4JGQA

The crystal structure of sporulation kinase d mutant sensor domain, r131a, from bacillus subtilis subsp in co-crystallization with pyruvate
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
203
structure length
203
Chain Sequence
b'KDTIAAEHKQEASVLLNLHRNKINYLIGETMARMTSLSIAIDRPVDIKKMQSILEKTFDSEPRFSGLYFLNAKGDVTASTTELKTKVNLADASFFIKAKETKKTVISDSYSSRITGQPIFTICVPVLDSKRNVTDYLVAAIQIDYLKNLINLLSPDVYIEVVNQDGKMIFASGQASHAEDQKPVSGYLDDISWNMKVYPNPVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sporulation kinase D
publication title Insight into the sporulation phosphorelay: Crystal structure of the sensor domain of Bacillus subtilis histidine kinase, KinD.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Transferase
total genus 54
structure length 203
sequence length 203
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4jgqA02
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4jgqA01
1OJGA 5J7EA 3LICA 1XJ2A 3NOTC 2PDRA 3NOPC 1GSVA 3NHQA 1NWZA 1TS0A 2QJ5A 4MN6A 4HP9A 3RTYA 1DP6A 2KX6A 2QWSA 4DJ3A 1LSVA 3UB9A 3LUQA 1N9OA 4RQ9A 5DJTA 2Z6DA 4L9GA 2V1AA 5HWTA 2PHYA 2W27A 3LIDA 1JNUA 2KDKA 3HJIA 1EW0A 5HZHA 1DRMA 1TS8A 3VE4A 4EERA 4B9OA 3E4OA 1N9NA 3UMDA 3IBRA 4JGOA 3LI9A 2WKQA 3ICYA 5F69A 4GW9A 3ZQ5A 4NXFA 3H7WB 1XJ3A 5HDSA 3A0SA 4YWZA 3KX0X 2VV8A 5TBMB 5TBMA 1UWPX 2OOLA 4XT2A 1LT0A 2W0NA 1S67L 4H6JB 4EQ1A 3UB6A 4PKYG 5I5LA 5AVEA 1OT9A 1DP9A 3H9WA 1UGUA 3MJQA 1VB6A 4R6LA 2A24A 2QKPA 1OTEA 3RH8B 1BYWA 2ZOIA 4I3IA 2PD8A 2EA9A 1S66L 4HNBA 4NXGA 2INWA 5HWWA 3PYPA 3HJKA 1X0OA 3D72A 2VV7A 4WF0A 2Z6CA 3OLOA 2P7JA 4I5SA 1D06A 1S4RA 2BASA 4HIAA 5DJUA 3UMEA 5F5YA 3LIBA 3UB8A 1F98A 5DKLA 4BBVA 4R70A 4BBUA 1LSWA 4WLAA 2QHKA 1F9IA 5IS1A 2OWJA 2OWHA 2H28A 4K08A 4I3JA 3UE6A 1P0ZA 1ODVA 2QJ7A 3K3CA 2CMNA 1XFNA 4KUKA 4I3AA 3EEHA 3CWFA 3UB7A 1KOUA 4NXEA 1OTIA 3LIFA 4LPZA 4HP4A 2VLGA 3A0RA 3B33A 1S1YA 2GJ3A 2JHEA 4JGQA 3LIAA 1Y28A 2YKHA 4HH2A 3C2WA 1V9YA 4EEPA 4EETB 4HI4A 1XFQA 4XT2B 1LSXA 4HJ6A 1LL8A 5KIZA 5J3WA 3G6OA 4GHIA 2L4RA 1S1ZA 4L9FA 2L1MA 1T1BA 1OTBA 5J4EA 4EEUA 3GDIA 2A24B 5HSQA 5G4YA 3IS2A 1OTAA 3ULFA 1WA9A 4M4XA 1T19A 3CAXA 3SW1A 5HDDA 3T50A 3E4QA 3LI8A 2V0UA 4E04A 4WN5A 4LRZE 4GS9A 2L0WA 4R38A 1OJ5A 2V0WA 3NJAA 2PYPA 5F68A 2D01A 4HY8A 3F1OA 3MQQA 4EXOA 3VE3A 4LRYC 4HQAA 2ZBBA 1TS7A 2I9VA 2K7SA 5HDCA 4BBTA 4HJ4A 4NXBA 1T1CA 5IU1A 2PR5A 5HD3A 3MR0A 3NOUC 2D02A 2V9AA 1XJ4A 3BY9A 1TS6A 3CLOA 3BY8A 5A8BA 1D7EA 1GSXA 5DKKA 4EESA 4LLOB 4L9EA 4HH3A 1N9LA 3EWKA 1P97A 2PD7A 2PYRA 3E4PA 4KUOA 3BWLA 4WL9A 2WKPA 3LYXA 2YKFA 2M1CA 3FG8A 4GHIB 4PKYA 3GECA 3F1NB 4KQDA 5EFWA 1XJ6A 2ZOHA 3F1NA 1T18A 2JN7A 4HOIA 3A0VA 3MQOA 4LRXC 3H7WA 4JGRA 1MZUA 5F6AA 5HWVA 1DP8A 1GSWA 3IS2B 4I39A 2J80A 5AVFA 1OT6A 2VV6A 4H6JA 5HD5A 1T1AA 3H82B 1S4SA 3FC7A 3H82A 4R3AA 3PHYA 4WUJA 4I38A 2HV1A 4GS9B 3P7NA 2VEAA 3K3DA 4HHDA 4F3LB 1OTDA 4MN5A 1UWNX 4F3LA 2PR6A 3LIEA 4GCZA 4HJ3A 4JGPA 3VOLA 3F1OB 5G4ZA 2WKRA 4EW7A 1V9ZA 2B02A 3MFXA 3F1PB 3C8CA 2V1BA 3F1PA 1G28A 4DJ2A 2R78A 3MXQA
chains in the Genus database with same CATH superfamily
4Z9QA 1VQQA 1ZTUA 1FIKA 4N9KA 1HZOA 2ZQ8A 2HDSA 5IT5A 3UPPA 4R1GA 3VV4A 3C4PA 3L9KA 2QWSA 3KO6A 4DJ3A 1IYOA 4RQ9A 4YFMA 2HDUA 4O8GA 5EV0A 4P6ZS 3EQVA 5HFOA 2PHYA 4PPRA 3DTIA 1N4OA 2Y2LA 3GMWA 2Y8HA 4XUZA 3LEZA 1DRMA 1G68A 5GHZA 1W79A 1SKOB 3KSFA 3QP4A 3UPNA 3N6IA 3DBAA 1ALQA 4E6WA 1ZKJA 4OQGA 3T1SA 3HLEA 3QP6A 3R7WB 3O5YA 5CHMA 2BTFP 2PBDP 5FAOA 3T4JA 3G32A 3A0SA 4YWZA 4YINA 3KX0X 2VV8A 1W5DA 4EV4A 5TBMA 2WZXA 2OOLA 2PU2A 3LY4A 3CITA 2W0NA 2XRNA 2VGJA 1PIOA 1S67L 4H6JB 5L2FA 4UA6A 4KG2A 1KE0A 4PKYG 4DXBA 3K2NA 1K57C 3B3XA 4QWOA 4LV2A 4S2LA 1GA9A 4P85A 4R4RA 4GN2A 3H9WA 4C75A 4R6LA 2QKPA 1Y4OA 1YSPA 4U0XA 2ZOIA 4ETXA 1TVFA 2EA9A 4HNBA 3O3VA 1NRJA 3HBRA 3ITBA 3PYPA 5A91A 2WZZA 1X0OA 3UB5P 1FCNA 3CPTB 5TFQA 1D06A 4P6BA 1K54C 3BM6A 2ZQ7A 1P9WA 5F5YA 3L7HA 5DKLA 5FA7A 3RXXA 5EOOA 4RA7A 2XSSA 5EVIB 3DWKA 4GKUA 1L3LA 2PAVP 1L0FA 5IS1A 3QP5A 1H8YA 3TJZC 4MNRA 2ZMFA 3ZGAB 2H28A 3M2JA 4KG5A 2CMNA 1MY8A 5DF9A 3BFDA 4KUKA 4XXRA 3PAGA 4I3AA 3OPPA 4EQIA 4PMAA 3UB7A 2O9BA 5E2HA 1OTIA 3Q81A 4JBFA 4LPZA 2JKTI 2Y2PA 4HP4A 3A0RA 1K55A 2HF6A 3T1RA 4Y0OA 4ZRRA 1S1YA 3T4SA 2W3DA 5CECA 1LL9A 3A3EA 3TSGA 4BWIA 2JHEA 4QD4A 2K2NA 3BEBA 4HEFA 1S0WA 1Y28A 1FQGA 4ZJ1A 3ZG7B 1PWCA 4GJ4A 3G2ZA 4G3VA 1NLZA 1V9YA 4NETA 4JXVA 4XT2B 3SS3A 5FQMA 3IT9A 1LL8A 2G7UA 5J3WA 3ITAA 3G6OA 4FD8A 2WKIA 2L4RA 1ES5A 5LBRA 5E2EA 4CLCB 2Z2LB 4GLQA 2Y2KA 3NY4A 1T1BA 4YNRA 2P9VB 4EEUA 1I2SA 1CEFA 2A24B 5G4YA 1YM1A 3NBLA 3IS2A 3ISGA 1OTAA 5E2GA 5GLBA 4IJGA 4M4XA 3AGFA 3FKWA 1T19A 4KZ8A 3CAXA 3IF5A 5KSCA 5HDDA 3DAVA 1FSWA 4OPYA 3V5MA 2V0UA 4S2JA 1C3BA 1QMFA 5F83A 4C3QA 1LI0A 1VETA 4IUHA 4OVDA 3GSGA 2XQZA 4Y15A 5EOEA 1FR6A 4GS9A 2HP6A 1XP4A 2L0WA 3HLCA 2WUQA 4R38A 1TF1A 4KQOA 4EBPA 5EVLA 5KSHA 4ARZA 4XUXA 5GLAA 1ES4A 1DJCA 4EXOA 4S2NC 5M1AA 2WADA 4K91A 1MKMA 5FQQA 3WRTA 4HJ4A 3ZG8B 1W8QA 2Q9NA 5HD3A 1LI9A 3MR0A 4UA9A 3S4XA 2D02A 4FH4A 4ZBEA 1ERQA 2O9AA 2KOIA 3BY9A 1TS6A 1D1JA 3MZEA 3HLWA 1JWZA 5DKKA 2FH5A 4G3KA 4OQIA 5CHJA 1PNEA 4WZ5C 2DCFA 3E4PA 4KUOA 2DMWA 2XD5A 4B4ZA 1ZHHB 3LYXA 3PXPA 4LCMA 3VOZA 1K6SA 3U2AA 3VFFA 1XJ6A 2G2UA 2JC7A 3R7WA 4Q0JA 5GHYA 2LB9A 3MXSA 1PWGA 4GD8A 3PTEA 3NIAA 5L07A 5AVFA 1BLPA 3OPHA 5FL3A 1KVMA 2A3UA 4H6JA 1T1AA 4FOFA 5GHXA 3GQZA 1W7FA 4WUJA 1S6RA 4B88A 3P7NA 5AJGA 4HHDA 1AXBA 4DXCA 1XX2A 4MN5A 1CI9A 3IHAA 1YPRA 1MWSA 3SOIA 4BJPA 5A93A 2O99A 1PZPA 1FILA 2PBYA 4OOMA 5A92A 1SDEA 1OMEA 5CERA 2ZC4B 1WYBA 5CXWA 3VSLA 3F1PB 2CC1A 3TG9A 2V1BA 1G28A 2VZWA 4KZ4A 3QP8A 5DFYA 3LICA 1GA0A 1Y54A 1XJ2A 3UE3A 3VMAA 3DTEA 1E25A 3S1YA 2BLSA 3G30A 3NOPC 4DDYA 1GSVA 2C5WB 3IXHA 3MSHA 3W2ZA 2QJ5A 1DP6A 4RVAA 3VOYA 2KX6A 2ACGA 1TDGA 3WS4A 4UA7A 2DRWA 3BFFA 1LSVA 3UB9A 3IH9A 3W4QA 4E3JA 2Z6DA 4EU0A 2JKRI 2XEPA 4BL2A 2W3HA 1CQAA 3Q7ZA 1MWUA 5HPFA 2Q0OA 1YKDA 4DE3A 1NYMA 3Q07A 3VE4A 2EX6A 1RP5A 2R9WA 1XXMA 2EXBA 3BFEA 4EERA 2EX9A 3PBOA 5HL1A 3IBRA 1ESUA 4G3WA 3BFCA 2VGLS 5F69A 2WKEA 3VP0A 2XR0A 1FR1A 3CZDA 4BMWA 4WEKA 4YOFA 2K31A 1NZOA 1UWPX 4XT2A 4PM9A 1LT0A 4MN7A 2NUPC 1L2SA 1LHYA 1NLYA 2XA7S 2P08A 5AQAA 5AVEA 2WKHA 3IX8A 4GZBA 1SHVA 4ESPA 2HP9A 2P9VA 1UGUA 2ZC5B 1RGYA 2A24A 2B18A 4DE0A 2EX2A 1OTEA 4FUWA 2JKFA 3E0YA 4HBUA 3KSGA 4R23A 5GLDA 5HWWA 5I94A 3TE8A 2ZMVA 4WF0A 3NC8A 4I5SA 1S4RA 2KLIA 4PM7A 1JVJA 4QY6A 3M6BA 2OAQ1 1J3WA 1ONHA 3FKVA 3WS5A 5FAPA 1E3UD 5FI2A 2XGNA 3KSIA 3ZDJA 3EOIA 3FPWA 4OQHA 4KZ7A 1F9IA 3ZG0A 2OV5A 3T4LA 4K0WA 5CEBA 3N7WA 3IXDA 4I3JA 1ODVA 3IWOA 3IXBA 3P01A 5CTNA 4NKPA 3IF6C 1PW1A 4IUKA 3JPUA 2VKSA 3M2KA 4UEYA 3CWFA 1YLPA 3LR3A 4KZ3A 3DTMA 1KVLA 4WEJA 2H5SA 2MJ6A 2WAEA 4S2IA 5L10A 4QPRA 3PBSA 4PM8A 2GJ3A 4Q0HA 5G18A 4DKIA 4GOGA 5FQ9A 4O0PA 4DN0A 2OSUA 4Y7PA 3N8LA 4NG2A 2VK3A 4DDSA 4EEPA 1XFQA 2A49A 2ZQCA 3OPLA 1LSXA 4NK3A 4HJ6A 5EVID 4OPQA 3ZG5A 4LFUA 1DJAA 1OTBA 4MBKA 5E2FA 4IEDA 1ZC2A 4EUVA 3BJNA 5EVEA 1PYYA 4ZTKA 3GDIA 2VX8A 1K55C 1HLUP 3EEAA 4P6ZM 3MF0A 3IF6A 3SW1A 4X55A 1YLTA 3T50A 1IYPA 2Y2GA 2XDMA 4WN5A 3A3FA 3Q82A 4LRZE 3VP4A 5FDHA 4HESA 4Z1WA 4JPMA 1BSGA 1VEUB 1OJ5A 4NEED 2W1TB 4MBFA 2PYPA 2M7UA 3IX4A 3Q7VA 2A2LA 5F68A 5MC7A 3FYZA 4R3JA 3VE3A 1MPLA 1STZA 2ZBBA 2B5RA 5HDCA 2VA0A 4BBTA 1FSYA 4CLCD 5FAQA 4R0QA 1G5UA 3BLSA 3OPRA 5IU1A 4CQHA 3PAEA 2RL3A 1KGGA 3UDIA 1XJ4A 3FZCA 3D4FA 3LFVA 2JKRM 3CLOA 3BY8A 4OPRA 3I7JA 4Y0TA 1D7EA 3V67A 1XPBA 4UQIM 4X68A 2Y4AA 4LLOB 2XF3A 3T4TA 3IWQA 3G35A 3MMHA 1NY0A 3SZTA 4N1HA 2C6WB 2Y91A 1IOUA 3BWLA 3BYDA 4WL9A 4UAAA 3WS2A 4DMZA 5CGXA 3QNBA 4E3KA 3OCNA 3O87A 2YKFA 2M1CA 4GHIB 2V20A 2XFSA 5EECA 3VP2A 1PRQA 4OOYA 3BQAA 5EFWA 2ZOHA 3F1NA 2UWXA 4HOIA 3A0VA 1L0EA 1BLSA 4JGRA 3T4KA 3U4LP 4KZBA 5HWVA 2ZC6B 4GB7A 4X1LA 2J9OA 3A3IA 3ZHHA 2EXAA 4E3IA 1OT6A 1KDSA 1GHPA 5HD5A 1S4SA 3A3JA 2R9XA 3OCLA 2Q9MA 1F2KA 3H82A 2H0TA 4R3AA 3FWLA 2EX8A 2ZL1A 4II7A 2VEAA 4WMCD 5FQJA 4B4XA 2HDQA 4RYEA 1JWVA 1UWNX 2H10A 4F3LA 2PR6A 4WZ4A 4PM6A 3MBZA 1XA7A 4HJ3A 4JGPA 4A5RA 3OZHA 3HLFA 2HPBA 2ZLYA 3VOLA 4KENB 1JTGA 3E2LA 3F1OB 1YAXA 4EW7A 1V9ZA 2B02A 3C8CA 5CTMA 1YMSA 2EFXA 2J9PA 3MXQA 1OJGA 4BL3A 4KZ9A 2J3TD 3IWIA 2PDRA 2HDRA 1KGEA 2HJEA 1FCOA 4Y5FA 1DY6A 1IKGA 1H8MA 4HP9A 4K0XA 4WYYA 1NRFA 3C4OA 4O01A 3UDXA 2O9CA 5C5KA 4S2OA 3UE0A 3NI9A 4MDZA 4N1XA 5DJTA 3LO7A 4OLDA 4L9GA 2V1AA 4X1MA 4MEZA 2W27A 3LIDA 1CF0A 3S22A 5U47A 3S7OA 4X56A 1F5MA 1EWZA 5CX7A 4BD1A 5HZHA 2ZQ9A 3ZNTA 1XGJA 4WM9A 4B9OA 1YLZA 3E4OA 3LY3A 1SKOA 1N9NA 3UMDA 5TR7A 4B93A 3AGEA 4JGOA 1N9BA 3T4QA 1E4DA 3LI9A 2WKQA 2Y2IA 1E3UA 3BECA 3ZQ5A 1MC0A 4H8RA 2IA2A 5DTSA 3KYZA 5HDSA 2ZC3B 5EUAA 1NXYA 5TBMB 1EI5A 3MZDA 2VJWA 2XFTA 3N4IA 4RX2A 3PBRA 3V39A 1W8YA 3G4PA 2ZM2A 2ZJ9A 4C6YA 2OAP1 4ID4A 5I5LA 4DRTA 1PW8A 3EQUA 1ERMA 1OT9A 2QPNA 2JE5A 4RX3A 1EROA 3RH8B 4QHCA 3MKFA 2PD8A 2QYBA 2XLNA 2UV0E 3E98A 1K4FA 2Y2HA 4JLFA 2VV7A 1NYYA 2Z6CA 3OLOA 1TD5A 2P7JA 4E6XA 4EUZA 3CPTA 4X69A 4JXWA 2Y79A 2GZAA 4X6TA 3LCEA 3P09A 3LIBA 2FZ0A 3W8KA 4BBUA 4ZJ2A 1LSWA 3JVVA 4WLAA 3R4KA 5EVIA 1O7EA 5FQIA 2B95A 4PHTA 4X25A 4E3NA 4ME4A 2OWHA 2XROA 3IH8A 1A0KA 4R3BA 3K3CA 5HAQA 1XA1A 4OKPA 3EEHA 4JF6A 1WE4A 2IWCA 2EWWA 1MBLA 3GV9A 4OONA 3HUMA 5CEDA 1KOUA 3GTCA 1FOFA 3D3OA 3CUEA 4ETZA 4NXEA 4S2PA 2JKTM 3LIFA 2HP5A 4BD0A 3NULA 4R4SA 5DFXA 4JXSA 4FCFA 4EWFA 2FFYA 3B33A 1YLJA 2ZMAA 3LIAA 3BRMA 4BLMA 4ZAMA 1L0GA 3HVFA 2WGWB 5EM1A 4GD6A 5HARA 1JTDA 4KZ5A 4GHIA 2XH9A 1S1ZA 3TRCA 4L9FA 2L1MA 4CLCA 5K5BA 1Z09A 2J7VA 5J4EA 2HZ5A 4WBGA 3HUNA 5HSQA 3GRJA 3PBTA 3ULFA 1PWDA 1HTZA 3O88A 3AGDA 1WA9A 5TJJA 1ES3A 5CHUA 4CPKA 2XD1A 5EE8A 2ZQAA 4GDNA 3E4QA 3PBNA 1VETB 1ES2A 3GVBA 4E04A 1JWPA 3MQ0A 3N8RA 1BLCA 3WS1A 2EFUA 4KQRA 4Y13A 3NJAA 4ARZB 2P04A 2D01A 3MXRA 1CI8A 4HY8A 5EPHA 3F1OA 5FEGA 2G2WA 4HQAA 1BUEA 3EGXC 1TS7A 1PI4A 1DJBA 2I9VA 2K7SA 1IELA 3OBFA 3VP1A 4U3TA 1TDLA 1NJ4A 4LV1A 2PR5A 3TW8A 3GR2A 4EBLA 3QNCA 4LV3A 4E3MA 5FASA 5KZHA 1H8ZA 2XA7M 4BENA 3SS4A 2GX5A 2PU4A 1Q2QA 4EESA 4WMCA 1W63Q 4U0TA 1P9RA 2V8FA 1CJFA 2VGKA 4JXGA 4L9EA 1N9LA 4DF6A 5GLCA 3RJUA 2PYRA 4LENA 4S2KA 2JBFA 3D9YA 2AVXA 4Y0UA 1IEMA 3G31A 1VM1A 3C5AA 3IBJA 3FG8A 1KDWA 3W4OA 3GECA 3T1XA 1AWIA 4P0MA 2Y59A 1T18A 4OPZA 5EM0A 4F94A 3MQOA 4FSFA 5HW3A 1VHMA 1MZUA 2EWVA 5F6AA 1H3QA 1K56A 1YLYA 2H0YA 1GSWA 5BOHA 3DTKA 4IHQA 2J80A 1KE3A 5HL6A 2LB5A 3JVUA 4CJNA 3KYQA 3FC7A 2J3WA 3HUOA 5CRFA 3SH7A 3CJMA 1K0KA 3RFBA 4UQIS 3K3DA 3UE1A 3UY6A 1NZUA 3ZFZA 2Y2QA 2GNXA 2J8YA 5FSRA 3HCYA 4M3KA 3LIEA 4OOLA 5FDSA 1K25A 3DW0A 3ZVWA 1ZG4A 2Z2MB 4KQQA 2QMIA 3NCKA 3ZYTA 3BW6A 3G34A 3LR4A 3F1PA 2R78A 4MCWA 5J7EA 1QMEA 4KZAA 5KMWA 4IBXA 3BFGA 3NOTC 5HPIA 3NHQA 1NWZA 1TS0A 4MN6A 1LLBA 3DWZA 3OC2A 3RTYA 1YLWA 1BTLA 3LR0A 3UPOA 4PAUA 2Y2NA 2X01A 3BQ8A 4JF4A 3VSKA 3LUQA 5M18A 1N9OA 3KSHA 1BT5A 5F1GA 4QY5A 1GCEA 2RCXA 3JYIA 5HWTA 1M6KA 1BLHA 5CGWA 2IWBA 3N8SA 4IVIA 3E2KA 3FV7A 1JNUA 2O0YA 1MXOA 2KDKA 2X71A 3HJIA 1EW0A 2PRFA 3C7VA 1K57A 5DF7A 5FQKA 1TS8A 4Y2FA 2IWDA 2JCHA 3MFDA 4D60A 2WK0A 1H5XA 1PFLA 1GHIA 5F1FA 1IYSA 3ICYA 4GDBA 4GW9A 4EBNA 2XK1A 5AQBA 4IBRA 4NXFA 3H7WB 1Z6FA 3O86A 5FATA 5FI6A 1XJ3A 3T4OA 4CLCE 4N9LA 3EGDC 3V50A 1PI5A 4DE2A 1I2WA 2WGWA 5E43A 1K54A 5IHVA 2Y55A 1YMXA 5M19A 3IX3A 3HLGA 1PZOA 1ESIA 4EQ1A 3UB6A 3HREA 5HAIA 2W1RA 2WYXA 1MWRA 3LGOA 1K6RA 3WS0A 2W3EA 5DVAA 1DP9A 3MJQA 1VB6A 5FEFA 3C38A 3T1QB 3FPVA 1BYWA 4I3IA 1S66L 4NXGA 2INWA 3HJKA 3D72A 4AFIA 1IFQA 4UHUA 3C30A 2BASA 5TGFA 4HIAA 1I5QA 5DJUA 3UMEA 2V1ZA 4MLLA 5DF8A 3UB8A 1F98A 4N92A 4P87A 3VP3A 1HVBA 4BBVA 4R70A 4BQMA 3BLMA 3UNWA 1TEMA 2QHKA 2Y2MA 1K56D 4LV0A 2OWJA 3PR6A 3Q1FA 4K08A 2Y2JA 3UE6A 1P0ZA 2QJ7A 2QZ6A 1XFNA 3MZFA 1OPXA 3IQAA 4QJGA 1L0DA 2Y2OA 4HBTA 5J8XA 2E8IA 4X53A 5F82A 2M7VA 3TOIA 4ZDXA 5HAPA 2VLGA 3OOVA 4OQ0A 3SS5A 2HGVA 5EVIC 1H0MA 4JGQA 4L0LA 4WELA 3T12B 1M40A 2YKHA 4HH2A 3WRZA 3UN7A 1LL5A 4OLGA 4KZ6A 2HJ9C 3C2WA 1KE4A 4OP5A 4EETB 4HI4A 3CI6A 5HX9A 1YT4A 5KIZA 4JF5A 2P74A 1J9MA 1O07A 2OLUA 2WGVA 1FCMA 4FTXA 3HLDA 5L09A 3CUEC 1WYCA 3SH8A 4S2NA 4Q8IA 1RCJA 1XKZA 3ZNYA 1CK3A 2BG1A 2FFFB 1MWTA 1BZAA 1K4EA 3IHBA 5L8MA 3PBQA 4PM5A 1SZVA 2E8JA 1Q2PA 1G6OA 3IF6B 3HL9A 3M6HA 2ZM8A 2V2FF 4ZJ3A 3P98A 4E3OA 5DTTA 2GDNA 1KGFA 2ZC7A 3LI8A 4QB8A 4DE1A 3IXGA 3B42A 1G6AA 3V3SA 4E3LA 1HD8A 4S2MA 2V0WA 1VEUA 3WWXA 3Q7VB 2W1TA 5AQ9A 4WZ5A 4CLCC 2NUTC 3ZG9B 4Y3IA 1K38A 3MQQA 4LGWA 4LRYC 3B47A 1U60A 2V8CA 2WGIA 1IKIA 4LCLA 5DTKA 3G2YA 2OLVA 4NXBA 3MKEA 3S7PA 3S7QA 1T1CA 4O7DA 3W4PA 3VFHA 3NOUC 1ONGA 2V9AA 3C7UA 1MKIA 5JYOA 2W3GA 3NDEA 5CGSA 1SCWA 5A8BA 1W63M 2PT7A 4OH0A 3SH9A 1GSXA 3RXWA 4FH2A 4QU3A 1YQSA 3QP2A 5AQ7A 4HH3A 3EWKA 4Q0IA 3ZCZA 4D2OA 1P97A 1ZG6A 3UDFA 2PD7A 2DNSA 3LR5A 4JKTA 2WKPA 3QHYA 5A90A 5FI7A 3CG5A 3LEQA 3UO9A 1SDNA 4PKYA 5GL9A 1YSQA 3F1NB 4Y17A 4KQDA 1GHMA 2JN7A 1IYQA 4LRXC 3H7WA 1RGZA 4OP8A 5JYPA 2X02A 1CEGA 1DP8A 3IS2B 4I39A 3CMZA 3NECA 1ACFA 2VV6A 1SKFA 3NDGA 3H82B 3V3RA 2I72A 4IVKA 4KG6A 5D3OA 2ZL1B 3PHYA 3CHWP 4I38A 2ZQDA 2HV1A 4GS9B 2JKGA 4F3LB 1OTDA 1XGIA 3MS6A 4GCZA 2ZD8A 3KYEA 2J3TC 4MMNA 3ZVTA 2W3FA 3S7NA 5G4ZA 2WKRA 2VGLM 4MBHA 3MFXA 2WAFA 3HLBA 1BULA 3A3DA 4GNUA 2ZM0A 4DJ2A 3QP1A
chains in the Genus database with same CATH topology
1OJGA 5J7EA 5DFYA 3LICA 1ZTUA 2J3TD 1XJ2A 3UE3A 3NOTC 2PDRA 5IT5A 3NOPC 5HPIA 1GSVA 2HJEA 4Y5FA 3NHQA 3W2ZA 1H8MA 1NWZA 1TS0A 2QJ5A 4MN6A 4HP9A 3VV4A 3OC2A 1DP6A 3RTYA 2KX6A 2QWSA 3KO6A 3LR0A 4DJ3A 4PAUA 1LSVA 4O01A 3BQ8A 2O9CA 3UB9A 5C5KA 3LUQA 1N9OA 4RQ9A 4MDZA 3KSHA 5DJTA 2Z6DA 4O8GA 4P6ZS 4EU0A 2JKRI 4L9GA 3EQVA 2V1AA 5HWTA 2W3HA 2PHYA 2W27A 3LIDA 1JNUA 5HPFA 1YKDA 2O0YA 2KDKA 2Y8HA 3S7OA 3HJIA 1EW0A 1F5MA 5CX7A 5HZHA 1DRMA 1TS8A 4Y2FA 3VE4A 4EERA 3KSFA 3PBOA 4B9OA 3E4OA 3DBAA 1N9NA 3UMDA 3IBRA 4B93A 4JGOA 4G3WA 3T4QA 3LI9A 2WKQA 2VGLS 3ICYA 5F69A 3R7WB 4GW9A 3O5YA 1MC0A 3ZQ5A 4NXFA 2IA2A 3H7WB 3T4OA 3T4JA 4CLCE 1XJ3A 3KYZA 3A0SA 5HDSA 4YWZA 3EGDC 3KX0X 4BMWA 2VV8A 5TBMB 4WEKA 4YOFA 2VJWA 5TBMA 2K31A 1UWPX 2OOLA 4XT2A 3CITA 1LT0A 3PBRA 2W0NA 2XRNA 1S67L 4H6JB 4MN7A 4EQ1A 2NUPC 3UB6A 4PKYG 2OAP1 2W1RA 1NLYA 5I5LA 3K2NA 2XA7S 2P08A 5AVEA 3EQUA 1OT9A 2W3EA 1DP9A 3H9WA 1UGUA 3MJQA 1VB6A 4R6LA 3C38A 2A24A 2QKPA 2B18A 1YSPA 3FPVA 1OTEA 3RH8B 1BYWA 2ZOIA 3E0YA 4I3IA 4ETXA 2PD8A 2QYBA 2EA9A 3KSGA 1S66L 4HNBA 4NXGA 2INWA 5HWWA 1NRJA 3PYPA 3HJKA 3E98A 1X0OA 3D72A 3TE8A 2VV7A 2ZMVA 4WF0A 2Z6CA 3OLOA 1TD5A 2P7JA 4AFIA 1IFQA 4I5SA 1D06A 1S4RA 3C30A 2BASA 2KLIA 4HIAA 5DJUA 1P9WA 3UMEA 5F5YA 2Y79A 2GZAA 3LIBA 2OAQ1 3UB8A 2FZ0A 1F98A 5DKLA 4BBVA 4R70A 4BBUA 2XSSA 1LSWA 3JVVA 3KSIA 3EOIA 4WLAA 3R4KA 3FPWA 4PHTA 2QHKA 1F9IA 5IS1A 3T4LA 3TJZC 2OWJA 3PR6A 2ZMFA 4ME4A 2OWHA 2H28A 4K08A 2XROA 4I3JA 3UE6A 1P0ZA 1ODVA 2QJ7A 3K3CA 2CMNA 1XFNA 5DF9A 3P01A 4NKPA 1OPXA 4KUKA 4I3AA 3EEHA 4IUKA 2EWWA 2VKSA 4UEYA 3CWFA 3UB7A 2O9BA 1KOUA 3LR3A 3D3OA 3CUEA 4ETZA 4NXEA 2M7VA 1OTIA 2JKTM 3LIFA 4WEJA 2MJ6A 4LPZA 2JKTI 5DFXA 4HP4A 2VLGA 3OOVA 4QPRA 3A0RA 2HF6A 4ZRRA 3PBSA 3B33A 1S1YA 2GJ3A 3T4SA 2W3DA 4Q0HA 4BWIA 2HGVA 2JHEA 4JGQA 4L0LA 2K2NA 4O0PA 4WELA 4DN0A 3LIAA 1Y28A 2YKHA 4HH2A 4GJ4A 4G3VA 1NLZA 2HJ9C 3C2WA 1V9YA 4EEPA 4EETB 4HI4A 1XFQA 3CI6A 4XT2B 1LSXA 4HJ6A 1LL8A 2G7UA 5KIZA 5J3WA 3G6OA 4GHIA 2L4RA 1S1ZA 3TRCA 4L9FA 2L1MA 5LBRA 4CLCB 4GLQA 4CLCA 5K5BA 1T1BA 1OTBA 3CUEC 4YNRA 4EUVA 5J4EA 3BJNA 4EEUA 3GDIA 2A24B 2VX8A 5G4YA 5HSQA 3IS2A 3EEAA 1OTAA 5L8MA 3PBQA 3PBTA 4IJGA 3ULFA 1WA9A 4M4XA 1G6OA 3MF0A 4P6ZM 5TJJA 1T19A 3CAXA 3SW1A 5HDDA 3T50A 3E4QA 3LI8A 2V0UA 3PBNA 4E04A 4WN5A 4IUHA 4LRZE 3B42A 4GS9A 3MQ0A 4Z1WA 2L0WA 4R38A 1OJ5A 1TF1A 2V0WA 4NEED 4KQOA 3NJAA 2W1TB 4ARZB 2PYPA 5KSHA 2M7UA 2W1TA 4ARZA 4CLCC 2A2LA 5F68A 5MC7A 2NUTC 2P04A 2D01A 4Y3IA 4HY8A 3F1OA 3MQQA 4EXOA 3VE3A 4LRYC 1STZA 4HQAA 2ZBBA 3B47A 3EGXC 1TS7A 2I9VA 2K7SA 1MKMA 3OBFA 5HDCA 2VA0A 4BBTA 4HJ4A 4CLCD 4NXBA 3S7PA 3S7QA 1T1CA 5IU1A 2PR5A 3TW8A 4CQHA 5HD3A 3MR0A 3NOUC 2D02A 2O9AA 2V9AA 1XJ4A 2KOIA 3BY9A 2XA7M 2W3GA 3LFVA 1TS6A 2GX5A 2JKRM 3CLOA 3BY8A 5A8BA 1W63M 2PT7A 1D7EA 3V67A 1GSXA 4UQIM 5DKKA 4EESA 2FH5A 1W63Q 4G3KA 1P9RA 4LLOB 3T4TA 4L9EA 3MMHA 4HH3A 1N9LA 3EWKA 4Q0IA 1P97A 2PD7A 3LR5A 2PYRA 3E4PA 1IOUA 4KUOA 2DMWA 3BWLA 4WL9A 4DMZA 2WKPA 1ZHHB 3OCNA 3LYXA 3IBJA 2YKFA 2M1CA 3FG8A 4GHIB 4PKYA 3PXPA 3GECA 1YSQA 3F1NB 3U2AA 4KQDA 5EFWA 3BQAA 1XJ6A 2ZOHA 3F1NA 1T18A 3R7WA 4Q0JA 2JN7A 2LB9A 4HOIA 3A0VA 3MQOA 4LRXC 4FSFA 3H7WA 1VHMA 4JGRA 1MZUA 2EWVA 3T4KA 5F6AA 1H3QA 5HWVA 1DP8A 1GSWA 3IS2B 4I39A 4IHQA 2J80A 5AVFA 5FL3A 1OT6A 2VV6A 5HL6A 2LB5A 3JVUA 4H6JA 3KYQA 1T1AA 3H82B 4FOFA 5HD5A 1S4SA 3FC7A 3OCLA 3H82A 2J3WA 4R3AA 3PHYA 4WUJA 4I38A 4II7A 3RFBA 2HV1A 4UQIS 4GS9B 3P7NA 5AJGA 2VEAA 3K3DA 4HHDA 4F3LB 1OTDA 4MN5A 1UWNX 2GNXA 2PR6A 4F3LA 3HCYA 4BJPA 3LIEA 4GCZA 4OOLA 4HJ3A 2O99A 4JGPA 2J3TC 4MMNA 2W3FA 4OOMA 3VOLA 3S7NA 3F1OB 5G4ZA 1YAXA 2WKRA 4EW7A 2VGLM 1V9ZA 2B02A 3BW6A 3ZYTA 3MFXA 3F1PB 3C8CA 3LR4A 2V1BA 3F1PA 1G28A 4DJ2A 2VZWA 2R78A 4MCWA 3MXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OJG A;  5J7E A;  3LIC A;  1XJ2 A;  3NOT C;  2PDR A;  3NOP C;  1GSV A;  3NHQ A;  1NWZ A;  1TS0 A;  2QJ5 A;  4MN6 A;  4HP9 A;  3RTY A;  1DP6 A;  2KX6 A;  2QWS A;  4DJ3 A;  1LSV A;  3UB9 A;  3LUQ A;  1N9O A;  4RQ9 A;  5DJT A;  2Z6D A;  4L9G A;  2V1A A;  5HWT A;  2PHY A;  2W27 A;  3LID A;  1JNU A;  2KDK A;  3HJI A;  1EW0 A;  5HZH A;  1DRM A;  1TS8 A;  3VE4 A;  4EER A;  4B9O A;  3E4O A;  1N9N A;  3UMD A;  3IBR A;  4JGO A;  3LI9 A;  2WKQ A;  3ICY A;  5F69 A;  4GW9 A;  3ZQ5 A;  4NXF A;  3H7W B;  1XJ3 A;  5HDS A;  3A0S A;  4YWZ A;  3KX0 X;  2VV8 A;  5TBM B;  5TBM A;  1UWP X;  2OOL A;  4XT2 A;  1LT0 A;  2W0N A;  1S67 L;  4H6J B;  4EQ1 A;  3UB6 A;  4PKY G;  5I5L A;  5AVE A;  1OT9 A;  1DP9 A;  3H9W A;  1UGU A;  3MJQ A;  1VB6 A;  4R6L A;  2A24 A;  2QKP A;  1OTE A;  3RH8 B;  1BYW A;  2ZOI A;  4I3I A;  2PD8 A;  2EA9 A;  1S66 L;  4HNB A;  4NXG A;  2INW A;  5HWW A;  3PYP A;  3HJK A;  1X0O A;  3D72 A;  2VV7 A;  4WF0 A;  2Z6C A;  3OLO A;  2P7J A;  4I5S A;  1D06 A;  1S4R A;  2BAS A;  4HIA A;  5DJU A;  3UME A;  5F5Y A;  3LIB A;  3UB8 A;  1F98 A;  5DKL A;  4BBV A;  4R70 A;  4BBU A;  1LSW A;  4WLA A;  2QHK A;  1F9I A;  5IS1 A;  2OWJ A;  2OWH A;  2H28 A;  4K08 A;  4I3J A;  3UE6 A;  1P0Z A;  1ODV A;  2QJ7 A;  3K3C A;  2CMN A;  1XFN A;  4KUK A;  4I3A A;  3EEH A;  3CWF A;  3UB7 A;  1KOU A;  4NXE A;  1OTI A;  3LIF A;  4LPZ A;  4HP4 A;  2VLG A;  3A0R A;  3B33 A;  1S1Y A;  2GJ3 A;  2JHE A;  4JGQ A;  3LIA A;  1Y28 A;  2YKH A;  4HH2 A;  3C2W A;  1V9Y A;  4EEP A;  4EET B;  4HI4 A;  1XFQ A;  4XT2 B;  1LSX A;  4HJ6 A;  1LL8 A;  5KIZ A;  5J3W A;  3G6O A;  4GHI A;  2L4R A;  1S1Z A;  4L9F A;  2L1M A;  1T1B A;  1OTB A;  5J4E A;  4EEU A;  3GDI A;  2A24 B;  5HSQ A;  5G4Y A;  3IS2 A;  1OTA A;  3ULF A;  1WA9 A;  4M4X A;  1T19 A;  3CAX A;  3SW1 A;  5HDD A;  3T50 A;  3E4Q A;  3LI8 A;  2V0U A;  4E04 A;  4WN5 A;  4LRZ E;  4GS9 A;  2L0W A;  4R38 A;  1OJ5 A;  2V0W A;  3NJA A;  2PYP A;  5F68 A;  2D01 A;  4HY8 A;  3F1O A;  3MQQ A;  4EXO A;  3VE3 A;  4LRY C;  4HQA A;  2ZBB A;  1TS7 A;  2I9V A;  2K7S A;  5HDC A;  4BBT A;  4HJ4 A;  4NXB A;  1T1C A;  5IU1 A;  2PR5 A;  5HD3 A;  3MR0 A;  3NOU C;  2D02 A;  2V9A A;  1XJ4 A;  3BY9 A;  1TS6 A;  3CLO A;  3BY8 A;  5A8B A;  1D7E A;  1GSX A;  5DKK A;  4EES A;  4LLO B;  4L9E A;  4HH3 A;  1N9L A;  3EWK A;  1P97 A;  2PD7 A;  2PYR A;  3E4P A;  4KUO A;  3BWL A;  4WL9 A;  2WKP A;  3LYX A;  2YKF A;  2M1C A;  3FG8 A;  4GHI B;  4PKY A;  3GEC A;  3F1N B;  4KQD A;  5EFW A;  1XJ6 A;  2ZOH A;  3F1N A;  1T18 A;  2JN7 A;  4HOI A;  3A0V A;  3MQO A;  4LRX C;  3H7W A;  4JGR A;  1MZU A;  5F6A A;  5HWV A;  1DP8 A;  1GSW A;  3IS2 B;  4I39 A;  2J80 A;  5AVF A;  1OT6 A;  2VV6 A;  4H6J A;  5HD5 A;  1T1A A;  3H82 B;  1S4S A;  3FC7 A;  3H82 A;  4R3A A;  3PHY A;  4WUJ A;  4I38 A;  2HV1 A;  4GS9 B;  3P7N A;  2VEA A;  3K3D A;  4HHD A;  4F3L B;  1OTD A;  4MN5 A;  1UWN X;  4F3L A;  2PR6 A;  3LIE A;  4GCZ A;  4HJ3 A;  4JGP A;  3VOL A;  3F1O B;  5G4Z A;  2WKR A;  4EW7 A;  1V9Z A;  2B02 A;  3MFX A;  3F1P B;  3C8C A;  2V1B A;  3F1P A;  1G28 A;  4DJ2 A;  2R78 A;  3MXQ A; 
#chains in the Genus database with same CATH topology
 4Z9Q A;  1VQQ A;  1ZTU A;  1FIK A;  4N9K A;  1HZO A;  2ZQ8 A;  2HDS A;  5IT5 A;  3UPP A;  4R1G A;  3VV4 A;  3C4P A;  3L9K A;  2QWS A;  3KO6 A;  4DJ3 A;  1IYO A;  4RQ9 A;  4YFM A;  2HDU A;  4O8G A;  5EV0 A;  4P6Z S;  3EQV A;  5HFO A;  2PHY A;  4PPR A;  3DTI A;  1N4O A;  2Y2L A;  3GMW A;  2Y8H A;  4XUZ A;  3LEZ A;  1DRM A;  1G68 A;  5GHZ A;  1W79 A;  1SKO B;  3KSF A;  3QP4 A;  3UPN A;  3N6I A;  3DBA A;  1ALQ A;  4E6W A;  1ZKJ A;  4OQG A;  3T1S A;  3HLE A;  3QP6 A;  3R7W B;  3O5Y A;  5CHM A;  2BTF P;  2PBD P;  5FAO A;  3T4J A;  3G32 A;  3A0S A;  4YWZ A;  4YIN A;  3KX0 X;  2VV8 A;  1W5D A;  4EV4 A;  5TBM A;  2WZX A;  2OOL A;  2PU2 A;  3LY4 A;  3CIT A;  2W0N A;  2XRN A;  2VGJ A;  1PIO A;  1S67 L;  4H6J B;  5L2F A;  4UA6 A;  4KG2 A;  1KE0 A;  4PKY G;  4DXB A;  3K2N A;  1K57 C;  3B3X A;  4QWO A;  4LV2 A;  4S2L A;  1GA9 A;  4P85 A;  4R4R A;  4GN2 A;  3H9W A;  4C75 A;  4R6L A;  2QKP A;  1Y4O A;  1YSP A;  4U0X A;  2ZOI A;  4ETX A;  1TVF A;  2EA9 A;  4HNB A;  3O3V A;  1NRJ A;  3HBR A;  3ITB A;  3PYP A;  5A91 A;  2WZZ A;  1X0O A;  3UB5 P;  1FCN A;  3CPT B;  5TFQ A;  1D06 A;  4P6B A;  1K54 C;  3BM6 A;  2ZQ7 A;  1P9W A;  5F5Y A;  3L7H A;  5DKL A;  5FA7 A;  3RXX A;  5EOO A;  4RA7 A;  2XSS A;  5EVI B;  3DWK A;  4GKU A;  1L3L A;  2PAV P;  1L0F A;  5IS1 A;  3QP5 A;  1H8Y A;  3TJZ C;  4MNR A;  2ZMF A;  3ZGA B;  2H28 A;  3M2J A;  4KG5 A;  2CMN A;  1MY8 A;  5DF9 A;  3BFD A;  4KUK A;  4XXR A;  3PAG A;  4I3A A;  3OPP A;  4EQI A;  4PMA A;  3UB7 A;  2O9B A;  5E2H A;  1OTI A;  3Q81 A;  4JBF A;  4LPZ A;  2JKT I;  2Y2P A;  4HP4 A;  3A0R A;  1K55 A;  2HF6 A;  3T1R A;  4Y0O A;  4ZRR A;  1S1Y A;  3T4S A;  2W3D A;  5CEC A;  1LL9 A;  3A3E A;  3TSG A;  4BWI A;  2JHE A;  4QD4 A;  2K2N A;  3BEB A;  4HEF A;  1S0W A;  1Y28 A;  1FQG A;  4ZJ1 A;  3ZG7 B;  1PWC A;  4GJ4 A;  3G2Z A;  4G3V A;  1NLZ A;  1V9Y A;  4NET A;  4JXV A;  4XT2 B;  3SS3 A;  5FQM A;  3IT9 A;  1LL8 A;  2G7U A;  5J3W A;  3ITA A;  3G6O A;  4FD8 A;  2WKI A;  2L4R A;  1ES5 A;  5LBR A;  5E2E A;  4CLC B;  2Z2L B;  4GLQ A;  2Y2K A;  3NY4 A;  1T1B A;  4YNR A;  2P9V B;  4EEU A;  1I2S A;  1CEF A;  2A24 B;  5G4Y A;  1YM1 A;  3NBL A;  3IS2 A;  3ISG A;  1OTA A;  5E2G A;  5GLB A;  4IJG A;  4M4X A;  3AGF A;  3FKW A;  1T19 A;  4KZ8 A;  3CAX A;  3IF5 A;  5KSC A;  5HDD A;  3DAV A;  1FSW A;  4OPY A;  3V5M A;  2V0U A;  4S2J A;  1C3B A;  1QMF A;  5F83 A;  4C3Q A;  1LI0 A;  1VET A;  4IUH A;  4OVD A;  3GSG A;  2XQZ A;  4Y15 A;  5EOE A;  1FR6 A;  4GS9 A;  2HP6 A;  1XP4 A;  2L0W A;  3HLC A;  2WUQ A;  4R38 A;  1TF1 A;  4KQO A;  4EBP A;  5EVL A;  5KSH A;  4ARZ A;  4XUX A;  5GLA A;  1ES4 A;  1DJC A;  4EXO A;  4S2N C;  5M1A A;  2WAD A;  4K91 A;  1MKM A;  5FQQ A;  3WRT A;  4HJ4 A;  3ZG8 B;  1W8Q A;  2Q9N A;  5HD3 A;  1LI9 A;  3MR0 A;  4UA9 A;  3S4X A;  2D02 A;  4FH4 A;  4ZBE A;  1ERQ A;  2O9A A;  2KOI A;  3BY9 A;  1TS6 A;  1D1J A;  3MZE A;  3HLW A;  1JWZ A;  5DKK A;  2FH5 A;  4G3K A;  4OQI A;  5CHJ A;  1PNE A;  4WZ5 C;  2DCF A;  3E4P A;  4KUO A;  2DMW A;  2XD5 A;  4B4Z A;  1ZHH B;  3LYX A;  3PXP A;  4LCM A;  3VOZ A;  1K6S A;  3U2A A;  3VFF A;  1XJ6 A;  2G2U A;  2JC7 A;  3R7W A;  4Q0J A;  5GHY A;  2LB9 A;  3MXS A;  1PWG A;  4GD8 A;  3PTE A;  3NIA A;  5L07 A;  5AVF A;  1BLP A;  3OPH A;  5FL3 A;  1KVM A;  2A3U A;  4H6J A;  1T1A A;  4FOF A;  5GHX A;  3GQZ A;  1W7F A;  4WUJ A;  1S6R A;  4B88 A;  3P7N A;  5AJG A;  4HHD A;  1AXB A;  4DXC A;  1XX2 A;  4MN5 A;  1CI9 A;  3IHA A;  1YPR A;  1MWS A;  3SOI A;  4BJP A;  5A93 A;  2O99 A;  1PZP A;  1FIL A;  2PBY A;  4OOM A;  5A92 A;  1SDE A;  1OME A;  5CER A;  2ZC4 B;  1WYB A;  5CXW A;  3VSL A;  3F1P B;  2CC1 A;  3TG9 A;  2V1B A;  1G28 A;  2VZW A;  4KZ4 A;  3QP8 A;  5DFY A;  3LIC A;  1GA0 A;  1Y54 A;  1XJ2 A;  3UE3 A;  3VMA A;  3DTE A;  1E25 A;  3S1Y A;  2BLS A;  3G30 A;  3NOP C;  4DDY A;  1GSV A;  2C5W B;  3IXH A;  3MSH A;  3W2Z A;  2QJ5 A;  1DP6 A;  4RVA A;  3VOY A;  2KX6 A;  2ACG A;  1TDG A;  3WS4 A;  4UA7 A;  2DRW A;  3BFF A;  1LSV A;  3UB9 A;  3IH9 A;  3W4Q A;  4E3J A;  2Z6D A;  4EU0 A;  2JKR I;  2XEP A;  4BL2 A;  2W3H A;  1CQA A;  3Q7Z A;  1MWU A;  5HPF A;  2Q0O A;  1YKD A;  4DE3 A;  1NYM A;  3Q07 A;  3VE4 A;  2EX6 A;  1RP5 A;  2R9W A;  1XXM A;  2EXB A;  3BFE A;  4EER A;  2EX9 A;  3PBO A;  5HL1 A;  3IBR A;  1ESU A;  4G3W A;  3BFC A;  2VGL S;  5F69 A;  2WKE A;  3VP0 A;  2XR0 A;  1FR1 A;  3CZD A;  4BMW A;  4WEK A;  4YOF A;  2K31 A;  1NZO A;  1UWP X;  4XT2 A;  4PM9 A;  1LT0 A;  4MN7 A;  2NUP C;  1L2S A;  1LHY A;  1NLY A;  2XA7 S;  2P08 A;  5AQA A;  5AVE A;  2WKH A;  3IX8 A;  4GZB A;  1SHV A;  4ESP A;  2HP9 A;  2P9V A;  1UGU A;  2ZC5 B;  1RGY A;  2A24 A;  2B18 A;  4DE0 A;  2EX2 A;  1OTE A;  4FUW A;  2JKF A;  3E0Y A;  4HBU A;  3KSG A;  4R23 A;  5GLD A;  5HWW A;  5I94 A;  3TE8 A;  2ZMV A;  4WF0 A;  3NC8 A;  4I5S A;  1S4R A;  2KLI A;  4PM7 A;  1JVJ A;  4QY6 A;  3M6B A;  2OAQ 1;  1J3W A;  1ONH A;  3FKV A;  3WS5 A;  5FAP A;  1E3U D;  5FI2 A;  2XGN A;  3KSI A;  3ZDJ A;  3EOI A;  3FPW A;  4OQH A;  4KZ7 A;  1F9I A;  3ZG0 A;  2OV5 A;  3T4L A;  4K0W A;  5CEB A;  3N7W A;  3IXD A;  4I3J A;  1ODV A;  3IWO A;  3IXB A;  3P01 A;  5CTN A;  4NKP A;  3IF6 C;  1PW1 A;  4IUK A;  3JPU A;  2VKS A;  3M2K A;  4UEY A;  3CWF A;  1YLP A;  3LR3 A;  4KZ3 A;  3DTM A;  1KVL A;  4WEJ A;  2H5S A;  2MJ6 A;  2WAE A;  4S2I A;  5L10 A;  4QPR A;  3PBS A;  4PM8 A;  2GJ3 A;  4Q0H A;  5G18 A;  4DKI A;  4GOG A;  5FQ9 A;  4O0P A;  4DN0 A;  2OSU A;  4Y7P A;  3N8L A;  4NG2 A;  2VK3 A;  4DDS A;  4EEP A;  1XFQ A;  2A49 A;  2ZQC A;  3OPL A;  1LSX A;  4NK3 A;  4HJ6 A;  5EVI D;  4OPQ A;  3ZG5 A;  4LFU A;  1DJA A;  1OTB A;  4MBK A;  5E2F A;  4IED A;  1ZC2 A;  4EUV A;  3BJN A;  5EVE A;  1PYY A;  4ZTK A;  3GDI A;  2VX8 A;  1K55 C;  1HLU P;  3EEA A;  4P6Z M;  3MF0 A;  3IF6 A;  3SW1 A;  4X55 A;  1YLT A;  3T50 A;  1IYP A;  2Y2G A;  2XDM A;  4WN5 A;  3A3F A;  3Q82 A;  4LRZ E;  3VP4 A;  5FDH A;  4HES A;  4Z1W A;  4JPM A;  1BSG A;  1VEU B;  1OJ5 A;  4NEE D;  2W1T B;  4MBF A;  2PYP A;  2M7U A;  3IX4 A;  3Q7V A;  2A2L A;  5F68 A;  5MC7 A;  3FYZ A;  4R3J A;  3VE3 A;  1MPL A;  1STZ A;  2ZBB A;  2B5R A;  5HDC A;  2VA0 A;  4BBT A;  1FSY A;  4CLC D;  5FAQ A;  4R0Q A;  1G5U A;  3BLS A;  3OPR A;  5IU1 A;  4CQH A;  3PAE A;  2RL3 A;  1KGG A;  3UDI A;  1XJ4 A;  3FZC A;  3D4F A;  3LFV A;  2JKR M;  3CLO A;  3BY8 A;  4OPR A;  3I7J A;  4Y0T A;  1D7E A;  3V67 A;  1XPB A;  4UQI M;  4X68 A;  2Y4A A;  4LLO B;  2XF3 A;  3T4T A;  3IWQ A;  3G35 A;  3MMH A;  1NY0 A;  3SZT A;  4N1H A;  2C6W B;  2Y91 A;  1IOU A;  3BWL A;  3BYD A;  4WL9 A;  4UAA A;  3WS2 A;  4DMZ A;  5CGX A;  3QNB A;  4E3K A;  3OCN A;  3O87 A;  2YKF A;  2M1C A;  4GHI B;  2V20 A;  2XFS A;  5EEC A;  3VP2 A;  1PRQ A;  4OOY A;  3BQA A;  5EFW A;  2ZOH A;  3F1N A;  2UWX A;  4HOI A;  3A0V A;  1L0E A;  1BLS A;  4JGR A;  3T4K A;  3U4L P;  4KZB A;  5HWV A;  2ZC6 B;  4GB7 A;  4X1L A;  2J9O A;  3A3I A;  3ZHH A;  2EXA A;  4E3I A;  1OT6 A;  1KDS A;  1GHP A;  5HD5 A;  1S4S A;  3A3J A;  2R9X A;  3OCL A;  2Q9M A;  1F2K A;  3H82 A;  2H0T A;  4R3A A;  3FWL A;  2EX8 A;  2ZL1 A;  4II7 A;  2VEA A;  4WMC D;  5FQJ A;  4B4X A;  2HDQ A;  4RYE A;  1JWV A;  1UWN X;  2H10 A;  4F3L A;  2PR6 A;  4WZ4 A;  4PM6 A;  3MBZ A;  1XA7 A;  4HJ3 A;  4JGP A;  4A5R A;  3OZH A;  3HLF A;  2HPB A;  2ZLY A;  3VOL A;  4KEN B;  1JTG A;  3E2L A;  3F1O B;  1YAX A;  4EW7 A;  1V9Z A;  2B02 A;  3C8C A;  5CTM A;  1YMS A;  2EFX A;  2J9P A;  3MXQ A;  1OJG A;  4BL3 A;  4KZ9 A;  2J3T D;  3IWI A;  2PDR A;  2HDR A;  1KGE A;  2HJE A;  1FCO A;  4Y5F A;  1DY6 A;  1IKG A;  1H8M A;  4HP9 A;  4K0X A;  4WYY A;  1NRF A;  3C4O A;  4O01 A;  3UDX A;  2O9C A;  5C5K A;  4S2O A;  3UE0 A;  3NI9 A;  4MDZ A;  4N1X A;  5DJT A;  3LO7 A;  4OLD A;  4L9G A;  2V1A A;  4X1M A;  4MEZ A;  2W27 A;  3LID A;  1CF0 A;  3S22 A;  5U47 A;  3S7O A;  4X56 A;  1F5M A;  1EWZ A;  5CX7 A;  4BD1 A;  5HZH A;  2ZQ9 A;  3ZNT A;  1XGJ A;  4WM9 A;  4B9O A;  1YLZ A;  3E4O A;  3LY3 A;  1SKO A;  1N9N A;  3UMD A;  5TR7 A;  4B93 A;  3AGE A;  4JGO A;  1N9B A;  3T4Q A;  1E4D A;  3LI9 A;  2WKQ A;  2Y2I A;  1E3U A;  3BEC A;  3ZQ5 A;  1MC0 A;  4H8R A;  2IA2 A;  5DTS A;  3KYZ A;  5HDS A;  2ZC3 B;  5EUA A;  1NXY A;  5TBM B;  1EI5 A;  3MZD A;  2VJW A;  2XFT A;  3N4I A;  4RX2 A;  3PBR A;  3V39 A;  1W8Y A;  3G4P A;  2ZM2 A;  2ZJ9 A;  4C6Y A;  2OAP 1;  4ID4 A;  5I5L A;  4DRT A;  1PW8 A;  3EQU A;  1ERM A;  1OT9 A;  2QPN A;  2JE5 A;  4RX3 A;  1ERO A;  3RH8 B;  4QHC A;  3MKF A;  2PD8 A;  2QYB A;  2XLN A;  2UV0 E;  3E98 A;  1K4F A;  2Y2H A;  4JLF A;  2VV7 A;  1NYY A;  2Z6C A;  3OLO A;  1TD5 A;  2P7J A;  4E6X A;  4EUZ A;  3CPT A;  4X69 A;  4JXW A;  2Y79 A;  2GZA A;  4X6T A;  3LCE A;  3P09 A;  3LIB A;  2FZ0 A;  3W8K A;  4BBU A;  4ZJ2 A;  1LSW A;  3JVV A;  4WLA A;  3R4K A;  5EVI A;  1O7E A;  5FQI A;  2B95 A;  4PHT A;  4X25 A;  4E3N A;  4ME4 A;  2OWH A;  2XRO A;  3IH8 A;  1A0K A;  4R3B A;  3K3C A;  5HAQ A;  1XA1 A;  4OKP A;  3EEH A;  4JF6 A;  1WE4 A;  2IWC A;  2EWW A;  1MBL A;  3GV9 A;  4OON A;  3HUM A;  5CED A;  1KOU A;  3GTC A;  1FOF A;  3D3O A;  3CUE A;  4ETZ A;  4NXE A;  4S2P A;  2JKT M;  3LIF A;  2HP5 A;  4BD0 A;  3NUL A;  4R4S A;  5DFX A;  4JXS A;  4FCF A;  4EWF A;  2FFY A;  3B33 A;  1YLJ A;  2ZMA A;  3LIA A;  3BRM A;  4BLM A;  4ZAM A;  1L0G A;  3HVF A;  2WGW B;  5EM1 A;  4GD6 A;  5HAR A;  1JTD A;  4KZ5 A;  4GHI A;  2XH9 A;  1S1Z A;  3TRC A;  4L9F A;  2L1M A;  4CLC A;  5K5B A;  1Z09 A;  2J7V A;  5J4E A;  2HZ5 A;  4WBG A;  3HUN A;  5HSQ A;  3GRJ A;  3PBT A;  3ULF A;  1PWD A;  1HTZ A;  3O88 A;  3AGD A;  1WA9 A;  5TJJ A;  1ES3 A;  5CHU A;  4CPK A;  2XD1 A;  5EE8 A;  2ZQA A;  4GDN A;  3E4Q A;  3PBN A;  1VET B;  1ES2 A;  3GVB A;  4E04 A;  1JWP A;  3MQ0 A;  3N8R A;  1BLC A;  3WS1 A;  2EFU A;  4KQR A;  4Y13 A;  3NJA A;  4ARZ B;  2P04 A;  2D01 A;  3MXR A;  1CI8 A;  4HY8 A;  5EPH A;  3F1O A;  5FEG A;  2G2W A;  4HQA A;  1BUE A;  3EGX C;  1TS7 A;  1PI4 A;  1DJB A;  2I9V A;  2K7S A;  1IEL A;  3OBF A;  3VP1 A;  4U3T A;  1TDL A;  1NJ4 A;  4LV1 A;  2PR5 A;  3TW8 A;  3GR2 A;  4EBL A;  3QNC A;  4LV3 A;  4E3M A;  5FAS A;  5KZH A;  1H8Z A;  2XA7 M;  4BEN A;  3SS4 A;  2GX5 A;  2PU4 A;  1Q2Q A;  4EES A;  4WMC A;  1W63 Q;  4U0T A;  1P9R A;  2V8F A;  1CJF A;  2VGK A;  4JXG A;  4L9E A;  1N9L A;  4DF6 A;  5GLC A;  3RJU A;  2PYR A;  4LEN A;  4S2K A;  2JBF A;  3D9Y A;  2AVX A;  4Y0U A;  1IEM A;  3G31 A;  1VM1 A;  3C5A A;  3IBJ A;  3FG8 A;  1KDW A;  3W4O A;  3GEC A;  3T1X A;  1AWI A;  4P0M A;  2Y59 A;  1T18 A;  4OPZ A;  5EM0 A;  4F94 A;  3MQO A;  4FSF A;  5HW3 A;  1VHM A;  1MZU A;  2EWV A;  5F6A A;  1H3Q A;  1K56 A;  1YLY A;  2H0Y A;  1GSW A;  5BOH A;  3DTK A;  4IHQ A;  2J80 A;  1KE3 A;  5HL6 A;  2LB5 A;  3JVU A;  4CJN A;  3KYQ A;  3FC7 A;  2J3W A;  3HUO A;  5CRF A;  3SH7 A;  3CJM A;  1K0K A;  3RFB A;  4UQI S;  3K3D A;  3UE1 A;  3UY6 A;  1NZU A;  3ZFZ A;  2Y2Q A;  2GNX A;  2J8Y A;  5FSR A;  3HCY A;  4M3K A;  3LIE A;  4OOL A;  5FDS A;  1K25 A;  3DW0 A;  3ZVW A;  1ZG4 A;  2Z2M B;  4KQQ A;  2QMI A;  3NCK A;  3ZYT A;  3BW6 A;  3G34 A;  3LR4 A;  3F1P A;  2R78 A;  4MCW A;  5J7E A;  1QME A;  4KZA A;  5KMW A;  4IBX A;  3BFG A;  3NOT C;  5HPI A;  3NHQ A;  1NWZ A;  1TS0 A;  4MN6 A;  1LLB A;  3DWZ A;  3OC2 A;  3RTY A;  1YLW A;  1BTL A;  3LR0 A;  3UPO A;  4PAU A;  2Y2N A;  2X01 A;  3BQ8 A;  4JF4 A;  3VSK A;  3LUQ A;  5M18 A;  1N9O A;  3KSH A;  1BT5 A;  5F1G A;  4QY5 A;  1GCE A;  2RCX A;  3JYI A;  5HWT A;  1M6K A;  1BLH A;  5CGW A;  2IWB A;  3N8S A;  4IVI A;  3E2K A;  3FV7 A;  1JNU A;  2O0Y A;  1MXO A;  2KDK A;  2X71 A;  3HJI A;  1EW0 A;  2PRF A;  3C7V A;  1K57 A;  5DF7 A;  5FQK A;  1TS8 A;  4Y2F A;  2IWD A;  2JCH A;  3MFD A;  4D60 A;  2WK0 A;  1H5X A;  1PFL A;  1GHI A;  5F1F A;  1IYS A;  3ICY A;  4GDB A;  4GW9 A;  4EBN A;  2XK1 A;  5AQB A;  4IBR A;  4NXF A;  3H7W B;  1Z6F A;  3O86 A;  5FAT A;  5FI6 A;  1XJ3 A;  3T4O A;  4CLC E;  4N9L A;  3EGD C;  3V50 A;  1PI5 A;  4DE2 A;  1I2W A;  2WGW A;  5E43 A;  1K54 A;  5IHV A;  2Y55 A;  1YMX A;  5M19 A;  3IX3 A;  3HLG A;  1PZO A;  1ESI A;  4EQ1 A;  3UB6 A;  3HRE A;  5HAI A;  2W1R A;  2WYX A;  1MWR A;  3LGO A;  1K6R A;  3WS0 A;  2W3E A;  5DVA A;  1DP9 A;  3MJQ A;  1VB6 A;  5FEF A;  3C38 A;  3T1Q B;  3FPV A;  1BYW A;  4I3I A;  1S66 L;  4NXG A;  2INW A;  3HJK A;  3D72 A;  4AFI A;  1IFQ A;  4UHU A;  3C30 A;  2BAS A;  5TGF A;  4HIA A;  1I5Q A;  5DJU A;  3UME A;  2V1Z A;  4MLL A;  5DF8 A;  3UB8 A;  1F98 A;  4N92 A;  4P87 A;  3VP3 A;  1HVB A;  4BBV A;  4R70 A;  4BQM A;  3BLM A;  3UNW A;  1TEM A;  2QHK A;  2Y2M A;  1K56 D;  4LV0 A;  2OWJ A;  3PR6 A;  3Q1F A;  4K08 A;  2Y2J A;  3UE6 A;  1P0Z A;  2QJ7 A;  2QZ6 A;  1XFN A;  3MZF A;  1OPX A;  3IQA A;  4QJG A;  1L0D A;  2Y2O A;  4HBT A;  5J8X A;  2E8I A;  4X53 A;  5F82 A;  2M7V A;  3TOI A;  4ZDX A;  5HAP A;  2VLG A;  3OOV A;  4OQ0 A;  3SS5 A;  2HGV A;  5EVI C;  1H0M A;  4JGQ A;  4L0L A;  4WEL A;  3T12 B;  1M40 A;  2YKH A;  4HH2 A;  3WRZ A;  3UN7 A;  1LL5 A;  4OLG A;  4KZ6 A;  2HJ9 C;  3C2W A;  1KE4 A;  4OP5 A;  4EET B;  4HI4 A;  3CI6 A;  5HX9 A;  1YT4 A;  5KIZ A;  4JF5 A;  2P74 A;  1J9M A;  1O07 A;  2OLU A;  2WGV A;  1FCM A;  4FTX A;  3HLD A;  5L09 A;  3CUE C;  1WYC A;  3SH8 A;  4S2N A;  4Q8I A;  1RCJ A;  1XKZ A;  3ZNY A;  1CK3 A;  2BG1 A;  2FFF B;  1MWT A;  1BZA A;  1K4E A;  3IHB A;  5L8M A;  3PBQ A;  4PM5 A;  1SZV A;  2E8J A;  1Q2P A;  1G6O A;  3IF6 B;  3HL9 A;  3M6H A;  2ZM8 A;  2V2F F;  4ZJ3 A;  3P98 A;  4E3O A;  5DTT A;  2GDN A;  1KGF A;  2ZC7 A;  3LI8 A;  4QB8 A;  4DE1 A;  3IXG A;  3B42 A;  1G6A A;  3V3S A;  4E3L A;  1HD8 A;  4S2M A;  2V0W A;  1VEU A;  3WWX A;  3Q7V B;  2W1T A;  5AQ9 A;  4WZ5 A;  4CLC C;  2NUT C;  3ZG9 B;  4Y3I A;  1K38 A;  3MQQ A;  4LGW A;  4LRY C;  3B47 A;  1U60 A;  2V8C A;  2WGI A;  1IKI A;  4LCL A;  5DTK A;  3G2Y A;  2OLV A;  4NXB A;  3MKE A;  3S7P A;  3S7Q A;  1T1C A;  4O7D A;  3W4P A;  3VFH A;  3NOU C;  1ONG A;  2V9A A;  3C7U A;  1MKI A;  5JYO A;  2W3G A;  3NDE A;  5CGS A;  1SCW A;  5A8B A;  1W63 M;  2PT7 A;  4OH0 A;  3SH9 A;  1GSX A;  3RXW A;  4FH2 A;  4QU3 A;  1YQS A;  3QP2 A;  5AQ7 A;  4HH3 A;  3EWK A;  4Q0I A;  3ZCZ A;  4D2O A;  1P97 A;  1ZG6 A;  3UDF A;  2PD7 A;  2DNS A;  3LR5 A;  4JKT A;  2WKP A;  3QHY A;  5A90 A;  5FI7 A;  3CG5 A;  3LEQ A;  3UO9 A;  1SDN A;  4PKY A;  5GL9 A;  1YSQ A;  3F1N B;  4Y17 A;  4KQD A;  1GHM A;  2JN7 A;  1IYQ A;  4LRX C;  3H7W A;  1RGZ A;  4OP8 A;  5JYP A;  2X02 A;  1CEG A;  1DP8 A;  3IS2 B;  4I39 A;  3CMZ A;  3NEC A;  1ACF A;  2VV6 A;  1SKF A;  3NDG A;  3H82 B;  3V3R A;  2I72 A;  4IVK A;  4KG6 A;  5D3O A;  2ZL1 B;  3PHY A;  3CHW P;  4I38 A;  2ZQD A;  2HV1 A;  4GS9 B;  2JKG A;  4F3L B;  1OTD A;  1XGI A;  3MS6 A;  4GCZ A;  2ZD8 A;  3KYE A;  2J3T C;  4MMN A;  3ZVT A;  2W3F A;  3S7N A;  5G4Z A;  2WKR A;  2VGL M;  4MBH A;  3MFX A;  2WAF A;  3HLB A;  1BUL A;  3A3D A;  4GNU A;  2ZM0 A;  4DJ2 A;  3QP1 A; 
#chains in the Genus database with same CATH homology
 1OJG A;  5J7E A;  5DFY A;  3LIC A;  1ZTU A;  2J3T D;  1XJ2 A;  3UE3 A;  3NOT C;  2PDR A;  5IT5 A;  3NOP C;  5HPI A;  1GSV A;  2HJE A;  4Y5F A;  3NHQ A;  3W2Z A;  1H8M A;  1NWZ A;  1TS0 A;  2QJ5 A;  4MN6 A;  4HP9 A;  3VV4 A;  3OC2 A;  1DP6 A;  3RTY A;  2KX6 A;  2QWS A;  3KO6 A;  3LR0 A;  4DJ3 A;  4PAU A;  1LSV A;  4O01 A;  3BQ8 A;  2O9C A;  3UB9 A;  5C5K A;  3LUQ A;  1N9O A;  4RQ9 A;  4MDZ A;  3KSH A;  5DJT A;  2Z6D A;  4O8G A;  4P6Z S;  4EU0 A;  2JKR I;  4L9G A;  3EQV A;  2V1A A;  5HWT A;  2W3H A;  2PHY A;  2W27 A;  3LID A;  1JNU A;  5HPF A;  1YKD A;  2O0Y A;  2KDK A;  2Y8H A;  3S7O A;  3HJI A;  1EW0 A;  1F5M A;  5CX7 A;  5HZH A;  1DRM A;  1TS8 A;  4Y2F A;  3VE4 A;  4EER A;  3KSF A;  3PBO A;  4B9O A;  3E4O A;  3DBA A;  1N9N A;  3UMD A;  3IBR A;  4B93 A;  4JGO A;  4G3W A;  3T4Q A;  3LI9 A;  2WKQ A;  2VGL S;  3ICY A;  5F69 A;  3R7W B;  4GW9 A;  3O5Y A;  1MC0 A;  3ZQ5 A;  4NXF A;  2IA2 A;  3H7W B;  3T4O A;  3T4J A;  4CLC E;  1XJ3 A;  3KYZ A;  3A0S A;  5HDS A;  4YWZ A;  3EGD C;  3KX0 X;  4BMW A;  2VV8 A;  5TBM B;  4WEK A;  4YOF A;  2VJW A;  5TBM A;  2K31 A;  1UWP X;  2OOL A;  4XT2 A;  3CIT A;  1LT0 A;  3PBR A;  2W0N A;  2XRN A;  1S67 L;  4H6J B;  4MN7 A;  4EQ1 A;  2NUP C;  3UB6 A;  4PKY G;  2OAP 1;  2W1R A;  1NLY A;  5I5L A;  3K2N A;  2XA7 S;  2P08 A;  5AVE A;  3EQU A;  1OT9 A;  2W3E A;  1DP9 A;  3H9W A;  1UGU A;  3MJQ A;  1VB6 A;  4R6L A;  3C38 A;  2A24 A;  2QKP A;  2B18 A;  1YSP A;  3FPV A;  1OTE A;  3RH8 B;  1BYW A;  2ZOI A;  3E0Y A;  4I3I A;  4ETX A;  2PD8 A;  2QYB A;  2EA9 A;  3KSG A;  1S66 L;  4HNB A;  4NXG A;  2INW A;  5HWW A;  1NRJ A;  3PYP A;  3HJK A;  3E98 A;  1X0O A;  3D72 A;  3TE8 A;  2VV7 A;  2ZMV A;  4WF0 A;  2Z6C A;  3OLO A;  1TD5 A;  2P7J A;  4AFI A;  1IFQ A;  4I5S A;  1D06 A;  1S4R A;  3C30 A;  2BAS A;  2KLI A;  4HIA A;  5DJU A;  1P9W A;  3UME A;  5F5Y A;  2Y79 A;  2GZA A;  3LIB A;  2OAQ 1;  3UB8 A;  2FZ0 A;  1F98 A;  5DKL A;  4BBV A;  4R70 A;  4BBU A;  2XSS A;  1LSW A;  3JVV A;  3KSI A;  3EOI A;  4WLA A;  3R4K A;  3FPW A;  4PHT A;  2QHK A;  1F9I A;  5IS1 A;  3T4L A;  3TJZ C;  2OWJ A;  3PR6 A;  2ZMF A;  4ME4 A;  2OWH A;  2H28 A;  4K08 A;  2XRO A;  4I3J A;  3UE6 A;  1P0Z A;  1ODV A;  2QJ7 A;  3K3C A;  2CMN A;  1XFN A;  5DF9 A;  3P01 A;  4NKP A;  1OPX A;  4KUK A;  4I3A A;  3EEH A;  4IUK A;  2EWW A;  2VKS A;  4UEY A;  3CWF A;  3UB7 A;  2O9B A;  1KOU A;  3LR3 A;  3D3O A;  3CUE A;  4ETZ A;  4NXE A;  2M7V A;  1OTI A;  2JKT M;  3LIF A;  4WEJ A;  2MJ6 A;  4LPZ A;  2JKT I;  5DFX A;  4HP4 A;  2VLG A;  3OOV A;  4QPR A;  3A0R A;  2HF6 A;  4ZRR A;  3PBS A;  3B33 A;  1S1Y A;  2GJ3 A;  3T4S A;  2W3D A;  4Q0H A;  4BWI A;  2HGV A;  2JHE A;  4JGQ A;  4L0L A;  2K2N A;  4O0P A;  4WEL A;  4DN0 A;  3LIA A;  1Y28 A;  2YKH A;  4HH2 A;  4GJ4 A;  4G3V A;  1NLZ A;  2HJ9 C;  3C2W A;  1V9Y A;  4EEP A;  4EET B;  4HI4 A;  1XFQ A;  3CI6 A;  4XT2 B;  1LSX A;  4HJ6 A;  1LL8 A;  2G7U A;  5KIZ A;  5J3W A;  3G6O A;  4GHI A;  2L4R A;  1S1Z A;  3TRC A;  4L9F A;  2L1M A;  5LBR A;  4CLC B;  4GLQ A;  4CLC A;  5K5B A;  1T1B A;  1OTB A;  3CUE C;  4YNR A;  4EUV A;  5J4E A;  3BJN A;  4EEU A;  3GDI A;  2A24 B;  2VX8 A;  5G4Y A;  5HSQ A;  3IS2 A;  3EEA A;  1OTA A;  5L8M A;  3PBQ A;  3PBT A;  4IJG A;  3ULF A;  1WA9 A;  4M4X A;  1G6O A;  3MF0 A;  4P6Z M;  5TJJ A;  1T19 A;  3CAX A;  3SW1 A;  5HDD A;  3T50 A;  3E4Q A;  3LI8 A;  2V0U A;  3PBN A;  4E04 A;  4WN5 A;  4IUH A;  4LRZ E;  3B42 A;  4GS9 A;  3MQ0 A;  4Z1W A;  2L0W A;  4R38 A;  1OJ5 A;  1TF1 A;  2V0W A;  4NEE D;  4KQO A;  3NJA A;  2W1T B;  4ARZ B;  2PYP A;  5KSH A;  2M7U A;  2W1T A;  4ARZ A;  4CLC C;  2A2L A;  5F68 A;  5MC7 A;  2NUT C;  2P04 A;  2D01 A;  4Y3I A;  4HY8 A;  3F1O A;  3MQQ A;  4EXO A;  3VE3 A;  4LRY C;  1STZ A;  4HQA A;  2ZBB A;  3B47 A;  3EGX C;  1TS7 A;  2I9V A;  2K7S A;  1MKM A;  3OBF A;  5HDC A;  2VA0 A;  4BBT A;  4HJ4 A;  4CLC D;  4NXB A;  3S7P A;  3S7Q A;  1T1C A;  5IU1 A;  2PR5 A;  3TW8 A;  4CQH A;  5HD3 A;  3MR0 A;  3NOU C;  2D02 A;  2O9A A;  2V9A A;  1XJ4 A;  2KOI A;  3BY9 A;  2XA7 M;  2W3G A;  3LFV A;  1TS6 A;  2GX5 A;  2JKR M;  3CLO A;  3BY8 A;  5A8B A;  1W63 M;  2PT7 A;  1D7E A;  3V67 A;  1GSX A;  4UQI M;  5DKK A;  4EES A;  2FH5 A;  1W63 Q;  4G3K A;  1P9R A;  4LLO B;  3T4T A;  4L9E A;  3MMH A;  4HH3 A;  1N9L A;  3EWK A;  4Q0I A;  1P97 A;  2PD7 A;  3LR5 A;  2PYR A;  3E4P A;  1IOU A;  4KUO A;  2DMW A;  3BWL A;  4WL9 A;  4DMZ A;  2WKP A;  1ZHH B;  3OCN A;  3LYX A;  3IBJ A;  2YKF A;  2M1C A;  3FG8 A;  4GHI B;  4PKY A;  3PXP A;  3GEC A;  1YSQ A;  3F1N B;  3U2A A;  4KQD A;  5EFW A;  3BQA A;  1XJ6 A;  2ZOH A;  3F1N A;  1T18 A;  3R7W A;  4Q0J A;  2JN7 A;  2LB9 A;  4HOI A;  3A0V A;  3MQO A;  4LRX C;  4FSF A;  3H7W A;  1VHM A;  4JGR A;  1MZU A;  2EWV A;  3T4K A;  5F6A A;  1H3Q A;  5HWV A;  1DP8 A;  1GSW A;  3IS2 B;  4I39 A;  4IHQ A;  2J80 A;  5AVF A;  5FL3 A;  1OT6 A;  2VV6 A;  5HL6 A;  2LB5 A;  3JVU A;  4H6J A;  3KYQ A;  1T1A A;  3H82 B;  4FOF A;  5HD5 A;  1S4S A;  3FC7 A;  3OCL A;  3H82 A;  2J3W A;  4R3A A;  3PHY A;  4WUJ A;  4I38 A;  4II7 A;  3RFB A;  2HV1 A;  4UQI S;  4GS9 B;  3P7N A;  5AJG A;  2VEA A;  3K3D A;  4HHD A;  4F3L B;  1OTD A;  4MN5 A;  1UWN X;  2GNX A;  2PR6 A;  4F3L A;  3HCY A;  4BJP A;  3LIE A;  4GCZ A;  4OOL A;  4HJ3 A;  2O99 A;  4JGP A;  2J3T C;  4MMN A;  2W3F A;  4OOM A;  3VOL A;  3S7N A;  3F1O B;  5G4Z A;  1YAX A;  2WKR A;  4EW7 A;  2VGL M;  1V9Z A;  2B02 A;  3BW6 A;  3ZYT A;  3MFX A;  3F1P B;  3C8C A;  3LR4 A;  2V1B A;  3F1P A;  1G28 A;  4DJ2 A;  2VZW A;  2R78 A;  4MCW A;  3MXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...