4JGRA

The crystal structure of sporulation kinase d mutant sensor domain, r131a, from bacillus subtilis subsp at 2.4a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
203
structure length
202
Chain Sequence
b'DTIAAEHKQEASVLLNLHRNKINYLIGETMARMTSLSIAIDRPVDIKKMQSILEKTFDEPRFSGLYFLNAKGDVTASTTELKTKVNLADASFFIKAKETKKTVISDSYSSRITGQPIFTICVPVLDSKRNVTDYLVAAIQIDYLKNLINLLSPDVYIEVVNQDGKMIFASGQASHAEDQKPVSGYLDDISWNMKVYPNPVTI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sporulation kinase D
molecule tags Transferase
source organism Bacillus subtilis subsp. subtilis
publication title Insight into the sporulation phosphorelay: Crystal structure of the sensor domain of Bacillus subtilis histidine kinase, KinD.
pubmed doi rcsb
total genus 53
structure length 202
sequence length 203
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4jgrA02
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4jgrA01
4PKYA 1MZUA 1S67L 1WA9A 4HJ6A 5F69A 4GW9A 4HJ3A 4I3AA 4EW7A 5G4ZA 4R70A 1S66L 3MFXA 2PR5A 4L9GA 2QJ5A 3BWLA 5I5LA 1DP6A 1N9NA 2A24A 2EA9A 2V1AA 1N9OA 2OOLA 3K3CA 4KUOA 1DP8A 1OTEA 2ZOIA 4K08A 4LPZA 5DKKA 3F1PB 1BYWA 1N9LA 1OTAA 3B33A 3H9WA 4F3LA 5HWWA 1GSWA 1TS8A 3UB8A 1KOUA 3VOLA 1XJ6A 2OWHA 3HJIA 3E4QA 1XJ4A 1D06A 4HP4A 5DKLA 4HH3A 4JGPA 2L0WA 3HJKA 3MJQA 5J3WA 2GJ3A 3SW1A 4R38A 1S4RA 1GSVA 3F1NA 3PYPA 2B02A 5DJTA 4I3JA 1GSXA 1XJ2A 3EWKA 4HHDA 3LYXA 2D02A 4GS9B 1P97A 3FG8A 5HDSA 5HD3A 1TS6A 4I3IA 4WL9A 2QHKA 5J4EA 3F1OB 2PDRA 5HDDA 2VV7A 3FC7A 1OT9A 1ODVA 1OT6A 2YKFA 3LICA 5AVFA 5HD5A 3RTYA 4BBUA 5HZHA 4EEUA 2J80A 2PYRA 1S4SA 4EEPA 4H6JB 4WN5A 3E4PA 3C2WA 3C8CA 3UB7A 3MQOA 5HWVA 3MR0A 1LT0A 2JN7A 1S1YA 1UGUA 2K7SA 4RQ9A 3UB6A 3LIEA 1NWZA 4BBVA 4R3AA 4WF0A 4DJ3A 1DRMA 2QWSA 4EETB 2PD8A 3A0RA 5F5YA 1G28A 4EESA 4EERA 3UE6A 1OJ5A 2W0NA 3UB9A 3CLOA 5IS1A 2R78A 4B9OA 3A0SA 1XJ3A 5IU1A 4DJ2A 4E04A 3GDIA 3LUQA 1T1CA 3MQQA 4LLOB 1OJGA 1OTBA 4WLAA 4H6JA 4EQ1A 1UWNX 3EEHA 3CAXA 1VB6A 2INWA 3H7WA 2YKHA 3BY8A 2OWJA 3OLOA 2D01A 5DJUA 5TBMB 4LRXC 1DP9A 5HWTA 3ULFA 2V1BA 4NXFA 2PHYA 2WKRA 1UWPX 3ZQ5A 4GS9A 2VLGA 2JHEA 1LSVA 1T19A 2PYPA 1LL8A 4KQDA 1EW0A 2VV6A 2W27A 3VE4A 4JGRA 4GCZA 4LRZE 1T1BA 1TS7A 3T50A 1XFQA 2L4RA 2ZOHA 3NOPC 4LRYC 1XFNA 5HDCA 4XT2B 1LSXA 3BY9A 3MXQA 4MN6A 2P7JA 3NJAA 4NXEA 5J7EA 3UMEA 2I9VA 4M4XA 1Y28A 3F1PA 4GHIB 4EXOA 2WKPA 3NOUC 3IS2B 4NXBA 4YWZA 4F3LB 4JGQA 4GHIA 2QKPA 1V9YA 3CWFA 2V0WA 4I5SA 4PKYG 2A24B 4I39A 4MN5A 4XT2A 2Z6DA 3G6OA 1F98A 3K3DA 4JGOA 4WUJA 3F1OA 2HV1A 1S1ZA 5F6AA 5KIZA 1LSWA 3NHQA 3P7NA 5A8BA 4NXGA 1F9IA 1JNUA 1TS0A 2V0UA 4HOIA 4BBTA 2V9AA 3F1NB 2PD7A 1OTDA 2BASA 1T1AA 1OTIA 4HJ4A 2ZBBA 2CMNA 3PHYA 4L9EA 4L9FA 2KDKA 4HQAA 5TBMA 3LI8A 5AVEA 2H28A 3IS2A 3H82B 3VE3A 3IBRA 3H7WB 3LIDA 3LIBA 4HP9A 2WKQA 3D72A 4HY8A 2Z6CA 5F68A 4KUKA 3LIAA 3RH8B 4HH2A 1X0OA 4HI4A 2QJ7A 2L1MA 3A0VA 3H82A 2VV8A 3LIFA 2VEAA 2KX6A 2M1CA 1T18A 3GECA 3ICYA 5G4YA 3UMDA 5HSQA 1D7EA 1P0ZA 3KX0X 3LI9A 2PR6A 4HIAA 4HNBA 4R6LA 1V9ZA 4I38A 3NOTC 5EFWA 3E4OA
chains in the Genus database with same CATH superfamily
3GRJA 3QNBA 5FL3A 2LB9A 5G4ZA 2LB5A 2Y91A 3IBJA 4LCMA 4LPZA 2OAP1 1PFLA 4GDNA 1FCNA 3ZG8B 3UB8A 3O88A 4AFIA 3EOIA 3HCYA 5EV0A 4Q8IA 2XLNA 1XJ2A 4YINA 5HPIA 1TS6A 3TE8A 2OSUA 1LL5A 2VV7A 1EI5A 3MQOA 2WZZA 5FDHA 4OPQA 4R3AA 4X68A 3WRZA 4P87A 3A0SA 4DJ2A 4WEKA 1W63M 4G3VA 1TDGA 4RVAA 1YSPA 3HLBA 4R4SA 5HFOA 3T1QB 3ZG0A 4R23A 3IX4A 2XDMA 5IT5A 2JHEA 4WZ4A 5L2FA 1PW1A 5EVIB 3HVFA 2X71A 3C4PA 1E3UD 3W4PA 1NLZA 4GKUA 5J7EA 4MBKA 1IEMA 4M4XA 3KYEA 4JGQA 2P08A 5FA7A 3B42A 3FYZA 4KZ4A 5AQBA 4MMNA 2B5RA 3F1OA 4UAAA 1E4DA 4ETXA 5A8BA 2W3GA 4IJGA 5AQ9A 3V39A 1BULA 3E0YA 4NK3A 2ZMAA 2KLIA 2X02A 4P0MA 3HLCA 3V50A 3MSHA 1W7FA 3IXBA 3HLWA 3T12B 3ZYTA 4CLCD 1YT4A 3UDIA 4QPRA 2UV0E 4X25A 5GLBA 1TS8A 2WGWB 3VOLA 2K31A 2G2WA 1K54A 3Q7VA 3LR5A 5JYOA 3VOZA 2V20A 1J3WA 4GS9B 4FD8A 5HD3A 3IXGA 1KVMA 4KENB 4JLFA 3FWLA 5FAQA 5EPHA 2H5SA 2A49A 2K7SA 1XXMA 1ERMA 3UB9A 2Y2JA 1I2WA 5GLAA 3B3XA 3ZVTA 1W8YA 4E6XA 2INWA 3OLOA 3VSLA 5HWTA 3ZHHA 5KSCA 4PM8A 1TVFA 4Y17A 1NY0A 3S7PA 3NDEA 2L4RA 4PM9A 3LO7A 3UPNA 2WKPA 2GNXA 2V0WA 1S1ZA 5CXWA 1SDNA 3MZFA 4R4RA 1IYSA 5FAOA 2X01A 5EVEA 1K38A 2ZBBA 3DWZA 3MZEA 5GHZA 1L3LA 4S2NC 3VE3A 3RXWA 4P6ZS 4U3TA 3G4PA 1G6AA 5G4YA 1JWZA 3Q1FA 3C4OA 1P0ZA 3LI9A 3W4OA 4DN0A 4I38A 3BQ8A 1MWUA 4JBFA 5FQ9A 3TJZC 1TDLA 1BT5A 4Y0UA 1KGEA 2PT7A 4HH3A 2B95A 1M40A 1HD8A 4EQIA 3PYPA 1XA7A 3OPRA 4EWFA 3CUEC 3BYDA 1KE4A 5HDSA 4Y0TA 2QHKA 1I5QA 1VHMA 2PDRA 3PR6A 4B4XA 5F5YA 3BFFA 2W3DA 3LUQA 4LLOB 2WGWA 2Y2IA 3S7OA 4Z1WA 3G35A 3RJUA 2HDUA 3Q81A 3LY4A 5CTNA 4FSFA 4JF5A 1MBLA 2PYPA 1CJFA 2M7UA 4EV4A 3T4LA 3EGDC 4IUHA 3BFDA 4MN6A 1BTLA 4EXOA 3IF5A 2Y2QA 3HREA 2J9PA 4K0WA 3T4TA 1K4EA 3NIAA 2WKIA 1JWPA 3VFFA 1JTGA 4EBPA 2PD7A 3LEQA 2Q9MA 2VGJA 3QP1A 3IS2A 3M2JA 4LV2A 2ZQDA 4OQGA 4E3OA 3UN7A 3WS5A 3PBQA 2V1ZA 3UMDA 3UDXA 1YLWA 1LHYA 1PNEA 2XQZA 4WMCD 5I5LA 3TW8A 3Q82A 1ESUA 3H9WA 4QU3A 1I2SA 2WKHA 2IWDA 4LV1A 3HJKA 4S2MA 2HJ9C 3VOYA 2UWXA 3F1NA 3R4KA 1G6OA 3LYXA 5E2EA 2FH5A 2O9AA 2YKFA 1PYYA 3UDFA 1NXYA 3FPWA 3IF6A 3C7VA 3T4OA 3W2ZA 3UB5P 4DJ3A 1PWDA 2Y59A 3CLOA 2R78A 4KG2A 3WS1A 2FZ0A 2DMWA 3MQQA 4OQHA 4WLAA 3B47A 3A3FA 3EEHA 3IX8A 2D01A 3SZTA 3ZFZA 3TSGA 5FEFA 1VEUB 5CHMA 3FZCA 1EW0A 2GX5A 2WAFA 1YLJA 3S1YA 1LL9A 4KZBA 2A24B 4YWZA 3G6OA 1XP4A 1XGJA 5FAPA 5KIZA 3P7NA 4GN2A 3V3RA 5CTMA 3IH9A 2XRNA 3F1NB 5HW3A 3OC2A 3G31A 3HUMA 3GR2A 1JWVA 5F68A 4KUKA 3KSGA 2Y2GA 1YSQA 2VV8A 5AJGA 1FR1A 1NZOA 4MNRA 1TD5A 2V8FA 1K0KA 4OP5A 3VP1A 3MFDA 1ES3A 3NOTC 4K0XA 4DE0A 3EQVA 4BD0A 4I3AA 5FSRA 4R70A 2A24A 4X1MA 4BJPA 1DP8A 2ZOIA 4K08A 1OTAA 4FTXA 5A91A 1GSWA 3QP6A 1XGIA 3QP8A 4ZAMA 4X56A 3RXXA 1GSVA 5FQIA 2HZ5A 2VA0A 1KDWA 3P01A 5GLDA 3RTYA 1XX2A 2JCHA 3MR0A 4FOFA 3HLFA 1ES2A 4MLLA 3LIEA 4O0PA 1MWRA 2XFTA 3IF6C 2FFFB 4EQ1A 3VMAA 2QZ6A 1W5DA 4JPMA 5CGXA 2J3WA 4P85A 3ZQ5A 5DFXA 4S2JA 2JKRI 4NEED 3CITA 4R1GA 4LRYC 5HDCA 3NOUC 4II7A 3G32A 1V9YA 1D1JA 5L8MA 4X69A 3M6BA 1MC0A 5CEDA 4CJNA 3SH8A 1NYMA 2WAEA 4EBNA 3G2YA 3NI9A 3WS0A 2OLUA 3IBRA 5JYPA 2QJ7A 2L1MA 3H82A 3VP3A 2GZAA 2IA2A 5EECA 5CERA 3HUOA 4GW9A 3RFBA 5DTSA 4GZBA 2Y79A 1IYQA 2A2LA 3T4QA 4BMWA 2O99A 4S2PA 1N9BA 3NC8A 1VM1A 4L0LA 4ZJ2A 4PAUA 2ZD8A 3A3DA 4Q0JA 5HL1A 1PIOA 4B4ZA 3W4QA 4P6ZM 3UPOA 1P97A 2G7UA 1K55C 1H5XA 4I3IA 1RCJA 2W1TA 1W8QA 4XUZA 4CPKA 5I94A 4E3MA 4OVDA 1HTZA 1UGUA 4BBVA 2HDQA 5F1GA 2JE5A 1G28A 1IFQA 2A3UA 2W3EA 5IU1A 4E3KA 4QJGA 2M7VA 1OJGA 3SH7A 1UWNX 1GHPA 1JTDA 3ULFA 4R3JA 5U47A 4JF4A 2JKTM 4OOMA 4KQDA 3QNCA 4JGRA 3IQAA 4R0QA 3T50A 4N1XA 3BY9A 1TEMA 4Z9QA 1Y28A 4E6WA 1SDEA 5HPFA 4KZ7A 3K3DA 4FH2A 4FH4A 4EU0A 3S7QA 2P04A 1GA9A 2PRFA 3U2AA 1T1AA 4HJ4A 3FV7A 1QMFA 4Y3IA 3A3IA 2XA7M 3ICYA 1FSYA 1YLYA 2MJ6A 2HP5A 4S2KA 4HJ6A 3BEBA 3IXDA 2ZM2A 5HARA 2V1AA 3N8SA 4DXCA 2O9BA 1OTEA 3O3VA 3B33A 1ES4A 2Y2OA 1BSGA 1XJ6A 1YPRA 2Y2HA 3D4FA 1KGGA 3ZG7B 1F2KA 3C7UA 3OOVA 2CC1A 1CEFA 3ZNYA 5K5BA 2ZJ9A 3DWKA 1MPLA 3QP4A 3ITAA 4DE2A 1OT6A 4FCFA 5M19A 3L7HA 3NECA 4OLDA 2PU2A 4ETZA 2OV5A 3UB7A 2NUPC 1Z09A 1L0DA 4EESA 4E04A 2ZQ7A 4Y13A 3CAXA 5FQJA 5BOHA 1Y4OA 5AQAA 4U0TA 3OPLA 2VLGA 4FUWA 4WM9A 5FI6A 4CLCA 4UQIS 5J8XA 1SKOA 3QP5A 4U0XA 1H8YA 3KSFA 3F1PA 2V8CA 5GHXA 3LGOA 3IHBA 4WELA 1G5UA 3WRTA 2ZL1A 1TS0A 1DY6A 3S22A 1E25A 2DRWA 3LR4A 2VGLS 5KSHA 4JXWA 1L0FA 2H28A 3H82B 3PBTA 2RL3A 4HH2A 4KG5A 3R7WA 3I7JA 2R9XA 3ITBA 2Y4AA 4IVKA 4QWOA 1V9ZA 2C5WB 3E4OA 4PKYA 3QHYA 2ZC7A 1S67L 2JKRM 3BECA 4HJ3A 1BLHA 2O0YA 2RCXA 3FKVA 4HP4A 4KZ3A 4IVIA 4KG6A 1YKDA 3DW0A 3D9YA 2Y2KA 4MBFA 2B02A 3PAGA 2P9VB 3IHAA 3MKEA 3FG8A 3WS4A 2HPBA 2JKGA 3HLDA 4HBTA 3LICA 5CGSA 1MKIA 2Z2LB 5HZHA 3LR3A 4GD8A 1DJCA 3GSGA 4OQIA 2PD8A 1QMEA 2WK0A 4IHQA 3VP0A 5EVLA 5EVID 3GDIA 3FPVA 3BFGA 2XEPA 3C38A 2Y8HA 2V1BA 5FQKA 4GLQA 4BQMA 4JKTA 3JVUA 1H3QA 1T19A 1KE0A 1OMEA 3OCNA 5FASA 4EUZA 3MZDA 1XFQA 3W8KA 5E43A 1YM1A 4OPRA 2Q9NA 1NRJA 4I5SA 3DBAA 3AGFA 1K56D 4LENA 4D2OA 2HF6A 2WZXA 3SS3A 5KZHA 4RA7A 4HP9A 4DXBA 3PXPA 3S4XA 4N1HA 4IUKA 5HSQA 4S2IA 4X55A 4R6LA 2VK3A 3C5AA 1PI4A 4ZBEA 1SCWA 3EGXC 1BZAA 1S66L 1O07A 2QJ5A 5LBRA 4YNRA 2Y2LA 4ZRRA 4ESPA 4JGPA 2L0WA 5J3WA 4DRTA 5E2FA 3P09A 2ZQ9A 4IEDA 5DJTA 1TF1A 2HJEA 4GD6A 3D3OA 2ZQ8A 1KE3A 2Y2NA 3SS4A 2VX8A 2JN7A 3UB6A 1YMXA 3KYQA 1Q2PA 5CX7A 3NDGA 1K56A 4QY5A 4WBGA 4H6JA 2JKTI 4UQIM 4Y7PA 4NXFA 4QY6A 3JVVA 3JPUA 5AQ7A 2WKEA 1N4OA 4UA9A 3ZGAB 4RX2A 1GCEA 4GCZA 5L07A 4WMCA 3DAVA 1XFNA 4F3LB 3OPHA 2E8JA 1CQAA 3KSHA 5EE8A 2QKPA 3N7WA 1RGYA 4XT2A 2Z6DA 2JC7A 3A3EA 3O87A 4JXVA 1F9IA 2XFSA 4Q0IA 1P9WA 4ME4A 2VGKA 2EWWA 1OTDA 4MCWA 3MKFA 2JBFA 4C75A 5M18A 3LIAA 2WYXA 2KX6A 2PAVP 1DJBA 4KQRA 3G2ZA 3KX0X 4ARZA 3CG5A 2W1RA 3IX3A 2EXBA 2ZMVA 4C6YA 1KDSA 4OH0A 3VV4A 2PR5A 4X6TA 2HDSA 2BLSA 1IKGA 3BWLA 4N92A 4XT2B 2EA9A 5DKLA 4S2LA 3ZDJA 4IBRA 2Q0OA 5FI7A 1K57C 1L0GA 3ISGA 3HUNA 3PBRA 3O5YA 2XK1A 5A93A 3T4KA 1KGFA 4ZJ1A 4GOGA 5L09A 1PRQA 2P9VA 4EEPA 3C8CA 5HWVA 5GHYA 3EEAA 1Y54A 4OP8A 4PM5A 4BL2A 4ZJ3A 5IS1A 1ZG4A 1S6RA 5GLCA 3IWIA 3OPPA 4LRXC 2DNSA 4JXGA 3UPPA 5FQQA 1UWPX 4UA6A 1LSVA 5IHVA 3VE4A 3UY6A 1FIKA 1LSXA 3G30A 1K6RA 1C3BA 3UMEA 2EX9A 4NXBA 4QD4A 3GQZA 4I39A 4MN5A 4DKIA 5F6AA 1U60A 2IWCA 4CLCC 4KZ8A 2V0UA 1ZHHB 3OCLA 5FDSA 5CHJA 2BASA 2XH9A 1BLPA 1MWSA 4PM7A 5E2GA 4HQAA 3EQUA 4Q0HA 5F1FA 2VEAA 1PWCA 3ZG9B 1P9RA 3BQAA 3JYIA 2WGVA 4DDYA 1N9NA 2OOLA 4NETA 1CI8A 4DE3A 1VETB 1KOUA 3WWXA 4LGWA 2H0TA 3GVBA 1G68A 2VZWA 3VP2A 3SOIA 1PI5A 3F1OB 1OT9A 1JVJA 1WE4A 2ACGA 1HVBA 1LT0A 4RQ9A 4BLMA 2DCFA 5FEGA 4WF0A 4EUVA 3OZHA 1FCMA 4E3LA 3TOIA 4A5RA 4PHTA 1W63Q 1FSWA 3PBNA 4K91A 1RP5A 3IF6B 3ZNTA 5EOEA 3HLEA 3BY8A 3CPTA 3E98A 1IYPA 4S2NA 5CECA 2ZC5B 4GS9A 5KMWA 3UNWA 1ZC2A 2W27A 5CGWA 1K25A 1YLZA 3PBSA 2ZLYA 4LFUA 3N6IA 2E8IA 3A3JA 3PTEA 3Q7ZA 4H8RA 5HAQA 1OTIA 3MF0A 2Z2MB 4L9EA 1S0WA 5G18A 5TBMA 4E3IA 3LIBA 3T1SA 3S7NA 3LIFA 1K54C 3BRMA 4HNBA 3FKWA 1MZUA 1WA9A 5EM1A 2ZM8A 3O86A 1E3UA 2QPNA 1O7EA 2ZQCA 4R38A 3GTCA 1N9OA 5DKKA 3CPTB 3NBLA 4LV0A 5EVIC 1N9LA 5HWWA 1H8ZA 4BD1A 2ZC6B 4P6BA 4GNUA 4OKPA 3ZG5A 4XXRA 4PM6A 4BBUA 2J80A 2PYRA 3OBFA 3C2WA 1BUEA 1DRMA 4F94A 1WYBA 4IBXA 2W0NA 5TR7A 1F5MA 5TJJA 1XJ3A 2EWVA 5MC7A 1NLYA 1OTBA 2P74A 5DJUA 1PWGA 1Q2QA 1NRFA 1XKZA 3CMZA 1ESIA 1YLPA 4UA7A 5CEBA 4KQQA 5HX9A 3IT9A 2P7JA 3NJAA 2B18A 2J8YA 3AGDA 4JXSA 1ZKJA 1H0MA 3LCEA 2ZM0A 5FI2A 4MEZA 5GL9A 1EWZA 1JNUA 3IWQA 3QP2A 4UEYA 2HP6A 1FOFA 1NZUA 2HDRA 5AVEA 3TG9A 2H10A 3N8RA 4DE1A 3BFEA 3A0VA 2AVXA 1CEGA 2R9WA 1YQSA 2J9OA 4B93A 2WGIA 3BLSA 1SZVA 3CUEA 5F69A 3IXHA 2VGLM 4ARZB 3MFXA 1IOUA 5L10A 4WYYA 4KUOA 3K3CA 2WUQA 2BG1A 1PW8A 2J7VA 3E4QA 2GJ3A 3AGEA 2ZQAA 3CJMA 3GV9A 4HHDA 2D02A 3FC7A 1MKMA 2FFYA 1S4SA 3CI6A 3UE6A 1ZG6A 4OQ0A 3ZCZA 2J3TD 2V2FF 3T4SA 5J4EA 5DF8A 3VP4A 2PHYA 1FR6A 3N4IA 1BLCA 4KZAA 1ONHA 2PBDP 4G3KA 1LL8A 3G34A 5TFQA 3V3SA 5EM0A 2VJWA 4N9LA 1T1BA 2BTFP 5DFYA 3LFVA 1Z6FA 3Q7VB 4GDBA 5TGFA 3MXQA 5HL6A 5A92A 4GHIB 1XPBA 1A0KA 5DTTA 2EX8A 4HESA 5A90A 4PKYG 4ZTKA 3UE0A 4KZ6A 1NJ4A 3K2NA 5HAPA 1HZOA 2WADA 3PHYA 1IELA 4HEFA 4WZ5A 4HY8A 1ES5A 3D72A 4EEUA 3RH8B 1K4FA 1KVLA 1IKIA 1CF0A 5FQMA 2M1CA 2XA7S 3MXSA 1D7EA 4YOFA 3SH9A 5DVAA 5EVIA 4DMZA 3ZVWA 1GHIA 4L9GA 2ZMFA 4MBHA 3V5MA 2HP9A 3F1PB 1BYWA 4OONA 2OWHA 1PZPA 3HJIA 3MQ0A 3LEZA 1STZA 4Y5FA 2W3FA 2KOIA 3GMWA 3EWKA 2PBYA 1AWIA 2VKSA 3T1RA 1YAXA 3DTMA 2ZC3B 3E4PA 4WZ5C 1FCOA 2QYBA 4X53A 4EERA 3A0RA 4B88A 1LLBA 4B9OA 2XD5A 2Y2PA 4BL3A 1VB6A 1VETA 1VEUA 2YKHA 3HLGA 3PAEA 4O8GA 2O9CA 3CZDA 4KZ9A 2WKRA 2IWBA 4CLCE 3DTEA 1M6KA 3CHWP 3SS5A 1TS7A 3R7WB 5EUAA 4WEJA 3BW6A 2I9VA 5DF9A 3IS2B 3BM6A 4GHIA 1SKOB 1XA1A 1LI0A 3M6HA 2J3TC 4BBTA 3BJNA 3N8LA 1W79A 3V67A 2CMNA 5CRFA 1X0OA 3KYZA 3MXRA 3UE1A 1L2SA 4D60A 2PR6A 3P98A 4O7DA 4EW7A 3MMHA 3C30A 1ALQA 4KQOA 1YLTA 1DP6A 3BLMA 3VSKA 1CK3A 3E2LA 5M1AA 3NULA 5C5KA 1D06A 3SW1A 1IYOA 1YMSA 1S4RA 5F82A 4I3JA 4WL9A 4QB8A 4PMAA 5EOOA 3Q07A 1ODVA 4YFMA 4M3KA 2W1TB 3UO9A 4WN5A 4GB7A 3NCKA 1SKFA 3KO6A 4EETB 1NWZA 2PU4A 5HAIA 2QWSA 3NY4A 3TRCA 3VFHA 1LI9A 2EX2A 3HL9A 2G2UA 4E3JA 4Y2FA 3MBZA 4R3BA 3LY3A 3WS2A 4OOYA 4RYEA 4G3WA 1DJAA 2HGVA 1AXBA 2XROA 3LR0A 1L0EA 2ZOHA 3M2KA 2JKFA 4UHUA 3E2KA 3MS6A 4XUXA 4DF6A 4O01A 3CWFA 2Y2MA 1F98A 1ONGA 4EBLA 2XD1A 2HV1A 4LCLA 4S2OA 5D3OA 2ZC4B 5CHUA 1CI9A 4ID4A 1VQQA 3DTIA 4MN7A 1ZTUA 2ZL1B 5DTKA 2KDKA 3LI8A 1NYYA 5F83A 3H7WB 2Z6CA 3PBOA 2OAQ1 4LV3A 4DDSA 4NG2A 4BENA 4HBUA 5DF7A 2I72A 4Y0OA 1J9MA 4BWIA 5EFWA 2XSSA 3IH8A 4F3LA 1PZOA 2QMIA 2GDNA 1XJ4A 1H8MA 3MJQA 1ERQA 1MWTA 3DTKA 1RGZA 1K57A 1GSXA 4GJ4A 2XF3A 4C3QA 4NKPA 2EFUA 1BLSA 5HDDA 5AVFA 5HD5A 3KSIA 3U4LP 4PPRA 2H0YA 4H6JB 4OOLA 4ZDXA 4OLGA 1S1YA 2XGNA 1EROA 2EX6A 1OJ5A 2K2NA 4OPYA 4E3NA 1T1CA 1FILA 3L9KA 3H7WA 3UE3A 2OWJA 5TBMB 1DP9A 4N9KA 5FATA 4JF6A 1MY8A 1WYCA 4CQHA 2VV6A 2C6WB 4LRZE 1OPXA 4MDZA 3NOPC 1GHMA 4NXEA 2NUTC 4X1LA 4RX3A 1FQGA 4KZ5A 4OPZA 1ACFA 2EXAA 5E2HA 4JGOA 1K55A 4WUJA 1LSWA 3NHQA 4NXGA 3T1XA 4HOIA 3T4JA 2W3HA 2V9AA 3IWOA 1SHVA 4QHCA 2OLVA 1HLUP 4L9FA 1MXOA 3HBRA 4Y15A 3BFCA 3LIDA 2WKQA 4HI4A 2EFXA 4CLCB 3GECA 1K6SA 1T18A 1GA0A 4HIAA 2Y55A 2XR0A
chains in the Genus database with same CATH topology
3EQVA 5FL3A 3EGXC 3CUEA 2LB9A 5F69A 4I3AA 2VGLM 4R70A 1S66L 2LB5A 3MFXA 5G4ZA 2QJ5A 4ARZB 1IOUA 3IBJA 5LBRA 2A24A 3K3CA 4KUOA 4BJPA 1DP8A 2ZOIA 4LPZA 4K08A 2OAP1 1OTAA 4YNRA 1GSWA 4ZRRA 3UB8A 3E4QA 4JGPA 2L0WA 5J3WA 2GJ3A 4AFIA 1GSVA 3EOIA 3HCYA 5DJTA 1TF1A 1XJ2A 2VA0A 4HHDA 2D02A 2HJEA 5HPIA 1TS6A 3TE8A 3D3OA 3P01A 2VV7A 3FC7A 3RTYA 1MKMA 1S4SA 3MQOA 2VX8A 3CI6A 3MR0A 4FOFA 2JN7A 3UB6A 3LIEA 4R3AA 3KYQA 3UE6A 5CX7A 4O0PA 3A0SA 4DJ2A 4WEKA 1W63M 4G3VA 2J3TD 4H6JA 4EQ1A 3T4SA 5J4EA 2JKTI 1YSPA 4UQIM 4NXFA 2PHYA 3JVVA 2J3WA 3ZQ5A 5DFXA 5IT5A 2JHEA 2JKRI 4G3KA 1LL8A 4NEED 3CITA 2VJWA 4GCZA 1T1BA 5DFYA 3LFVA 4LRYC 1XFNA 5HDCA 1NLZA 3MXQA 5J7EA 5HL6A 4M4XA 4GHIB 4F3LB 3NOUC 4II7A 4JGQA 3KSHA 2P08A 2QKPA 1V9YA 3B42A 4PKYG 4XT2A 2Z6DA 5L8MA 4MMNA 3F1OA 4ETXA 3K2NA 5A8BA 1F9IA 1MC0A 2W3GA 4Q0IA 1P9WA 4ME4A 2EWWA 4IJGA 1OTDA 4MCWA 3PHYA 3IBRA 4HY8A 3E0YA 3D72A 4EEUA 3RH8B 3LIAA 2QJ7A 2KLIA 2L1MA 3H82A 2KX6A 2M1CA 2XA7S 1D7EA 4YOFA 3KX0X 2GZAA 4ARZA 2IA2A 2W1RA 2ZMVA 4DMZA 4GW9A 3RFBA 3VV4A 2PR5A 4L9GA 2ZMFA 2Y79A 3BWLA 2A2LA 3ZYTA 3T4QA 4XT2B 2EA9A 5DKLA 4BMWA 4CLCD 2O99A 3F1PB 1BYWA 4QPRA 1TS8A 4L0LA 3VOLA 2OWHA 3HJIA 2K31A 3MQ0A 3LR5A 4PAUA 1STZA 4Q0JA 4Y5FA 2W3FA 3PBRA 2KOIA 3O5YA 3EWKA 4P6ZM 4GS9B 3T4KA 1P97A 2G7UA 5HD3A 4I3IA 2VKSA 2W1TA 1YAXA 4EEPA 3E4PA 3C8CA 5HWVA 2QYBA 3EEAA 1UGUA 4BBVA 2K7SA 4EERA 3A0RA 1G28A 3UB9A 5IS1A 1IFQA 2W3EA 4B9OA 5IU1A 2M7VA 1OJGA 1UWNX 1VB6A 2INWA 3OLOA 2YKHA 4LRXC 4O8GA 2O9CA 5HWTA 3ULFA 2WKRA 1UWPX 4CLCE 1LSVA 2JKTM 4OOMA 4KQDA 3S7PA 3VE4A 4JGRA 3T50A 1TS7A 3R7WB 2L4RA 1LSXA 3BY9A 4WEJA 3BW6A 3UMEA 2I9VA 1Y28A 5DF9A 2WKPA 4NXBA 3IS2B 4GHIA 2GNXA 5HPFA 2V0WA 4I39A 4MN5A 3K3DA 1S1ZA 4EU0A 5F6AA 3S7QA 2P04A 4CLCC 2J3TC 2V0UA 3U2AA 4BBTA 1ZHHB 3OCLA 3BJNA 2BASA 1T1AA 4HJ4A 2ZBBA 3V67A 2CMNA 4HQAA 3EQUA 3VE3A 4P6ZS 4Y3IA 1X0OA 4Q0HA 3KYZA 2VEAA 2XA7M 3ICYA 5G4YA 1P0ZA 3LI9A 2PR6A 4DN0A 2MJ6A 1P9RA 4I38A 3BQ8A 3BQAA 4HJ6A 4EW7A 3TJZC 3MMHA 3C30A 4KQOA 1DP6A 1N9NA 2V1AA 2OOLA 2O9BA 1OTEA 2PT7A 3B33A 1KOUA 1XJ6A 5C5KA 1D06A 4HH3A 3OOVA 3SW1A 1S4RA 2VZWA 3PYPA 4I3JA 5K5BA 3CUEC 5HDSA 4WL9A 2QHKA 3F1OB 1VHMA 2PDRA 1OT9A 1ODVA 1OT6A 2W1TB 4ETZA 3PR6A 4WN5A 3UB7A 1LT0A 4RQ9A 3KO6A 4EETB 1NWZA 2NUPC 4WF0A 4EUVA 3TRCA 2QWSA 5F5YA 4EESA 4PHTA 1W63Q 3PBNA 2W3DA 4E04A 3LUQA 4Y2FA 4LLOB 3S7OA 4Z1WA 3CAXA 3BY8A 3E98A 4G3WA 4FSFA 4GS9A 2VLGA 2HGVA 2PYPA 2W27A 2M7UA 2XROA 3T4LA 3EGDC 3LR0A 4IUHA 2ZOHA 4UQIS 4CLCA 4MN6A 3KSFA 3F1PA 3PBSA 4EXOA 4O01A 3CWFA 3T4TA 1F98A 4WELA 2HV1A 1TS0A 2PD7A 4MN7A 3LR4A 2VGLS 1OTIA 5KSHA 3MF0A 1ZTUA 4L9EA 2KDKA 5TBMA 3LI8A 2H28A 3IS2A 3H82B 3PBTA 3LIBA 3H7WB 2Z6CA 3PBOA 3S7NA 4HH2A 3PBQA 2OAQ1 3LIFA 3R7WA 3UMDA 4HNBA 1V9ZA 4BWIA 5EFWA 3E4OA 4PKYA 1MZUA 1S67L 1WA9A 2JKRM 4HJ3A 2XSSA 5I5LA 2O0YA 3TW8A 4R38A 1N9OA 5DKKA 1N9LA 3H9WA 4F3LA 5HWWA 4HP4A 1XJ4A 1H8MA 1YKDA 3HJKA 3MJQA 2HJ9C 3F1NA 3R4KA 2B02A 1G6OA 1GSXA 3LYXA 4GJ4A 3FG8A 2FH5A 2O9AA 4NKPA 5HDDA 3LICA 5AVFA 5HD5A 4BBUA 2YKFA 3KSIA 5HZHA 3LR3A 2J80A 2PYRA 3OBFA 4H6JB 4OOLA 3C2WA 3FPWA 3T4OA 1S1YA 3W2ZA 4DJ3A 1DRMA 2PD8A 4IHQA 1OJ5A 2W0NA 3CLOA 2R78A 1F5MA 5TJJA 1XJ3A 2EWVA 2K2NA 2FZ0A 2DMWA 3GDIA 1T1CA 3MQQA 3FPVA 1NLYA 1OTBA 5MC7A 4WLAA 3B47A 3H7WA 3EEHA 3UE3A 3C38A 5DJUA 2OWJA 2D01A 5TBMB 2Y8HA 1DP9A 2V1BA 4GLQA 3JVUA 1H3QA 1T19A 1EW0A 4CQHA 2VV6A 3OCNA 2GX5A 4LRZE 1OPXA 4MDZA 1XFQA 3NOPC 2P7JA 3NJAA 2B18A 2NUTC 4NXEA 1NRJA 4I5SA 2A24B 4YWZA 3G6OA 4JGOA 3DBAA 4WUJA 5KIZA 1LSWA 3NHQA 3P7NA 4NXGA 1JNUA 2HF6A 2W3HA 4HOIA 3T4JA 2V9AA 2XRNA 3F1NB 3OC2A 4UEYA 4L9FA 5AVEA 3LIDA 4HP9A 2WKQA 5F68A 4KUKA 3KSGA 3PXPA 4HI4A 1YSQA 3A0VA 2VV8A 4IUKA 3GECA 5AJGA 4CLCB 1T18A 5HSQA 1TD5A 4B93A 4HIAA 4R6LA 3NOTC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PKY A;  1MZU A;  1S67 L;  1WA9 A;  4HJ6 A;  5F69 A;  4GW9 A;  4HJ3 A;  4I3A A;  4EW7 A;  5G4Z A;  4R70 A;  1S66 L;  3MFX A;  2PR5 A;  4L9G A;  2QJ5 A;  3BWL A;  5I5L A;  1DP6 A;  1N9N A;  2A24 A;  2EA9 A;  2V1A A;  1N9O A;  2OOL A;  3K3C A;  4KUO A;  1DP8 A;  1OTE A;  2ZOI A;  4K08 A;  4LPZ A;  5DKK A;  3F1P B;  1BYW A;  1N9L A;  1OTA A;  3B33 A;  3H9W A;  4F3L A;  5HWW A;  1GSW A;  1TS8 A;  3UB8 A;  1KOU A;  3VOL A;  1XJ6 A;  2OWH A;  3HJI A;  3E4Q A;  1XJ4 A;  1D06 A;  4HP4 A;  5DKL A;  4HH3 A;  4JGP A;  2L0W A;  3HJK A;  3MJQ A;  5J3W A;  2GJ3 A;  3SW1 A;  4R38 A;  1S4R A;  1GSV A;  3F1N A;  3PYP A;  2B02 A;  5DJT A;  4I3J A;  1GSX A;  1XJ2 A;  3EWK A;  4HHD A;  3LYX A;  2D02 A;  4GS9 B;  1P97 A;  3FG8 A;  5HDS A;  5HD3 A;  1TS6 A;  4I3I A;  4WL9 A;  2QHK A;  5J4E A;  3F1O B;  2PDR A;  5HDD A;  2VV7 A;  3FC7 A;  1OT9 A;  1ODV A;  1OT6 A;  2YKF A;  3LIC A;  5AVF A;  5HD5 A;  3RTY A;  4BBU A;  5HZH A;  4EEU A;  2J80 A;  2PYR A;  1S4S A;  4EEP A;  4H6J B;  4WN5 A;  3E4P A;  3C2W A;  3C8C A;  3UB7 A;  3MQO A;  5HWV A;  3MR0 A;  1LT0 A;  2JN7 A;  1S1Y A;  1UGU A;  2K7S A;  4RQ9 A;  3UB6 A;  3LIE A;  1NWZ A;  4BBV A;  4R3A A;  4WF0 A;  4DJ3 A;  1DRM A;  2QWS A;  4EET B;  2PD8 A;  3A0R A;  5F5Y A;  1G28 A;  4EES A;  4EER A;  3UE6 A;  1OJ5 A;  2W0N A;  3UB9 A;  3CLO A;  5IS1 A;  2R78 A;  4B9O A;  3A0S A;  1XJ3 A;  5IU1 A;  4DJ2 A;  4E04 A;  3GDI A;  3LUQ A;  1T1C A;  3MQQ A;  4LLO B;  1OJG A;  1OTB A;  4WLA A;  4H6J A;  4EQ1 A;  1UWN X;  3EEH A;  3CAX A;  1VB6 A;  2INW A;  3H7W A;  2YKH A;  3BY8 A;  2OWJ A;  3OLO A;  2D01 A;  5DJU A;  5TBM B;  4LRX C;  1DP9 A;  5HWT A;  3ULF A;  2V1B A;  4NXF A;  2PHY A;  2WKR A;  1UWP X;  3ZQ5 A;  4GS9 A;  2VLG A;  2JHE A;  1LSV A;  1T19 A;  2PYP A;  1LL8 A;  4KQD A;  1EW0 A;  2VV6 A;  2W27 A;  3VE4 A;  4JGR A;  4GCZ A;  4LRZ E;  1T1B A;  1TS7 A;  3T50 A;  1XFQ A;  2L4R A;  2ZOH A;  3NOP C;  4LRY C;  1XFN A;  5HDC A;  4XT2 B;  1LSX A;  3BY9 A;  3MXQ A;  4MN6 A;  2P7J A;  3NJA A;  4NXE A;  5J7E A;  3UME A;  2I9V A;  4M4X A;  1Y28 A;  3F1P A;  4GHI B;  4EXO A;  2WKP A;  3NOU C;  3IS2 B;  4NXB A;  4YWZ A;  4F3L B;  4JGQ A;  4GHI A;  2QKP A;  1V9Y A;  3CWF A;  2V0W A;  4I5S A;  4PKY G;  2A24 B;  4I39 A;  4MN5 A;  4XT2 A;  2Z6D A;  3G6O A;  1F98 A;  3K3D A;  4JGO A;  4WUJ A;  3F1O A;  2HV1 A;  1S1Z A;  5F6A A;  5KIZ A;  1LSW A;  3NHQ A;  3P7N A;  5A8B A;  4NXG A;  1F9I A;  1JNU A;  1TS0 A;  2V0U A;  4HOI A;  4BBT A;  2V9A A;  3F1N B;  2PD7 A;  1OTD A;  2BAS A;  1T1A A;  1OTI A;  4HJ4 A;  2ZBB A;  2CMN A;  3PHY A;  4L9E A;  4L9F A;  2KDK A;  4HQA A;  5TBM A;  3LI8 A;  5AVE A;  2H28 A;  3IS2 A;  3H82 B;  3VE3 A;  3IBR A;  3H7W B;  3LID A;  3LIB A;  4HP9 A;  2WKQ A;  3D72 A;  4HY8 A;  2Z6C A;  5F68 A;  4KUK A;  3LIA A;  3RH8 B;  4HH2 A;  1X0O A;  4HI4 A;  2QJ7 A;  2L1M A;  3A0V A;  3H82 A;  2VV8 A;  3LIF A;  2VEA A;  2KX6 A;  2M1C A;  1T18 A;  3GEC A;  3ICY A;  5G4Y A;  3UMD A;  5HSQ A;  1D7E A;  1P0Z A;  3KX0 X;  3LI9 A;  2PR6 A;  4HIA A;  4HNB A;  4R6L A;  1V9Z A;  4I38 A;  3NOT C;  5EFW A;  3E4O A; 
#chains in the Genus database with same CATH topology
 3GRJ A;  3QNB A;  5FL3 A;  2LB9 A;  5G4Z A;  2LB5 A;  2Y91 A;  3IBJ A;  4LCM A;  4LPZ A;  2OAP 1;  1PFL A;  4GDN A;  1FCN A;  3ZG8 B;  3UB8 A;  3O88 A;  4AFI A;  3EOI A;  3HCY A;  5EV0 A;  4Q8I A;  2XLN A;  1XJ2 A;  4YIN A;  5HPI A;  1TS6 A;  3TE8 A;  2OSU A;  1LL5 A;  2VV7 A;  1EI5 A;  3MQO A;  2WZZ A;  5FDH A;  4OPQ A;  4R3A A;  4X68 A;  3WRZ A;  4P87 A;  3A0S A;  4DJ2 A;  4WEK A;  1W63 M;  4G3V A;  1TDG A;  4RVA A;  1YSP A;  3HLB A;  4R4S A;  5HFO A;  3T1Q B;  3ZG0 A;  4R23 A;  3IX4 A;  2XDM A;  5IT5 A;  2JHE A;  4WZ4 A;  5L2F A;  1PW1 A;  5EVI B;  3HVF A;  2X71 A;  3C4P A;  1E3U D;  3W4P A;  1NLZ A;  4GKU A;  5J7E A;  4MBK A;  1IEM A;  4M4X A;  3KYE A;  4JGQ A;  2P08 A;  5FA7 A;  3B42 A;  3FYZ A;  4KZ4 A;  5AQB A;  4MMN A;  2B5R A;  3F1O A;  4UAA A;  1E4D A;  4ETX A;  5A8B A;  2W3G A;  4IJG A;  5AQ9 A;  3V39 A;  1BUL A;  3E0Y A;  4NK3 A;  2ZMA A;  2KLI A;  2X02 A;  4P0M A;  3HLC A;  3V50 A;  3MSH A;  1W7F A;  3IXB A;  3HLW A;  3T12 B;  3ZYT A;  4CLC D;  1YT4 A;  3UDI A;  4QPR A;  2UV0 E;  4X25 A;  5GLB A;  1TS8 A;  2WGW B;  3VOL A;  2K31 A;  2G2W A;  1K54 A;  3Q7V A;  3LR5 A;  5JYO A;  3VOZ A;  2V20 A;  1J3W A;  4GS9 B;  4FD8 A;  5HD3 A;  3IXG A;  1KVM A;  4KEN B;  4JLF A;  3FWL A;  5FAQ A;  5EPH A;  2H5S A;  2A49 A;  2K7S A;  1XXM A;  1ERM A;  3UB9 A;  2Y2J A;  1I2W A;  5GLA A;  3B3X A;  3ZVT A;  1W8Y A;  4E6X A;  2INW A;  3OLO A;  3VSL A;  5HWT A;  3ZHH A;  5KSC A;  4PM8 A;  1TVF A;  4Y17 A;  1NY0 A;  3S7P A;  3NDE A;  2L4R A;  4PM9 A;  3LO7 A;  3UPN A;  2WKP A;  2GNX A;  2V0W A;  1S1Z A;  5CXW A;  1SDN A;  3MZF A;  4R4R A;  1IYS A;  5FAO A;  2X01 A;  5EVE A;  1K38 A;  2ZBB A;  3DWZ A;  3MZE A;  5GHZ A;  1L3L A;  4S2N C;  3VE3 A;  3RXW A;  4P6Z S;  4U3T A;  3G4P A;  1G6A A;  5G4Y A;  1JWZ A;  3Q1F A;  3C4O A;  1P0Z A;  3LI9 A;  3W4O A;  4DN0 A;  4I38 A;  3BQ8 A;  1MWU A;  4JBF A;  5FQ9 A;  3TJZ C;  1TDL A;  1BT5 A;  4Y0U A;  1KGE A;  2PT7 A;  4HH3 A;  2B95 A;  1M40 A;  1HD8 A;  4EQI A;  3PYP A;  1XA7 A;  3OPR A;  4EWF A;  3CUE C;  3BYD A;  1KE4 A;  5HDS A;  4Y0T A;  2QHK A;  1I5Q A;  1VHM A;  2PDR A;  3PR6 A;  4B4X A;  5F5Y A;  3BFF A;  2W3D A;  3LUQ A;  4LLO B;  2WGW A;  2Y2I A;  3S7O A;  4Z1W A;  3G35 A;  3RJU A;  2HDU A;  3Q81 A;  3LY4 A;  5CTN A;  4FSF A;  4JF5 A;  1MBL A;  2PYP A;  1CJF A;  2M7U A;  4EV4 A;  3T4L A;  3EGD C;  4IUH A;  3BFD A;  4MN6 A;  1BTL A;  4EXO A;  3IF5 A;  2Y2Q A;  3HRE A;  2J9P A;  4K0W A;  3T4T A;  1K4E A;  3NIA A;  2WKI A;  1JWP A;  3VFF A;  1JTG A;  4EBP A;  2PD7 A;  3LEQ A;  2Q9M A;  2VGJ A;  3QP1 A;  3IS2 A;  3M2J A;  4LV2 A;  2ZQD A;  4OQG A;  4E3O A;  3UN7 A;  3WS5 A;  3PBQ A;  2V1Z A;  3UMD A;  3UDX A;  1YLW A;  1LHY A;  1PNE A;  2XQZ A;  4WMC D;  5I5L A;  3TW8 A;  3Q82 A;  1ESU A;  3H9W A;  4QU3 A;  1I2S A;  2WKH A;  2IWD A;  4LV1 A;  3HJK A;  4S2M A;  2HJ9 C;  3VOY A;  2UWX A;  3F1N A;  3R4K A;  1G6O A;  3LYX A;  5E2E A;  2FH5 A;  2O9A A;  2YKF A;  1PYY A;  3UDF A;  1NXY A;  3FPW A;  3IF6 A;  3C7V A;  3T4O A;  3W2Z A;  3UB5 P;  4DJ3 A;  1PWD A;  2Y59 A;  3CLO A;  2R78 A;  4KG2 A;  3WS1 A;  2FZ0 A;  2DMW A;  3MQQ A;  4OQH A;  4WLA A;  3B47 A;  3A3F A;  3EEH A;  3IX8 A;  2D01 A;  3SZT A;  3ZFZ A;  3TSG A;  5FEF A;  1VEU B;  5CHM A;  3FZC A;  1EW0 A;  2GX5 A;  2WAF A;  1YLJ A;  3S1Y A;  1LL9 A;  4KZB A;  2A24 B;  4YWZ A;  3G6O A;  1XP4 A;  1XGJ A;  5FAP A;  5KIZ A;  3P7N A;  4GN2 A;  3V3R A;  5CTM A;  3IH9 A;  2XRN A;  3F1N B;  5HW3 A;  3OC2 A;  3G31 A;  3HUM A;  3GR2 A;  1JWV A;  5F68 A;  4KUK A;  3KSG A;  2Y2G A;  1YSQ A;  2VV8 A;  5AJG A;  1FR1 A;  1NZO A;  4MNR A;  1TD5 A;  2V8F A;  1K0K A;  4OP5 A;  3VP1 A;  3MFD A;  1ES3 A;  3NOT C;  4K0X A;  4DE0 A;  3EQV A;  4BD0 A;  4I3A A;  5FSR A;  4R70 A;  2A24 A;  4X1M A;  4BJP A;  1DP8 A;  2ZOI A;  4K08 A;  1OTA A;  4FTX A;  5A91 A;  1GSW A;  3QP6 A;  1XGI A;  3QP8 A;  4ZAM A;  4X56 A;  3RXX A;  1GSV A;  5FQI A;  2HZ5 A;  2VA0 A;  1KDW A;  3P01 A;  5GLD A;  3RTY A;  1XX2 A;  2JCH A;  3MR0 A;  4FOF A;  3HLF A;  1ES2 A;  4MLL A;  3LIE A;  4O0P A;  1MWR A;  2XFT A;  3IF6 C;  2FFF B;  4EQ1 A;  3VMA A;  2QZ6 A;  1W5D A;  4JPM A;  5CGX A;  2J3W A;  4P85 A;  3ZQ5 A;  5DFX A;  4S2J A;  2JKR I;  4NEE D;  3CIT A;  4R1G A;  4LRY C;  5HDC A;  3NOU C;  4II7 A;  3G32 A;  1V9Y A;  1D1J A;  5L8M A;  4X69 A;  3M6B A;  1MC0 A;  5CED A;  4CJN A;  3SH8 A;  1NYM A;  2WAE A;  4EBN A;  3G2Y A;  3NI9 A;  3WS0 A;  2OLU A;  3IBR A;  5JYP A;  2QJ7 A;  2L1M A;  3H82 A;  3VP3 A;  2GZA A;  2IA2 A;  5EEC A;  5CER A;  3HUO A;  4GW9 A;  3RFB A;  5DTS A;  4GZB A;  2Y79 A;  1IYQ A;  2A2L A;  3T4Q A;  4BMW A;  2O99 A;  4S2P A;  1N9B A;  3NC8 A;  1VM1 A;  4L0L A;  4ZJ2 A;  4PAU A;  2ZD8 A;  3A3D A;  4Q0J A;  5HL1 A;  1PIO A;  4B4Z A;  3W4Q A;  4P6Z M;  3UPO A;  1P97 A;  2G7U A;  1K55 C;  1H5X A;  4I3I A;  1RCJ A;  2W1T A;  1W8Q A;  4XUZ A;  4CPK A;  5I94 A;  4E3M A;  4OVD A;  1HTZ A;  1UGU A;  4BBV A;  2HDQ A;  5F1G A;  2JE5 A;  1G28 A;  1IFQ A;  2A3U A;  2W3E A;  5IU1 A;  4E3K A;  4QJG A;  2M7V A;  1OJG A;  3SH7 A;  1UWN X;  1GHP A;  1JTD A;  3ULF A;  4R3J A;  5U47 A;  4JF4 A;  2JKT M;  4OOM A;  4KQD A;  3QNC A;  4JGR A;  3IQA A;  4R0Q A;  3T50 A;  4N1X A;  3BY9 A;  1TEM A;  4Z9Q A;  1Y28 A;  4E6W A;  1SDE A;  5HPF A;  4KZ7 A;  3K3D A;  4FH2 A;  4FH4 A;  4EU0 A;  3S7Q A;  2P04 A;  1GA9 A;  2PRF A;  3U2A A;  1T1A A;  4HJ4 A;  3FV7 A;  1QMF A;  4Y3I A;  3A3I A;  2XA7 M;  3ICY A;  1FSY A;  1YLY A;  2MJ6 A;  2HP5 A;  4S2K A;  4HJ6 A;  3BEB A;  3IXD A;  2ZM2 A;  5HAR A;  2V1A A;  3N8S A;  4DXC A;  2O9B A;  1OTE A;  3O3V A;  3B33 A;  1ES4 A;  2Y2O A;  1BSG A;  1XJ6 A;  1YPR A;  2Y2H A;  3D4F A;  1KGG A;  3ZG7 B;  1F2K A;  3C7U A;  3OOV A;  2CC1 A;  1CEF A;  3ZNY A;  5K5B A;  2ZJ9 A;  3DWK A;  1MPL A;  3QP4 A;  3ITA A;  4DE2 A;  1OT6 A;  4FCF A;  5M19 A;  3L7H A;  3NEC A;  4OLD A;  2PU2 A;  4ETZ A;  2OV5 A;  3UB7 A;  2NUP C;  1Z09 A;  1L0D A;  4EES A;  4E04 A;  2ZQ7 A;  4Y13 A;  3CAX A;  5FQJ A;  5BOH A;  1Y4O A;  5AQA A;  4U0T A;  3OPL A;  2VLG A;  4FUW A;  4WM9 A;  5FI6 A;  4CLC A;  4UQI S;  5J8X A;  1SKO A;  3QP5 A;  4U0X A;  1H8Y A;  3KSF A;  3F1P A;  2V8C A;  5GHX A;  3LGO A;  3IHB A;  4WEL A;  1G5U A;  3WRT A;  2ZL1 A;  1TS0 A;  1DY6 A;  3S22 A;  1E25 A;  2DRW A;  3LR4 A;  2VGL S;  5KSH A;  4JXW A;  1L0F A;  2H28 A;  3H82 B;  3PBT A;  2RL3 A;  4HH2 A;  4KG5 A;  3R7W A;  3I7J A;  2R9X A;  3ITB A;  2Y4A A;  4IVK A;  4QWO A;  1V9Z A;  2C5W B;  3E4O A;  4PKY A;  3QHY A;  2ZC7 A;  1S67 L;  2JKR M;  3BEC A;  4HJ3 A;  1BLH A;  2O0Y A;  2RCX A;  3FKV A;  4HP4 A;  4KZ3 A;  4IVI A;  4KG6 A;  1YKD A;  3DW0 A;  3D9Y A;  2Y2K A;  4MBF A;  2B02 A;  3PAG A;  2P9V B;  3IHA A;  3MKE A;  3FG8 A;  3WS4 A;  2HPB A;  2JKG A;  3HLD A;  4HBT A;  3LIC A;  5CGS A;  1MKI A;  2Z2L B;  5HZH A;  3LR3 A;  4GD8 A;  1DJC A;  3GSG A;  4OQI A;  2PD8 A;  1QME A;  2WK0 A;  4IHQ A;  3VP0 A;  5EVL A;  5EVI D;  3GDI A;  3FPV A;  3BFG A;  2XEP A;  3C38 A;  2Y8H A;  2V1B A;  5FQK A;  4GLQ A;  4BQM A;  4JKT A;  3JVU A;  1H3Q A;  1T19 A;  1KE0 A;  1OME A;  3OCN A;  5FAS A;  4EUZ A;  3MZD A;  1XFQ A;  3W8K A;  5E43 A;  1YM1 A;  4OPR A;  2Q9N A;  1NRJ A;  4I5S A;  3DBA A;  3AGF A;  1K56 D;  4LEN A;  4D2O A;  2HF6 A;  2WZX A;  3SS3 A;  5KZH A;  4RA7 A;  4HP9 A;  4DXB A;  3PXP A;  3S4X A;  4N1H A;  4IUK A;  5HSQ A;  4S2I A;  4X55 A;  4R6L A;  2VK3 A;  3C5A A;  1PI4 A;  4ZBE A;  1SCW A;  3EGX C;  1BZA A;  1S66 L;  1O07 A;  2QJ5 A;  5LBR A;  4YNR A;  2Y2L A;  4ZRR A;  4ESP A;  4JGP A;  2L0W A;  5J3W A;  4DRT A;  5E2F A;  3P09 A;  2ZQ9 A;  4IED A;  5DJT A;  1TF1 A;  2HJE A;  4GD6 A;  3D3O A;  2ZQ8 A;  1KE3 A;  2Y2N A;  3SS4 A;  2VX8 A;  2JN7 A;  3UB6 A;  1YMX A;  3KYQ A;  1Q2P A;  5CX7 A;  3NDG A;  1K56 A;  4QY5 A;  4WBG A;  4H6J A;  2JKT I;  4UQI M;  4Y7P A;  4NXF A;  4QY6 A;  3JVV A;  3JPU A;  5AQ7 A;  2WKE A;  1N4O A;  4UA9 A;  3ZGA B;  4RX2 A;  1GCE A;  4GCZ A;  5L07 A;  4WMC A;  3DAV A;  1XFN A;  4F3L B;  3OPH A;  2E8J A;  1CQA A;  3KSH A;  5EE8 A;  2QKP A;  3N7W A;  1RGY A;  4XT2 A;  2Z6D A;  2JC7 A;  3A3E A;  3O87 A;  4JXV A;  1F9I A;  2XFS A;  4Q0I A;  1P9W A;  4ME4 A;  2VGK A;  2EWW A;  1OTD A;  4MCW A;  3MKF A;  2JBF A;  4C75 A;  5M18 A;  3LIA A;  2WYX A;  2KX6 A;  2PAV P;  1DJB A;  4KQR A;  3G2Z A;  3KX0 X;  4ARZ A;  3CG5 A;  2W1R A;  3IX3 A;  2EXB A;  2ZMV A;  4C6Y A;  1KDS A;  4OH0 A;  3VV4 A;  2PR5 A;  4X6T A;  2HDS A;  2BLS A;  1IKG A;  3BWL A;  4N92 A;  4XT2 B;  2EA9 A;  5DKL A;  4S2L A;  3ZDJ A;  4IBR A;  2Q0O A;  5FI7 A;  1K57 C;  1L0G A;  3ISG A;  3HUN A;  3PBR A;  3O5Y A;  2XK1 A;  5A93 A;  3T4K A;  1KGF A;  4ZJ1 A;  4GOG A;  5L09 A;  1PRQ A;  2P9V A;  4EEP A;  3C8C A;  5HWV A;  5GHY A;  3EEA A;  1Y54 A;  4OP8 A;  4PM5 A;  4BL2 A;  4ZJ3 A;  5IS1 A;  1ZG4 A;  1S6R A;  5GLC A;  3IWI A;  3OPP A;  4LRX C;  2DNS A;  4JXG A;  3UPP A;  5FQQ A;  1UWP X;  4UA6 A;  1LSV A;  5IHV A;  3VE4 A;  3UY6 A;  1FIK A;  1LSX A;  3G30 A;  1K6R A;  1C3B A;  3UME A;  2EX9 A;  4NXB A;  4QD4 A;  3GQZ A;  4I39 A;  4MN5 A;  4DKI A;  5F6A A;  1U60 A;  2IWC A;  4CLC C;  4KZ8 A;  2V0U A;  1ZHH B;  3OCL A;  5FDS A;  5CHJ A;  2BAS A;  2XH9 A;  1BLP A;  1MWS A;  4PM7 A;  5E2G A;  4HQA A;  3EQU A;  4Q0H A;  5F1F A;  2VEA A;  1PWC A;  3ZG9 B;  1P9R A;  3BQA A;  3JYI A;  2WGV A;  4DDY A;  1N9N A;  2OOL A;  4NET A;  1CI8 A;  4DE3 A;  1VET B;  1KOU A;  3WWX A;  4LGW A;  2H0T A;  3GVB A;  1G68 A;  2VZW A;  3VP2 A;  3SOI A;  1PI5 A;  3F1O B;  1OT9 A;  1JVJ A;  1WE4 A;  2ACG A;  1HVB A;  1LT0 A;  4RQ9 A;  4BLM A;  2DCF A;  5FEG A;  4WF0 A;  4EUV A;  3OZH A;  1FCM A;  4E3L A;  3TOI A;  4A5R A;  4PHT A;  1W63 Q;  1FSW A;  3PBN A;  4K91 A;  1RP5 A;  3IF6 B;  3ZNT A;  5EOE A;  3HLE A;  3BY8 A;  3CPT A;  3E98 A;  1IYP A;  4S2N A;  5CEC A;  2ZC5 B;  4GS9 A;  5KMW A;  3UNW A;  1ZC2 A;  2W27 A;  5CGW A;  1K25 A;  1YLZ A;  3PBS A;  2ZLY A;  4LFU A;  3N6I A;  2E8I A;  3A3J A;  3PTE A;  3Q7Z A;  4H8R A;  5HAQ A;  1OTI A;  3MF0 A;  2Z2M B;  4L9E A;  1S0W A;  5G18 A;  5TBM A;  4E3I A;  3LIB A;  3T1S A;  3S7N A;  3LIF A;  1K54 C;  3BRM A;  4HNB A;  3FKW A;  1MZU A;  1WA9 A;  5EM1 A;  2ZM8 A;  3O86 A;  1E3U A;  2QPN A;  1O7E A;  2ZQC A;  4R38 A;  3GTC A;  1N9O A;  5DKK A;  3CPT B;  3NBL A;  4LV0 A;  5EVI C;  1N9L A;  5HWW A;  1H8Z A;  4BD1 A;  2ZC6 B;  4P6B A;  4GNU A;  4OKP A;  3ZG5 A;  4XXR A;  4PM6 A;  4BBU A;  2J80 A;  2PYR A;  3OBF A;  3C2W A;  1BUE A;  1DRM A;  4F94 A;  1WYB A;  4IBX A;  2W0N A;  5TR7 A;  1F5M A;  5TJJ A;  1XJ3 A;  2EWV A;  5MC7 A;  1NLY A;  1OTB A;  2P74 A;  5DJU A;  1PWG A;  1Q2Q A;  1NRF A;  1XKZ A;  3CMZ A;  1ESI A;  1YLP A;  4UA7 A;  5CEB A;  4KQQ A;  5HX9 A;  3IT9 A;  2P7J A;  3NJA A;  2B18 A;  2J8Y A;  3AGD A;  4JXS A;  1ZKJ A;  1H0M A;  3LCE A;  2ZM0 A;  5FI2 A;  4MEZ A;  5GL9 A;  1EWZ A;  1JNU A;  3IWQ A;  3QP2 A;  4UEY A;  2HP6 A;  1FOF A;  1NZU A;  2HDR A;  5AVE A;  3TG9 A;  2H10 A;  3N8R A;  4DE1 A;  3BFE A;  3A0V A;  2AVX A;  1CEG A;  2R9W A;  1YQS A;  2J9O A;  4B93 A;  2WGI A;  3BLS A;  1SZV A;  3CUE A;  5F69 A;  3IXH A;  2VGL M;  4ARZ B;  3MFX A;  1IOU A;  5L10 A;  4WYY A;  4KUO A;  3K3C A;  2WUQ A;  2BG1 A;  1PW8 A;  2J7V A;  3E4Q A;  2GJ3 A;  3AGE A;  2ZQA A;  3CJM A;  3GV9 A;  4HHD A;  2D02 A;  3FC7 A;  1MKM A;  2FFY A;  1S4S A;  3CI6 A;  3UE6 A;  1ZG6 A;  4OQ0 A;  3ZCZ A;  2J3T D;  2V2F F;  3T4S A;  5J4E A;  5DF8 A;  3VP4 A;  2PHY A;  1FR6 A;  3N4I A;  1BLC A;  4KZA A;  1ONH A;  2PBD P;  4G3K A;  1LL8 A;  3G34 A;  5TFQ A;  3V3S A;  5EM0 A;  2VJW A;  4N9L A;  1T1B A;  2BTF P;  5DFY A;  3LFV A;  1Z6F A;  3Q7V B;  4GDB A;  5TGF A;  3MXQ A;  5HL6 A;  5A92 A;  4GHI B;  1XPB A;  1A0K A;  5DTT A;  2EX8 A;  4HES A;  5A90 A;  4PKY G;  4ZTK A;  3UE0 A;  4KZ6 A;  1NJ4 A;  3K2N A;  5HAP A;  1HZO A;  2WAD A;  3PHY A;  1IEL A;  4HEF A;  4WZ5 A;  4HY8 A;  1ES5 A;  3D72 A;  4EEU A;  3RH8 B;  1K4F A;  1KVL A;  1IKI A;  1CF0 A;  5FQM A;  2M1C A;  2XA7 S;  3MXS A;  1D7E A;  4YOF A;  3SH9 A;  5DVA A;  5EVI A;  4DMZ A;  3ZVW A;  1GHI A;  4L9G A;  2ZMF A;  4MBH A;  3V5M A;  2HP9 A;  3F1P B;  1BYW A;  4OON A;  2OWH A;  1PZP A;  3HJI A;  3MQ0 A;  3LEZ A;  1STZ A;  4Y5F A;  2W3F A;  2KOI A;  3GMW A;  3EWK A;  2PBY A;  1AWI A;  2VKS A;  3T1R A;  1YAX A;  3DTM A;  2ZC3 B;  3E4P A;  4WZ5 C;  1FCO A;  2QYB A;  4X53 A;  4EER A;  3A0R A;  4B88 A;  1LLB A;  4B9O A;  2XD5 A;  2Y2P A;  4BL3 A;  1VB6 A;  1VET A;  1VEU A;  2YKH A;  3HLG A;  3PAE A;  4O8G A;  2O9C A;  3CZD A;  4KZ9 A;  2WKR A;  2IWB A;  4CLC E;  3DTE A;  1M6K A;  3CHW P;  3SS5 A;  1TS7 A;  3R7W B;  5EUA A;  4WEJ A;  3BW6 A;  2I9V A;  5DF9 A;  3IS2 B;  3BM6 A;  4GHI A;  1SKO B;  1XA1 A;  1LI0 A;  3M6H A;  2J3T C;  4BBT A;  3BJN A;  3N8L A;  1W79 A;  3V67 A;  2CMN A;  5CRF A;  1X0O A;  3KYZ A;  3MXR A;  3UE1 A;  1L2S A;  4D60 A;  2PR6 A;  3P98 A;  4O7D A;  4EW7 A;  3MMH A;  3C30 A;  1ALQ A;  4KQO A;  1YLT A;  1DP6 A;  3BLM A;  3VSK A;  1CK3 A;  3E2L A;  5M1A A;  3NUL A;  5C5K A;  1D06 A;  3SW1 A;  1IYO A;  1YMS A;  1S4R A;  5F82 A;  4I3J A;  4WL9 A;  4QB8 A;  4PMA A;  5EOO A;  3Q07 A;  1ODV A;  4YFM A;  4M3K A;  2W1T B;  3UO9 A;  4WN5 A;  4GB7 A;  3NCK A;  1SKF A;  3KO6 A;  4EET B;  1NWZ A;  2PU4 A;  5HAI A;  2QWS A;  3NY4 A;  3TRC A;  3VFH A;  1LI9 A;  2EX2 A;  3HL9 A;  2G2U A;  4E3J A;  4Y2F A;  3MBZ A;  4R3B A;  3LY3 A;  3WS2 A;  4OOY A;  4RYE A;  4G3W A;  1DJA A;  2HGV A;  1AXB A;  2XRO A;  3LR0 A;  1L0E A;  2ZOH A;  3M2K A;  2JKF A;  4UHU A;  3E2K A;  3MS6 A;  4XUX A;  4DF6 A;  4O01 A;  3CWF A;  2Y2M A;  1F98 A;  1ONG A;  4EBL A;  2XD1 A;  2HV1 A;  4LCL A;  4S2O A;  5D3O A;  2ZC4 B;  5CHU A;  1CI9 A;  4ID4 A;  1VQQ A;  3DTI A;  4MN7 A;  1ZTU A;  2ZL1 B;  5DTK A;  2KDK A;  3LI8 A;  1NYY A;  5F83 A;  3H7W B;  2Z6C A;  3PBO A;  2OAQ 1;  4LV3 A;  4DDS A;  4NG2 A;  4BEN A;  4HBU A;  5DF7 A;  2I72 A;  4Y0O A;  1J9M A;  4BWI A;  5EFW A;  2XSS A;  3IH8 A;  4F3L A;  1PZO A;  2QMI A;  2GDN A;  1XJ4 A;  1H8M A;  3MJQ A;  1ERQ A;  1MWT A;  3DTK A;  1RGZ A;  1K57 A;  1GSX A;  4GJ4 A;  2XF3 A;  4C3Q A;  4NKP A;  2EFU A;  1BLS A;  5HDD A;  5AVF A;  5HD5 A;  3KSI A;  3U4L P;  4PPR A;  2H0Y A;  4H6J B;  4OOL A;  4ZDX A;  4OLG A;  1S1Y A;  2XGN A;  1ERO A;  2EX6 A;  1OJ5 A;  2K2N A;  4OPY A;  4E3N A;  1T1C A;  1FIL A;  3L9K A;  3H7W A;  3UE3 A;  2OWJ A;  5TBM B;  1DP9 A;  4N9K A;  5FAT A;  4JF6 A;  1MY8 A;  1WYC A;  4CQH A;  2VV6 A;  2C6W B;  4LRZ E;  1OPX A;  4MDZ A;  3NOP C;  1GHM A;  4NXE A;  2NUT C;  4X1L A;  4RX3 A;  1FQG A;  4KZ5 A;  4OPZ A;  1ACF A;  2EXA A;  5E2H A;  4JGO A;  1K55 A;  4WUJ A;  1LSW A;  3NHQ A;  4NXG A;  3T1X A;  4HOI A;  3T4J A;  2W3H A;  2V9A A;  3IWO A;  1SHV A;  4QHC A;  2OLV A;  1HLU P;  4L9F A;  1MXO A;  3HBR A;  4Y15 A;  3BFC A;  3LID A;  2WKQ A;  4HI4 A;  2EFX A;  4CLC B;  3GEC A;  1K6S A;  1T18 A;  1GA0 A;  4HIA A;  2Y55 A;  2XR0 A; 
#chains in the Genus database with same CATH homology
 3EQV A;  5FL3 A;  3EGX C;  3CUE A;  2LB9 A;  5F69 A;  4I3A A;  2VGL M;  4R70 A;  1S66 L;  2LB5 A;  3MFX A;  5G4Z A;  2QJ5 A;  4ARZ B;  1IOU A;  3IBJ A;  5LBR A;  2A24 A;  3K3C A;  4KUO A;  4BJP A;  1DP8 A;  2ZOI A;  4LPZ A;  4K08 A;  2OAP 1;  1OTA A;  4YNR A;  1GSW A;  4ZRR A;  3UB8 A;  3E4Q A;  4JGP A;  2L0W A;  5J3W A;  2GJ3 A;  4AFI A;  1GSV A;  3EOI A;  3HCY A;  5DJT A;  1TF1 A;  1XJ2 A;  2VA0 A;  4HHD A;  2D02 A;  2HJE A;  5HPI A;  1TS6 A;  3TE8 A;  3D3O A;  3P01 A;  2VV7 A;  3FC7 A;  3RTY A;  1MKM A;  1S4S A;  3MQO A;  2VX8 A;  3CI6 A;  3MR0 A;  4FOF A;  2JN7 A;  3UB6 A;  3LIE A;  4R3A A;  3KYQ A;  3UE6 A;  5CX7 A;  4O0P A;  3A0S A;  4DJ2 A;  4WEK A;  1W63 M;  4G3V A;  2J3T D;  4H6J A;  4EQ1 A;  3T4S A;  5J4E A;  2JKT I;  1YSP A;  4UQI M;  4NXF A;  2PHY A;  3JVV A;  2J3W A;  3ZQ5 A;  5DFX A;  5IT5 A;  2JHE A;  2JKR I;  4G3K A;  1LL8 A;  4NEE D;  3CIT A;  2VJW A;  4GCZ A;  1T1B A;  5DFY A;  3LFV A;  4LRY C;  1XFN A;  5HDC A;  1NLZ A;  3MXQ A;  5J7E A;  5HL6 A;  4M4X A;  4GHI B;  4F3L B;  3NOU C;  4II7 A;  4JGQ A;  3KSH A;  2P08 A;  2QKP A;  1V9Y A;  3B42 A;  4PKY G;  4XT2 A;  2Z6D A;  5L8M A;  4MMN A;  3F1O A;  4ETX A;  3K2N A;  5A8B A;  1F9I A;  1MC0 A;  2W3G A;  4Q0I A;  1P9W A;  4ME4 A;  2EWW A;  4IJG A;  1OTD A;  4MCW A;  3PHY A;  3IBR A;  4HY8 A;  3E0Y A;  3D72 A;  4EEU A;  3RH8 B;  3LIA A;  2QJ7 A;  2KLI A;  2L1M A;  3H82 A;  2KX6 A;  2M1C A;  2XA7 S;  1D7E A;  4YOF A;  3KX0 X;  2GZA A;  4ARZ A;  2IA2 A;  2W1R A;  2ZMV A;  4DMZ A;  4GW9 A;  3RFB A;  3VV4 A;  2PR5 A;  4L9G A;  2ZMF A;  2Y79 A;  3BWL A;  2A2L A;  3ZYT A;  3T4Q A;  4XT2 B;  2EA9 A;  5DKL A;  4BMW A;  4CLC D;  2O99 A;  3F1P B;  1BYW A;  4QPR A;  1TS8 A;  4L0L A;  3VOL A;  2OWH A;  3HJI A;  2K31 A;  3MQ0 A;  3LR5 A;  4PAU A;  1STZ A;  4Q0J A;  4Y5F A;  2W3F A;  3PBR A;  2KOI A;  3O5Y A;  3EWK A;  4P6Z M;  4GS9 B;  3T4K A;  1P97 A;  2G7U A;  5HD3 A;  4I3I A;  2VKS A;  2W1T A;  1YAX A;  4EEP A;  3E4P A;  3C8C A;  5HWV A;  2QYB A;  3EEA A;  1UGU A;  4BBV A;  2K7S A;  4EER A;  3A0R A;  1G28 A;  3UB9 A;  5IS1 A;  1IFQ A;  2W3E A;  4B9O A;  5IU1 A;  2M7V A;  1OJG A;  1UWN X;  1VB6 A;  2INW A;  3OLO A;  2YKH A;  4LRX C;  4O8G A;  2O9C A;  5HWT A;  3ULF A;  2WKR A;  1UWP X;  4CLC E;  1LSV A;  2JKT M;  4OOM A;  4KQD A;  3S7P A;  3VE4 A;  4JGR A;  3T50 A;  1TS7 A;  3R7W B;  2L4R A;  1LSX A;  3BY9 A;  4WEJ A;  3BW6 A;  3UME A;  2I9V A;  1Y28 A;  5DF9 A;  2WKP A;  4NXB A;  3IS2 B;  4GHI A;  2GNX A;  5HPF A;  2V0W A;  4I39 A;  4MN5 A;  3K3D A;  1S1Z A;  4EU0 A;  5F6A A;  3S7Q A;  2P04 A;  4CLC C;  2J3T C;  2V0U A;  3U2A A;  4BBT A;  1ZHH B;  3OCL A;  3BJN A;  2BAS A;  1T1A A;  4HJ4 A;  2ZBB A;  3V67 A;  2CMN A;  4HQA A;  3EQU A;  3VE3 A;  4P6Z S;  4Y3I A;  1X0O A;  4Q0H A;  3KYZ A;  2VEA A;  2XA7 M;  3ICY A;  5G4Y A;  1P0Z A;  3LI9 A;  2PR6 A;  4DN0 A;  2MJ6 A;  1P9R A;  4I38 A;  3BQ8 A;  3BQA A;  4HJ6 A;  4EW7 A;  3TJZ C;  3MMH A;  3C30 A;  4KQO A;  1DP6 A;  1N9N A;  2V1A A;  2OOL A;  2O9B A;  1OTE A;  2PT7 A;  3B33 A;  1KOU A;  1XJ6 A;  5C5K A;  1D06 A;  4HH3 A;  3OOV A;  3SW1 A;  1S4R A;  2VZW A;  3PYP A;  4I3J A;  5K5B A;  3CUE C;  5HDS A;  4WL9 A;  2QHK A;  3F1O B;  1VHM A;  2PDR A;  1OT9 A;  1ODV A;  1OT6 A;  2W1T B;  4ETZ A;  3PR6 A;  4WN5 A;  3UB7 A;  1LT0 A;  4RQ9 A;  3KO6 A;  4EET B;  1NWZ A;  2NUP C;  4WF0 A;  4EUV A;  3TRC A;  2QWS A;  5F5Y A;  4EES A;  4PHT A;  1W63 Q;  3PBN A;  2W3D A;  4E04 A;  3LUQ A;  4Y2F A;  4LLO B;  3S7O A;  4Z1W A;  3CAX A;  3BY8 A;  3E98 A;  4G3W A;  4FSF A;  4GS9 A;  2VLG A;  2HGV A;  2PYP A;  2W27 A;  2M7U A;  2XRO A;  3T4L A;  3EGD C;  3LR0 A;  4IUH A;  2ZOH A;  4UQI S;  4CLC A;  4MN6 A;  3KSF A;  3F1P A;  3PBS A;  4EXO A;  4O01 A;  3CWF A;  3T4T A;  1F98 A;  4WEL A;  2HV1 A;  1TS0 A;  2PD7 A;  4MN7 A;  3LR4 A;  2VGL S;  1OTI A;  5KSH A;  3MF0 A;  1ZTU A;  4L9E A;  2KDK A;  5TBM A;  3LI8 A;  2H28 A;  3IS2 A;  3H82 B;  3PBT A;  3LIB A;  3H7W B;  2Z6C A;  3PBO A;  3S7N A;  4HH2 A;  3PBQ A;  2OAQ 1;  3LIF A;  3R7W A;  3UMD A;  4HNB A;  1V9Z A;  4BWI A;  5EFW A;  3E4O A;  4PKY A;  1MZU A;  1S67 L;  1WA9 A;  2JKR M;  4HJ3 A;  2XSS A;  5I5L A;  2O0Y A;  3TW8 A;  4R38 A;  1N9O A;  5DKK A;  1N9L A;  3H9W A;  4F3L A;  5HWW A;  4HP4 A;  1XJ4 A;  1H8M A;  1YKD A;  3HJK A;  3MJQ A;  2HJ9 C;  3F1N A;  3R4K A;  2B02 A;  1G6O A;  1GSX A;  3LYX A;  4GJ4 A;  3FG8 A;  2FH5 A;  2O9A A;  4NKP A;  5HDD A;  3LIC A;  5AVF A;  5HD5 A;  4BBU A;  2YKF A;  3KSI A;  5HZH A;  3LR3 A;  2J80 A;  2PYR A;  3OBF A;  4H6J B;  4OOL A;  3C2W A;  3FPW A;  3T4O A;  1S1Y A;  3W2Z A;  4DJ3 A;  1DRM A;  2PD8 A;  4IHQ A;  1OJ5 A;  2W0N A;  3CLO A;  2R78 A;  1F5M A;  5TJJ A;  1XJ3 A;  2EWV A;  2K2N A;  2FZ0 A;  2DMW A;  3GDI A;  1T1C A;  3MQQ A;  3FPV A;  1NLY A;  1OTB A;  5MC7 A;  4WLA A;  3B47 A;  3H7W A;  3EEH A;  3UE3 A;  3C38 A;  5DJU A;  2OWJ A;  2D01 A;  5TBM B;  2Y8H A;  1DP9 A;  2V1B A;  4GLQ A;  3JVU A;  1H3Q A;  1T19 A;  1EW0 A;  4CQH A;  2VV6 A;  3OCN A;  2GX5 A;  4LRZ E;  1OPX A;  4MDZ A;  1XFQ A;  3NOP C;  2P7J A;  3NJA A;  2B18 A;  2NUT C;  4NXE A;  1NRJ A;  4I5S A;  2A24 B;  4YWZ A;  3G6O A;  4JGO A;  3DBA A;  4WUJ A;  5KIZ A;  1LSW A;  3NHQ A;  3P7N A;  4NXG A;  1JNU A;  2HF6 A;  2W3H A;  4HOI A;  3T4J A;  2V9A A;  2XRN A;  3F1N B;  3OC2 A;  4UEY A;  4L9F A;  5AVE A;  3LID A;  4HP9 A;  2WKQ A;  5F68 A;  4KUK A;  3KSG A;  3PXP A;  4HI4 A;  1YSQ A;  3A0V A;  2VV8 A;  4IUK A;  3GEC A;  5AJG A;  4CLC B;  1T18 A;  5HSQ A;  1TD5 A;  4B93 A;  4HIA A;  4R6L A;  3NOT C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...