JNUA 1N9OA 4O8GA 4BWIA 3GECA 3TE8A 1F5MA 2HJ9C 2NUPC 3K3DA 4UQIS 3E98A 3A0SA 2OOLA 1UGUA 1XFQA 1N9LA 4WEJA 4YWZA 1GSWA 3PXPA 4KQDA 2PYRA 1WA9A 5DKLA 1LSXA 3B42A 4MN7A 4WUJA 5DFXA 3U2AA 4I38A 3DBAA 4GHIB 1YSPA 3T4TA 3F1NB 3T4KA 3S7NA 4LRYC 2O9CA 3HJKA 5LBRA 1UWPX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LIA A;  4H6J B;  1D06 A;  3OLO A;  5AVE A;  3T50 A;  2D01 A;  5HSQ A;  3KX0 X;  5DJU A;  1OTI A;  3UB8 A;  1S1Z A;  1KOU A;  1S67 L;  4EET B;  3MFX A;  4HP4 A;  4GHI A;  3B33 A;  5J3W A;  1OJG A;  2K7S A;  4JGO A;  3CLO A;  2V0U A;  4HIA A;  4R70 A;  4R3A A;  2V0W A;  2KX6 A;  4NXB A;  1UWN X;  3EWK A;  2PD7 A;  4L9F A;  1TS6 A;  4KUO A;  3UB6 A;  1S4R A;  2QKP A;  1OT6 A;  1T19 A;  2D02 A;  3LIB A;  1P97 A;  1F98 A;  4LRX C;  2L0W A;  2PHY A;  3C2W A;  1GSX A;  4GS9 B;  1S1Y A;  2INW A;  3CWF A;  3P7N A;  3F1O A;  4PKY A;  3H7W A;  4L9E A;  1XJ3 A;  3ICY A;  3MR0 A;  4HJ3 A;  1P0Z A;  4R6L A;  3LI9 A;  3LUQ A;  3MQO A;  4JGP A;  4HOI A;  4RQ9 A;  4HH2 A;  3H82 A;  4EEP A;  2V1A A;  3IS2 B;  3MQQ A;  2QWS A;  3VOL A;  5I5L A;  1Y28 A;  3NOU C;  1LSV A;  2JN7 A;  2BAS A;  5KIZ A;  4EER A;  3PYP A;  5J4E A;  5F68 A;  3VE3 A;  1DRM A;  2H28 A;  4HQA A;  4HH3 A;  2ZBB A;  5DJT A;  4F3L B;  1EW0 A;  4EES A;  1T1C A;  2VV6 A;  2OWH A;  1N9N A;  3BY9 A;  3NJA A;  1DP8 A;  2QHK A;  4HJ6 A;  1ODV A;  2PYP A;  5F69 A;  3A0R A;  3F1N A;  3LI8 A;  4PKY G;  1OTA A;  5HZH A;  1VB6 A;  1XJ2 A;  4GS9 A;  4LLO B;  5AVF A;  4DJ2 A;  3F1P B;  1TS7 A;  4XT2 A;  1S66 L;  3HJI A;  1NWZ A;  2B02 A;  2ZOH A;  3E4P A;  5HD5 A;  3LYX A;  1LSW A;  4BBV A;  1OT9 A;  4NXE A;  4WL9 A;  3RH8 B;  1TS0 A;  4HI4 A;  3FG8 A;  4NXG A;  1T1A A;  4MN6 A;  5HWV A;  1XJ6 A;  2VLG A;  2Z6C A;  3BWL A;  4L9G A;  3PHY A;  1S4S A;  5F5Y A;  4GCZ A;  2WKR A;  1OTB A;  2CMN A;  4MN5 A;  5HDS A;  3SW1 A;  2HV1 A;  2L4R A;  4H6J A;  4HHD A;  5G4Z A;  2GJ3 A;  1BYW A;  2PR6 A;  5A8B A;  3IBR A;  4BBU A;  1LT0 A;  2KDK A;  1OTD A;  5TBM B;  3UME A;  2VEA A;  3CAX A;  4HNB A;  4I39 A;  3ZQ5 A;  5DKK A;  1V9Y A;  5HD3 A;  2PD8 A;  4WLA A;  3E4Q A;  3GDI A;  2WKQ A;  4XT2 B;  4JGR A;  4LRZ E;  5TBM A;  3C8C A;  5J7E A;  4K08 A;  1DP9 A;  4KUK A;  3LIC A;  1XFN A;  2A24 B;  2OWJ A;  2P7J A;  3K3C A;  4NXF A;  4EQ1 A;  4F3L A;  4I3I A;  3NOT C;  3FC7 A;  1DP6 A;  4HY8 A;  4WF0 A;  1JNU A;  5HDD A;  3BY8 A;  1N9O A;  5EFW A;  3RTY A;  2EA9 A;  2A24 A;  3GEC A;  3IS2 A;  2ZOI A;  3G6O A;  1G28 A;  1GSV A;  4JGQ A;  3H82 B;  4BBT A;  3F1P A;  1OJ5 A;  1X0O A;  4R38 A;  2I9V A;  5G4Y A;  3F1O B;  1V9Z A;  2PR5 A;  3K3D A;  3H7W B;  4HP9 A;  3UMD A;  2R78 A;  3EEH A;  4M4X A;  3A0S A;  5IU1 A;  2OOL A;  1UGU A;  1XFQ A;  2M1C A;  2Z6D A;  1N9L A;  3MJQ A;  4LPZ A;  2YKH A;  1XJ4 A;  2JHE A;  3H9W A;  3HJK A;  3E4O A;  3UB9 A;  3LID A;  4YWZ A;  1GSW A;  2W0N A;  4KQD A;  2PYR A;  1WA9 A;  2QJ5 A;  1TS8 A;  5F6A A;  3UE6 A;  4EEU A;  5DKL A;  4EXO A;  5HWW A;  1T18 A;  1LSX A;  1LL8 A;  3A0V A;  4WUJ A;  3LIF A;  2L1M A;  3D72 A;  5HWT A;  2V9A A;  4HJ4 A;  4I38 A;  4GW9 A;  1F9I A;  2YKF A;  4GHI B;  5HDC A;  4B9O A;  1MZU A;  4E04 A;  4EW7 A;  2W27 A;  3LIE A;  3UB7 A;  2J80 A;  2PDR A;  1T1B A;  4I3A A;  4I3J A;  3NHQ A;  3F1N B;  3VE4 A;  2WKP A;  2QJ7 A;  5IS1 A;  4LRY C;  3MXQ A;  2VV7 A;  2V1B A;  4I5S A;  1OTE A;  4WN5 A;  3ULF A;  4DJ3 A;  2VV8 A;  3NOP C;  1D7E A;  1UWP X; 
#chains in the Genus database with same CATH topology
 3LIA A;  1YM1 A;  3FYZ A;  1S1Z A;  4R4S A;  4Q0I A;  2RL3 A;  4ZJ3 A;  3O88 A;  2K7S A;  3KYE A;  3C4O A;  1OT6 A;  4JKT A;  1OME A;  5KMW A;  5K5B A;  2PHY A;  4BLM A;  4PKY A;  4D2O A;  4GN2 A;  5I5L A;  4Y15 A;  1L0E A;  2W1T A;  2EX8 A;  1IKI A;  1N9N A;  4LCL A;  5TJJ A;  3P01 A;  3IWO A;  3TOI A;  4DRT A;  1H8M A;  5CHM A;  3M2K A;  5AQB A;  3BRM A;  3Q07 A;  3BJN A;  4O0P A;  4HI4 A;  3S7Q A;  5M18 A;  2PBY A;  1S4S A;  4GCZ A;  2A3U A;  2WAD A;  3MZF A;  2O9B A;  4DN0 A;  2LB5 A;  2VEA A;  3WS4 A;  1PW8 A;  1V9Y A;  1L0F A;  3T1Q B;  3BFC A;  2ZL1 B;  1HVB A;  1H8Z A;  1XGI A;  3FPV A;  3T4Q A;  3E2K A;  4UHU A;  4S2N C;  3H82 B;  3DTK A;  1ZKJ A;  1XGJ A;  2YKH A;  4ME4 A;  3UO9 A;  1W79 A;  4EXO A;  3G32 A;  3A0V A;  4F94 A;  5EPH A;  1TEM A;  4I3J A;  2OAQ 1;  1OTE A;  3A3F A;  3HLB A;  1HTZ A;  2PT7 A;  4KZ7 A;  3KX0 X;  2V8C A;  2J8Y A;  1H5X A;  3NCK A;  5F1G A;  4GKU A;  1CI9 A;  3OOV A;  4MBH A;  5EOO A;  2P9V A;  1YLW A;  5IHV A;  4EU0 A;  2EX6 A;  2ZQ9 A;  2VGL M;  3VP4 A;  5EV0 A;  3M6H A;  3VSK A;  2OV5 A;  3ZG8 B;  2HDQ A;  3ICY A;  4IED A;  2JKG A;  2HDU A;  4EEP A;  3VP1 A;  4E3M A;  4HBU A;  4Y0O A;  5GHX A;  4EER A;  1ZHH B;  2EWV A;  3RJU A;  1ACF A;  1W7F A;  1ZG6 A;  3NI9 A;  3V39 A;  3NY4 A;  3IQA A;  3MZD A;  3T4J A;  3UE3 A;  2B02 A;  3UDF A;  3C38 A;  1OT9 A;  3R7W B;  5GL9 A;  4RVA A;  1W8Q A;  4JBF A;  3G35 A;  2ZQC A;  1W5D A;  4H6J A;  1E3U A;  3CAX A;  1YT4 A;  1O07 A;  5HD3 A;  1IYO A;  5FQM A;  1LI0 A;  3ZG9 B;  3TW8 A;  3PBS A;  4WF0 A;  1M40 A;  4S2P A;  4UQI M;  3S7O A;  3RTY A;  2BG1 A;  4LCM A;  2P04 A;  4OPQ A;  4KG2 A;  2DCF A;  4B4Z A;  4Q8I A;  1FCM A;  4KZ6 A;  3V50 A;  2VZW A;  3HLW A;  2B5R A;  2W1T B;  5HWT A;  1VEU B;  5J8X A;  1MZU A;  2Y2P A;  4WZ5 C;  1S0W A;  4HHD A;  1GA9 A;  3RXX A;  1KOU A;  1NYM A;  4IVI A;  3MFX A;  3CPT A;  3Q7V B;  1PFL A;  4G3K A;  4X53 A;  2ZM0 A;  4FH4 A;  3QP1 A;  4DDY A;  3C2W A;  1GSX A;  4ZBE A;  2H0Y A;  4FOF A;  4HJ3 A;  2IWB A;  4IJG A;  1XP4 A;  2V1A A;  5GHZ A;  4DE1 A;  2JE5 A;  3IF5 A;  3VE3 A;  4HH3 A;  3Q82 A;  1PYY A;  3BY9 A;  4DKI A;  1ODV A;  4B93 A;  3LI8 A;  4ZJ2 A;  5HW3 A;  3JVV A;  3SH9 A;  5HZH A;  3WS5 A;  2HDS A;  1YKD A;  1TS7 A;  5FDH A;  3BYD A;  4ESP A;  2OLV A;  4L9G A;  3Q81 A;  4DF6 A;  3WWX A;  2AVX A;  4OOY A;  5FA7 A;  2H0T A;  2PR6 A;  1ZG4 A;  1TD5 A;  2PD8 A;  4ZTK A;  5HL1 A;  4LRZ E;  4K08 A;  5EVI A;  3ZDJ A;  4WMC D;  1YLZ A;  3NOT C;  3FC7 A;  1BZA A;  2Y79 A;  1K56 D;  4X69 A;  4N9L A;  3EGX C;  1J9M A;  2HF6 A;  1STZ A;  4S2L A;  3CJM A;  3FWL A;  4DXB A;  3IF6 B;  2V8F A;  4XUZ A;  1PRQ A;  2QJ5 A;  5IT5 A;  1LL8 A;  1SHV A;  1WE4 A;  4FSF A;  3BFD A;  2FZ0 A;  2I72 A;  3MKF A;  3ULF A;  3NOP C;  5A8B A;  3O86 A;  3UB8 A;  4UA6 A;  2ZD8 A;  4HES A;  1VEU A;  5A91 A;  3B3X A;  1MKI A;  5FQI A;  3ZYT A;  4L9F A;  2XRN A;  4Y13 A;  3O5Y A;  1JWZ A;  2KLI A;  4Q0J A;  2BLS A;  3G2Y A;  3HLG A;  4N1H A;  4S2K A;  4KZ9 A;  5HL6 A;  4RX3 A;  1GHP A;  4RQ9 A;  2QWS A;  3VOL A;  2O0Y A;  2PBD P;  4S2M A;  3GSG A;  2M7V A;  5KZH A;  4QHC A;  1EW0 A;  1YMS A;  4Y2F A;  1E25 A;  3V3R A;  3KYQ A;  2W3D A;  1YSQ A;  3WRZ A;  2G2U A;  4MN6 A;  4BL2 A;  3R7W A;  5F5Y A;  4CLC A;  4R23 A;  2HV1 A;  1Q2P A;  2OSU A;  4FH2 A;  1WYC A;  1OTD A;  3ZNY A;  2OAP 1;  2JKT M;  1PIO A;  4ZAM A;  2ZJ9 A;  5J7E A;  3IHB A;  2OWJ A;  4EQ1 A;  2W3H A;  3QNB A;  3HUN A;  5AQA A;  4JXS A;  4S2J A;  3TE8 A;  2VGJ A;  3A3I A;  3WS1 A;  4UQI S;  2C6W B;  2OOL A;  1XFQ A;  2XLN A;  1N9L A;  2PYR A;  3O87 A;  1AWI A;  4PM5 A;  3B42 A;  5U47 A;  3U2A A;  4JPM A;  2JBF A;  2J7V A;  3T1X A;  4MLL A;  4OQG A;  3T4K A;  3F1N B;  2O9C A;  4KQQ A;  1VQQ A;  3OLO A;  2D01 A;  3VSL A;  1QMF A;  4ARZ A;  5TGF A;  3NUL A;  3LR4 A;  1OJG A;  5FAQ A;  5HAQ A;  4MBF A;  4NXB A;  1UWN X;  2H5S A;  1TS6 A;  3LGO A;  2L0W A;  3QP4 A;  5DVA A;  3FPW A;  3NIA A;  3H82 A;  1FSW A;  1FCO A;  5FDS A;  5FAO A;  5FQ9 A;  1YLY A;  2XSS A;  4LV2 A;  4IHQ A;  1H8Y A;  3QP6 A;  1P9W A;  2JKR I;  1VB6 A;  4GS9 A;  4B88 A;  2X01 A;  1KDS A;  1LI9 A;  3ZHH A;  4JLF A;  3BQA A;  4CLC B;  1JVJ A;  3ZFZ A;  4NXG A;  3NBL A;  2J3T C;  4RX2 A;  4GD6 A;  5HDS A;  5AJG A;  3PBO A;  3A3D A;  3KSI A;  2PU2 A;  1BYW A;  4WZ5 A;  3E0Y A;  5EE8 A;  5CGW A;  2HJE A;  1XFN A;  2P7J A;  1Y54 A;  3K3C A;  1IYP A;  1NRJ A;  5FSR A;  3BY8 A;  4PAU A;  4KZ8 A;  3OZH A;  2XGN A;  4JF4 A;  1H3Q A;  5G18 A;  2R78 A;  3K2N A;  2DNS A;  5CEC A;  3LID A;  4NET A;  1SKO B;  1TS8 A;  5C5K A;  2QMI A;  5EUA A;  3AGF A;  5FI6 A;  4E04 A;  5DF7 A;  1W63 Q;  3QP8 A;  4ZRR A;  1IKG A;  3MMH A;  3GRJ A;  3UN7 A;  4Y0T A;  5EVE A;  4GOG A;  4XT2 B;  5D3O A;  2ZQD A;  2Y2M A;  1L2S A;  3CZD A;  1MY8 A;  2OLU A;  3IT9 A;  5M1A A;  2V0W A;  1BLH A;  3GV9 A;  1S4R A;  5AQ7 A;  3LIB A;  3SS5 A;  5GLD A;  1BSG A;  4OH0 A;  3I7J A;  1DY6 A;  1KE4 A;  4E3J A;  4E6W A;  4JGP A;  4KZB A;  3T4L A;  3DW0 A;  2JN7 A;  1PNE A;  1U60 A;  4KZ4 A;  2VV6 A;  2A49 A;  2WAE A;  2ZMF A;  3C30 A;  4RYE A;  2ZQ7 A;  2WKI A;  3Q7Z A;  4QU3 A;  4YNR A;  1YQS A;  4QY5 A;  5E43 A;  1XJ6 A;  2VLG A;  2Y8H A;  3FKV A;  1OTB A;  2Y55 A;  1FQG A;  2L4R A;  2P08 A;  1IYS A;  1K57 C;  5DFY A;  2GDN A;  2M7U A;  3LEQ A;  4IBR A;  3V5M A;  3T1R A;  5EM1 A;  2W1R A;  4NXF A;  1TF1 A;  1DP6 A;  3VP2 A;  1PW1 A;  1LL5 A;  2O99 A;  2JKR M;  2A24 A;  1I2S A;  2WKH A;  2WZZ A;  4M4X A;  1NZU A;  3M6B A;  2WGV A;  3IX3 A;  3TRC A;  4NKP A;  3E4O A;  3UB9 A;  2W0N A;  3UE6 A;  2Y2K A;  1YMX A;  2L1M A;  4K0X A;  2B95 A;  3PAG A;  3MXS A;  3KSG A;  1T1B A;  3NHQ A;  5MC7 A;  2HZ5 A;  5IS1 A;  1KGE A;  4I5S A;  4DJ3 A;  2VV8 A;  5AVE A;  4IVK A;  2ZM8 A;  4JXG A;  4EET B;  3VMA A;  5EVL A;  2UWX A;  4O01 A;  3OC2 A;  3CLO A;  2V0U A;  1E4D A;  1K54 A;  4CPK A;  2Q9N A;  1NZO A;  2PAV P;  4GJ4 A;  4MCW A;  1VM1 A;  4BMW A;  2K31 A;  3IXG A;  2Y2J A;  3LI9 A;  5CER A;  1JWV A;  2Y2G A;  1LSV A;  1SDE A;  3CUE C;  3MFD A;  2C5W B;  2XRO A;  1ES5 A;  2H28 A;  5A93 A;  4E6X A;  2ZC7 A;  3PBT A;  1DP8 A;  1KE0 A;  5F69 A;  3VOZ A;  1CK3 A;  3G30 A;  5F1F A;  3HL9 A;  4NXE A;  3RH8 B;  1P9R A;  3RFB A;  4FTX A;  2HPB A;  3IBR A;  1LT0 A;  1JWP A;  5M19 A;  4MNR A;  2XF3 A;  3E4Q A;  4JGR A;  3SH7 A;  3LIC A;  2A24 B;  4I3I A;  2Y2H A;  1ONG A;  4NEE D;  4OVD A;  1DJB A;  2Y91 A;  5I94 A;  5KSC A;  4R38 A;  4DDS A;  1K25 A;  3UMD A;  3TG9 A;  2Z6D A;  4FD8 A;  4OQI A;  5FQK A;  1N4O A;  5F83 A;  5F6A A;  3LIF A;  2PU4 A;  4GW9 A;  1YLP A;  5HAP A;  1DJC A;  2HDR A;  2FH5 A;  3C4P A;  1DJA A;  1GHM A;  4OLG A;  2ZC4 B;  1K38 A;  3L9K A;  3DTE A;  4UA7 A;  1ERO A;  3T1S A;  4CQH A;  3A3J A;  3NDG A;  3UB6 A;  2RCX A;  3G31 A;  1LLB A;  4NG2 A;  1XXM A;  4WMC A;  3UY6 A;  2WK0 A;  3CUE A;  3W4O A;  4QPR A;  2UV0 E;  1XX2 A;  4E3N A;  2ZC3 B;  3T4O A;  1FIL A;  4E3O A;  5FAS A;  5CHU A;  1Z6F A;  3JYI A;  1O7E A;  4N1X A;  3GR2 A;  1G68 A;  4WL9 A;  1ES2 A;  3S22 A;  5DTT A;  3KSH A;  4YOF A;  5L09 A;  4X25 A;  2X71 A;  3C5A A;  2HP6 A;  2V2F F;  3IF6 A;  3SH8 A;  3CMZ A;  1SKF A;  1DP9 A;  3D3O A;  1GHI A;  1MWS A;  2HJ9 C;  2NUP C;  3D9Y A;  5E2G A;  1UGU A;  4WEJ A;  3UE1 A;  3OPL A;  4KQD A;  4S2N A;  3MZE A;  4WUJ A;  5DFX A;  3UPO A;  3DBA A;  1BUE A;  4H8R A;  2R9W A;  4GB7 A;  3T4T A;  3S7N A;  3L7H A;  1QME A;  4LV1 A;  5LBR A;  3OPH A;  4H6J B;  1K57 A;  1L0G A;  1S67 L;  4R4R A;  5CHJ A;  4K0W A;  5DF8 A;  3AGE A;  5FAT A;  1YAX A;  5E2H A;  3B47 A;  3HVF A;  4Q0H A;  3IX4 A;  2WAF A;  3HLD A;  3PBQ A;  3MR0 A;  3LUQ A;  3UDX A;  4HOI A;  5CRF A;  2Y2L A;  3IS2 B;  1YPR A;  2EX2 A;  4HQA A;  3PTE A;  4BD0 A;  1YLT A;  4CLC E;  2VA0 A;  3IX8 A;  1C3B A;  3F1N A;  3LFV A;  4NK3 A;  1OTA A;  2JC7 A;  1F2K A;  3QP5 A;  4OPY A;  3WS0 A;  3LR0 A;  1MBL A;  2A2L A;  5CX7 A;  4U3T A;  4BBV A;  1LSW A;  1M6K A;  3PHY A;  4E3K A;  4ZDX A;  3ISG A;  1KGG A;  1FIK A;  2Q0O A;  3QP2 A;  4QWO A;  4K91 A;  2GNX A;  2HP5 A;  2ZMV A;  1ZC2 A;  4S2I A;  3FKW A;  4HY8 A;  1KVL A;  3T12 B;  2B18 A;  4WBG A;  3RXW A;  3N6I A;  5G4Y A;  4MDZ A;  4YFM A;  3BLS A;  4KEN B;  1T18 A;  1W63 M;  4GLQ A;  3V67 A;  2JKT I;  1F9I A;  1K55 C;  3VE4 A;  3CHW P;  3MBZ A;  3ITB A;  4WN5 A;  1MC0 A;  3IBJ A;  5E2F A;  4GDB A;  1D06 A;  2QYB A;  5BOH A;  3BFG A;  2XQZ A;  3S7P A;  2ZMA A;  1ES4 A;  3ZVW A;  1KGF A;  4BQM A;  1CJF A;  1P97 A;  1F98 A;  5JYP A;  4LRX C;  1MPL A;  3HBR A;  5AQ9 A;  4GS9 B;  1FR1 A;  3CWF A;  4P6B A;  1NJ4 A;  5J4E A;  1MWU A;  1MWT A;  2ZQA A;  2PYP A;  1BLC A;  2IA2 A;  4OQ0 A;  5EVI D;  4Y17 A;  1TS0 A;  5GLA A;  2GX5 A;  3DWZ A;  2Z2L B;  2R9X A;  3IXB A;  3VP3 A;  4HNB A;  1LHY A;  1MWR A;  5DKK A;  3HRE A;  3IH8 A;  4MEZ A;  3C8C A;  3VP0 A;  2WYX A;  3BEC A;  5HDD A;  1ERM A;  2XA7 M;  2KOI A;  4OON A;  2EX9 A;  4P85 A;  1G28 A;  4BBT A;  3BLM A;  2I9V A;  4PM7 A;  2WGI A;  5HAI A;  4M3K A;  4DMZ A;  5F82 A;  4OOL A;  1K4F A;  1KE3 A;  3A3E A;  1IOU A;  2ZL1 A;  3PAE A;  4E3I A;  5GHY A;  4EEU A;  5HWW A;  2V20 A;  4G3W A;  4HJ4 A;  3BEB A;  4PMA A;  2W27 A;  2W3G A;  1FSY A;  2PDR A;  2WKP A;  2QJ7 A;  2XA7 S;  2VV7 A;  2V1B A;  2ACG A;  2XDM A;  4OLD A;  5HFO A;  1J3W A;  2Y4A A;  5A90 A;  2JCH A;  3T4S A;  4LV3 A;  4R70 A;  4MBK A;  2WZX A;  4L0L A;  2KX6 A;  1I5Q A;  4KUO A;  2QKP A;  3GQZ A;  5EVI C;  3IF6 C;  4YIN A;  3OBF A;  4KQR A;  3F1O A;  1D1J A;  3JPU A;  2J9P A;  2E8I A;  2EWW A;  3PYP A;  3P09 A;  1OPX A;  4X1M A;  1CI8 A;  1FOF A;  1NY0 A;  4F3L B;  5EVI B;  2OWH A;  4OP8 A;  2QHK A;  3A0R A;  2G2W A;  1RP5 A;  4EBL A;  3UB5 P;  4N9K A;  2W3E A;  2ZOH A;  2HGV A;  3E4P A;  4OPZ A;  1PWC A;  5CTM A;  4PHT A;  3SZT A;  3GMW A;  3W4Q A;  2Y59 A;  4EBN A;  4X56 A;  4WLA A;  2Y2I A;  3N8R A;  5TBM A;  2WKQ A;  2XFT A;  1RGZ A;  4BL3 A;  1K0K A;  5EM0 A;  1MKM A;  4F3L A;  1IFQ A;  2EA9 A;  1GSV A;  1CQA A;  3EQV A;  3FZC A;  5FAP A;  3W4P A;  1FCN A;  3NDE A;  2M1C A;  5KIZ A;  4LPZ A;  3H9W A;  2VJW A;  4R3B A;  3D72 A;  2YKF A;  3CPT B;  4ZJ1 A;  1PI4 A;  4ETX A;  4B9O A;  4EW7 A;  3LIE A;  3UB7 A;  3S4X A;  2J80 A;  1N9B A;  4GNU A;  1SDN A;  3O3V A;  1D7E A;  4QJG A;  5DJU A;  1G6A A;  5L07 A;  4X6T A;  4CLC C;  3CIT A;  3LR3 A;  4PM8 A;  5FEG A;  4OKP A;  4HP4 A;  4BD1 A;  4FCF A;  3PBN A;  2PD7 A;  2LB9 A;  4WEL A;  3ZGA B;  5CXW A;  3HCY A;  3P7N A;  5FQQ A;  2BTF P;  2O9A A;  2FFF B;  2EFU A;  4DE0 A;  1DRM A;  5DJT A;  3AGD A;  4EQI A;  4EBP A;  4C75 A;  1BLS A;  4GD8 A;  4LLO B;  2EFX A;  4O7D A;  4Z1W A;  1NWZ A;  3N7W A;  4P6Z S;  2VX8 A;  4Y0U A;  3ZG7 B;  3FG8 A;  1BT5 A;  5GLC A;  4CLC D;  1PZO A;  2KDK A;  2XEP A;  3UNW A;  3GDI A;  5DTS A;  3CI6 A;  5TR7 A;  1A0K A;  2J9O A;  5E2E A;  4O8G A;  1ERQ A;  4BWI A;  3GEC A;  1F5M A;  4U0T A;  1Q2Q A;  3LCE A;  1PI5 A;  2ZM2 A;  2P74 A;  1SKO A;  2H10 A;  4N92 A;  4YWZ A;  1GSW A;  3GTC A;  5DKL A;  2EXB A;  2QZ6 A;  2WGW A;  4MN7 A;  3ZG0 A;  3QHY A;  3GVB A;  1KDW A;  1Y4O A;  5FI7 A;  1TVF A;  3DWK A;  3LY4 A;  5DTK A;  2IWD A;  2ZC5 B;  3HJK A;  5HSQ A;  3T50 A;  4QY6 A;  1XA1 A;  1S6R A;  2Q9M A;  4A5R A;  3LR5 A;  3P98 A;  3VOY A;  1K4E A;  4R3A A;  3G2Z A;  4B4X A;  1GA0 A;  5CGX A;  5HAR A;  1PZP A;  3MQ0 A;  1S1Y A;  4G3V A;  4L9E A;  3LEZ A;  1P0Z A;  4KG6 A;  1K6S A;  2Y2O A;  2ZLY A;  3N4I A;  2BAS A;  1AXB A;  2XH9 A;  1E3U D;  1ESI A;  2VK3 A;  3LY3 A;  4JF5 A;  5CGS A;  2X02 A;  3W2Z A;  3WS2 A;  1TDG A;  4IBX A;  4OQH A;  3HJI A;  3LYX A;  5CED A;  1T1A A;  3HLE A;  2Z6C A;  1H0M A;  4WYY A;  4PPR A;  3HLF A;  3HUM A;  2GJ3 A;  1L0D A;  5TBM B;  5DF9 A;  3ZQ5 A;  2HP9 A;  2FFY A;  3MS6 A;  3SS4 A;  4KG5 A;  5A92 A;  4LFU A;  4KUK A;  4MMN A;  4LEN A;  1W8Y A;  1EWZ A;  1VET A;  5FEF A;  3IS2 A;  2ZOI A;  3G6O A;  4JGQ A;  1NLY A;  4ID4 A;  3EOI A;  3N8S A;  3R4K A;  1JTD A;  3H7W B;  3EEH A;  3BFF A;  4IUH A;  1XJ4 A;  4OOM A;  4XXR A;  3PR6 A;  4UA9 A;  4CJN A;  5L2F A;  5CEB A;  5HDC A;  3QNC A;  3BW6 A;  1CEF A;  2XK1 A;  4WZ4 A;  1K6R A;  4AFI A;  2CC1 A;  4WEK A;  2J3W A;  4P87 A;  2XD5 A;  3LO7 A;  3KYZ A;  1NLZ A;  5HPF A;  1ONH A;  4GHI A;  4S2O A;  5EEC A;  4JGO A;  4HIA A;  1IEM A;  1T19 A;  1MXO A;  4EUV A;  3FV7 A;  2Y2Q A;  3E2L A;  2INW A;  4R0Q A;  1I2W A;  3H7W A;  2J3T D;  4R6L A;  1LL9 A;  4JXV A;  4KZ3 A;  3IWI A;  4X1L A;  5L10 A;  1Y28 A;  3NOU C;  1BLP A;  2WKE A;  5F68 A;  5L8M A;  3EQU A;  4EES A;  4GDN A;  1FR6 A;  1ES3 A;  4DJ2 A;  2ZC6 B;  4II7 A;  3F1P B;  2XR0 A;  4XT2 A;  1S66 L;  5HD5 A;  3IH9 A;  2XD1 A;  1SZV A;  3CG5 A;  3MXR A;  3SOI A;  4BEN A;  1HLU P;  3BWL A;  3OCN A;  3MF0 A;  3OCL A;  3SW1 A;  2VGK A;  5FQJ A;  3DAV A;  4GZB A;  4Y7P A;  3UME A;  1K55 A;  2E8J A;  3Q7V A;  3ZNT A;  1GCE A;  1YLJ A;  5GLB A;  3JVU A;  3VFF A;  4R1G A;  3ZCZ A;  5EFW A;  5FI2 A;  3KO6 A;  1ZTU A;  4KQO A;  2NUT C;  2K2N A;  3F1P A;  4WM9 A;  3F1O B;  1V9Z A;  4HP9 A;  3MJQ A;  3C7V A;  4OP5 A;  2JHE A;  5KSH A;  4Y3I A;  2V9A A;  4ETZ A;  3HUO A;  4HEF A;  2V1Z A;  4C3Q A;  3MXQ A;  4UAA A;  3NEC A;  1Z09 A;  4U0X A;  1OTI A;  1G5U A;  3EGD C;  3B33 A;  5EOE A;  3BFE A;  3EWK A;  4E3L A;  3V3S A;  1NRF A;  3IXD A;  4KZA A;  2MJ6 A;  4X68 A;  4HH2 A;  2JKF A;  3IHA A;  3Q1F A;  4DE2 A;  1KVM A;  1IEL A;  3MSH A;  2WGW B;  2ZBB A;  4QB8 A;  3UDI A;  4ARZ B;  4HJ6 A;  4JF6 A;  4PKY G;  4C6Y A;  1XJ2 A;  5AVF A;  1HD8 A;  4Z9Q A;  3TSG A;  2W3F A;  4XUX A;  2WKR A;  2CMN A;  4PM9 A;  4OPR A;  3D4F A;  4DXC A;  4I39 A;  3MKE A;  5CTN A;  3G34 A;  3S1Y A;  3DTI A;  1K54 C;  4QD4 A;  3TJZ C;  1CEG A;  1NXY A;  1XKZ A;  4X55 A;  1BUL A;  1OJ5 A;  1X0O A;  3OPR A;  2PR5 A;  1IYQ A;  5IU1 A;  3W8K A;  2DRW A;  3SS3 A;  1K56 A;  2G7U A;  4HBT A;  1XA7 A;  2ZQ8 A;  4KZ5 A;  3UE0 A;  1HZO A;  2VKS A;  4FUW A;  4Y5F A;  4PM6 A;  1EI5 A;  3BQ8 A;  3U4L P;  2IWC A;  3VV4 A;  4I3A A;  4UEY A;  1SCW A;  1VHM A;  5HPI A;  4RA7 A;  4P6Z M;  3NC8 A;  4D60 A;  3DTM A;  5J3W A;  3WRT A;  1ALQ A;  2XFS A;  4BJP A;  2Y2N A;  2D02 A;  1RCJ A;  2WUQ A;  3IXH A;  5JYO A;  1XJ3 A;  4LV0 A;  3MQO A;  1PWD A;  3MQQ A;  3ZVT A;  1JTG A;  1TDL A;  4P0M A;  1T1C A;  3NJA A;  5FL3 A;  3PBR A;  2VGL S;  4JXW A;  4IUK A;  1NYY A;  2GZA A;  5HWV A;  2EXA A;  2DMW A;  2Z2M B;  5TFQ A;  4MN5 A;  4EUZ A;  4LGW A;  5G4Z A;  4BBU A;  1BTL A;  3HLC A;  3ITA A;  3EEA A;  3KSF A;  1G6O A;  1VET B;  1CF0 A;  3M2J A;  1PWG A;  1JNU A;  5HX9 A;  1L3L A;  1N9O A;  4EV4 A;  1WYB A;  4EWF A;  3K3D A;  2PRF A;  3E98 A;  3A0S A;  1RGY A;  4R3J A;  3BM6 A;  3UPN A;  3PXP A;  1WA9 A;  4DE3 A;  1XPB A;  1LSX A;  3UPP A;  2QPN A;  4I38 A;  4GHI B;  3G4P A;  3ZG5 A;  2P9V B;  3N8L A;  3OPP A;  1YSP A;  1ESU A;  4LRY C;  3IWQ A;  3VFH A;  3C7U A;  1UWP X; 
#chains in the Genus database with same CATH homology
 3LIA A;  4H6J B;  5HSQ A;  3OLO A;  3T50 A;  2D01 A;  1S1Z A;  1S67 L;  4Q0I A;  4ARZ A;  3LR5 A;  3LR4 A;  1OJG A;  2K7S A;  4R3A A;  4NXB A;  1UWN X;  1YAX A;  1TS6 A;  1OT6 A;  3B47 A;  4Q0H A;  3MQ0 A;  2L0W A;  2PHY A;  5K5B A;  1S1Y A;  4G3V A;  3FPW A;  4PKY A;  4L9E A;  3PBQ A;  3MR0 A;  1P0Z A;  3LUQ A;  4HOI A;  3H82 A;  3IS2 B;  5I5L A;  2BAS A;  2W1T A;  4HQA A;  2XSS A;  4CLC E;  1N9N A;  2VA0 A;  3W2Z A;  4IHQ A;  5TJJ A;  3P01 A;  3F1N A;  3LFV A;  1OTA A;  1P9W A;  2JKR I;  1VB6 A;  4GS9 A;  3LR0 A;  1H8M A;  2A2L A;  5CX7 A;  3HJI A;  3LYX A;  1LSW A;  3BQA A;  4BBV A;  4CLC B;  3BJN A;  4O0P A;  4HI4 A;  3S7Q A;  4NXG A;  1T1A A;  2Z6C A;  3PHY A;  1S4S A;  2J3T C;  4GCZ A;  5HDS A;  5AJG A;  3PBO A;  3KSI A;  2O9B A;  2GJ3 A;  1BYW A;  4DN0 A;  2LB5 A;  5TBM B;  2VEA A;  5DF9 A;  3ZQ5 A;  3E0Y A;  1V9Y A;  2GNX A;  2ZMV A;  4KUK A;  2HJE A;  1XFN A;  2P7J A;  3FPV A;  3K3C A;  4MMN A;  3T4Q A;  4HY8 A;  1NRJ A;  3BY8 A;  4PAU A;  2B18 A;  3IS2 A;  2ZOI A;  3G6O A;  4JGQ A;  1NLY A;  3H82 B;  3EOI A;  1H3Q A;  3R4K A;  5G4Y A;  4MDZ A;  3H7W B;  2R78 A;  3EEH A;  4IUH A;  2YKH A;  1XJ4 A;  3K2N A;  4OOM A;  3LID A;  4ME4 A;  1TS8 A;  5C5K A;  4EXO A;  3PR6 A;  1T18 A;  3A0V A;  1W63 M;  4GLQ A;  3V67 A;  2JKT I;  1F9I A;  5HDC A;  4E04 A;  1W63 Q;  3BW6 A;  4ZRR A;  4I3J A;  3VE4 A;  2OAQ 1;  3MMH A;  4WN5 A;  1OTE A;  4AFI A;  1MC0 A;  4XT2 B;  4WEK A;  2PT7 A;  3IBJ A;  1D06 A;  2J3W A;  2QYB A;  3KX0 X;  3KYZ A;  1NLZ A;  5HPF A;  3S7P A;  3OOV A;  4GHI A;  4JGO A;  4HIA A;  4EU0 A;  2V0W A;  2VGL M;  1S4R A;  1T19 A;  3LIB A;  1P97 A;  1F98 A;  4EUV A;  4LRX C;  4GS9 B;  2INW A;  3CWF A;  3H7W A;  3ICY A;  2J3T D;  4R6L A;  4JGP A;  4EEP A;  3T4L A;  1Y28 A;  3NOU C;  2JN7 A;  4EER A;  5J4E A;  1ZHH B;  2EWV A;  5F68 A;  5L8M A;  3EQU A;  4EES A;  2VV6 A;  2PYP A;  2ZMF A;  3C30 A;  2IA2 A;  4DJ2 A;  4II7 A;  3F1P B;  4XT2 A;  3T4J A;  1S66 L;  4YNR A;  2B02 A;  5HD5 A;  3UE3 A;  3C38 A;  1OT9 A;  3R7W B;  1TS0 A;  1XJ6 A;  2VLG A;  2Y8H A;  3BWL A;  3OCN A;  2GX5 A;  1OTB A;  3MF0 A;  3OCL A;  3SW1 A;  2L4R A;  2P08 A;  4H6J A;  5DFY A;  3UME A;  2M7U A;  3CAX A;  4HNB A;  5DKK A;  5HD3 A;  3C8C A;  2W1R A;  4NXF A;  3TW8 A;  3PBS A;  1TF1 A;  1DP6 A;  4WF0 A;  5HDD A;  3JVU A;  4UQI M;  3S7O A;  2O99 A;  2JKR M;  5EFW A;  2XA7 M;  2A24 A;  3RTY A;  2KOI A;  3KO6 A;  2P04 A;  1ZTU A;  1G28 A;  4KQO A;  4BBT A;  2NUT C;  3F1P A;  2K2N A;  2I9V A;  3F1O B;  1V9Z A;  4HP9 A;  4DMZ A;  4M4X A;  3MJQ A;  4OOL A;  2JHE A;  5KSH A;  3TRC A;  4NKP A;  3E4O A;  3UB9 A;  1IOU A;  2W0N A;  3UE6 A;  4EEU A;  5HWW A;  4Y3I A;  2VZW A;  2L1M A;  2W1T B;  4G3W A;  2V9A A;  4HJ4 A;  5HWT A;  1MZU A;  4ETZ A;  2W27 A;  2W3G A;  2PDR A;  3KSG A;  1T1B A;  3NHQ A;  5MC7 A;  2WKP A;  2QJ7 A;  5IS1 A;  2XA7 S;  3MXQ A;  2VV7 A;  2V1B A;  4I5S A;  4DJ3 A;  2VV8 A;  4HHD A;  5AVE A;  1OTI A;  1KOU A;  4EET B;  3MFX A;  3EGD C;  3T4S A;  3B33 A;  4O01 A;  3OC2 A;  4G3K A;  3CLO A;  2V0U A;  4R70 A;  4L0L A;  2KX6 A;  3EWK A;  4KUO A;  2QKP A;  3C2W A;  1GSX A;  4GJ4 A;  4MCW A;  3OBF A;  2MJ6 A;  3F1O A;  4BMW A;  2K31 A;  4FOF A;  4HJ3 A;  3LI9 A;  4IJG A;  4HH2 A;  2V1A A;  1LSV A;  2EWW A;  3CUE C;  3PYP A;  1OPX A;  3VE3 A;  2XRO A;  2H28 A;  4HH3 A;  2ZBB A;  4F3L B;  3PBT A;  2OWH A;  3BY9 A;  4ARZ B;  1DP8 A;  2QHK A;  4HJ6 A;  1ODV A;  4B93 A;  5F69 A;  3A0R A;  3LI8 A;  4PKY G;  3JVV A;  5HZH A;  1XJ2 A;  5AVF A;  1YKD A;  1TS7 A;  2W3E A;  2ZOH A;  2HGV A;  3E4P A;  4NXE A;  2W3F A;  3RH8 B;  4L9G A;  1P9R A;  4PHT A;  2WKR A;  2CMN A;  3RFB A;  2PR6 A;  3IBR A;  1LT0 A;  4I39 A;  1TD5 A;  2PD8 A;  4WLA A;  3E4Q A;  5TBM A;  2WKQ A;  4JGR A;  4LRZ E;  4K08 A;  3LIC A;  2A24 B;  1MKM A;  4F3L A;  1IFQ A;  4I3I A;  3NOT C;  3FC7 A;  2Y79 A;  3TJZ C;  4NEE D;  2EA9 A;  1GSV A;  3EGX C;  1OJ5 A;  2HF6 A;  3EQV A;  1X0O A;  4R38 A;  1STZ A;  2PR5 A;  3UMD A;  5IU1 A;  2Z6D A;  2M1C A;  5KIZ A;  4LPZ A;  3H9W A;  2VJW A;  2QJ5 A;  5F6A A;  5IT5 A;  2G7U A;  1LL8 A;  3LIF A;  3D72 A;  2VKS A;  4GW9 A;  4Y5F A;  2YKF A;  4ETX A;  4B9O A;  3BQ8 A;  4EW7 A;  3VV4 A;  3LIE A;  3UB7 A;  2J80 A;  2FH5 A;  4I3A A;  4FSF A;  2FZ0 A;  4UEY A;  3ULF A;  3NOP C;  5A8B A;  1D7E A;  1VHM A;  5DJU A;  5HPI A;  3UB8 A;  4P6Z M;  4CLC C;  3CIT A;  3LR3 A;  4HP4 A;  5J3W A;  4CQH A;  3PBN A;  4BJP A;  3ZYT A;  4L9F A;  3UB6 A;  2PD7 A;  2XRN A;  2LB9 A;  2D02 A;  3O5Y A;  4WEL A;  2KLI A;  3HCY A;  4Q0J A;  3P7N A;  5HL6 A;  1XJ3 A;  2O9A A;  3MQO A;  4RQ9 A;  3CUE A;  3MQQ A;  2QWS A;  3VOL A;  2O0Y A;  4QPR A;  3T4O A;  1DRM A;  5DJT A;  2M7V A;  1EW0 A;  1T1C A;  3NJA A;  5FL3 A;  4Y2F A;  3PBR A;  2VGL S;  3KYQ A;  2W3D A;  4LLO B;  1YSQ A;  4IUK A;  4Z1W A;  1NWZ A;  4P6Z S;  4WL9 A;  2VX8 A;  3FG8 A;  2GZA A;  4MN6 A;  5HWV A;  2DMW A;  3R7W A;  5F5Y A;  4CLC A;  3KSH A;  4MN5 A;  2HV1 A;  5G4Z A;  4YOF A;  4CLC D;  4BBU A;  2KDK A;  1OTD A;  2OAP 1;  2JKT M;  3EEA A;  3GDI A;  5J7E A;  3KSF A;  1DP9 A;  1G6O A;  2OWJ A;  4EQ1 A;  2W3H A;  3CI6 A;  3D3O A;  1JNU A;  1N9O A;  4O8G A;  4BWI A;  3GEC A;  3TE8 A;  1F5M A;  2HJ9 C;  2NUP C;  3K3D A;  4UQI S;  3E98 A;  3A0S A;  2OOL A;  1UGU A;  1XFQ A;  1N9L A;  4WEJ A;  4YWZ A;  1GSW A;  3PXP A;  4KQD A;  2PYR A;  1WA9 A;  5DKL A;  1LSX A;  3B42 A;  4MN7 A;  4WUJ A;  5DFX A;  3U2A A;  4I38 A;  3DBA A;  4GHI B;  1YSP A;  3T4T A;  3F1N B;  3T4K A;  3S7N A;  4LRY C;  2O9C A;  3HJK A;  5LBR A;  1UWP X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...