4JGQA

The crystal structure of sporulation kinase d mutant sensor domain, r131a, from bacillus subtilis subsp in co-crystallization with pyruvate
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
203
structure length
203
Chain Sequence
b'KDTIAAEHKQEASVLLNLHRNKINYLIGETMARMTSLSIAIDRPVDIKKMQSILEKTFDSEPRFSGLYFLNAKGDVTASTTELKTKVNLADASFFIKAKETKKTVISDSYSSRITGQPIFTICVPVLDSKRNVTDYLVAAIQIDYLKNLINLLSPDVYIEVVNQDGKMIFASGQASHAEDQKPVSGYLDDISWNMKVYPNPVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insight into the sporulation phosphorelay: Crystal structure of the sensor domain of Bacillus subtilis histidine kinase, KinD.
pubmed doi rcsb
molecule keywords Sporulation kinase D
source organism Bacillus subtilis subsp. subtilis
molecule tags Transferase
total genus 54
structure length 203
sequence length 203
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4jgqA02
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4jgqA01
1GSWA 3B33A 4HOIA 2L0WA 1UWNX 5F68A 5I5LA 4HJ6A 4HY8A 2VV7A 4WL9A 3F1NB 3KX0X 1T1BA 4EXOA 3GDIA 2WKPA 5KIZA 1LSWA 2CMNA 2WKQA 1XJ2A 4HJ3A 4WF0A 4HI4A 4I39A 3LI9A 3A0SA 4R70A 3IS2B 4HHDA 3NOUC 1LL8A 4LLOB 4GS9A 5HWTA 4GCZA 3E4OA 2HV1A 3H82B 1OTAA 1F9IA 3VOLA 1T19A 1N9NA 2ZOHA 3LIBA 1XJ4A 2QHKA 1EW0A 2J80A 4F3LB 3F1PA 4WLAA 4EQ1A 2H28A 2YKFA 4HH3A 1JNUA 3E4PA 2A24B 1OJGA 3RH8B 2V1BA 3VE3A 1OTDA 3PYPA 5A8BA 4R38A 4LPZA 3F1OB 1GSVA 4EESA 2V0WA 4HP4A 3P7NA 5HSQA 1LT0A 4GHIA 4LRXC 2ZOIA 2GJ3A 2QJ7A 4XT2A 4MN6A 1V9YA 3LUQA 5F6AA 5DKLA 2PD7A 4WN5A 2D02A 3LIFA 2OOLA 2PD8A 1F98A 5AVFA 2JN7A 4JGRA 2KX6A 2V0UA 1TS6A 3IBRA 3UMEA 5J3WA 4EEUA 1VB6A 4RQ9A 4HNBA 4XT2B 2OWHA 3HJIA 1XJ3A 3BWLA 3VE4A 5DJTA 4PKYA 1S4SA 2VLGA 3K3CA 3G6OA 1WA9A 4NXEA 3CAXA 4BBVA 1GSXA 1S4RA 2L1MA 2PDRA 4BBTA 4NXBA 2EA9A 1KOUA 3LIEA 4I38A 4YWZA 1XFNA 2V9AA 5J4EA 3A0RA 3ZQ5A 1OTEA 1S67L 4I5SA 5G4YA 3UB7A 5IS1A 3NOTC 3HJKA 3LIAA 1XFQA 4MN5A 3UB9A 4BBUA 5DJUA 1TS7A 4EW7A 3EWKA 4GS9B 5TBMA 4GW9A 4EERA 1X0OA 1MZUA 4R3AA 1T1CA 1N9LA 3H7WA 1S1YA 5DKKA 3NOPC 3SW1A 3F1PB 5HZHA 2R78A 1UWPX 4H6JA 4NXGA 5AVEA 3MFXA 1Y28A 5HDCA 1OJ5A 1S66L 5HDSA 4JGPA 3MXQA 2PR5A 4K08A 3FG8A 3UB6A 4JGOA 4L9FA 2K7SA 4KQDA 5HWWA 4HIAA 3GECA 3D72A 2V1AA 2WKRA 4GHIB 1N9OA 3PHYA 4HH2A 2L4RA 2I9VA 2YKHA 4H6JB 4I3AA 5EFWA 2VV6A 4I3JA 1DP6A 1XJ6A 3H82A 2ZBBA 2M1CA 4HP9A 3H9WA 3FC7A 1V9ZA 1TS0A 1OT9A 4DJ2A 4EETB 4F3LA 1TS8A 4WUJA 2W27A 2VV8A 4HQAA 2QJ5A 1T1AA 3NHQA 3LI8A 1NWZA 1UGUA 4KUKA 3C8CA 1OTBA 1P0ZA 3MQOA 2A24A 4DJ3A 1T18A 2PHYA 1LSVA 4M4XA 2PYRA 2QWSA 2PYPA 1D06A 1DP9A 1G28A 1OTIA 3F1OA 3ICYA 2W0NA 2VEAA 3BY9A 4E04A 3OLOA 4HJ4A 1S1ZA 2JHEA 3C2WA 3UB8A 4I3IA 2BASA 2PR6A 1DP8A 2P7JA 1OT6A 3LIDA 3A0VA 3LYXA 3CLOA 1P97A 3E4QA 4LRYC 5HWVA 3MR0A 4KUOA 3ULFA 5HD3A 3BY8A 4LRZE 1BYWA 3UMDA 4EEPA 5HD5A 4JGQA 5HDDA 2QKPA 4L9GA 3LICA 3EEHA 3NJAA 2KDKA 3MJQA 2OWJA 3RTYA 1D7EA 2INWA 3K3DA 4NXFA 4R6LA 1DRMA 5J7EA 2Z6DA 3MQQA 2D01A 5IU1A 5TBMB 3F1NA 2B02A 4L9EA 2Z6CA 4PKYG 3UE6A 5F5YA 1ODVA 3H7WB 1LSXA 3CWFA 5G4ZA 4B9OA 5F69A 3T50A 3IS2A
chains in the Genus database with same CATH superfamily
3ITAA 3IWIA 1FR6A 4EBLA 4OP8A 4S2IA 3B33A 4HOIA 2KOIA 5L8MA 1NRJA 4OLGA 4Y15A 3FKWA 1K4EA 1SCWA 4HY8A 2VV7A 4OPRA 5EVLA 3P98A 4UA7A 2JKGA 3ZCZA 1H8ZA 2FFFB 2WKPA 3W4PA 3O87A 3ZG7B 5FASA 1XJ2A 4JPMA 4WF0A 3LR0A 3HL9A 3UDXA 3A0SA 4WM9A 1O7EA 2DMWA 3CPTB 3DWKA 5HARA 1W8QA 2HV1A 3H82B 1OTAA 5CEDA 1N9NA 3M2JA 3LIBA 2XEPA 3EOIA 1N9BA 3UO9A 3T1RA 1ALQA 2J80A 4JKTA 3F1PA 2HGVA 3E4PA 4MN7A 1IYSA 3Q81A 2JBFA 1Q2QA 5M1AA 3K2NA 3SS4A 1OTDA 4N1HA 2EX2A 3PYPA 5A8BA 3PBOA 2LB9A 5F1FA 1JWPA 1GSVA 3S7QA 3G34A 3KYQA 5CEBA 3VFHA 2OAP1 2VKSA 1LT0A 4GHIA 4X55A 4LRXC 5L07A 4N92A 3CITA 3PXPA 2VGLM 2VJWA 2ZC4B 1M6KA 3MBZA 4HBUA 3IH8A 3VSLA 2H0YA 2EXAA 2D02A 4O0PA 3ZVWA 4E3OA 3KYZA 3NIAA 3ZG9B 4Y17A 4B4XA 4BQMA 2HP9A 2KX6A 4KZ9A 4JXGA 1EROA 2DNSA 4KZBA 2XSSA 4U0TA 5E2GA 3BW6A 2VGJA 4R4SA 3E98A 3T4KA 1YLTA 3NI9A 1YMSA 4DRTA 1XA7A 1H8MA 1A0KA 3UDFA 1FCNA 1S4SA 1MWTA 3PAEA 4NXEA 5U47A 2Q9NA 3QP2A 4Q8IA 2B95A 3L7HA 4MBFA 1YSPA 2NUTC 5FQQA 4FUWA 4CLCC 3KSHA 1WYCA 2EA9A 3LIEA 4Y5FA 3IH9A 4KQRA 4QY6A 1E4DA 3BJNA 1YLPA 3ZG8B 2ZMVA 5CGWA 5DTTA 1OMEA 4I5SA 5IS1A 1SDEA 3NOTC 3LIAA 4CPKA 3HLCA 3OPPA 4G3WA 4RX3A 3T4SA 4RVAA 1PWDA 3HLWA 4BD0A 2VZWA 4EW7A 1TVFA 4P85A 3QNCA 4GS9B 1K38A 1L0FA 3ISGA 1W63M 3RXWA 3VOZA 1LLBA 1S1YA 3S4XA 4X53A 3A3FA 4OQGA 3ZNTA 4Y3IA 5HZHA 2EFXA 3PBRA 4IBXA 4NXGA 5M18A 3G31A 3DTMA 5HDSA 4DN0A 4JGPA 3C4PA 3LFVA 3MXQA 3VP3A 3D3OA 4JXSA 5CTMA 4KQDA 4JLFA 1HLUP 5FEFA 3CZDA 2JE5A 4CJNA 4WELA 1YSQA 2M7UA 1FIKA 3GMWA 3CJMA 3D72A 1ES5A 3T4OA 1K55C 3A3EA 2YKHA 5IT5A 5EFWA 1KGGA 2VV6A 3QP8A 4I3JA 1DP6A 1SHVA 1TDGA 3S22A 3H82A 1FSYA 3IQAA 3G4PA 2B18A 2ZBBA 2M1CA 2W3GA 3FC7A 3CMZA 4DE0A 5E2FA 4GJ4A 1PW8A 1TS8A 4JBFA 4HEFA 4HQAA 4E3JA 5AQBA 4D2OA 4KZ3A 3NHQA 4MNRA 4Q0JA 2QZ6A 1I2WA 5E2EA 4LCLA 2ZC7A 3MMHA 1YLZA 1T18A 3WS1A 3TE8A 1YLYA 2EX6A 2QWSA 4ME4A 1ONGA 1D06A 1G28A 1P9WA 3ICYA 4OPQA 3BY9A 1BT5A 4E04A 3OLOA 2ZQ7A 2ZLYA 2BASA 4UEYA 2PR6A 2X71A 1DP8A 4Z9QA 3LYXA 3MS6A 3CLOA 4S2NC 1K4FA 3MR0A 4KUOA 3GV9A 4S2KA 1YPRA 2BG1A 3BY8A 3MZEA 1XKZA 5HD3A 3W8KA 1MWSA 2Y2HA 5F83A 2WKIA 1RP5A 3VP1A 4EEPA 5HD5A 4JGQA 3GVBA 5HDDA 2OAQ1 3ZG0A 4C3QA 3EEHA 2XDMA 3UN7A 1CK3A 3DWZA 2OWJA 2WAFA 1MKMA 3B42A 4LV2A 3MKEA 4BENA 4X68A 3C7VA 4U3TA 3QNBA 5J7EA 2I72A 5FDHA 4FH4A 5BOHA 1ZG4A 4ARZA 5IU1A 5CHJA 4UAAA 5TBMB 3MF0A 2Z6CA 3O5YA 3UE6A 5FEGA 4B88A 4PM6A 3IX8A 4KZ4A 1TEMA 1PIOA 5F69A 3IXHA 1DJBA 2UV0E 3N6IA 1GSWA 1HZOA 2GX5A 3M6HA 1UWNX 2V8FA 4ETZA 2Y2NA 1K6SA 3D4FA 5F68A 5I5LA 4KZ6A 4U0XA 2JKRM 3E2KA 4HJ6A 2ZJ9A 3F1NB 1T1BA 5KIZA 5FI6A 3WS5A 3AGEA 1F2KA 5GHYA 2Y2IA 3IS2B 4OP5A 2VGKA 2Y2KA 4O01A 3W4QA 5HAIA 4GS9A 3E4OA 5HX9A 4UA9A 3VOLA 5D3OA 1ERMA 4NKPA 3C38A 2QHKA 3N8RA 3G32A 1VEUA 3NY4A 4N9KA 1S6RA 4EQ1A 2WK0A 4PM8A 2H28A 2YKFA 4IUKA 3PBTA 3GSGA 1SZVA 4RA7A 3UB5P 3ZHHA 1K54A 4GKUA 5HL1A 4IEDA 3RXXA 3SS3A 3RH8B 2V1BA 1CEFA 4HESA 4R38A 3LCEA 3NULA 1PI5A 3IWQA 5GLDA 2A49A 4EESA 1NJ4A 3JVUA 5E2HA 1ZG6A 3KYEA 5HSQA 4FSFA 2WKHA 1GA0A 2JKTI 2XK1A 2PAVP 1KE0A 4XT2A 4MN6A 3UE3A 4X1MA 1K56A 3WS0A 3NECA 3SH7A 3LIFA 2G7UA 2PD8A 4MCWA 3QP5A 4Q0HA 2G2WA 3W2ZA 2GZAA 3SZTA 1XPBA 2JN7A 4OQIA 2J3TD 1KGEA 2OV5A 3IBRA 1HVBA 4OOYA 3LEZA 4WZ5C 3HLGA 3UMEA 3QP6A 5J3WA 4EEUA 4NETA 1VB6A 4A5RA 4RQ9A 3DBAA 5MC7A 4S2PA 1WYBA 3HJIA 1NYYA 2HJ9C 3BWLA 2Y2MA 4E6WA 2VLGA 2ZC6B 4II7A 3G6OA 4KZAA 1K57A 5K5BA 1WA9A 5FQ9A 1GSXA 1H5XA 4E3LA 2XGNA 3ITBA 1S4RA 2WZXA 5FQIA 4CLCB 4KG2A 4OLDA 5J4EA 4S2MA 2V2FF 1H3QA 4C6YA 1S67L 3UB7A 1K56D 4FH2A 3IF6A 4Y13A 1ZTUA 3QHYA 2HP5A 3FKVA 3V50A 4MN5A 3BQAA 4X56A 5KMWA 3UB9A 4Y0TA 3OPRA 5GLBA 3P01A 2JKFA 2G2UA 1LL5A 2A2LA 5TBMA 2W1RA 3JPUA 1N9LA 2JC7A 3IX3A 3NOPC 3NDGA 2KLIA 5CHUA 2WGVA 4UA6A 4FD8A 2R78A 3LGOA 3BFFA 5A91A 4OOMA 1GHPA 3MFXA 1G6OA 1L0GA 2XA7M 5EVIA 2NUPC 1I5QA 2ZC3B 3V3RA 4BL2A 1J9MA 3FG8A 3T1QB 3UB6A 4GLQA 2ZM0A 4PM7A 3IX4A 2K7SA 3VV4A 1CI8A 2PRFA 5HWWA 4OQHA 3DW0A 1SKOB 5FSRA 5DF8A 2V1AA 1W63Q 2WKRA 2AVXA 2EX9A 3EQUA 4ZTKA 3HLFA 5CHMA 2P9VB 1XGIA 3HUMA 5EECA 2B5RA 2I9VA 4H6JB 2ZMFA 1F5MA 3TSGA 3S7NA 1BLCA 4GZBA 1JWZA 5FI7A 1XJ6A 3HUOA 3SOIA 2QPNA 1IKGA 4P6ZS 2Y2PA 5DF9A 4X69A 1TS0A 3MKFA 3S7PA 2W27A 2XR0A 1ACFA 2Z2LB 3CG5A 3LI8A 3RFBA 1P0ZA 5CERA 3V5MA 4DJ3A 1AXBA 3GR2A 5CRFA 5FI2A 1LSVA 2PYRA 3HREA 1IEMA 4LGWA 1OTIA 2PYPA 4EU0A 2Y79A 3W4OA 1KE4A 5DFXA 5EVID 5CTNA 4C75A 1S1ZA 4M3KA 2JHEA 2W1TA 1LI0A 2XROA 1FILA 4NK3A 2J7VA 1MBLA 1OT6A 3LIDA 3TOIA 3A0VA 1P97A 2ZD8A 4LRYC 1QMEA 3NBLA 5KZHA 2HDRA 1K6RA 4LRZE 2WZZA 1VHMA 3CUEC 4BMWA 1PYYA 4B4ZA 1C3BA 4L9GA 3LICA 1M40A 3NJAA 2KDKA 3G2ZA 1MXOA 1K25A 3MJQA 1ERQA 2PBDP 1YM1A 3VOYA 3K3DA 4NXFA 4L0LA 4Z1WA 2H10A 3QP4A 5DF7A 3IBJA 1E3UA 1XGJA 3MQQA 1NLZA 3ZG5A 5A90A 4UQIS 5DTSA 2B02A 4L9EA 5FQJA 3FWLA 4ZJ1A 3IT9A 1LSXA 3CWFA 5G4ZA 4K0WA 3PBSA 1I2SA 3IWOA 3DAVA 2WGIA 3CPTA 1Y54A 1IYPA 5LBRA 2O9CA 4PM5A 4PMAA 2E8JA 3HBRA 1CF0A 5CXWA 1FCOA 5CX7A 3EGXC 5AQAA 4ZBEA 2P04A 3R7WB 2K2NA 2V8CA 4QHCA 3SH9A 3GDIA 3BFEA 4EXOA 5A93A 1IKIA 1LSWA 1NLYA 2CMNA 2J3WA 3OOVA 2WAEA 5AQ7A 2PU2A 4HJ3A 3T1XA 3EEAA 4I39A 5EM0A 3S1YA 2XD5A 1K0KA 4WMCA 3NOUC 4LLOB 1LI9A 3MXRA 4WEJA 1FSWA 1GA9A 5HWTA 3ZYTA 1W5DA 4KZ8A 1YQSA 1N4OA 1F9IA 1E3UD 2ZOHA 4P87A 5KSHA 2HPBA 4OONA 4OOLA 5HPFA 3KO6A 4YFMA 1MWRA 3S7OA 5I94A 3DTEA 3DTIA 1YAXA 3PBQA 5HFOA 2H0TA 3OCNA 4ETXA 5C5KA 5L2FA 2ZQ9A 4G3KA 3T4JA 3HLDA 3IF5A 4BJPA 4LPZA 4PHTA 2UWXA 2Y4AA 2J3TC 5EV0A 3F1OB 2FFYA 1IFQA 2Y91A 1PWGA 1S0WA 4BL3A 2HZ5A 4DE3A 3AGFA 4QY5A 4FCFA 2VGLS 4WBGA 3O88A 2ACGA 1MC0A 4GNUA 2Y2OA 2HDSA 1U60A 3O86A 1K54C 4S2OA 3NCKA 3LUQA 5EOEA 1DJAA 2HDUA 2EWWA 4WN5A 2H5SA 4QJGA 3HLBA 4DDSA 1KGFA 3CI6A 3LY4A 4WMCD 3PR6A 5DFYA 1XXMA 5AVFA 4JGRA 4G3VA 2V0UA 4IUHA 4ZRRA 2XFSA 2XRNA 2CC1A 3JYIA 4JF4A 5FAOA 1PZPA 2HDQA 5A92A 2EX8A 4QPRA 4MLLA 4JF5A 3EQVA 2XFTA 1XJ3A 3OZHA 1PNEA 4ZDXA 2WUQA 5TJJA 3K3CA 3SS5A 1Z09A 1Y4OA 5L10A 2O0YA 3CAXA 1IYQA 5GHZA 1NXYA 3C5AA 3HUNA 4S2NA 4JF6A 3CHWP 4BBTA 4NXBA 1KOUA 5AJGA 5EE8A 3KSFA 1XFNA 2V9AA 3I7JA 2BLSA 1BLHA 4K0XA 3LO7A 3UE0A 1BUEA 5JYPA 1OTEA 5G4YA 2XLNA 1AWIA 3PBNA 4OPYA 3OCLA 1XFQA 4DKIA 4BD1A 3T1SA 3BLMA 1P9RA 5TGFA 5DJUA 3T4TA 4P6BA 3TW8A 3V39A 3OBFA 3WRZA 3LR4A 1GCEA 1X0OA 1MZUA 3ZGAB 2WKEA 1T1CA 3ZFZA 5HAPA 3GQZA 1QMFA 5DKKA 3G35A 2A3UA 4NG2A 3MFDA 3IF6C 5AVEA 4YOFA 4DE1A 4OPZA 1OJ5A 3MZDA 5M19A 4YNRA 3HCYA 1S66L 1VETB 2EWVA 5EOOA 1CI9A 1G6AA 4LCMA 4S2JA 5HAQA 3LR5A 1TDLA 2Y8HA 4K08A 3FPVA 1ES4A 4KG6A 3U2AA 4DE2A 5JYOA 1FCMA 4QWOA 4ZJ3A 3MQ0A 4CLCE 4HIAA 4IJGA 1ESUA 5G18A 4UQIM 3ZVTA 1N9OA 1O07A 2V20A 5GLAA 3PHYA 2XQZA 5HL6A 5CGSA 1YT4A 5EVIC 2Y2QA 1IELA 4KG5A 1V9ZA 3Q7VB 1OT9A 5FA7A 2VV8A 1SKFA 4XUZA 1LL9A 1T1AA 2X02A 3B47A 4Y0OA 1DY6A 1NWZA 5EM1A 4KUKA 3LEQA 3ZNYA 2PHYA 3VMAA 1BSGA 3Q82A 1GHMA 1L0EA 2RCXA 3OPLA 3F1OA 2W0NA 2ZQAA 2VEAA 1PI4A 3VSKA 3FZCA 3C2WA 5FAPA 1KVLA 4I3IA 3D9YA 4GOGA 3ZDJA 2FZ0A 3T4LA 1HD8A 2LB5A 2R9XA 4DXBA 2P7JA 4IVIA 2VK3A 5FDSA 5E43A 3E4QA 3MSHA 5HWVA 1CQAA 4D60A 2O99A 2ZQ8A 4MBHA 1BYWA 2IWBA 4LFUA 2ZQDA 4R4RA 3UPPA 1XP4A 1H8YA 4JXVA 3RTYA 1KVMA 3BQ8A 3FYZA 4XUXA 1ZHHB 3IHBA 3UY6A 1G68A 4Y0UA 1D7EA 4Q0IA 1NRFA 3BRMA 4DXCA 3N8LA 4R6LA 4KZ5A 4NEED 1FQGA 2ZMAA 4Y7PA 2Z6DA 2V1ZA 4WZ5A 4GD6A 3U4LP 4ZJ2A 3TRCA 1NYMA 2ZM2A 3F1NA 4XXRA 2PT7A 4MMNA 4JXWA 5EPHA 1ODVA 3H7WB 1IOUA 3UDIA 4KENB 3T50A 3IS2A 3BFDA 4WYYA 1W7FA 5J8XA 3LR3A 2JCHA 2ZL1B 1PZOA 2L0WA 4DF6A 4BWIA 2O9AA 3P09A 4ARZB 1J3WA 4O7DA 4B93A 4X1LA 5GHXA 1YLJA 4WL9A 3KX0X 1JWVA 3IXDA 2WKQA 5EUAA 4HI4A 4K91A 3LI9A 4R70A 4E6XA 3WWXA 4HHDA 1LL8A 3FV7A 3GRJA 4LENA 4GCZA 3DTKA 5FAQA 3KSIA 5FATA 1T19A 4EWFA 3OPHA 5HPIA 1XJ4A 2WGWB 1EW0A 4LV3A 4F3LB 2R9WA 3NDEA 2W3EA 4WLAA 4EBPA 3OC2A 1JTGA 4HH3A 2J9OA 1JNUA 4ZAMA 2W3HA 1VETA 4EUZA 2A24B 1D1JA 4X25A 1OJGA 5GL9A 3VE3A 4FTXA 1BTLA 2EXBA 2OLVA 2HP6A 3V3SA 3UNWA 2V0WA 1BLSA 2QYBA 4HP4A 3NC8A 1XA1A 3P7NA 3M2KA 4OQ0A 5F82A 2PU4A 3VP2A 1SDNA 4PAUA 4EUVA 1VEUB 5GLCA 3M6BA 2XD1A 2ZOIA 3G2YA 2GJ3A 2O9BA 3FPWA 3WS4A 1NZUA 2QJ7A 4R3JA 1W8YA 1V9YA 4GD8A 5F6AA 1BZAA 2Z2MB 1NY0A 5DKLA 2Q9MA 2E8IA 2PBYA 5KSCA 2PD7A 4RX2A 1VM1A 1YMXA 3AGDA 3BYDA 3V67A 1JVJA 2OOLA 1IYOA 2Y59A 3Q7VA 3MXSA 1F98A 2Q0OA 3BLSA 1TS6A 1ES3A 1LHYA 3LY3A 4IBRA 4CLCA 4N1XA 4BLMA 3BECA 3G30A 4QD4A 4S2LA 1FOFA 1PWCA 3L9KA 4HNBA 4YINA 4RYEA 4XT2B 3UPOA 2OWHA 2C5WB 1H0MA 4OVDA 1W79A 4ESPA 3VE4A 1ZKJA 4H8RA 5DJTA 4PKYA 2VA0A 1YLWA 2X01A 3WS2A 2BTFP 1L0DA 4Y2FA 1ESIA 4GB7A 4BBVA 2DRWA 3EGDC 3PTEA 2L1MA 3KSGA 2PDRA 1RGZA 4P0MA 1RCJA 4AFIA 4I38A 2GDNA 4YWZA 4EBNA 4FOFA 3A0RA 1E25A 3CUEA 3BFGA 5TR7A 3ZQ5A 4QU3A 1CJFA 4E3IA 3N8SA 3VFFA 4EQIA 4MBKA 3GTCA 3JVVA 3HJKA 2P74A 4LV1A 3A3IA 3C4OA 2M7VA 1PW1A 4MEZA 2WADA 1KE3A 4BBUA 1KDWA 3T4QA 1TS7A 1KDSA 4LV0A 4E3MA 3EWKA 3Q7ZA 4ID4A 4KZ7A 4GW9A 4HBTA 4EERA 4CLCD 4R3AA 1SKOA 4R1GA 2ZM8A 3H7WA 5IHVA 5L09A 2W3FA 2XA7S 3SW1A 3F1PB 2P9VA 4R3BA 1UWPX 4H6JA 4R23A 1K55A 3IF6B 2Y2GA 4KQOA 1Y28A 5HDCA 1XX2A 1EWZA 2QMIA 2RL3A 1NZOA 2ZL1A 3BM6A 5HW3A 3C7UA 2Y2JA 1FR1A 1YKDA 2PR5A 2JKRI 3R4KA 2IA2A 1HTZA 2P08A 4JGOA 4L9FA 5DVAA 3T12B 5EVEA 3UE1A 3B3XA 3GECA 3IHAA 4GHIB 2C6WB 3UPNA 5F1GA 2DCFA 4HH2A 2L4RA 4PPRA 3SH8A 2GNXA 4I3AA 2VX8A 2OLUA 3E2LA 1WE4A 3A3JA 2K31A 1OPXA 5EVIB 1L3LA 4OH0A 5TFQA 3VP4A 1BLPA 3IXGA 4HP9A 2WGWA 3H9WA 2Y55A 3Q07A 3O3VA 1JTDA 1MPLA 4DJ2A 4EETB 1EI5A 4E3NA 4F3LA 1MWUA 4WUJA 4DDYA 2QJ5A 1CEGA 4P6ZM 4CQHA 1UGUA 5CGXA 2XF3A 3MZFA 3C8CA 1OTBA 5FQMA 1Q2PA 3MQOA 2A24A 3WRTA 4E3KA 2IWCA 4M4XA 3HLEA 3A3DA 4IVKA 1VQQA 1ZC2A 1RGYA 4GDNA 1DP9A 3C30A 4GN2A 2OSUA 3IXBA 5FL3A 1L2SA 4HJ4A 3PAGA 5CECA 2ZC5B 3Q1FA 2J8YA 3UB8A 4UHUA 1K57C 1TD5A 4O8GA 3QP1A 4KQQA 3TG9A 2Y2LA 4WEKA 2EFUA 5AQ9A 4WZ4A 1MY8A 2ZQCA 3ULFA 1MKIA 2W3DA 1PFLA 3BFCA 3UMDA 4QB8A 2MJ6A 2HF6A 2QKPA 3BEBA 1GHIA 4EV4A 2IWDA 4N9LA 1G5UA 2INWA 2J9PA 2W1TB 3E0YA 5FQKA 4OKPA 4IHQA 1DRMA 3RJUA 1ES2A 2FH5A 1BULA 4F94A 2D01A 4GDBA 2HJEA 1DJCA 4R0QA 3VP0A 4PM9A 4MDZA 1Z6FA 3R7WA 2WYXA 3N4IA 4X6TA 3HVFA 4PKYG 1TF1A 5F5YA 3N7WA 2JKTM 4DMZA 4B9OA 5DTKA 1STZA 1ONHA 1PRQA 2XH9A 3TJZC
chains in the Genus database with same CATH topology
1GSWA 2GX5A 3LR3A 3B33A 4HOIA 2KOIA 5L8MA 2L0WA 1UWNX 5LBRA 1NRJA 2O9CA 4ETZA 5F68A 5I5LA 2JKRM 4BWIA 2O9AA 4HJ6A 4ARZB 4B93A 4HY8A 2VV7A 5CX7A 3EGXC 2P04A 4WL9A 3F1NB 3R7WB 3KX0X 2K2NA 1T1BA 4EXOA 3GDIA 2WKPA 5KIZA 1LSWA 1NLYA 2CMNA 2J3WA 3OOVA 2WKQA 1XJ2A 4HJ3A 4WF0A 3EEAA 3LR0A 4HI4A 4I39A 3LI9A 3A0SA 4R70A 3IS2B 4HHDA 3NOUC 1LL8A 4O01A 4LLOB 2DMWA 4GS9A 4WEJA 3ZYTA 5HWTA 4GCZA 3E4OA 2HV1A 3H82B 1OTAA 1F9IA 3KSIA 3VOLA 1T19A 1N9NA 2ZOHA 4NKPA 3C38A 1XJ4A 2QHKA 3LIBA 5HPIA 1EW0A 5KSHA 3EOIA 4OOLA 2J80A 4F3LB 5HPFA 3KO6A 2W3EA 3F1PA 4WLAA 4EQ1A 3OC2A 2HGVA 3S7OA 2H28A 2YKFA 4HH3A 4IUKA 3PBTA 1JNUA 3E4PA 1YAXA 3PBQA 2W3HA 4MN7A 2A24B 3OCNA 1OJGA 4ETXA 5C5KA 3K2NA 3RH8B 2V1BA 3VE3A 4G3KA 3T4JA 1OTDA 3PYPA 5A8BA 4R38A 3PBOA 4BJPA 2LB9A 4LPZA 4PHTA 2J3TC 3F1OB 1GSVA 1IFQA 4EESA 2V0WA 2QYBA 3S7QA 3KYQA 4HP4A 3P7NA 2OAP1 3JVUA 5HSQA 4FSFA 2VGLS 2VKSA 1LT0A 2JKTI 4PAUA 4EUVA 4GHIA 1MC0A 4LRXC 2ZOIA 3CITA 2GJ3A 2O9BA 3FPWA 2QJ7A 3PXPA 2VGLM 2VJWA 4XT2A 4MN6A 1V9YA 3LUQA 3UE3A 5F6AA 5DKLA 2PD7A 2EWWA 3V67A 4WN5A 2D02A 3LIFA 4O0PA 2G7UA 2OOLA 2PD8A 4MCWA 3KYZA 4Q0HA 3CI6A 3W2ZA 2GZAA 3PR6A 5DFYA 1F98A 5AVFA 2JN7A 4JGRA 2J3TD 2KX6A 4G3VA 2V0UA 1TS6A 4IUHA 4ZRRA 3IBRA 2XRNA 4CLCA 2XSSA 3UMEA 5J3WA 4EEUA 3BW6A 4QPRA 1VB6A 3E98A 4RQ9A 4HNBA 3T4KA 3DBAA 5MC7A 3EQVA 4XT2B 2OWHA 3HJIA 1H8MA 2HJ9C 1XJ3A 3BWLA 3VE4A 5DJTA 4PKYA 2VA0A 1S4SA 2VLGA 5TJJA 3K3CA 4II7A 4Y2FA 3G6OA 5K5BA 2O0YA 1WA9A 4NXEA 3CAXA 4BBVA 1GSXA 1YSPA 2NUTC 3EGDC 1S4RA 4CLCC 2L1MA 3KSHA 3KSGA 2PDRA 4AFIA 4BBTA 4NXBA 2EA9A 4CLCB 1KOUA 3LIEA 4Y5FA 5AJGA 4I38A 4YWZA 3KSFA 1XFNA 2V9AA 5J4EA 4FOFA 3A0RA 3CUEA 3BJNA 3ZQ5A 1H3QA 2ZMVA 1OTEA 1S67L 4I5SA 5G4YA 3UB7A 5IS1A 3NOTC 3JVVA 3HJKA 3PBNA 1ZTUA 3LIAA 3OCLA 1XFQA 4G3WA 4MN5A 2M7VA 3T4SA 3BQAA 3UB9A 4BBUA 1P9RA 3T4QA 5DJUA 3T4TA 1TS7A 3TW8A 2VZWA 3P01A 4EW7A 3OBFA 3EWKA 4GS9B 3LR4A 2A2LA 5TBMA 4GW9A 4EERA 1X0OA 1MZUA 4CLCD 1W63M 2W1RA 4R3AA 1T1CA 1N9LA 3H7WA 1S1YA 5DKKA 3NOPC 2KLIA 2W3FA 2XA7S 4Y3IA 3SW1A 3F1PB 5HZHA 2R78A 1UWPX 3PBRA 4H6JA 4NXGA 4OOMA 5AVEA 4YOFA 4KQOA 3MFXA 1G6OA 1Y28A 5HDCA 1OJ5A 4YNRA 3HCYA 1S66L 2XA7M 2EWVA 2NUPC 1YKDA 5HDSA 3LR5A 4JGPA 4DN0A 3LFVA 3MXQA 2PR5A 2JKRI 3R4KA 2IA2A 2P08A 2Y8HA 4K08A 3D3OA 3FG8A 3UB6A 3FPVA 4GLQA 3U2AA 4JGOA 4L9FA 2K7SA 3VV4A 4KQDA 3MQ0A 4CLCE 5HWWA 4HIAA 1YSQA 4IJGA 4WELA 2M7UA 3GECA 3D72A 2V1AA 1W63Q 2WKRA 4GHIB 4UQIM 3EQUA 1N9OA 3T4OA 3PHYA 4HH2A 2L4RA 5HL6A 2GNXA 2I9VA 2YKHA 4H6JB 5IT5A 2ZMFA 1F5MA 4I3AA 5EFWA 2VX8A 3S7NA 2VV6A 4I3JA 1DP6A 1XJ6A 2K31A 1OPXA 3H82A 2B18A 2ZBBA 4P6ZS 2M1CA 2W3GA 4HP9A 3H9WA 3FC7A 5DF9A 1V9ZA 4GJ4A 1TS0A 1OT9A 4DJ2A 4EETB 4F3LA 1TS8A 4WUJA 2W27A 2VV8A 3S7PA 4HQAA 2QJ5A 1T1AA 3NHQA 3B47A 4P6ZM 4Q0JA 3LI8A 1NWZA 4CQHA 1UGUA 4KUKA 3C8CA 1OTBA 3RFBA 1P0ZA 3MMHA 3MQOA 2A24A 4DJ3A 1T18A 2PHYA 3TE8A 1LSVA 4M4XA 2PYRA 2QWSA 4ME4A 2PYPA 1D06A 1DP9A 1G28A 1OTIA 3C30A 1P9WA 4EU0A 2Y79A 3F1OA 3ICYA 5FL3A 2W0NA 5DFXA 2VEAA 3BY9A 4E04A 3OLOA 4HJ4A 1S1ZA 2JHEA 3C2WA 2W1TA 3UB8A 4I3IA 2BASA 4UEYA 2XROA 1TD5A 2FZ0A 4O8GA 3T4LA 2PR6A 2LB5A 1DP8A 2P7JA 1OT6A 3LIDA 3A0VA 3LYXA 3CLOA 4WEKA 1P97A 3E4QA 4LRYC 5HWVA 3MR0A 4KUOA 3ULFA 5HD3A 3BY8A 2W3DA 4LRZE 2O99A 1BYWA 1VHMA 3UMDA 4EEPA 5HD5A 3CUEC 4JGQA 2MJ6A 4BMWA 2HF6A 5HDDA 2QKPA 2OAQ1 4L9GA 3LICA 3EEHA 3NJAA 2KDKA 3MJQA 2OWJA 3RTYA 1MKMA 3B42A 3BQ8A 1ZHHB 1D7EA 4Q0IA 2INWA 2W1TB 3E0YA 3K3DA 4NXFA 4L0LA 4Z1WA 4R6LA 4NEED 4IHQA 1DRMA 5J7EA 3IBJA 2Z6DA 3MQQA 2FH5A 1NLZA 2D01A 4ARZA 2HJEA 5IU1A 3TRCA 4UQIS 4MDZA 5TBMB 3F1NA 2B02A 4L9EA 3R7WA 3MF0A 2Z6CA 2PT7A 4PKYG 3O5YA 4MMNA 1TF1A 3UE6A 5F5YA 1ODVA 3H7WB 1IOUA 2JKTM 1LSXA 3CWFA 4DMZA 5G4ZA 4B9OA 1STZA 5F69A 3T50A 3IS2A 3PBSA 3TJZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GSW A;  3B33 A;  4HOI A;  2L0W A;  1UWN X;  5F68 A;  5I5L A;  4HJ6 A;  4HY8 A;  2VV7 A;  4WL9 A;  3F1N B;  3KX0 X;  1T1B A;  4EXO A;  3GDI A;  2WKP A;  5KIZ A;  1LSW A;  2CMN A;  2WKQ A;  1XJ2 A;  4HJ3 A;  4WF0 A;  4HI4 A;  4I39 A;  3LI9 A;  3A0S A;  4R70 A;  3IS2 B;  4HHD A;  3NOU C;  1LL8 A;  4LLO B;  4GS9 A;  5HWT A;  4GCZ A;  3E4O A;  2HV1 A;  3H82 B;  1OTA A;  1F9I A;  3VOL A;  1T19 A;  1N9N A;  2ZOH A;  3LIB A;  1XJ4 A;  2QHK A;  1EW0 A;  2J80 A;  4F3L B;  3F1P A;  4WLA A;  4EQ1 A;  2H28 A;  2YKF A;  4HH3 A;  1JNU A;  3E4P A;  2A24 B;  1OJG A;  3RH8 B;  2V1B A;  3VE3 A;  1OTD A;  3PYP A;  5A8B A;  4R38 A;  4LPZ A;  3F1O B;  1GSV A;  4EES A;  2V0W A;  4HP4 A;  3P7N A;  5HSQ A;  1LT0 A;  4GHI A;  4LRX C;  2ZOI A;  2GJ3 A;  2QJ7 A;  4XT2 A;  4MN6 A;  1V9Y A;  3LUQ A;  5F6A A;  5DKL A;  2PD7 A;  4WN5 A;  2D02 A;  3LIF A;  2OOL A;  2PD8 A;  1F98 A;  5AVF A;  2JN7 A;  4JGR A;  2KX6 A;  2V0U A;  1TS6 A;  3IBR A;  3UME A;  5J3W A;  4EEU A;  1VB6 A;  4RQ9 A;  4HNB A;  4XT2 B;  2OWH A;  3HJI A;  1XJ3 A;  3BWL A;  3VE4 A;  5DJT A;  4PKY A;  1S4S A;  2VLG A;  3K3C A;  3G6O A;  1WA9 A;  4NXE A;  3CAX A;  4BBV A;  1GSX A;  1S4R A;  2L1M A;  2PDR A;  4BBT A;  4NXB A;  2EA9 A;  1KOU A;  3LIE A;  4I38 A;  4YWZ A;  1XFN A;  2V9A A;  5J4E A;  3A0R A;  3ZQ5 A;  1OTE A;  1S67 L;  4I5S A;  5G4Y A;  3UB7 A;  5IS1 A;  3NOT C;  3HJK A;  3LIA A;  1XFQ A;  4MN5 A;  3UB9 A;  4BBU A;  5DJU A;  1TS7 A;  4EW7 A;  3EWK A;  4GS9 B;  5TBM A;  4GW9 A;  4EER A;  1X0O A;  1MZU A;  4R3A A;  1T1C A;  1N9L A;  3H7W A;  1S1Y A;  5DKK A;  3NOP C;  3SW1 A;  3F1P B;  5HZH A;  2R78 A;  1UWP X;  4H6J A;  4NXG A;  5AVE A;  3MFX A;  1Y28 A;  5HDC A;  1OJ5 A;  1S66 L;  5HDS A;  4JGP A;  3MXQ A;  2PR5 A;  4K08 A;  3FG8 A;  3UB6 A;  4JGO A;  4L9F A;  2K7S A;  4KQD A;  5HWW A;  4HIA A;  3GEC A;  3D72 A;  2V1A A;  2WKR A;  4GHI B;  1N9O A;  3PHY A;  4HH2 A;  2L4R A;  2I9V A;  2YKH A;  4H6J B;  4I3A A;  5EFW A;  2VV6 A;  4I3J A;  1DP6 A;  1XJ6 A;  3H82 A;  2ZBB A;  2M1C A;  4HP9 A;  3H9W A;  3FC7 A;  1V9Z A;  1TS0 A;  1OT9 A;  4DJ2 A;  4EET B;  4F3L A;  1TS8 A;  4WUJ A;  2W27 A;  2VV8 A;  4HQA A;  2QJ5 A;  1T1A A;  3NHQ A;  3LI8 A;  1NWZ A;  1UGU A;  4KUK A;  3C8C A;  1OTB A;  1P0Z A;  3MQO A;  2A24 A;  4DJ3 A;  1T18 A;  2PHY A;  1LSV A;  4M4X A;  2PYR A;  2QWS A;  2PYP A;  1D06 A;  1DP9 A;  1G28 A;  1OTI A;  3F1O A;  3ICY A;  2W0N A;  2VEA A;  3BY9 A;  4E04 A;  3OLO A;  4HJ4 A;  1S1Z A;  2JHE A;  3C2W A;  3UB8 A;  4I3I A;  2BAS A;  2PR6 A;  1DP8 A;  2P7J A;  1OT6 A;  3LID A;  3A0V A;  3LYX A;  3CLO A;  1P97 A;  3E4Q A;  4LRY C;  5HWV A;  3MR0 A;  4KUO A;  3ULF A;  5HD3 A;  3BY8 A;  4LRZ E;  1BYW A;  3UMD A;  4EEP A;  5HD5 A;  4JGQ A;  5HDD A;  2QKP A;  4L9G A;  3LIC A;  3EEH A;  3NJA A;  2KDK A;  3MJQ A;  2OWJ A;  3RTY A;  1D7E A;  2INW A;  3K3D A;  4NXF A;  4R6L A;  1DRM A;  5J7E A;  2Z6D A;  3MQQ A;  2D01 A;  5IU1 A;  5TBM B;  3F1N A;  2B02 A;  4L9E A;  2Z6C A;  4PKY G;  3UE6 A;  5F5Y A;  1ODV A;  3H7W B;  1LSX A;  3CWF A;  5G4Z A;  4B9O A;  5F69 A;  3T50 A;  3IS2 A; 
#chains in the Genus database with same CATH topology
 3ITA A;  3IWI A;  1FR6 A;  4EBL A;  4OP8 A;  4S2I A;  3B33 A;  4HOI A;  2KOI A;  5L8M A;  1NRJ A;  4OLG A;  4Y15 A;  3FKW A;  1K4E A;  1SCW A;  4HY8 A;  2VV7 A;  4OPR A;  5EVL A;  3P98 A;  4UA7 A;  2JKG A;  3ZCZ A;  1H8Z A;  2FFF B;  2WKP A;  3W4P A;  3O87 A;  3ZG7 B;  5FAS A;  1XJ2 A;  4JPM A;  4WF0 A;  3LR0 A;  3HL9 A;  3UDX A;  3A0S A;  4WM9 A;  1O7E A;  2DMW A;  3CPT B;  3DWK A;  5HAR A;  1W8Q A;  2HV1 A;  3H82 B;  1OTA A;  5CED A;  1N9N A;  3M2J A;  3LIB A;  2XEP A;  3EOI A;  1N9B A;  3UO9 A;  3T1R A;  1ALQ A;  2J80 A;  4JKT A;  3F1P A;  2HGV A;  3E4P A;  4MN7 A;  1IYS A;  3Q81 A;  2JBF A;  1Q2Q A;  5M1A A;  3K2N A;  3SS4 A;  1OTD A;  4N1H A;  2EX2 A;  3PYP A;  5A8B A;  3PBO A;  2LB9 A;  5F1F A;  1JWP A;  1GSV A;  3S7Q A;  3G34 A;  3KYQ A;  5CEB A;  3VFH A;  2OAP 1;  2VKS A;  1LT0 A;  4GHI A;  4X55 A;  4LRX C;  5L07 A;  4N92 A;  3CIT A;  3PXP A;  2VGL M;  2VJW A;  2ZC4 B;  1M6K A;  3MBZ A;  4HBU A;  3IH8 A;  3VSL A;  2H0Y A;  2EXA A;  2D02 A;  4O0P A;  3ZVW A;  4E3O A;  3KYZ A;  3NIA A;  3ZG9 B;  4Y17 A;  4B4X A;  4BQM A;  2HP9 A;  2KX6 A;  4KZ9 A;  4JXG A;  1ERO A;  2DNS A;  4KZB A;  2XSS A;  4U0T A;  5E2G A;  3BW6 A;  2VGJ A;  4R4S A;  3E98 A;  3T4K A;  1YLT A;  3NI9 A;  1YMS A;  4DRT A;  1XA7 A;  1H8M A;  1A0K A;  3UDF A;  1FCN A;  1S4S A;  1MWT A;  3PAE A;  4NXE A;  5U47 A;  2Q9N A;  3QP2 A;  4Q8I A;  2B95 A;  3L7H A;  4MBF A;  1YSP A;  2NUT C;  5FQQ A;  4FUW A;  4CLC C;  3KSH A;  1WYC A;  2EA9 A;  3LIE A;  4Y5F A;  3IH9 A;  4KQR A;  4QY6 A;  1E4D A;  3BJN A;  1YLP A;  3ZG8 B;  2ZMV A;  5CGW A;  5DTT A;  1OME A;  4I5S A;  5IS1 A;  1SDE A;  3NOT C;  3LIA A;  4CPK A;  3HLC A;  3OPP A;  4G3W A;  4RX3 A;  3T4S A;  4RVA A;  1PWD A;  3HLW A;  4BD0 A;  2VZW A;  4EW7 A;  1TVF A;  4P85 A;  3QNC A;  4GS9 B;  1K38 A;  1L0F A;  3ISG A;  1W63 M;  3RXW A;  3VOZ A;  1LLB A;  1S1Y A;  3S4X A;  4X53 A;  3A3F A;  4OQG A;  3ZNT A;  4Y3I A;  5HZH A;  2EFX A;  3PBR A;  4IBX A;  4NXG A;  5M18 A;  3G31 A;  3DTM A;  5HDS A;  4DN0 A;  4JGP A;  3C4P A;  3LFV A;  3MXQ A;  3VP3 A;  3D3O A;  4JXS A;  5CTM A;  4KQD A;  4JLF A;  1HLU P;  5FEF A;  3CZD A;  2JE5 A;  4CJN A;  4WEL A;  1YSQ A;  2M7U A;  1FIK A;  3GMW A;  3CJM A;  3D72 A;  1ES5 A;  3T4O A;  1K55 C;  3A3E A;  2YKH A;  5IT5 A;  5EFW A;  1KGG A;  2VV6 A;  3QP8 A;  4I3J A;  1DP6 A;  1SHV A;  1TDG A;  3S22 A;  3H82 A;  1FSY A;  3IQA A;  3G4P A;  2B18 A;  2ZBB A;  2M1C A;  2W3G A;  3FC7 A;  3CMZ A;  4DE0 A;  5E2F A;  4GJ4 A;  1PW8 A;  1TS8 A;  4JBF A;  4HEF A;  4HQA A;  4E3J A;  5AQB A;  4D2O A;  4KZ3 A;  3NHQ A;  4MNR A;  4Q0J A;  2QZ6 A;  1I2W A;  5E2E A;  4LCL A;  2ZC7 A;  3MMH A;  1YLZ A;  1T18 A;  3WS1 A;  3TE8 A;  1YLY A;  2EX6 A;  2QWS A;  4ME4 A;  1ONG A;  1D06 A;  1G28 A;  1P9W A;  3ICY A;  4OPQ A;  3BY9 A;  1BT5 A;  4E04 A;  3OLO A;  2ZQ7 A;  2ZLY A;  2BAS A;  4UEY A;  2PR6 A;  2X71 A;  1DP8 A;  4Z9Q A;  3LYX A;  3MS6 A;  3CLO A;  4S2N C;  1K4F A;  3MR0 A;  4KUO A;  3GV9 A;  4S2K A;  1YPR A;  2BG1 A;  3BY8 A;  3MZE A;  1XKZ A;  5HD3 A;  3W8K A;  1MWS A;  2Y2H A;  5F83 A;  2WKI A;  1RP5 A;  3VP1 A;  4EEP A;  5HD5 A;  4JGQ A;  3GVB A;  5HDD A;  2OAQ 1;  3ZG0 A;  4C3Q A;  3EEH A;  2XDM A;  3UN7 A;  1CK3 A;  3DWZ A;  2OWJ A;  2WAF A;  1MKM A;  3B42 A;  4LV2 A;  3MKE A;  4BEN A;  4X68 A;  3C7V A;  4U3T A;  3QNB A;  5J7E A;  2I72 A;  5FDH A;  4FH4 A;  5BOH A;  1ZG4 A;  4ARZ A;  5IU1 A;  5CHJ A;  4UAA A;  5TBM B;  3MF0 A;  2Z6C A;  3O5Y A;  3UE6 A;  5FEG A;  4B88 A;  4PM6 A;  3IX8 A;  4KZ4 A;  1TEM A;  1PIO A;  5F69 A;  3IXH A;  1DJB A;  2UV0 E;  3N6I A;  1GSW A;  1HZO A;  2GX5 A;  3M6H A;  1UWN X;  2V8F A;  4ETZ A;  2Y2N A;  1K6S A;  3D4F A;  5F68 A;  5I5L A;  4KZ6 A;  4U0X A;  2JKR M;  3E2K A;  4HJ6 A;  2ZJ9 A;  3F1N B;  1T1B A;  5KIZ A;  5FI6 A;  3WS5 A;  3AGE A;  1F2K A;  5GHY A;  2Y2I A;  3IS2 B;  4OP5 A;  2VGK A;  2Y2K A;  4O01 A;  3W4Q A;  5HAI A;  4GS9 A;  3E4O A;  5HX9 A;  4UA9 A;  3VOL A;  5D3O A;  1ERM A;  4NKP A;  3C38 A;  2QHK A;  3N8R A;  3G32 A;  1VEU A;  3NY4 A;  4N9K A;  1S6R A;  4EQ1 A;  2WK0 A;  4PM8 A;  2H28 A;  2YKF A;  4IUK A;  3PBT A;  3GSG A;  1SZV A;  4RA7 A;  3UB5 P;  3ZHH A;  1K54 A;  4GKU A;  5HL1 A;  4IED A;  3RXX A;  3SS3 A;  3RH8 B;  2V1B A;  1CEF A;  4HES A;  4R38 A;  3LCE A;  3NUL A;  1PI5 A;  3IWQ A;  5GLD A;  2A49 A;  4EES A;  1NJ4 A;  3JVU A;  5E2H A;  1ZG6 A;  3KYE A;  5HSQ A;  4FSF A;  2WKH A;  1GA0 A;  2JKT I;  2XK1 A;  2PAV P;  1KE0 A;  4XT2 A;  4MN6 A;  3UE3 A;  4X1M A;  1K56 A;  3WS0 A;  3NEC A;  3SH7 A;  3LIF A;  2G7U A;  2PD8 A;  4MCW A;  3QP5 A;  4Q0H A;  2G2W A;  3W2Z A;  2GZA A;  3SZT A;  1XPB A;  2JN7 A;  4OQI A;  2J3T D;  1KGE A;  2OV5 A;  3IBR A;  1HVB A;  4OOY A;  3LEZ A;  4WZ5 C;  3HLG A;  3UME A;  3QP6 A;  5J3W A;  4EEU A;  4NET A;  1VB6 A;  4A5R A;  4RQ9 A;  3DBA A;  5MC7 A;  4S2P A;  1WYB A;  3HJI A;  1NYY A;  2HJ9 C;  3BWL A;  2Y2M A;  4E6W A;  2VLG A;  2ZC6 B;  4II7 A;  3G6O A;  4KZA A;  1K57 A;  5K5B A;  1WA9 A;  5FQ9 A;  1GSX A;  1H5X A;  4E3L A;  2XGN A;  3ITB A;  1S4R A;  2WZX A;  5FQI A;  4CLC B;  4KG2 A;  4OLD A;  5J4E A;  4S2M A;  2V2F F;  1H3Q A;  4C6Y A;  1S67 L;  3UB7 A;  1K56 D;  4FH2 A;  3IF6 A;  4Y13 A;  1ZTU A;  3QHY A;  2HP5 A;  3FKV A;  3V50 A;  4MN5 A;  3BQA A;  4X56 A;  5KMW A;  3UB9 A;  4Y0T A;  3OPR A;  5GLB A;  3P01 A;  2JKF A;  2G2U A;  1LL5 A;  2A2L A;  5TBM A;  2W1R A;  3JPU A;  1N9L A;  2JC7 A;  3IX3 A;  3NOP C;  3NDG A;  2KLI A;  5CHU A;  2WGV A;  4UA6 A;  4FD8 A;  2R78 A;  3LGO A;  3BFF A;  5A91 A;  4OOM A;  1GHP A;  3MFX A;  1G6O A;  1L0G A;  2XA7 M;  5EVI A;  2NUP C;  1I5Q A;  2ZC3 B;  3V3R A;  4BL2 A;  1J9M A;  3FG8 A;  3T1Q B;  3UB6 A;  4GLQ A;  2ZM0 A;  4PM7 A;  3IX4 A;  2K7S A;  3VV4 A;  1CI8 A;  2PRF A;  5HWW A;  4OQH A;  3DW0 A;  1SKO B;  5FSR A;  5DF8 A;  2V1A A;  1W63 Q;  2WKR A;  2AVX A;  2EX9 A;  3EQU A;  4ZTK A;  3HLF A;  5CHM A;  2P9V B;  1XGI A;  3HUM A;  5EEC A;  2B5R A;  2I9V A;  4H6J B;  2ZMF A;  1F5M A;  3TSG A;  3S7N A;  1BLC A;  4GZB A;  1JWZ A;  5FI7 A;  1XJ6 A;  3HUO A;  3SOI A;  2QPN A;  1IKG A;  4P6Z S;  2Y2P A;  5DF9 A;  4X69 A;  1TS0 A;  3MKF A;  3S7P A;  2W27 A;  2XR0 A;  1ACF A;  2Z2L B;  3CG5 A;  3LI8 A;  3RFB A;  1P0Z A;  5CER A;  3V5M A;  4DJ3 A;  1AXB A;  3GR2 A;  5CRF A;  5FI2 A;  1LSV A;  2PYR A;  3HRE A;  1IEM A;  4LGW A;  1OTI A;  2PYP A;  4EU0 A;  2Y79 A;  3W4O A;  1KE4 A;  5DFX A;  5EVI D;  5CTN A;  4C75 A;  1S1Z A;  4M3K A;  2JHE A;  2W1T A;  1LI0 A;  2XRO A;  1FIL A;  4NK3 A;  2J7V A;  1MBL A;  1OT6 A;  3LID A;  3TOI A;  3A0V A;  1P97 A;  2ZD8 A;  4LRY C;  1QME A;  3NBL A;  5KZH A;  2HDR A;  1K6R A;  4LRZ E;  2WZZ A;  1VHM A;  3CUE C;  4BMW A;  1PYY A;  4B4Z A;  1C3B A;  4L9G A;  3LIC A;  1M40 A;  3NJA A;  2KDK A;  3G2Z A;  1MXO A;  1K25 A;  3MJQ A;  1ERQ A;  2PBD P;  1YM1 A;  3VOY A;  3K3D A;  4NXF A;  4L0L A;  4Z1W A;  2H10 A;  3QP4 A;  5DF7 A;  3IBJ A;  1E3U A;  1XGJ A;  3MQQ A;  1NLZ A;  3ZG5 A;  5A90 A;  4UQI S;  5DTS A;  2B02 A;  4L9E A;  5FQJ A;  3FWL A;  4ZJ1 A;  3IT9 A;  1LSX A;  3CWF A;  5G4Z A;  4K0W A;  3PBS A;  1I2S A;  3IWO A;  3DAV A;  2WGI A;  3CPT A;  1Y54 A;  1IYP A;  5LBR A;  2O9C A;  4PM5 A;  4PMA A;  2E8J A;  3HBR A;  1CF0 A;  5CXW A;  1FCO A;  5CX7 A;  3EGX C;  5AQA A;  4ZBE A;  2P04 A;  3R7W B;  2K2N A;  2V8C A;  4QHC A;  3SH9 A;  3GDI A;  3BFE A;  4EXO A;  5A93 A;  1IKI A;  1LSW A;  1NLY A;  2CMN A;  2J3W A;  3OOV A;  2WAE A;  5AQ7 A;  2PU2 A;  4HJ3 A;  3T1X A;  3EEA A;  4I39 A;  5EM0 A;  3S1Y A;  2XD5 A;  1K0K A;  4WMC A;  3NOU C;  4LLO B;  1LI9 A;  3MXR A;  4WEJ A;  1FSW A;  1GA9 A;  5HWT A;  3ZYT A;  1W5D A;  4KZ8 A;  1YQS A;  1N4O A;  1F9I A;  1E3U D;  2ZOH A;  4P87 A;  5KSH A;  2HPB A;  4OON A;  4OOL A;  5HPF A;  3KO6 A;  4YFM A;  1MWR A;  3S7O A;  5I94 A;  3DTE A;  3DTI A;  1YAX A;  3PBQ A;  5HFO A;  2H0T A;  3OCN A;  4ETX A;  5C5K A;  5L2F A;  2ZQ9 A;  4G3K A;  3T4J A;  3HLD A;  3IF5 A;  4BJP A;  4LPZ A;  4PHT A;  2UWX A;  2Y4A A;  2J3T C;  5EV0 A;  3F1O B;  2FFY A;  1IFQ A;  2Y91 A;  1PWG A;  1S0W A;  4BL3 A;  2HZ5 A;  4DE3 A;  3AGF A;  4QY5 A;  4FCF A;  2VGL S;  4WBG A;  3O88 A;  2ACG A;  1MC0 A;  4GNU A;  2Y2O A;  2HDS A;  1U60 A;  3O86 A;  1K54 C;  4S2O A;  3NCK A;  3LUQ A;  5EOE A;  1DJA A;  2HDU A;  2EWW A;  4WN5 A;  2H5S A;  4QJG A;  3HLB A;  4DDS A;  1KGF A;  3CI6 A;  3LY4 A;  4WMC D;  3PR6 A;  5DFY A;  1XXM A;  5AVF A;  4JGR A;  4G3V A;  2V0U A;  4IUH A;  4ZRR A;  2XFS A;  2XRN A;  2CC1 A;  3JYI A;  4JF4 A;  5FAO A;  1PZP A;  2HDQ A;  5A92 A;  2EX8 A;  4QPR A;  4MLL A;  4JF5 A;  3EQV A;  2XFT A;  1XJ3 A;  3OZH A;  1PNE A;  4ZDX A;  2WUQ A;  5TJJ A;  3K3C A;  3SS5 A;  1Z09 A;  1Y4O A;  5L10 A;  2O0Y A;  3CAX A;  1IYQ A;  5GHZ A;  1NXY A;  3C5A A;  3HUN A;  4S2N A;  4JF6 A;  3CHW P;  4BBT A;  4NXB A;  1KOU A;  5AJG A;  5EE8 A;  3KSF A;  1XFN A;  2V9A A;  3I7J A;  2BLS A;  1BLH A;  4K0X A;  3LO7 A;  3UE0 A;  1BUE A;  5JYP A;  1OTE A;  5G4Y A;  2XLN A;  1AWI A;  3PBN A;  4OPY A;  3OCL A;  1XFQ A;  4DKI A;  4BD1 A;  3T1S A;  3BLM A;  1P9R A;  5TGF A;  5DJU A;  3T4T A;  4P6B A;  3TW8 A;  3V39 A;  3OBF A;  3WRZ A;  3LR4 A;  1GCE A;  1X0O A;  1MZU A;  3ZGA B;  2WKE A;  1T1C A;  3ZFZ A;  5HAP A;  3GQZ A;  1QMF A;  5DKK A;  3G35 A;  2A3U A;  4NG2 A;  3MFD A;  3IF6 C;  5AVE A;  4YOF A;  4DE1 A;  4OPZ A;  1OJ5 A;  3MZD A;  5M19 A;  4YNR A;  3HCY A;  1S66 L;  1VET B;  2EWV A;  5EOO A;  1CI9 A;  1G6A A;  4LCM A;  4S2J A;  5HAQ A;  3LR5 A;  1TDL A;  2Y8H A;  4K08 A;  3FPV A;  1ES4 A;  4KG6 A;  3U2A A;  4DE2 A;  5JYO A;  1FCM A;  4QWO A;  4ZJ3 A;  3MQ0 A;  4CLC E;  4HIA A;  4IJG A;  1ESU A;  5G18 A;  4UQI M;  3ZVT A;  1N9O A;  1O07 A;  2V20 A;  5GLA A;  3PHY A;  2XQZ A;  5HL6 A;  5CGS A;  1YT4 A;  5EVI C;  2Y2Q A;  1IEL A;  4KG5 A;  1V9Z A;  3Q7V B;  1OT9 A;  5FA7 A;  2VV8 A;  1SKF A;  4XUZ A;  1LL9 A;  1T1A A;  2X02 A;  3B47 A;  4Y0O A;  1DY6 A;  1NWZ A;  5EM1 A;  4KUK A;  3LEQ A;  3ZNY A;  2PHY A;  3VMA A;  1BSG A;  3Q82 A;  1GHM A;  1L0E A;  2RCX A;  3OPL A;  3F1O A;  2W0N A;  2ZQA A;  2VEA A;  1PI4 A;  3VSK A;  3FZC A;  3C2W A;  5FAP A;  1KVL A;  4I3I A;  3D9Y A;  4GOG A;  3ZDJ A;  2FZ0 A;  3T4L A;  1HD8 A;  2LB5 A;  2R9X A;  4DXB A;  2P7J A;  4IVI A;  2VK3 A;  5FDS A;  5E43 A;  3E4Q A;  3MSH A;  5HWV A;  1CQA A;  4D60 A;  2O99 A;  2ZQ8 A;  4MBH A;  1BYW A;  2IWB A;  4LFU A;  2ZQD A;  4R4R A;  3UPP A;  1XP4 A;  1H8Y A;  4JXV A;  3RTY A;  1KVM A;  3BQ8 A;  3FYZ A;  4XUX A;  1ZHH B;  3IHB A;  3UY6 A;  1G68 A;  4Y0U A;  1D7E A;  4Q0I A;  1NRF A;  3BRM A;  4DXC A;  3N8L A;  4R6L A;  4KZ5 A;  4NEE D;  1FQG A;  2ZMA A;  4Y7P A;  2Z6D A;  2V1Z A;  4WZ5 A;  4GD6 A;  3U4L P;  4ZJ2 A;  3TRC A;  1NYM A;  2ZM2 A;  3F1N A;  4XXR A;  2PT7 A;  4MMN A;  4JXW A;  5EPH A;  1ODV A;  3H7W B;  1IOU A;  3UDI A;  4KEN B;  3T50 A;  3IS2 A;  3BFD A;  4WYY A;  1W7F A;  5J8X A;  3LR3 A;  2JCH A;  2ZL1 B;  1PZO A;  2L0W A;  4DF6 A;  4BWI A;  2O9A A;  3P09 A;  4ARZ B;  1J3W A;  4O7D A;  4B93 A;  4X1L A;  5GHX A;  1YLJ A;  4WL9 A;  3KX0 X;  1JWV A;  3IXD A;  2WKQ A;  5EUA A;  4HI4 A;  4K91 A;  3LI9 A;  4R70 A;  4E6X A;  3WWX A;  4HHD A;  1LL8 A;  3FV7 A;  3GRJ A;  4LEN A;  4GCZ A;  3DTK A;  5FAQ A;  3KSI A;  5FAT A;  1T19 A;  4EWF A;  3OPH A;  5HPI A;  1XJ4 A;  2WGW B;  1EW0 A;  4LV3 A;  4F3L B;  2R9W A;  3NDE A;  2W3E A;  4WLA A;  4EBP A;  3OC2 A;  1JTG A;  4HH3 A;  2J9O A;  1JNU A;  4ZAM A;  2W3H A;  1VET A;  4EUZ A;  2A24 B;  1D1J A;  4X25 A;  1OJG A;  5GL9 A;  3VE3 A;  4FTX A;  1BTL A;  2EXB A;  2OLV A;  2HP6 A;  3V3S A;  3UNW A;  2V0W A;  1BLS A;  2QYB A;  4HP4 A;  3NC8 A;  1XA1 A;  3P7N A;  3M2K A;  4OQ0 A;  5F82 A;  2PU4 A;  3VP2 A;  1SDN A;  4PAU A;  4EUV A;  1VEU B;  5GLC A;  3M6B A;  2XD1 A;  2ZOI A;  3G2Y A;  2GJ3 A;  2O9B A;  3FPW A;  3WS4 A;  1NZU A;  2QJ7 A;  4R3J A;  1W8Y A;  1V9Y A;  4GD8 A;  5F6A A;  1BZA A;  2Z2M B;  1NY0 A;  5DKL A;  2Q9M A;  2E8I A;  2PBY A;  5KSC A;  2PD7 A;  4RX2 A;  1VM1 A;  1YMX A;  3AGD A;  3BYD A;  3V67 A;  1JVJ A;  2OOL A;  1IYO A;  2Y59 A;  3Q7V A;  3MXS A;  1F98 A;  2Q0O A;  3BLS A;  1TS6 A;  1ES3 A;  1LHY A;  3LY3 A;  4IBR A;  4CLC A;  4N1X A;  4BLM A;  3BEC A;  3G30 A;  4QD4 A;  4S2L A;  1FOF A;  1PWC A;  3L9K A;  4HNB A;  4YIN A;  4RYE A;  4XT2 B;  3UPO A;  2OWH A;  2C5W B;  1H0M A;  4OVD A;  1W79 A;  4ESP A;  3VE4 A;  1ZKJ A;  4H8R A;  5DJT A;  4PKY A;  2VA0 A;  1YLW A;  2X01 A;  3WS2 A;  2BTF P;  1L0D A;  4Y2F A;  1ESI A;  4GB7 A;  4BBV A;  2DRW A;  3EGD C;  3PTE A;  2L1M A;  3KSG A;  2PDR A;  1RGZ A;  4P0M A;  1RCJ A;  4AFI A;  4I38 A;  2GDN A;  4YWZ A;  4EBN A;  4FOF A;  3A0R A;  1E25 A;  3CUE A;  3BFG A;  5TR7 A;  3ZQ5 A;  4QU3 A;  1CJF A;  4E3I A;  3N8S A;  3VFF A;  4EQI A;  4MBK A;  3GTC A;  3JVV A;  3HJK A;  2P74 A;  4LV1 A;  3A3I A;  3C4O A;  2M7V A;  1PW1 A;  4MEZ A;  2WAD A;  1KE3 A;  4BBU A;  1KDW A;  3T4Q A;  1TS7 A;  1KDS A;  4LV0 A;  4E3M A;  3EWK A;  3Q7Z A;  4ID4 A;  4KZ7 A;  4GW9 A;  4HBT A;  4EER A;  4CLC D;  4R3A A;  1SKO A;  4R1G A;  2ZM8 A;  3H7W A;  5IHV A;  5L09 A;  2W3F A;  2XA7 S;  3SW1 A;  3F1P B;  2P9V A;  4R3B A;  1UWP X;  4H6J A;  4R23 A;  1K55 A;  3IF6 B;  2Y2G A;  4KQO A;  1Y28 A;  5HDC A;  1XX2 A;  1EWZ A;  2QMI A;  2RL3 A;  1NZO A;  2ZL1 A;  3BM6 A;  5HW3 A;  3C7U A;  2Y2J A;  1FR1 A;  1YKD A;  2PR5 A;  2JKR I;  3R4K A;  2IA2 A;  1HTZ A;  2P08 A;  4JGO A;  4L9F A;  5DVA A;  3T12 B;  5EVE A;  3UE1 A;  3B3X A;  3GEC A;  3IHA A;  4GHI B;  2C6W B;  3UPN A;  5F1G A;  2DCF A;  4HH2 A;  2L4R A;  4PPR A;  3SH8 A;  2GNX A;  4I3A A;  2VX8 A;  2OLU A;  3E2L A;  1WE4 A;  3A3J A;  2K31 A;  1OPX A;  5EVI B;  1L3L A;  4OH0 A;  5TFQ A;  3VP4 A;  1BLP A;  3IXG A;  4HP9 A;  2WGW A;  3H9W A;  2Y55 A;  3Q07 A;  3O3V A;  1JTD A;  1MPL A;  4DJ2 A;  4EET B;  1EI5 A;  4E3N A;  4F3L A;  1MWU A;  4WUJ A;  4DDY A;  2QJ5 A;  1CEG A;  4P6Z M;  4CQH A;  1UGU A;  5CGX A;  2XF3 A;  3MZF A;  3C8C A;  1OTB A;  5FQM A;  1Q2P A;  3MQO A;  2A24 A;  3WRT A;  4E3K A;  2IWC A;  4M4X A;  3HLE A;  3A3D A;  4IVK A;  1VQQ A;  1ZC2 A;  1RGY A;  4GDN A;  1DP9 A;  3C30 A;  4GN2 A;  2OSU A;  3IXB A;  5FL3 A;  1L2S A;  4HJ4 A;  3PAG A;  5CEC A;  2ZC5 B;  3Q1F A;  2J8Y A;  3UB8 A;  4UHU A;  1K57 C;  1TD5 A;  4O8G A;  3QP1 A;  4KQQ A;  3TG9 A;  2Y2L A;  4WEK A;  2EFU A;  5AQ9 A;  4WZ4 A;  1MY8 A;  2ZQC A;  3ULF A;  1MKI A;  2W3D A;  1PFL A;  3BFC A;  3UMD A;  4QB8 A;  2MJ6 A;  2HF6 A;  2QKP A;  3BEB A;  1GHI A;  4EV4 A;  2IWD A;  4N9L A;  1G5U A;  2INW A;  2J9P A;  2W1T B;  3E0Y A;  5FQK A;  4OKP A;  4IHQ A;  1DRM A;  3RJU A;  1ES2 A;  2FH5 A;  1BUL A;  4F94 A;  2D01 A;  4GDB A;  2HJE A;  1DJC A;  4R0Q A;  3VP0 A;  4PM9 A;  4MDZ A;  1Z6F A;  3R7W A;  2WYX A;  3N4I A;  4X6T A;  3HVF A;  4PKY G;  1TF1 A;  5F5Y A;  3N7W A;  2JKT M;  4DMZ A;  4B9O A;  5DTK A;  1STZ A;  1ONH A;  1PRQ A;  2XH9 A;  3TJZ C; 
#chains in the Genus database with same CATH homology
 1GSW A;  2GX5 A;  3LR3 A;  3B33 A;  4HOI A;  2KOI A;  5L8M A;  2L0W A;  1UWN X;  5LBR A;  1NRJ A;  2O9C A;  4ETZ A;  5F68 A;  5I5L A;  2JKR M;  4BWI A;  2O9A A;  4HJ6 A;  4ARZ B;  4B93 A;  4HY8 A;  2VV7 A;  5CX7 A;  3EGX C;  2P04 A;  4WL9 A;  3F1N B;  3R7W B;  3KX0 X;  2K2N A;  1T1B A;  4EXO A;  3GDI A;  2WKP A;  5KIZ A;  1LSW A;  1NLY A;  2CMN A;  2J3W A;  3OOV A;  2WKQ A;  1XJ2 A;  4HJ3 A;  4WF0 A;  3EEA A;  3LR0 A;  4HI4 A;  4I39 A;  3LI9 A;  3A0S A;  4R70 A;  3IS2 B;  4HHD A;  3NOU C;  1LL8 A;  4O01 A;  4LLO B;  2DMW A;  4GS9 A;  4WEJ A;  3ZYT A;  5HWT A;  4GCZ A;  3E4O A;  2HV1 A;  3H82 B;  1OTA A;  1F9I A;  3KSI A;  3VOL A;  1T19 A;  1N9N A;  2ZOH A;  4NKP A;  3C38 A;  1XJ4 A;  2QHK A;  3LIB A;  5HPI A;  1EW0 A;  5KSH A;  3EOI A;  4OOL A;  2J80 A;  4F3L B;  5HPF A;  3KO6 A;  2W3E A;  3F1P A;  4WLA A;  4EQ1 A;  3OC2 A;  2HGV A;  3S7O A;  2H28 A;  2YKF A;  4HH3 A;  4IUK A;  3PBT A;  1JNU A;  3E4P A;  1YAX A;  3PBQ A;  2W3H A;  4MN7 A;  2A24 B;  3OCN A;  1OJG A;  4ETX A;  5C5K A;  3K2N A;  3RH8 B;  2V1B A;  3VE3 A;  4G3K A;  3T4J A;  1OTD A;  3PYP A;  5A8B A;  4R38 A;  3PBO A;  4BJP A;  2LB9 A;  4LPZ A;  4PHT A;  2J3T C;  3F1O B;  1GSV A;  1IFQ A;  4EES A;  2V0W A;  2QYB A;  3S7Q A;  3KYQ A;  4HP4 A;  3P7N A;  2OAP 1;  3JVU A;  5HSQ A;  4FSF A;  2VGL S;  2VKS A;  1LT0 A;  2JKT I;  4PAU A;  4EUV A;  4GHI A;  1MC0 A;  4LRX C;  2ZOI A;  3CIT A;  2GJ3 A;  2O9B A;  3FPW A;  2QJ7 A;  3PXP A;  2VGL M;  2VJW A;  4XT2 A;  4MN6 A;  1V9Y A;  3LUQ A;  3UE3 A;  5F6A A;  5DKL A;  2PD7 A;  2EWW A;  3V67 A;  4WN5 A;  2D02 A;  3LIF A;  4O0P A;  2G7U A;  2OOL A;  2PD8 A;  4MCW A;  3KYZ A;  4Q0H A;  3CI6 A;  3W2Z A;  2GZA A;  3PR6 A;  5DFY A;  1F98 A;  5AVF A;  2JN7 A;  4JGR A;  2J3T D;  2KX6 A;  4G3V A;  2V0U A;  1TS6 A;  4IUH A;  4ZRR A;  3IBR A;  2XRN A;  4CLC A;  2XSS A;  3UME A;  5J3W A;  4EEU A;  3BW6 A;  4QPR A;  1VB6 A;  3E98 A;  4RQ9 A;  4HNB A;  3T4K A;  3DBA A;  5MC7 A;  3EQV A;  4XT2 B;  2OWH A;  3HJI A;  1H8M A;  2HJ9 C;  1XJ3 A;  3BWL A;  3VE4 A;  5DJT A;  4PKY A;  2VA0 A;  1S4S A;  2VLG A;  5TJJ A;  3K3C A;  4II7 A;  4Y2F A;  3G6O A;  5K5B A;  2O0Y A;  1WA9 A;  4NXE A;  3CAX A;  4BBV A;  1GSX A;  1YSP A;  2NUT C;  3EGD C;  1S4R A;  4CLC C;  2L1M A;  3KSH A;  3KSG A;  2PDR A;  4AFI A;  4BBT A;  4NXB A;  2EA9 A;  4CLC B;  1KOU A;  3LIE A;  4Y5F A;  5AJG A;  4I38 A;  4YWZ A;  3KSF A;  1XFN A;  2V9A A;  5J4E A;  4FOF A;  3A0R A;  3CUE A;  3BJN A;  3ZQ5 A;  1H3Q A;  2ZMV A;  1OTE A;  1S67 L;  4I5S A;  5G4Y A;  3UB7 A;  5IS1 A;  3NOT C;  3JVV A;  3HJK A;  3PBN A;  1ZTU A;  3LIA A;  3OCL A;  1XFQ A;  4G3W A;  4MN5 A;  2M7V A;  3T4S A;  3BQA A;  3UB9 A;  4BBU A;  1P9R A;  3T4Q A;  5DJU A;  3T4T A;  1TS7 A;  3TW8 A;  2VZW A;  3P01 A;  4EW7 A;  3OBF A;  3EWK A;  4GS9 B;  3LR4 A;  2A2L A;  5TBM A;  4GW9 A;  4EER A;  1X0O A;  1MZU A;  4CLC D;  1W63 M;  2W1R A;  4R3A A;  1T1C A;  1N9L A;  3H7W A;  1S1Y A;  5DKK A;  3NOP C;  2KLI A;  2W3F A;  2XA7 S;  4Y3I A;  3SW1 A;  3F1P B;  5HZH A;  2R78 A;  1UWP X;  3PBR A;  4H6J A;  4NXG A;  4OOM A;  5AVE A;  4YOF A;  4KQO A;  3MFX A;  1G6O A;  1Y28 A;  5HDC A;  1OJ5 A;  4YNR A;  3HCY A;  1S66 L;  2XA7 M;  2EWV A;  2NUP C;  1YKD A;  5HDS A;  3LR5 A;  4JGP A;  4DN0 A;  3LFV A;  3MXQ A;  2PR5 A;  2JKR I;  3R4K A;  2IA2 A;  2P08 A;  2Y8H A;  4K08 A;  3D3O A;  3FG8 A;  3UB6 A;  3FPV A;  4GLQ A;  3U2A A;  4JGO A;  4L9F A;  2K7S A;  3VV4 A;  4KQD A;  3MQ0 A;  4CLC E;  5HWW A;  4HIA A;  1YSQ A;  4IJG A;  4WEL A;  2M7U A;  3GEC A;  3D72 A;  2V1A A;  1W63 Q;  2WKR A;  4GHI B;  4UQI M;  3EQU A;  1N9O A;  3T4O A;  3PHY A;  4HH2 A;  2L4R A;  5HL6 A;  2GNX A;  2I9V A;  2YKH A;  4H6J B;  5IT5 A;  2ZMF A;  1F5M A;  4I3A A;  5EFW A;  2VX8 A;  3S7N A;  2VV6 A;  4I3J A;  1DP6 A;  1XJ6 A;  2K31 A;  1OPX A;  3H82 A;  2B18 A;  2ZBB A;  4P6Z S;  2M1C A;  2W3G A;  4HP9 A;  3H9W A;  3FC7 A;  5DF9 A;  1V9Z A;  4GJ4 A;  1TS0 A;  1OT9 A;  4DJ2 A;  4EET B;  4F3L A;  1TS8 A;  4WUJ A;  2W27 A;  2VV8 A;  3S7P A;  4HQA A;  2QJ5 A;  1T1A A;  3NHQ A;  3B47 A;  4P6Z M;  4Q0J A;  3LI8 A;  1NWZ A;  4CQH A;  1UGU A;  4KUK A;  3C8C A;  1OTB A;  3RFB A;  1P0Z A;  3MMH A;  3MQO A;  2A24 A;  4DJ3 A;  1T18 A;  2PHY A;  3TE8 A;  1LSV A;  4M4X A;  2PYR A;  2QWS A;  4ME4 A;  2PYP A;  1D06 A;  1DP9 A;  1G28 A;  1OTI A;  3C30 A;  1P9W A;  4EU0 A;  2Y79 A;  3F1O A;  3ICY A;  5FL3 A;  2W0N A;  5DFX A;  2VEA A;  3BY9 A;  4E04 A;  3OLO A;  4HJ4 A;  1S1Z A;  2JHE A;  3C2W A;  2W1T A;  3UB8 A;  4I3I A;  2BAS A;  4UEY A;  2XRO A;  1TD5 A;  2FZ0 A;  4O8G A;  3T4L A;  2PR6 A;  2LB5 A;  1DP8 A;  2P7J A;  1OT6 A;  3LID A;  3A0V A;  3LYX A;  3CLO A;  4WEK A;  1P97 A;  3E4Q A;  4LRY C;  5HWV A;  3MR0 A;  4KUO A;  3ULF A;  5HD3 A;  3BY8 A;  2W3D A;  4LRZ E;  2O99 A;  1BYW A;  1VHM A;  3UMD A;  4EEP A;  5HD5 A;  3CUE C;  4JGQ A;  2MJ6 A;  4BMW A;  2HF6 A;  5HDD A;  2QKP A;  2OAQ 1;  4L9G A;  3LIC A;  3EEH A;  3NJA A;  2KDK A;  3MJQ A;  2OWJ A;  3RTY A;  1MKM A;  3B42 A;  3BQ8 A;  1ZHH B;  1D7E A;  4Q0I A;  2INW A;  2W1T B;  3E0Y A;  3K3D A;  4NXF A;  4L0L A;  4Z1W A;  4R6L A;  4NEE D;  4IHQ A;  1DRM A;  5J7E A;  3IBJ A;  2Z6D A;  3MQQ A;  2FH5 A;  1NLZ A;  2D01 A;  4ARZ A;  2HJE A;  5IU1 A;  3TRC A;  4UQI S;  4MDZ A;  5TBM B;  3F1N A;  2B02 A;  4L9E A;  3R7W A;  3MF0 A;  2Z6C A;  2PT7 A;  4PKY G;  3O5Y A;  4MMN A;  1TF1 A;  3UE6 A;  5F5Y A;  1ODV A;  3H7W B;  1IOU A;  2JKT M;  1LSX A;  3CWF A;  4DMZ A;  5G4Z A;  4B9O A;  1STZ A;  5F69 A;  3T50 A;  3IS2 A;  3PBS A;  3TJZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...