4JGRA

The crystal structure of sporulation kinase d mutant sensor domain, r131a, from bacillus subtilis subsp at 2.4a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
203
structure length
202
Chain Sequence
DTIAAEHKQEASVLLNLHRNKINYLIGETMARMTSLSIAIDRPVDIKKMQSILEKTFDEPRFSGLYFLNAKGDVTASTTELKTKVNLADASFFIKAKETKKTVISDSYSSRITGQPIFTICVPVLDSKRNVTDYLVAAIQIDYLKNLINLLSPDVYIEVVNQDGKMIFASGQASHAEDQKPVSGYLDDISWNMKVYPNPVTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sporulation kinase D
publication title Insight into the sporulation phosphorelay: Crystal structure of the sensor domain of Bacillus subtilis histidine kinase, KinD.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Transferase
total genus 53
structure length 202
sequence length 203
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4jgrA02
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4jgrA01
4XT2A 1S67L 4KUOA 3H9WA 3MR0A 1S4RA 5G4YA 2P7JA 5F5YA 2V1BA 1S4SA 4BBTA 1P0ZA 4L9EA 4B9OA 4H6JA 2VV8A 3IBRA 3UB8A 2CMNA 4EETB 4EEUA 4KUKA 5I5LA 4I39A 1UGUA 3E4OA 1XFQA 4HH3A 1OTBA 4GHIB 4R3AA 2V9AA 5HWTA 1T1BA 1LT0A 2J80A 4NXBA 4GCZA 1DP8A 1S1ZA 2D02A 5A8BA 1OJ5A 3UE6A 3BY8A 3LYXA 3G6OA 2B02A 2QHKA 2PHYA 3LI8A 3ULFA 1LSXA 1N9LA 1Y28A 2PR5A 4I38A 2YKHA 1LSVA 4JGOA 1GSVA 4BBVA 2WKQA 4WLAA 1ODVA 4GHIA 1V9YA 2OOLA 2PDRA 5HWWA 1GSXA 2ZOIA 4NXFA 1MZUA 3CWFA 2L1MA 3F1PB 3C2WA 2EA9A 2Z6CA 3LIFA 2I9VA 5HZHA 1TS8A 4EEPA 5HDSA 3P7NA 4MN5A 4R70A 3ZQ5A 1D06A 4NXGA 5TBMB 5AVFA 1DP6A 3NJAA 3UB9A 4RQ9A 4I3AA 1XJ2A 3K3CA 4MN6A 2Z6DA 5G4ZA 3H7WB 1V9ZA 5DJUA 2WKPA 3VE3A 1DP9A 1TS6A 3LIAA 3BWLA 3FC7A 4LLOB 1X0OA 3F1PA 1OTDA 2V1AA 4GS9B 1NWZA 2PD7A 2ZOHA 3F1OB 4HI4A 3E4QA 4DJ2A 1TS0A 5TBMA 2WKRA 3PHYA 2QJ7A 2QJ5A 4LRZE 3UMEA 5F68A 2GJ3A 3CAXA 4LPZA 1UWNX 3H7WA 1DRMA 1LSWA 2QWSA 2JHEA 3UB6A 1UWPX 2V0WA 5DJTA 4HJ4A 3A0SA 5J4EA 1VB6A 4GS9A 5HD3A 3OLOA 3MFXA 3F1OA 4WUJA 4JGQA 3EEHA 1S1YA 3LI9A 4LRYC 4EXOA 3EWKA 5HDDA 4HP4A 2KDKA 2YKFA 2KX6A 3UMDA 3GECA 3FG8A 4WN5A 3K3DA 4HNBA 4GW9A 1BYWA 4NXEA 5AVEA 4YWZA 4KQDA 4WL9A 3BY9A 2INWA 5HWVA 4JGRA 4LRXC 5HSQA 3MJQA 5DKLA 2H28A 5IU1A 5HDCA 4EERA 1XJ4A 2W0NA 5EFWA 3MXQA 4HJ6A 1OTAA 3A0VA 2VEAA 4I3IA 3UB7A 4R6LA 3H82B 2M1CA 3RTYA 1OTEA 1T1CA 3LIDA 3B33A 3LUQA 1LL8A 1N9OA 2VV7A 3C8CA 5HD5A 2W27A 4K08A 1EW0A 3GDIA 4I5SA 1XFNA 1D7EA 3NOUC 4F3LB 3SW1A 3F1NB 2K7SA 3NOTC 2PYPA 5KIZA 1XJ6A 3RH8B 3A0RA 4L9GA 3H82A 2V0UA 3MQQA 5F6AA 1N9NA 4R38A 3NHQA 1GSWA 2R78A 2ZBBA 1OTIA 1S66L 1T1AA 4I3JA 1P97A 2D01A 4JGPA 3MQOA 1JNUA 1OJGA 4HOIA 2VV6A 4HHDA 3LIBA 2OWJA 4F3LA 4PKYG 3VOLA 5DKKA 4EW7A 1F9IA 3CLOA 3F1NA 2PYRA 4HH2A 3HJKA 5IS1A 3IS2B 1WA9A 3ICYA 1TS7A 4HY8A 4PKYA 3PYPA 5F69A 4L9FA 2VLGA 1F98A 2OWHA 2L4RA 2JN7A 4HP9A 2BASA 2HV1A 4EESA 4E04A 2A24B 4XT2B 1KOUA 1T18A 3E4PA 4HJ3A 3VE4A 3KX0X 1OT9A 4H6JB 4BBUA 4M4XA 3D72A 2PD8A 3T50A 1T19A 3IS2A 1XJ3A 4HQAA 4WF0A 3HJIA 3NOPC 2PR6A 2L0WA 3LIEA 4EQ1A 2QKPA 1OT6A 1G28A 4HIAA 4DJ3A 5J3WA 5J7EA 3LICA 2A24A
chains in the Genus database with same CATH superfamily
4DXCA 4X6TA 2O99A 1FCNA 4UQIM 2VK3A 4EBLA 5CHMA 5FAOA 1Q2PA 2H5SA 2P7JA 5GHXA 4OH0A 5EVIA 1NJ4A 3UPNA 3V67A 4OLDA 5EECA 3RXXA 3R4KA 2WZXA 1I5QA 4EEUA 2JC7A 1IKIA 1I2SA 3ZG5A 2VGJA 3PBQA 3NI9A 2HZ5A 1XFQA 2EXBA 4HH3A 2W1TA 4R3AA 5HWTA 5FI7A 3V3SA 1LHYA 1DP8A 1SKOB 3O86A 4WYYA 2X01A 2D02A 1KGGA 4CLCD 5DVAA 1ZC2A 3LYXA 2B02A 3D3OA 2HF6A 1ES4A 2BLSA 1BLHA 1Y28A 3S7OA 5HX9A 1YMXA 3FYZA 4A5RA 4BBVA 1Q2QA 2B5RA 4EBNA 1SHVA 3QP2A 4DE1A 1F2KA 1BLPA 4ZJ1A 4GHIA 1GHPA 1VM1A 3I7JA 2ZOIA 4KENB 5I94A 3W4QA 1MZUA 1WE4A 2WAFA 2Y2GA 4LV0A 5FI2A 3WRZA 3C2WA 2Q0OA 1AXBA 1MWUA 3ZQ5A 1P9RA 4QWOA 4GD6A 4IBRA 4KZ9A 4JF4A 1D06A 4B4ZA 1MC0A 2O9BA 1N9BA 5FATA 2LB9A 1J3WA 4ZDXA 4RQ9A 1XA7A 4BD0A 2HP5A 4R4RA 1PI4A 2XQZA 3OPHA 2XROA 3W2ZA 1VEUB 3AGEA 2VZWA 4QD4A 3BWLA 4LLOB 3PBOA 1X0OA 3F1PA 2UV0E 3IWIA 3HLEA 5HAIA 3O5YA 2BTFP 4E3IA 1FCMA 3T12B 3SH8A 4GS9B 2W3HA 1PRQA 3CUEC 3F1OB 4KZ5A 5U47A 4HI4A 5IHVA 1MPLA 2V8FA 5HW3A 4BL2A 3PHYA 3VP1A 2QJ5A 4LRZE 1PWGA 5FEGA 5F68A 4LPZA 3IH9A 1NZOA 3ZVWA 4NETA 1LSWA 3OC2A 3IWOA 4Y13A 1MKIA 3HL9A 3QP6A 2B18A 3CJMA 2OLVA 4P87A 2V0WA 4FH2A 5DJTA 3BFFA 5CGWA 5HD3A 3OLOA 1TDLA 5FAQA 1KE3A 4WUJA 2J8YA 3EEHA 1E3UD 2WZZA 4IHQA 4LRYC 2WADA 4EXOA 4DMZA 2WKEA 3PAEA 2XK1A 1ES2A 5HDDA 4JF6A 4HP4A 4EQIA 3A3JA 4HNBA 2G7UA 2EXAA 5AVEA 3LEQA 4KQDA 4WL9A 2QMIA 2ZC4B 3GQZA 4LRXC 4N9KA 4ZAMA 1BLSA 2HDRA 2J7VA 1HTZA 4DDYA 5EFWA 4MLLA 1MWRA 2XH9A 1FQGA 3VOYA 3VFHA 4HJ6A 2R9XA 1W8QA 2FFFB 2HP6A 3IHBA 4I3IA 3WS0A 2IA2A 4R6LA 5CHJA 4HEFA 4E3NA 3LIDA 3IQAA 1LL8A 2V8CA 1BUEA 1ACFA 4K08A 1IYQA 4OKPA 2P9VA 4C6YA 2JKRI 4ARZB 1IOUA 1SDEA 1IYPA 1D7EA 3NOUC 2ZMFA 4NG2A 4F3LB 3W8KA 3QP1A 2JKFA 3T1XA 4S2OA 1FR1A 3SS4A 3ZCZA 1VETA 2PYPA 1XJ6A 3RH8B 5GLBA 3A0RA 3PBTA 1YT4A 2V0UA 3IH8A 1TF1A 3MQQA 5A93A 2K2NA 1TD5A 5CGSA 4R38A 2PU4A 3HLCA 2QZ6A 1HVBA 3UPOA 3Q7VA 3GVBA 4EV4A 1S66L 1T1AA 5HPIA 1P97A 3OPLA 4X69A 4JF5A 4JGPA 1YKDA 4GNUA 2HJ9C 5DF8A 1U60A 4HHDA 3QP5A 4GOGA 3IXDA 3B3XA 4JBFA 1KGEA 3VOLA 4Y0UA 1O7EA 1PWDA 3L7HA 4QU3A 2DRWA 4RX2A 2ZJ9A 5E2EA 4Y0OA 1MY8A 3VSKA 3IWQA 4UA6A 4E3MA 4L0LA 3UNWA 4WEKA 5F82A 4LFUA 4E04A 4OOMA 2A24B 3HLWA 1GA9A 2EWWA 2ZQCA 4MBHA 1GHIA 5A90A 5E2GA 1ONHA 3DWZA 3KX0X 5F1GA 2ACGA 4Q0IA 1EWZA 3RFBA 4H6JB 4M4XA 3D72A 2EX2A 3T50A 1T19A 5GHYA 5EE8A 3IS2A 1K54C 1KE4A 3EGDC 3VOZA 2IWDA 3R7WB 4LV2A 4CLCC 3LEZA 4P6ZM 2L0WA 4PM8A 4FCFA 3OPPA 4EQ1A 2P04A 1VHMA 2QKPA 2XD1A 2ZC5B 3VSLA 4IBXA 1YSPA 4DJ3A 5J3WA 4G3KA 1LL5A 3MQ0A 2W3DA 4XT2A 4ZJ2A 4KUOA 3H9WA 2FH5A 4OOYA 3MR0A 1CEGA 1S4RA 5G4YA 3PXPA 5FI6A 4R3BA 1K6SA 3E2LA 2V1BA 1S4SA 1P0ZA 4L9EA 1GHMA 2ZMAA 3S7PA 4GDNA 3MBZA 3NULA 1FOFA 5D3OA 1YLJA 5TJJA 4YFMA 2R9WA 2X02A 1OPXA 3AGDA 1OMEA 2K31A 3VV4A 1YLPA 5GLDA 4E6WA 5EVEA 2Y2OA 5M19A 2ZL1A 1NLYA 2P08A 4DN0A 2J80A 4NXBA 3UDFA 1L0FA 2JKTM 1FIKA 3HBRA 5A8BA 1ZTUA 3NY4A 4B88A 5KZHA 2V20A 3T1RA 4P6BA 3BY8A 1SDNA 3DW0A 5K5BA 3HUNA 2Y55A 2H10A 3UO9A 3BFCA 1CEFA 4I38A 3BLSA 3PBNA 3E98A 1CQAA 4G3WA 1JWPA 2I72A 2A49A 1MXOA 1PIOA 2B95A 2VA0A 3UE3A 5HAPA 1IELA 4MMNA 4WLAA 2ZM0A 2WKIA 1IYSA 1K4EA 2ZD8A 3IHAA 1TVFA 2HJEA 2OOLA 5HWWA 1SKOA 1GSXA 4NXFA 1H8ZA 3CWFA 4DKIA 2L1MA 3CG5A 3DBAA 4B93A 2Z6CA 1ZKJA 3NBLA 3UN7A 2NUTC 1QMEA 4EEPA 5HDSA 4BJPA 3P09A 3P7NA 4ZBEA 1CJFA 4R70A 1Z09A 3GRJA 2PBDP 4OQGA 3UDXA 4S2KA 4NXGA 2G2WA 3JYIA 5AVFA 1DP6A 5TBMB 1E4DA 3IF6B 1BZAA 3TJZC 4N92A 4ME4A 3MZFA 5G4ZA 2JKGA 5DJUA 1TEMA 5JYPA 1P9WA 3VP2A 4LENA 3FC7A 4Q0HA 1BT5A 2PD7A 1F5MA 4GN2A 4HBTA 2FFYA 4ETZA 1K57A 2FZ0A 3E4QA 1BULA 5BOHA 1RCJA 3UMEA 4DE2A 5L09A 4JXVA 1ERMA 1UWNX 4IUKA 5DTSA 2XFTA 3V3RA 2ZQAA 3BJNA 1VEUA 4GKUA 1J9MA 1Y4OA 3MZEA 4IJGA 3MF0A 1YMSA 1L2SA 2BG1A 4UA7A 3UB6A 1NZUA 4HJ4A 1VQQA 3A0SA 5J4EA 4UHUA 3SOIA 2OSUA 2ZC3B 4GS9A 1K56D 1MWTA 3S7NA 2ZQ8A 3F1OA 3JPUA 4CLCB 4PM5A 3LFVA 3G35A 4JKTA 3LI9A 4Y7PA 5MC7A 4OPQA 3DTMA 3EQUA 3EWKA 4G3VA 3U2AA 3K2NA 1DJCA 4HESA 3FZCA 3QP4A 2O9CA 4WN5A 4K91A 4KG2A 2OAP1 4YWZA 4R1GA 3BY9A 2INWA 3ISGA 3T4KA 4JGRA 3MJQA 5DKLA 3C4OA 2H28A 2A3UA 5HDCA 1GA0A 2ZC7A 4FD8A 2O0YA 1XJ4A 3CMZA 3MS6A 4R23A 4WM9A 3CZDA 4WMCD 5E2FA 4RVAA 2Z2LB 3A0VA 4II7A 4D2OA 3S4XA 3M6BA 3QNCA 1IEMA 3DAVA 3EEAA 2AVXA 3B33A 3VFFA 3WS4A 2J9OA 3TW8A 1EW0A 1NLZA 4I5SA 5FQ9A 1K25A 4WZ5C 3OZHA 3BFDA 1H5XA 1PZOA 3PR6A 1W8YA 4C75A 3F1NB 3BYDA 2K7SA 5HL6A 5KMWA 2XGNA 2XR0A 3HLFA 4OQIA 1BTLA 1IKGA 3GR2A 1ALQA 4EUZA 1TDGA 5F6AA 3CHWP 4XUXA 3JVVA 3C7UA 2ZBBA 3IX4A 5AJGA 3TE8A 3C7VA 3CPTB 4I3JA 5FQIA 2D01A 4GJ4A 3DTIA 4XUZA 3MQOA 4ID4A 1OJGA 2XF3A 4E3LA 1LLBA 3MXSA 3L9KA 4CJNA 3W4OA 5EUAA 3UE0A 4ARZA 3BM6A 2OWJA 2WGWB 4F3LA 2X71A 2OV5A 2XDMA 1F9IA 3CLOA 2PYRA 5TFQA 2GNXA 3FPVA 2W3GA 1WA9A 3ICYA 1TS7A 3OCNA 3D9YA 4L9FA 1C3BA 2Y2LA 2OWHA 2L4RA 2JN7A 4OQHA 2JCHA 4NKPA 3G2YA 3LR3A 5DTTA 1FSYA 1MWSA 3VE4A 4C3QA 1YLWA 1XXMA 2E8JA 1OT9A 2Y2JA 5EM0A 3S22A 4BBUA 2CC1A 1L0GA 2GDNA 4MBKA 1Z6FA 3IXBA 2QYBA 1K55C 4WF0A 1KGFA 2ZQDA 3SH9A 2EWVA 3NDGA 4DDSA 1NYMA 2XLNA 4KG6A 3O3VA 3NCKA 3LICA 3EGXC 2A24A 3KSIA 4MN7A 1S67L 3CUEA 1YLTA 1K4FA 3IT9A 4WZ5A 2EFUA 4ETXA 1M40A 5F5YA 5CXWA 4XXRA 4B9OA 3RXWA 4H6JA 3VP3A 2KLIA 3N8SA 4OVDA 1QMFA 2VV8A 3GMWA 4DRTA 3D4FA 3IXHA 1L0DA 4UEYA 5HFOA 4KQRA 4LV1A 1RGYA 4KG5A 3R7WA 5DF7A 4I39A 5M18A 3IF6C 1UGUA 3E4OA 4KQOA 3E2KA 3TOIA 1OTBA 2V9AA 1T1BA 4WELA 4K0WA 4GCZA 3NIAA 1RGZA 3MZDA 4PAUA 3OCLA 3WS2A 1DJAA 1Y54A 1OJ5A 1JVJA 3UE6A 3NDEA 3G6OA 3HUOA 4O01A 1S6RA 2QHKA 2PHYA 4S2JA 5L8MA 3UY6A 1LSXA 5GLAA 3LO7A 1YM1A 2XA7S 4GD8A 2PR5A 2C5WB 3SS3A 2YKHA 4NEED 4S2LA 1LSVA 2IWBA 3VP4A 4S2NC 3NC8A 1ODVA 5TGFA 5FAPA 3DTKA 1ESUA 3OBFA 2PDRA 3FPWA 3AGFA 5DFXA 5EOEA 2EA9A 3LIFA 2XEPA 2I9VA 5HZHA 1TS8A 4Z9QA 2Y59A 3BEBA 4MN5A 4QB8A 5CERA 2HDSA 5CRFA 4Y0TA 1LI0A 4LGWA 4M3KA 5HPFA 3B47A 3UB9A 4DE3A 1XJ2A 3K3CA 4FUWA 5CTMA 5F1FA 4ZTKA 2Z6DA 4GDBA 2HP9A 2XA7M 3H7WB 4MCWA 3HLBA 3CITA 3VE3A 4X68A 5KSHA 1DP9A 1TS6A 3KSGA 2WAEA 4E6XA 3P01A 3PBRA 4LCMA 1PYYA 5AQBA 2VJWA 2Y8HA 1OTDA 5FQKA 3HLDA 4JPMA 4YINA 1NWZA 4ZJ3A 1G5UA 2V1ZA 4QPRA 4ZRRA 1CF0A 1CK3A 3EOIA 3ZG8B 4KZ8A 4DJ2A 3SZTA 1TS0A 4P85A 4X25A 5TBMA 2Y2PA 3IF6A 5EVIC 5DFYA 3V50A 2GJ3A 3CAXA 2HDQA 2WGVA 1DRMA 3RJUA 1L3LA 1IYOA 4GZBA 4O8GA 3ZGAB 5TR7A 4KZAA 3NECA 1XPBA 1A0KA 4UA9A 2JHEA 3A3IA 4ESPA 3T1QB 1XKZA 4HBUA 5IT5A 1KDWA 2Y91A 4R3JA 3MFXA 4X55A 4DF6A 5EPHA 3Q82A 3N8RA 1S1YA 5HL1A 3ZHHA 4MEZA 5FQQA 2JKRM 4X1MA 1PWCA 2KDKA 2YKFA 3BRMA 2KX6A 3UMDA 3ZNYA 4RX3A 3TRCA 3GECA 1D1JA 2PT7A 1I2WA 5A92A 4PMAA 1W79A 1BYWA 4UQIS 1PW8A 1FSWA 3W4PA 5IU1A 2WYXA 5FL3A 5AQAA 1K54A 2MJ6A 3MXQA 4Y15A 4CLCA 1YLYA 3T4QA 4N1XA 3N4IA 3Q81A 4JXGA 4O0PA 1K56A 4QJGA 3LR4A 2J3TD 3H82B 3MKFA 5CHUA 1OTEA 1W63M 1T1CA 2GX5A 2QPNA 2V2FF 4RYEA 1DY6A 1XP4A 1N9OA 4O7DA 5KSCA 2VV7A 1H0MA 1E25A 5HD5A 2A2LA 3V39A 2ZL1B 4S2MA 1BLCA 4KZ3A 1YLZA 3A3EA 4Y17A 5FA7A 2LB5A 1WYBA 3V5MA 4N1HA 4P0MA 4BQMA 3JVUA 1SCWA 2EX9A 1M6KA 4DXBA 3NOTC 4OPRA 1ZG4A 1NYYA 2W3EA 2IWCA 5KIZA 1ES3A 4MDZA 4WMCA 4E3JA 3C5AA 3MFDA 1N9NA 1CI8A 5CGXA 3MMHA 3NHQA 1GSWA 2GZAA 1RP5A 1HZOA 1G68A 5L10A 3T4LA 1XGIA 2KOIA 1JNUA 4EUVA 3M2KA 4BMWA 2W1RA 1W5DA 4WBGA 3LGOA 3IX3A 4Y3IA 4Z1WA 4BENA 4EU0A 4D60A 3F1NA 1PFLA 2Y2NA 3HJKA 5AQ9A 4IEDA 2Y2KA 3LR0A 3G4PA 3T4TA 1JWVA 2EX6A 4PKYA 2XD5A 3G31A 1F98A 1K38A 5AQ7A 4NK3A 2H0YA 3WWXA 4EESA 5M1AA 5EVID 3WS1A 3CPTA 3EQVA 4BL3A 2ZLYA 2J3WA 2EX8A 4CQHA 1YAXA 3E4PA 4HJ3A 4R4SA 3VP0A 2WGWA 4KZ6A 5EVIB 1H8YA 3MKEA 4PPRA 1YQSA 2Q9MA 3UE1A 1G6AA 2G2UA 4MNRA 1XX2A 2PBYA 5L2FA 2WUQA 4HQAA 1IFQA 1MKMA 1E3UA 3HJIA 2PR6A 4AFIA 2RL3A 4RA7A 4K0XA 1EI5A 3OPRA 2W1TB 3ZG9B 2ZC6B 3KSFA 1G28A 3M6HA 4FH4A 4FSFA 2EFXA 5IS1A 3ZNTA 2ZQ7A 3BQAA 1KE0A 1PI5A 1K6RA 2Y2MA 4Q8IA 1H8MA 2ZM2A 5FDSA 4N9LA 4BBTA 4UAAA 4YOFA 2HGVA 3IBRA 3UB8A 2CMNA 3KYZA 1NXYA 4EETB 3KSHA 2OLUA 3IBJA 4KUKA 5I5LA 5EOOA 5CX7A 3OOVA 1XA1A 3S7QA 5DF9A 2ZQ9A 3KO6A 3PTEA 4GHIB 1ONGA 1LT0A 2DCFA 1JTGA 1S1ZA 2VGLS 3IF5A 1WYCA 1NY0A 3HREA 3DWKA 4OPZA 5DTKA 4LV3A 1W7FA 3ZG0A 3SH7A 4R0QA 3ZYTA 3O87A 3MXRA 3LI8A 3ULFA 1N9LA 3S1YA 4WZ4A 4Y5FA 5FDHA 3BQ8A 1FCOA 1SZVA 5EV0A 1NRFA 3UPPA 4JGOA 1GSVA 3WRTA 5CEBA 3FKVA 4IUHA 3WS5A 2WKQA 4OOLA 4JXWA 3Q7ZA 1HD8A 3VMAA 2PRFA 3BFGA 1V9YA 3HUMA 2JBFA 1ESIA 2M7VA 3LY4A 1L0EA 5A91A 3Q07A 3F1PB 3CI6A 3PBSA 1ES5A 4QHCA 5G18A 4YNRA 2OAQ1 2VGLM 2O9AA 3HVFA 3ZG7B 3G30A 4QY6A 5FQJA 1YPRA 4GLQA 2WK0A 5CECA 3NJAA 4I3AA 4MN6A 2JKTI 3N7WA 1V9ZA 3G34A 2WKPA 4DE0A 3BECA 3GTCA 2WKHA 5E43A 1HLUP 2M7UA 3LIAA 1EROA 2V1AA 4CLCE 3B42A 2ZOHA 2VX8A 2DNSA 1H3QA 4OP8A 5FSRA 3P98A 5GLCA 3LY3A 4OLGA 2XSSA 2WKRA 2QJ7A 2HDUA 1STZA 1BSGA 3H7WA 4JXSA 1PW1A 2H0TA 3GSGA 5JYOA 3Q1FA 1PNEA 3ITBA 1K0KA 2QWSA 3QHYA 3BW6A 4LCLA 4F94A 2J3TC 1UWPX 1KVLA 2RCXA 1VB6A 4MBFA 1KVMA 4KQQA 4JGQA 2NUPC 2XFSA 3LR5A 4P6ZS 3DTEA 4PM7A 3N8LA 4FTXA 1FILA 3T1SA 2Y2HA 1KDSA 3C38A 4KZ7A 4KZBA 3HCYA 2ZMVA 3FG8A 3K3DA 4EBPA 4GW9A 4NXEA 2P74A 5C5KA 4WEJA 5HWVA 2Z2MB 5HSQA 4X56A 3T4OA 4PHTA 2P9VB 4EERA 5FEFA 4QY5A 1ZHHB 2ZM8A 5CEDA 2W0NA 1K55A 3ITAA 3GV9A 1OTAA 5GHZA 4X53A 3BLMA 3ZFZA 1VETB 2VEAA 1ZG6A 3UB7A 2Y4AA 2Y2IA 2M1CA 3KYEA 3RTYA 3U4LP 3BFEA 4OPYA 3LUQA 5LBRA 4BD1A 1LL9A 2J9PA 3Q7VB 3C8CA 4Y2FA 2W27A 1JTDA 3T4JA 1MBLA 3M2JA 3O88A 3GDIA 1JWZA 2DMWA 4S2PA 4E3KA 2W3FA 4X1LA 1N4OA 3IX8A 1XFNA 1PZPA 1W63Q 3SW1A 3UB5P 4OP5A 4B4XA 1G6OA 5EM1A 3KYQA 1SKFA 3TG9A 4JLFA 3FKWA 3IXGA 1AWIA 4L9GA 4PM6A 3H82A 1K57C 2PU2A 1XGJA 2R78A 2Y2QA 2UWXA 4H8RA 1OTIA 2JE5A 1FR6A 3PAGA 1ERQA 1YSQA 1NRJA 3FV7A 4BWIA 4CPKA 2VGKA 2WGIA 4HOIA 2VV6A 3TSGA 3UDIA 3MSHA 3LIBA 3QNBA 3G2ZA 4S2IA 5J8XA 2Q9NA 4FOFA 4PKYG 4S2NA 4IVKA 5DKKA 5FQMA 4EW7A 3FWLA 4HH2A 4Q0JA 1CI9A 3IS2B 1GCEA 3SS5A 2C6WB 2PAVP 4BLMA 1DJBA 3HLGA 5L07A 4IVIA 4HY8A 3PYPA 4U0XA 5F69A 3A3FA 2VLGA 4OONA 5HAQA 5GL9A 5FASA 4KZ4A 1S0WA 4U0TA 2XRNA 4HP9A 2BASA 2HV1A 4XT2B 1KOUA 4GB7A 3LCEA 1T18A 3E0YA 4E3OA 5CTNA 4EWFA 3G32A 1O07A 3ZVTA 2PD8A 5HARA 3ZDJA 2VKSA 2E8IA 3QP8A 1XJ3A 3C30A 3NOPC 5EVLA 3LIEA 3C4PA 4U3TA 5E2HA 2Y79A 1LI9A 3A3DA 1OT6A 2HPBA 4HIAA 3N6IA 4OQ0A 5J7EA 4PM9A 3T4SA 5F83A
chains in the Genus database with same CATH topology
3KSIA 4MN7A 3BQAA 4XT2A 2O99A 1S67L 3CUEA 4KUOA 4UQIM 3H9WA 2FH5A 3MR0A 4ETXA 1S4RA 5G4YA 3PXPA 1H8MA 2P7JA 5F5YA 2V1BA 1S4SA 4BBTA 1P0ZA 4L9EA 4YOFA 4B9OA 4H6JA 2HGVA 3V67A 2KLIA 3S7PA 2VV8A 3IBRA 3UB8A 2CMNA 3KYZA 3R4KA 4EETB 3KSHA 4EEUA 5TJJA 4UEYA 3IBJA 4KUKA 3R7WA 5I5LA 1OPXA 5CX7A 3OOVA 4I39A 3S7QA 5DF9A 1UGUA 3PBQA 2K31A 3VV4A 3E4OA 3KO6A 1XFQA 4KQOA 4HH3A 2W1TA 1OTBA 4GHIB 4R3AA 2V9AA 5HWTA 1T1BA 1NLYA 4WELA 1LT0A 2P08A 4DN0A 2J80A 4NXBA 4GCZA 1DP8A 1S1ZA 2VGLS 2JKTM 4PAUA 3OCLA 2D02A 5A8BA 1ZTUA 1OJ5A 3UE6A 4CLCD 3BY8A 3LYXA 3G6OA 4O01A 3ZYTA 2B02A 3D3OA 2QHKA 2PHYA 5L8MA 2HF6A 3LI8A 3ULFA 1LSXA 1N9LA 5K5BA 1Y28A 4Y5FA 2XA7S 3S7OA 2PR5A 3BQ8A 4I38A 3PBNA 3E98A 2YKHA 4G3WA 4NEED 1LSVA 4JGOA 1GSVA 4BBVA 2VA0A 3UE3A 4IUHA 4MMNA 2WKQA 4WLAA 4OOLA 1ODVA 4GHIA 1V9YA 2HJEA 2OOLA 3OBFA 2PDRA 5HWWA 1GSXA 3FPWA 2M7VA 2ZOIA 4NXFA 5DFXA 1MZUA 3CWFA 2L1MA 3CI6A 3F1PB 3PBSA 3C2WA 2EA9A 3DBAA 4B93A 2Z6CA 3LIFA 2NUTC 2I9VA 5HZHA 4YNRA 2OAQ1 1TS8A 4EEPA 5HDSA 4BJPA 3P7NA 2VGLM 2O9AA 4MN5A 4R70A 1P9RA 3ZQ5A 4GLQA 1D06A 1MC0A 2O9BA 4NXGA 5TBMB 5AVFA 1DP6A 2LB9A 5HPFA 3B47A 3NJAA 3UB9A 4RQ9A 4I3AA 3TJZC 1XJ2A 3K3CA 4MN6A 2JKTI 2Z6DA 4ME4A 5G4ZA 2XA7M 1V9ZA 3H7WB 4MCWA 5DJUA 2WKPA 3CITA 3VE3A 2XROA 5KSHA 1P9WA 3W2ZA 1DP9A 1TS6A 2VZWA 3KSGA 2M7UA 3P01A 3PBRA 3LIAA 3BWLA 3FC7A 4LLOB 3PBOA 4Q0HA 1X0OA 2VJWA 3F1PA 2Y8HA 3O5YA 1OTDA 2V1AA 4CLCE 4GS9B 1NWZA 2PD7A 3B42A 1F5MA 2W3HA 2ZOHA 2VX8A 3CUEC 3F1OB 4QPRA 4ZRRA 3EOIA 4ETZA 4HI4A 1H3QA 2FZ0A 3E4QA 4DJ2A 1TS0A 5TBMA 2XSSA 2WKRA 5DFYA 3PHYA 2QJ7A 2QJ5A 4LRZE 1STZA 3UMEA 5F68A 2GJ3A 3CAXA 4LPZA 1UWNX 3H7WA 4IUKA 1DRMA 3BJNA 4O8GA 4IJGA 1LSWA 3OC2A 2QWSA 2B18A 3MF0A 2JHEA 3BW6A 3UB6A 2J3TC 1UWPX 2V0WA 5DJTA 4HJ4A 3A0SA 5IT5A 5J4EA 1VB6A 4GS9A 5HD3A 3S7NA 3OLOA 3MFXA 3F1OA 4CLCB 3LFVA 4WUJA 4JGQA 2NUPC 3EEHA 1S1YA 3LI9A 5MC7A 4IHQA 2JKRM 4LRYC 3LR5A 4P6ZS 4EXOA 4DMZA 3EQUA 3EWKA 4G3VA 5HDDA 4HP4A 2KDKA 2YKFA 3U2AA 2KX6A 3UMDA 3K2NA 3C38A 3TRCA 3GECA 2PT7A 3HCYA 2O9CA 2ZMVA 3FG8A 4WN5A 3K3DA 4HNBA 4GW9A 1BYWA 2G7UA 4UQIS 4NXEA 5AVEA 2OAP1 4YWZA 4KQDA 4WL9A 3BY9A 2INWA 5C5KA 4WEJA 5HWVA 3T4KA 4JGRA 4LRXC 5HSQA 3MJQA 5DKLA 2H28A 5IU1A 4PHTA 3T4OA 5HDCA 5FL3A 4EERA 1ZHHB 2O0YA 1XJ4A 2MJ6A 2W0NA 5EFWA 3MXQA 4CLCA 3T4QA 4HJ6A 1OTAA 3A0VA 4II7A 2VEAA 4O0PA 4I3IA 3UB7A 2IA2A 3LR4A 2J3TD 4R6LA 3H82B 2M1CA 3RTYA 1OTEA 1W63M 1T1CA 2GX5A 3EEAA 3LIDA 3B33A 3LUQA 5LBRA 1LL8A 1N9OA 2VV7A 3C8CA 5HD5A 3TW8A 4Y2FA 2A2LA 2W27A 4K08A 3T4JA 1EW0A 3GDIA 1NLZA 4I5SA 2DMWA 2W3FA 2JKRI 2LB5A 4ARZB 1IOUA 1XFNA 1D7EA 3NOUC 3JVUA 2ZMFA 4F3LB 1W63Q 3PR6A 3SW1A 3F1NB 2K7SA 3NOTC 5HL6A 1G6OA 2W3EA 3KYQA 2PYPA 5KIZA 1XJ6A 3RH8B 3A0RA 4L9GA 3PBTA 3H82A 4MDZA 2V0UA 1TF1A 3MQQA 2K2NA 5F6AA 1TD5A 1N9NA 4R38A 3MMHA 3NHQA 1GSWA 2R78A 3JVVA 2GZAA 2ZBBA 1OTIA 5AJGA 1S66L 3TE8A 1T1AA 5HPIA 4I3JA 1P97A 1YSQA 2D01A 1NRJA 3T4LA 4GJ4A 4BWIA 4JGPA 2KOIA 3MQOA 1YKDA 1JNUA 1OJGA 4EUVA 2HJ9C 4HOIA 2VV6A 4BMWA 4HHDA 4ARZA 2W1RA 3LIBA 2OWJA 4F3LA 4Y3IA 4Z1WA 4FOFA 4EU0A 4PKYG 3VOLA 5DKKA 4EW7A 1F9IA 3CLOA 3F1NA 2PYRA 4HH2A 4Q0JA 3HJKA 2GNXA 5IS1A 3FPVA 2W3GA 3LR0A 3IS2B 1WA9A 3ICYA 3T4TA 1TS7A 3OCNA 4HY8A 4PKYA 3PYPA 5F69A 4L9FA 2VLGA 1F98A 2OWHA 2L4RA 4L0LA 2JN7A 4WEKA 2XRNA 4HP9A 2BASA 2HV1A 4EESA 3EQVA 4E04A 4NKPA 4OOMA 2A24B 4XT2B 1KOUA 2EWWA 1T18A 2J3WA 3LR3A 4CQHA 2W3DA 3E0YA 1YAXA 3E4PA 4HJ3A 3VE4A 3KX0X 4Q0IA 3RFBA 1OT9A 4H6JB 4BBUA 4M4XA 3D72A 2PD8A 3T50A 1T19A 3IS2A 2VKSA 1XJ3A 2QYBA 3EGDC 3C30A 4HQAA 1IFQA 3R7WB 1MKMA 4WF0A 3HJIA 3NOPC 4CLCC 2PR6A 4AFIA 4P6ZM 2EWVA 2L0WA 3LIEA 4EQ1A 2P04A 1VHMA 2QKPA 2W1TB 2Y79A 3KSFA 1OT6A 1G28A 1YSPA 4FSFA 4HIAA 4DJ3A 5J3WA 5J7EA 4G3KA 3LICA 3MQ0A 3EGXC 3T4SA 2A24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XT2 A;  1S67 L;  4KUO A;  3H9W A;  3MR0 A;  1S4R A;  5G4Y A;  2P7J A;  5F5Y A;  2V1B A;  1S4S A;  4BBT A;  1P0Z A;  4L9E A;  4B9O A;  4H6J A;  2VV8 A;  3IBR A;  3UB8 A;  2CMN A;  4EET B;  4EEU A;  4KUK A;  5I5L A;  4I39 A;  1UGU A;  3E4O A;  1XFQ A;  4HH3 A;  1OTB A;  4GHI B;  4R3A A;  2V9A A;  5HWT A;  1T1B A;  1LT0 A;  2J80 A;  4NXB A;  4GCZ A;  1DP8 A;  1S1Z A;  2D02 A;  5A8B A;  1OJ5 A;  3UE6 A;  3BY8 A;  3LYX A;  3G6O A;  2B02 A;  2QHK A;  2PHY A;  3LI8 A;  3ULF A;  1LSX A;  1N9L A;  1Y28 A;  2PR5 A;  4I38 A;  2YKH A;  1LSV A;  4JGO A;  1GSV A;  4BBV A;  2WKQ A;  4WLA A;  1ODV A;  4GHI A;  1V9Y A;  2OOL A;  2PDR A;  5HWW A;  1GSX A;  2ZOI A;  4NXF A;  1MZU A;  3CWF A;  2L1M A;  3F1P B;  3C2W A;  2EA9 A;  2Z6C A;  3LIF A;  2I9V A;  5HZH A;  1TS8 A;  4EEP A;  5HDS A;  3P7N A;  4MN5 A;  4R70 A;  3ZQ5 A;  1D06 A;  4NXG A;  5TBM B;  5AVF A;  1DP6 A;  3NJA A;  3UB9 A;  4RQ9 A;  4I3A A;  1XJ2 A;  3K3C A;  4MN6 A;  2Z6D A;  5G4Z A;  3H7W B;  1V9Z A;  5DJU A;  2WKP A;  3VE3 A;  1DP9 A;  1TS6 A;  3LIA A;  3BWL A;  3FC7 A;  4LLO B;  1X0O A;  3F1P A;  1OTD A;  2V1A A;  4GS9 B;  1NWZ A;  2PD7 A;  2ZOH A;  3F1O B;  4HI4 A;  3E4Q A;  4DJ2 A;  1TS0 A;  5TBM A;  2WKR A;  3PHY A;  2QJ7 A;  2QJ5 A;  4LRZ E;  3UME A;  5F68 A;  2GJ3 A;  3CAX A;  4LPZ A;  1UWN X;  3H7W A;  1DRM A;  1LSW A;  2QWS A;  2JHE A;  3UB6 A;  1UWP X;  2V0W A;  5DJT A;  4HJ4 A;  3A0S A;  5J4E A;  1VB6 A;  4GS9 A;  5HD3 A;  3OLO A;  3MFX A;  3F1O A;  4WUJ A;  4JGQ A;  3EEH A;  1S1Y A;  3LI9 A;  4LRY C;  4EXO A;  3EWK A;  5HDD A;  4HP4 A;  2KDK A;  2YKF A;  2KX6 A;  3UMD A;  3GEC A;  3FG8 A;  4WN5 A;  3K3D A;  4HNB A;  4GW9 A;  1BYW A;  4NXE A;  5AVE A;  4YWZ A;  4KQD A;  4WL9 A;  3BY9 A;  2INW A;  5HWV A;  4JGR A;  4LRX C;  5HSQ A;  3MJQ A;  5DKL A;  2H28 A;  5IU1 A;  5HDC A;  4EER A;  1XJ4 A;  2W0N A;  5EFW A;  3MXQ A;  4HJ6 A;  1OTA A;  3A0V A;  2VEA A;  4I3I A;  3UB7 A;  4R6L A;  3H82 B;  2M1C A;  3RTY A;  1OTE A;  1T1C A;  3LID A;  3B33 A;  3LUQ A;  1LL8 A;  1N9O A;  2VV7 A;  3C8C A;  5HD5 A;  2W27 A;  4K08 A;  1EW0 A;  3GDI A;  4I5S A;  1XFN A;  1D7E A;  3NOU C;  4F3L B;  3SW1 A;  3F1N B;  2K7S A;  3NOT C;  2PYP A;  5KIZ A;  1XJ6 A;  3RH8 B;  3A0R A;  4L9G A;  3H82 A;  2V0U A;  3MQQ A;  5F6A A;  1N9N A;  4R38 A;  3NHQ A;  1GSW A;  2R78 A;  2ZBB A;  1OTI A;  1S66 L;  1T1A A;  4I3J A;  1P97 A;  2D01 A;  4JGP A;  3MQO A;  1JNU A;  1OJG A;  4HOI A;  2VV6 A;  4HHD A;  3LIB A;  2OWJ A;  4F3L A;  4PKY G;  3VOL A;  5DKK A;  4EW7 A;  1F9I A;  3CLO A;  3F1N A;  2PYR A;  4HH2 A;  3HJK A;  5IS1 A;  3IS2 B;  1WA9 A;  3ICY A;  1TS7 A;  4HY8 A;  4PKY A;  3PYP A;  5F69 A;  4L9F A;  2VLG A;  1F98 A;  2OWH A;  2L4R A;  2JN7 A;  4HP9 A;  2BAS A;  2HV1 A;  4EES A;  4E04 A;  2A24 B;  4XT2 B;  1KOU A;  1T18 A;  3E4P A;  4HJ3 A;  3VE4 A;  3KX0 X;  1OT9 A;  4H6J B;  4BBU A;  4M4X A;  3D72 A;  2PD8 A;  3T50 A;  1T19 A;  3IS2 A;  1XJ3 A;  4HQA A;  4WF0 A;  3HJI A;  3NOP C;  2PR6 A;  2L0W A;  3LIE A;  4EQ1 A;  2QKP A;  1OT6 A;  1G28 A;  4HIA A;  4DJ3 A;  5J3W A;  5J7E A;  3LIC A;  2A24 A; 
#chains in the Genus database with same CATH topology
 4DXC A;  4X6T A;  2O99 A;  1FCN A;  4UQI M;  2VK3 A;  4EBL A;  5CHM A;  5FAO A;  1Q2P A;  2H5S A;  2P7J A;  5GHX A;  4OH0 A;  5EVI A;  1NJ4 A;  3UPN A;  3V67 A;  4OLD A;  5EEC A;  3RXX A;  3R4K A;  2WZX A;  1I5Q A;  4EEU A;  2JC7 A;  1IKI A;  1I2S A;  3ZG5 A;  2VGJ A;  3PBQ A;  3NI9 A;  2HZ5 A;  1XFQ A;  2EXB A;  4HH3 A;  2W1T A;  4R3A A;  5HWT A;  5FI7 A;  3V3S A;  1LHY A;  1DP8 A;  1SKO B;  3O86 A;  4WYY A;  2X01 A;  2D02 A;  1KGG A;  4CLC D;  5DVA A;  1ZC2 A;  3LYX A;  2B02 A;  3D3O A;  2HF6 A;  1ES4 A;  2BLS A;  1BLH A;  1Y28 A;  3S7O A;  5HX9 A;  1YMX A;  3FYZ A;  4A5R A;  4BBV A;  1Q2Q A;  2B5R A;  4EBN A;  1SHV A;  3QP2 A;  4DE1 A;  1F2K A;  1BLP A;  4ZJ1 A;  4GHI A;  1GHP A;  1VM1 A;  3I7J A;  2ZOI A;  4KEN B;  5I94 A;  3W4Q A;  1MZU A;  1WE4 A;  2WAF A;  2Y2G A;  4LV0 A;  5FI2 A;  3WRZ A;  3C2W A;  2Q0O A;  1AXB A;  1MWU A;  3ZQ5 A;  1P9R A;  4QWO A;  4GD6 A;  4IBR A;  4KZ9 A;  4JF4 A;  1D06 A;  4B4Z A;  1MC0 A;  2O9B A;  1N9B A;  5FAT A;  2LB9 A;  1J3W A;  4ZDX A;  4RQ9 A;  1XA7 A;  4BD0 A;  2HP5 A;  4R4R A;  1PI4 A;  2XQZ A;  3OPH A;  2XRO A;  3W2Z A;  1VEU B;  3AGE A;  2VZW A;  4QD4 A;  3BWL A;  4LLO B;  3PBO A;  1X0O A;  3F1P A;  2UV0 E;  3IWI A;  3HLE A;  5HAI A;  3O5Y A;  2BTF P;  4E3I A;  1FCM A;  3T12 B;  3SH8 A;  4GS9 B;  2W3H A;  1PRQ A;  3CUE C;  3F1O B;  4KZ5 A;  5U47 A;  4HI4 A;  5IHV A;  1MPL A;  2V8F A;  5HW3 A;  4BL2 A;  3PHY A;  3VP1 A;  2QJ5 A;  4LRZ E;  1PWG A;  5FEG A;  5F68 A;  4LPZ A;  3IH9 A;  1NZO A;  3ZVW A;  4NET A;  1LSW A;  3OC2 A;  3IWO A;  4Y13 A;  1MKI A;  3HL9 A;  3QP6 A;  2B18 A;  3CJM A;  2OLV A;  4P87 A;  2V0W A;  4FH2 A;  5DJT A;  3BFF A;  5CGW A;  5HD3 A;  3OLO A;  1TDL A;  5FAQ A;  1KE3 A;  4WUJ A;  2J8Y A;  3EEH A;  1E3U D;  2WZZ A;  4IHQ A;  4LRY C;  2WAD A;  4EXO A;  4DMZ A;  2WKE A;  3PAE A;  2XK1 A;  1ES2 A;  5HDD A;  4JF6 A;  4HP4 A;  4EQI A;  3A3J A;  4HNB A;  2G7U A;  2EXA A;  5AVE A;  3LEQ A;  4KQD A;  4WL9 A;  2QMI A;  2ZC4 B;  3GQZ A;  4LRX C;  4N9K A;  4ZAM A;  1BLS A;  2HDR A;  2J7V A;  1HTZ A;  4DDY A;  5EFW A;  4MLL A;  1MWR A;  2XH9 A;  1FQG A;  3VOY A;  3VFH A;  4HJ6 A;  2R9X A;  1W8Q A;  2FFF B;  2HP6 A;  3IHB A;  4I3I A;  3WS0 A;  2IA2 A;  4R6L A;  5CHJ A;  4HEF A;  4E3N A;  3LID A;  3IQA A;  1LL8 A;  2V8C A;  1BUE A;  1ACF A;  4K08 A;  1IYQ A;  4OKP A;  2P9V A;  4C6Y A;  2JKR I;  4ARZ B;  1IOU A;  1SDE A;  1IYP A;  1D7E A;  3NOU C;  2ZMF A;  4NG2 A;  4F3L B;  3W8K A;  3QP1 A;  2JKF A;  3T1X A;  4S2O A;  1FR1 A;  3SS4 A;  3ZCZ A;  1VET A;  2PYP A;  1XJ6 A;  3RH8 B;  5GLB A;  3A0R A;  3PBT A;  1YT4 A;  2V0U A;  3IH8 A;  1TF1 A;  3MQQ A;  5A93 A;  2K2N A;  1TD5 A;  5CGS A;  4R38 A;  2PU4 A;  3HLC A;  2QZ6 A;  1HVB A;  3UPO A;  3Q7V A;  3GVB A;  4EV4 A;  1S66 L;  1T1A A;  5HPI A;  1P97 A;  3OPL A;  4X69 A;  4JF5 A;  4JGP A;  1YKD A;  4GNU A;  2HJ9 C;  5DF8 A;  1U60 A;  4HHD A;  3QP5 A;  4GOG A;  3IXD A;  3B3X A;  4JBF A;  1KGE A;  3VOL A;  4Y0U A;  1O7E A;  1PWD A;  3L7H A;  4QU3 A;  2DRW A;  4RX2 A;  2ZJ9 A;  5E2E A;  4Y0O A;  1MY8 A;  3VSK A;  3IWQ A;  4UA6 A;  4E3M A;  4L0L A;  3UNW A;  4WEK A;  5F82 A;  4LFU A;  4E04 A;  4OOM A;  2A24 B;  3HLW A;  1GA9 A;  2EWW A;  2ZQC A;  4MBH A;  1GHI A;  5A90 A;  5E2G A;  1ONH A;  3DWZ A;  3KX0 X;  5F1G A;  2ACG A;  4Q0I A;  1EWZ A;  3RFB A;  4H6J B;  4M4X A;  3D72 A;  2EX2 A;  3T50 A;  1T19 A;  5GHY A;  5EE8 A;  3IS2 A;  1K54 C;  1KE4 A;  3EGD C;  3VOZ A;  2IWD A;  3R7W B;  4LV2 A;  4CLC C;  3LEZ A;  4P6Z M;  2L0W A;  4PM8 A;  4FCF A;  3OPP A;  4EQ1 A;  2P04 A;  1VHM A;  2QKP A;  2XD1 A;  2ZC5 B;  3VSL A;  4IBX A;  1YSP A;  4DJ3 A;  5J3W A;  4G3K A;  1LL5 A;  3MQ0 A;  2W3D A;  4XT2 A;  4ZJ2 A;  4KUO A;  3H9W A;  2FH5 A;  4OOY A;  3MR0 A;  1CEG A;  1S4R A;  5G4Y A;  3PXP A;  5FI6 A;  4R3B A;  1K6S A;  3E2L A;  2V1B A;  1S4S A;  1P0Z A;  4L9E A;  1GHM A;  2ZMA A;  3S7P A;  4GDN A;  3MBZ A;  3NUL A;  1FOF A;  5D3O A;  1YLJ A;  5TJJ A;  4YFM A;  2R9W A;  2X02 A;  1OPX A;  3AGD A;  1OME A;  2K31 A;  3VV4 A;  1YLP A;  5GLD A;  4E6W A;  5EVE A;  2Y2O A;  5M19 A;  2ZL1 A;  1NLY A;  2P08 A;  4DN0 A;  2J80 A;  4NXB A;  3UDF A;  1L0F A;  2JKT M;  1FIK A;  3HBR A;  5A8B A;  1ZTU A;  3NY4 A;  4B88 A;  5KZH A;  2V20 A;  3T1R A;  4P6B A;  3BY8 A;  1SDN A;  3DW0 A;  5K5B A;  3HUN A;  2Y55 A;  2H10 A;  3UO9 A;  3BFC A;  1CEF A;  4I38 A;  3BLS A;  3PBN A;  3E98 A;  1CQA A;  4G3W A;  1JWP A;  2I72 A;  2A49 A;  1MXO A;  1PIO A;  2B95 A;  2VA0 A;  3UE3 A;  5HAP A;  1IEL A;  4MMN A;  4WLA A;  2ZM0 A;  2WKI A;  1IYS A;  1K4E A;  2ZD8 A;  3IHA A;  1TVF A;  2HJE A;  2OOL A;  5HWW A;  1SKO A;  1GSX A;  4NXF A;  1H8Z A;  3CWF A;  4DKI A;  2L1M A;  3CG5 A;  3DBA A;  4B93 A;  2Z6C A;  1ZKJ A;  3NBL A;  3UN7 A;  2NUT C;  1QME A;  4EEP A;  5HDS A;  4BJP A;  3P09 A;  3P7N A;  4ZBE A;  1CJF A;  4R70 A;  1Z09 A;  3GRJ A;  2PBD P;  4OQG A;  3UDX A;  4S2K A;  4NXG A;  2G2W A;  3JYI A;  5AVF A;  1DP6 A;  5TBM B;  1E4D A;  3IF6 B;  1BZA A;  3TJZ C;  4N92 A;  4ME4 A;  3MZF A;  5G4Z A;  2JKG A;  5DJU A;  1TEM A;  5JYP A;  1P9W A;  3VP2 A;  4LEN A;  3FC7 A;  4Q0H A;  1BT5 A;  2PD7 A;  1F5M A;  4GN2 A;  4HBT A;  2FFY A;  4ETZ A;  1K57 A;  2FZ0 A;  3E4Q A;  1BUL A;  5BOH A;  1RCJ A;  3UME A;  4DE2 A;  5L09 A;  4JXV A;  1ERM A;  1UWN X;  4IUK A;  5DTS A;  2XFT A;  3V3R A;  2ZQA A;  3BJN A;  1VEU A;  4GKU A;  1J9M A;  1Y4O A;  3MZE A;  4IJG A;  3MF0 A;  1YMS A;  1L2S A;  2BG1 A;  4UA7 A;  3UB6 A;  1NZU A;  4HJ4 A;  1VQQ A;  3A0S A;  5J4E A;  4UHU A;  3SOI A;  2OSU A;  2ZC3 B;  4GS9 A;  1K56 D;  1MWT A;  3S7N A;  2ZQ8 A;  3F1O A;  3JPU A;  4CLC B;  4PM5 A;  3LFV A;  3G35 A;  4JKT A;  3LI9 A;  4Y7P A;  5MC7 A;  4OPQ A;  3DTM A;  3EQU A;  3EWK A;  4G3V A;  3U2A A;  3K2N A;  1DJC A;  4HES A;  3FZC A;  3QP4 A;  2O9C A;  4WN5 A;  4K91 A;  4KG2 A;  2OAP 1;  4YWZ A;  4R1G A;  3BY9 A;  2INW A;  3ISG A;  3T4K A;  4JGR A;  3MJQ A;  5DKL A;  3C4O A;  2H28 A;  2A3U A;  5HDC A;  1GA0 A;  2ZC7 A;  4FD8 A;  2O0Y A;  1XJ4 A;  3CMZ A;  3MS6 A;  4R23 A;  4WM9 A;  3CZD A;  4WMC D;  5E2F A;  4RVA A;  2Z2L B;  3A0V A;  4II7 A;  4D2O A;  3S4X A;  3M6B A;  3QNC A;  1IEM A;  3DAV A;  3EEA A;  2AVX A;  3B33 A;  3VFF A;  3WS4 A;  2J9O A;  3TW8 A;  1EW0 A;  1NLZ A;  4I5S A;  5FQ9 A;  1K25 A;  4WZ5 C;  3OZH A;  3BFD A;  1H5X A;  1PZO A;  3PR6 A;  1W8Y A;  4C75 A;  3F1N B;  3BYD A;  2K7S A;  5HL6 A;  5KMW A;  2XGN A;  2XR0 A;  3HLF A;  4OQI A;  1BTL A;  1IKG A;  3GR2 A;  1ALQ A;  4EUZ A;  1TDG A;  5F6A A;  3CHW P;  4XUX A;  3JVV A;  3C7U A;  2ZBB A;  3IX4 A;  5AJG A;  3TE8 A;  3C7V A;  3CPT B;  4I3J A;  5FQI A;  2D01 A;  4GJ4 A;  3DTI A;  4XUZ A;  3MQO A;  4ID4 A;  1OJG A;  2XF3 A;  4E3L A;  1LLB A;  3MXS A;  3L9K A;  4CJN A;  3W4O A;  5EUA A;  3UE0 A;  4ARZ A;  3BM6 A;  2OWJ A;  2WGW B;  4F3L A;  2X71 A;  2OV5 A;  2XDM A;  1F9I A;  3CLO A;  2PYR A;  5TFQ A;  2GNX A;  3FPV A;  2W3G A;  1WA9 A;  3ICY A;  1TS7 A;  3OCN A;  3D9Y A;  4L9F A;  1C3B A;  2Y2L A;  2OWH A;  2L4R A;  2JN7 A;  4OQH A;  2JCH A;  4NKP A;  3G2Y A;  3LR3 A;  5DTT A;  1FSY A;  1MWS A;  3VE4 A;  4C3Q A;  1YLW A;  1XXM A;  2E8J A;  1OT9 A;  2Y2J A;  5EM0 A;  3S22 A;  4BBU A;  2CC1 A;  1L0G A;  2GDN A;  4MBK A;  1Z6F A;  3IXB A;  2QYB A;  1K55 C;  4WF0 A;  1KGF A;  2ZQD A;  3SH9 A;  2EWV A;  3NDG A;  4DDS A;  1NYM A;  2XLN A;  4KG6 A;  3O3V A;  3NCK A;  3LIC A;  3EGX C;  2A24 A;  3KSI A;  4MN7 A;  1S67 L;  3CUE A;  1YLT A;  1K4F A;  3IT9 A;  4WZ5 A;  2EFU A;  4ETX A;  1M40 A;  5F5Y A;  5CXW A;  4XXR A;  4B9O A;  3RXW A;  4H6J A;  3VP3 A;  2KLI A;  3N8S A;  4OVD A;  1QMF A;  2VV8 A;  3GMW A;  4DRT A;  3D4F A;  3IXH A;  1L0D A;  4UEY A;  5HFO A;  4KQR A;  4LV1 A;  1RGY A;  4KG5 A;  3R7W A;  5DF7 A;  4I39 A;  5M18 A;  3IF6 C;  1UGU A;  3E4O A;  4KQO A;  3E2K A;  3TOI A;  1OTB A;  2V9A A;  1T1B A;  4WEL A;  4K0W A;  4GCZ A;  3NIA A;  1RGZ A;  3MZD A;  4PAU A;  3OCL A;  3WS2 A;  1DJA A;  1Y54 A;  1OJ5 A;  1JVJ A;  3UE6 A;  3NDE A;  3G6O A;  3HUO A;  4O01 A;  1S6R A;  2QHK A;  2PHY A;  4S2J A;  5L8M A;  3UY6 A;  1LSX A;  5GLA A;  3LO7 A;  1YM1 A;  2XA7 S;  4GD8 A;  2PR5 A;  2C5W B;  3SS3 A;  2YKH A;  4NEE D;  4S2L A;  1LSV A;  2IWB A;  3VP4 A;  4S2N C;  3NC8 A;  1ODV A;  5TGF A;  5FAP A;  3DTK A;  1ESU A;  3OBF A;  2PDR A;  3FPW A;  3AGF A;  5DFX A;  5EOE A;  2EA9 A;  3LIF A;  2XEP A;  2I9V A;  5HZH A;  1TS8 A;  4Z9Q A;  2Y59 A;  3BEB A;  4MN5 A;  4QB8 A;  5CER A;  2HDS A;  5CRF A;  4Y0T A;  1LI0 A;  4LGW A;  4M3K A;  5HPF A;  3B47 A;  3UB9 A;  4DE3 A;  1XJ2 A;  3K3C A;  4FUW A;  5CTM A;  5F1F A;  4ZTK A;  2Z6D A;  4GDB A;  2HP9 A;  2XA7 M;  3H7W B;  4MCW A;  3HLB A;  3CIT A;  3VE3 A;  4X68 A;  5KSH A;  1DP9 A;  1TS6 A;  3KSG A;  2WAE A;  4E6X A;  3P01 A;  3PBR A;  4LCM A;  1PYY A;  5AQB A;  2VJW A;  2Y8H A;  1OTD A;  5FQK A;  3HLD A;  4JPM A;  4YIN A;  1NWZ A;  4ZJ3 A;  1G5U A;  2V1Z A;  4QPR A;  4ZRR A;  1CF0 A;  1CK3 A;  3EOI A;  3ZG8 B;  4KZ8 A;  4DJ2 A;  3SZT A;  1TS0 A;  4P85 A;  4X25 A;  5TBM A;  2Y2P A;  3IF6 A;  5EVI C;  5DFY A;  3V50 A;  2GJ3 A;  3CAX A;  2HDQ A;  2WGV A;  1DRM A;  3RJU A;  1L3L A;  1IYO A;  4GZB A;  4O8G A;  3ZGA B;  5TR7 A;  4KZA A;  3NEC A;  1XPB A;  1A0K A;  4UA9 A;  2JHE A;  3A3I A;  4ESP A;  3T1Q B;  1XKZ A;  4HBU A;  5IT5 A;  1KDW A;  2Y91 A;  4R3J A;  3MFX A;  4X55 A;  4DF6 A;  5EPH A;  3Q82 A;  3N8R A;  1S1Y A;  5HL1 A;  3ZHH A;  4MEZ A;  5FQQ A;  2JKR M;  4X1M A;  1PWC A;  2KDK A;  2YKF A;  3BRM A;  2KX6 A;  3UMD A;  3ZNY A;  4RX3 A;  3TRC A;  3GEC A;  1D1J A;  2PT7 A;  1I2W A;  5A92 A;  4PMA A;  1W79 A;  1BYW A;  4UQI S;  1PW8 A;  1FSW A;  3W4P A;  5IU1 A;  2WYX A;  5FL3 A;  5AQA A;  1K54 A;  2MJ6 A;  3MXQ A;  4Y15 A;  4CLC A;  1YLY A;  3T4Q A;  4N1X A;  3N4I A;  3Q81 A;  4JXG A;  4O0P A;  1K56 A;  4QJG A;  3LR4 A;  2J3T D;  3H82 B;  3MKF A;  5CHU A;  1OTE A;  1W63 M;  1T1C A;  2GX5 A;  2QPN A;  2V2F F;  4RYE A;  1DY6 A;  1XP4 A;  1N9O A;  4O7D A;  5KSC A;  2VV7 A;  1H0M A;  1E25 A;  5HD5 A;  2A2L A;  3V39 A;  2ZL1 B;  4S2M A;  1BLC A;  4KZ3 A;  1YLZ A;  3A3E A;  4Y17 A;  5FA7 A;  2LB5 A;  1WYB A;  3V5M A;  4N1H A;  4P0M A;  4BQM A;  3JVU A;  1SCW A;  2EX9 A;  1M6K A;  4DXB A;  3NOT C;  4OPR A;  1ZG4 A;  1NYY A;  2W3E A;  2IWC A;  5KIZ A;  1ES3 A;  4MDZ A;  4WMC A;  4E3J A;  3C5A A;  3MFD A;  1N9N A;  1CI8 A;  5CGX A;  3MMH A;  3NHQ A;  1GSW A;  2GZA A;  1RP5 A;  1HZO A;  1G68 A;  5L10 A;  3T4L A;  1XGI A;  2KOI A;  1JNU A;  4EUV A;  3M2K A;  4BMW A;  2W1R A;  1W5D A;  4WBG A;  3LGO A;  3IX3 A;  4Y3I A;  4Z1W A;  4BEN A;  4EU0 A;  4D60 A;  3F1N A;  1PFL A;  2Y2N A;  3HJK A;  5AQ9 A;  4IED A;  2Y2K A;  3LR0 A;  3G4P A;  3T4T A;  1JWV A;  2EX6 A;  4PKY A;  2XD5 A;  3G31 A;  1F98 A;  1K38 A;  5AQ7 A;  4NK3 A;  2H0Y A;  3WWX A;  4EES A;  5M1A A;  5EVI D;  3WS1 A;  3CPT A;  3EQV A;  4BL3 A;  2ZLY A;  2J3W A;  2EX8 A;  4CQH A;  1YAX A;  3E4P A;  4HJ3 A;  4R4S A;  3VP0 A;  2WGW A;  4KZ6 A;  5EVI B;  1H8Y A;  3MKE A;  4PPR A;  1YQS A;  2Q9M A;  3UE1 A;  1G6A A;  2G2U A;  4MNR A;  1XX2 A;  2PBY A;  5L2F A;  2WUQ A;  4HQA A;  1IFQ A;  1MKM A;  1E3U A;  3HJI A;  2PR6 A;  4AFI A;  2RL3 A;  4RA7 A;  4K0X A;  1EI5 A;  3OPR A;  2W1T B;  3ZG9 B;  2ZC6 B;  3KSF A;  1G28 A;  3M6H A;  4FH4 A;  4FSF A;  2EFX A;  5IS1 A;  3ZNT A;  2ZQ7 A;  3BQA A;  1KE0 A;  1PI5 A;  1K6R A;  2Y2M A;  4Q8I A;  1H8M A;  2ZM2 A;  5FDS A;  4N9L A;  4BBT A;  4UAA A;  4YOF A;  2HGV A;  3IBR A;  3UB8 A;  2CMN A;  3KYZ A;  1NXY A;  4EET B;  3KSH A;  2OLU A;  3IBJ A;  4KUK A;  5I5L A;  5EOO A;  5CX7 A;  3OOV A;  1XA1 A;  3S7Q A;  5DF9 A;  2ZQ9 A;  3KO6 A;  3PTE A;  4GHI B;  1ONG A;  1LT0 A;  2DCF A;  1JTG A;  1S1Z A;  2VGL S;  3IF5 A;  1WYC A;  1NY0 A;  3HRE A;  3DWK A;  4OPZ A;  5DTK A;  4LV3 A;  1W7F A;  3ZG0 A;  3SH7 A;  4R0Q A;  3ZYT A;  3O87 A;  3MXR A;  3LI8 A;  3ULF A;  1N9L A;  3S1Y A;  4WZ4 A;  4Y5F A;  5FDH A;  3BQ8 A;  1FCO A;  1SZV A;  5EV0 A;  1NRF A;  3UPP A;  4JGO A;  1GSV A;  3WRT A;  5CEB A;  3FKV A;  4IUH A;  3WS5 A;  2WKQ A;  4OOL A;  4JXW A;  3Q7Z A;  1HD8 A;  3VMA A;  2PRF A;  3BFG A;  1V9Y A;  3HUM A;  2JBF A;  1ESI A;  2M7V A;  3LY4 A;  1L0E A;  5A91 A;  3Q07 A;  3F1P B;  3CI6 A;  3PBS A;  1ES5 A;  4QHC A;  5G18 A;  4YNR A;  2OAQ 1;  2VGL M;  2O9A A;  3HVF A;  3ZG7 B;  3G30 A;  4QY6 A;  5FQJ A;  1YPR A;  4GLQ A;  2WK0 A;  5CEC A;  3NJA A;  4I3A A;  4MN6 A;  2JKT I;  3N7W A;  1V9Z A;  3G34 A;  2WKP A;  4DE0 A;  3BEC A;  3GTC A;  2WKH A;  5E43 A;  1HLU P;  2M7U A;  3LIA A;  1ERO A;  2V1A A;  4CLC E;  3B42 A;  2ZOH A;  2VX8 A;  2DNS A;  1H3Q A;  4OP8 A;  5FSR A;  3P98 A;  5GLC A;  3LY3 A;  4OLG A;  2XSS A;  2WKR A;  2QJ7 A;  2HDU A;  1STZ A;  1BSG A;  3H7W A;  4JXS A;  1PW1 A;  2H0T A;  3GSG A;  5JYO A;  3Q1F A;  1PNE A;  3ITB A;  1K0K A;  2QWS A;  3QHY A;  3BW6 A;  4LCL A;  4F94 A;  2J3T C;  1UWP X;  1KVL A;  2RCX A;  1VB6 A;  4MBF A;  1KVM A;  4KQQ A;  4JGQ A;  2NUP C;  2XFS A;  3LR5 A;  4P6Z S;  3DTE A;  4PM7 A;  3N8L A;  4FTX A;  1FIL A;  3T1S A;  2Y2H A;  1KDS A;  3C38 A;  4KZ7 A;  4KZB A;  3HCY A;  2ZMV A;  3FG8 A;  3K3D A;  4EBP A;  4GW9 A;  4NXE A;  2P74 A;  5C5K A;  4WEJ A;  5HWV A;  2Z2M B;  5HSQ A;  4X56 A;  3T4O A;  4PHT A;  2P9V B;  4EER A;  5FEF A;  4QY5 A;  1ZHH B;  2ZM8 A;  5CED A;  2W0N A;  1K55 A;  3ITA A;  3GV9 A;  1OTA A;  5GHZ A;  4X53 A;  3BLM A;  3ZFZ A;  1VET B;  2VEA A;  1ZG6 A;  3UB7 A;  2Y4A A;  2Y2I A;  2M1C A;  3KYE A;  3RTY A;  3U4L P;  3BFE A;  4OPY A;  3LUQ A;  5LBR A;  4BD1 A;  1LL9 A;  2J9P A;  3Q7V B;  3C8C A;  4Y2F A;  2W27 A;  1JTD A;  3T4J A;  1MBL A;  3M2J A;  3O88 A;  3GDI A;  1JWZ A;  2DMW A;  4S2P A;  4E3K A;  2W3F A;  4X1L A;  1N4O A;  3IX8 A;  1XFN A;  1PZP A;  1W63 Q;  3SW1 A;  3UB5 P;  4OP5 A;  4B4X A;  1G6O A;  5EM1 A;  3KYQ A;  1SKF A;  3TG9 A;  4JLF A;  3FKW A;  3IXG A;  1AWI A;  4L9G A;  4PM6 A;  3H82 A;  1K57 C;  2PU2 A;  1XGJ A;  2R78 A;  2Y2Q A;  2UWX A;  4H8R A;  1OTI A;  2JE5 A;  1FR6 A;  3PAG A;  1ERQ A;  1YSQ A;  1NRJ A;  3FV7 A;  4BWI A;  4CPK A;  2VGK A;  2WGI A;  4HOI A;  2VV6 A;  3TSG A;  3UDI A;  3MSH A;  3LIB A;  3QNB A;  3G2Z A;  4S2I A;  5J8X A;  2Q9N A;  4FOF A;  4PKY G;  4S2N A;  4IVK A;  5DKK A;  5FQM A;  4EW7 A;  3FWL A;  4HH2 A;  4Q0J A;  1CI9 A;  3IS2 B;  1GCE A;  3SS5 A;  2C6W B;  2PAV P;  4BLM A;  1DJB A;  3HLG A;  5L07 A;  4IVI A;  4HY8 A;  3PYP A;  4U0X A;  5F69 A;  3A3F A;  2VLG A;  4OON A;  5HAQ A;  5GL9 A;  5FAS A;  4KZ4 A;  1S0W A;  4U0T A;  2XRN A;  4HP9 A;  2BAS A;  2HV1 A;  4XT2 B;  1KOU A;  4GB7 A;  3LCE A;  1T18 A;  3E0Y A;  4E3O A;  5CTN A;  4EWF A;  3G32 A;  1O07 A;  3ZVT A;  2PD8 A;  5HAR A;  3ZDJ A;  2VKS A;  2E8I A;  3QP8 A;  1XJ3 A;  3C30 A;  3NOP C;  5EVL A;  3LIE A;  3C4P A;  4U3T A;  5E2H A;  2Y79 A;  1LI9 A;  3A3D A;  1OT6 A;  2HPB A;  4HIA A;  3N6I A;  4OQ0 A;  5J7E A;  4PM9 A;  3T4S A;  5F83 A; 
#chains in the Genus database with same CATH homology
 3KSI A;  4MN7 A;  3BQA A;  4XT2 A;  2O99 A;  1S67 L;  3CUE A;  4KUO A;  4UQI M;  3H9W A;  2FH5 A;  3MR0 A;  4ETX A;  1S4R A;  5G4Y A;  3PXP A;  1H8M A;  2P7J A;  5F5Y A;  2V1B A;  1S4S A;  4BBT A;  1P0Z A;  4L9E A;  4YOF A;  4B9O A;  4H6J A;  2HGV A;  3V67 A;  2KLI A;  3S7P A;  2VV8 A;  3IBR A;  3UB8 A;  2CMN A;  3KYZ A;  3R4K A;  4EET B;  3KSH A;  4EEU A;  5TJJ A;  4UEY A;  3IBJ A;  4KUK A;  3R7W A;  5I5L A;  1OPX A;  5CX7 A;  3OOV A;  4I39 A;  3S7Q A;  5DF9 A;  1UGU A;  3PBQ A;  2K31 A;  3VV4 A;  3E4O A;  3KO6 A;  1XFQ A;  4KQO A;  4HH3 A;  2W1T A;  1OTB A;  4GHI B;  4R3A A;  2V9A A;  5HWT A;  1T1B A;  1NLY A;  4WEL A;  1LT0 A;  2P08 A;  4DN0 A;  2J80 A;  4NXB A;  4GCZ A;  1DP8 A;  1S1Z A;  2VGL S;  2JKT M;  4PAU A;  3OCL A;  2D02 A;  5A8B A;  1ZTU A;  1OJ5 A;  3UE6 A;  4CLC D;  3BY8 A;  3LYX A;  3G6O A;  4O01 A;  3ZYT A;  2B02 A;  3D3O A;  2QHK A;  2PHY A;  5L8M A;  2HF6 A;  3LI8 A;  3ULF A;  1LSX A;  1N9L A;  5K5B A;  1Y28 A;  4Y5F A;  2XA7 S;  3S7O A;  2PR5 A;  3BQ8 A;  4I38 A;  3PBN A;  3E98 A;  2YKH A;  4G3W A;  4NEE D;  1LSV A;  4JGO A;  1GSV A;  4BBV A;  2VA0 A;  3UE3 A;  4IUH A;  4MMN A;  2WKQ A;  4WLA A;  4OOL A;  1ODV A;  4GHI A;  1V9Y A;  2HJE A;  2OOL A;  3OBF A;  2PDR A;  5HWW A;  1GSX A;  3FPW A;  2M7V A;  2ZOI A;  4NXF A;  5DFX A;  1MZU A;  3CWF A;  2L1M A;  3CI6 A;  3F1P B;  3PBS A;  3C2W A;  2EA9 A;  3DBA A;  4B93 A;  2Z6C A;  3LIF A;  2NUT C;  2I9V A;  5HZH A;  4YNR A;  2OAQ 1;  1TS8 A;  4EEP A;  5HDS A;  4BJP A;  3P7N A;  2VGL M;  2O9A A;  4MN5 A;  4R70 A;  1P9R A;  3ZQ5 A;  4GLQ A;  1D06 A;  1MC0 A;  2O9B A;  4NXG A;  5TBM B;  5AVF A;  1DP6 A;  2LB9 A;  5HPF A;  3B47 A;  3NJA A;  3UB9 A;  4RQ9 A;  4I3A A;  3TJZ C;  1XJ2 A;  3K3C A;  4MN6 A;  2JKT I;  2Z6D A;  4ME4 A;  5G4Z A;  2XA7 M;  1V9Z A;  3H7W B;  4MCW A;  5DJU A;  2WKP A;  3CIT A;  3VE3 A;  2XRO A;  5KSH A;  1P9W A;  3W2Z A;  1DP9 A;  1TS6 A;  2VZW A;  3KSG A;  2M7U A;  3P01 A;  3PBR A;  3LIA A;  3BWL A;  3FC7 A;  4LLO B;  3PBO A;  4Q0H A;  1X0O A;  2VJW A;  3F1P A;  2Y8H A;  3O5Y A;  1OTD A;  2V1A A;  4CLC E;  4GS9 B;  1NWZ A;  2PD7 A;  3B42 A;  1F5M A;  2W3H A;  2ZOH A;  2VX8 A;  3CUE C;  3F1O B;  4QPR A;  4ZRR A;  3EOI A;  4ETZ A;  4HI4 A;  1H3Q A;  2FZ0 A;  3E4Q A;  4DJ2 A;  1TS0 A;  5TBM A;  2XSS A;  2WKR A;  5DFY A;  3PHY A;  2QJ7 A;  2QJ5 A;  4LRZ E;  1STZ A;  3UME A;  5F68 A;  2GJ3 A;  3CAX A;  4LPZ A;  1UWN X;  3H7W A;  4IUK A;  1DRM A;  3BJN A;  4O8G A;  4IJG A;  1LSW A;  3OC2 A;  2QWS A;  2B18 A;  3MF0 A;  2JHE A;  3BW6 A;  3UB6 A;  2J3T C;  1UWP X;  2V0W A;  5DJT A;  4HJ4 A;  3A0S A;  5IT5 A;  5J4E A;  1VB6 A;  4GS9 A;  5HD3 A;  3S7N A;  3OLO A;  3MFX A;  3F1O A;  4CLC B;  3LFV A;  4WUJ A;  4JGQ A;  2NUP C;  3EEH A;  1S1Y A;  3LI9 A;  5MC7 A;  4IHQ A;  2JKR M;  4LRY C;  3LR5 A;  4P6Z S;  4EXO A;  4DMZ A;  3EQU A;  3EWK A;  4G3V A;  5HDD A;  4HP4 A;  2KDK A;  2YKF A;  3U2A A;  2KX6 A;  3UMD A;  3K2N A;  3C38 A;  3TRC A;  3GEC A;  2PT7 A;  3HCY A;  2O9C A;  2ZMV A;  3FG8 A;  4WN5 A;  3K3D A;  4HNB A;  4GW9 A;  1BYW A;  2G7U A;  4UQI S;  4NXE A;  5AVE A;  2OAP 1;  4YWZ A;  4KQD A;  4WL9 A;  3BY9 A;  2INW A;  5C5K A;  4WEJ A;  5HWV A;  3T4K A;  4JGR A;  4LRX C;  5HSQ A;  3MJQ A;  5DKL A;  2H28 A;  5IU1 A;  4PHT A;  3T4O A;  5HDC A;  5FL3 A;  4EER A;  1ZHH B;  2O0Y A;  1XJ4 A;  2MJ6 A;  2W0N A;  5EFW A;  3MXQ A;  4CLC A;  3T4Q A;  4HJ6 A;  1OTA A;  3A0V A;  4II7 A;  2VEA A;  4O0P A;  4I3I A;  3UB7 A;  2IA2 A;  3LR4 A;  2J3T D;  4R6L A;  3H82 B;  2M1C A;  3RTY A;  1OTE A;  1W63 M;  1T1C A;  2GX5 A;  3EEA A;  3LID A;  3B33 A;  3LUQ A;  5LBR A;  1LL8 A;  1N9O A;  2VV7 A;  3C8C A;  5HD5 A;  3TW8 A;  4Y2F A;  2A2L A;  2W27 A;  4K08 A;  3T4J A;  1EW0 A;  3GDI A;  1NLZ A;  4I5S A;  2DMW A;  2W3F A;  2JKR I;  2LB5 A;  4ARZ B;  1IOU A;  1XFN A;  1D7E A;  3NOU C;  3JVU A;  2ZMF A;  4F3L B;  1W63 Q;  3PR6 A;  3SW1 A;  3F1N B;  2K7S A;  3NOT C;  5HL6 A;  1G6O A;  2W3E A;  3KYQ A;  2PYP A;  5KIZ A;  1XJ6 A;  3RH8 B;  3A0R A;  4L9G A;  3PBT A;  3H82 A;  4MDZ A;  2V0U A;  1TF1 A;  3MQQ A;  2K2N A;  5F6A A;  1TD5 A;  1N9N A;  4R38 A;  3MMH A;  3NHQ A;  1GSW A;  2R78 A;  3JVV A;  2GZA A;  2ZBB A;  1OTI A;  5AJG A;  1S66 L;  3TE8 A;  1T1A A;  5HPI A;  4I3J A;  1P97 A;  1YSQ A;  2D01 A;  1NRJ A;  3T4L A;  4GJ4 A;  4BWI A;  4JGP A;  2KOI A;  3MQO A;  1YKD A;  1JNU A;  1OJG A;  4EUV A;  2HJ9 C;  4HOI A;  2VV6 A;  4BMW A;  4HHD A;  4ARZ A;  2W1R A;  3LIB A;  2OWJ A;  4F3L A;  4Y3I A;  4Z1W A;  4FOF A;  4EU0 A;  4PKY G;  3VOL A;  5DKK A;  4EW7 A;  1F9I A;  3CLO A;  3F1N A;  2PYR A;  4HH2 A;  4Q0J A;  3HJK A;  2GNX A;  5IS1 A;  3FPV A;  2W3G A;  3LR0 A;  3IS2 B;  1WA9 A;  3ICY A;  3T4T A;  1TS7 A;  3OCN A;  4HY8 A;  4PKY A;  3PYP A;  5F69 A;  4L9F A;  2VLG A;  1F98 A;  2OWH A;  2L4R A;  4L0L A;  2JN7 A;  4WEK A;  2XRN A;  4HP9 A;  2BAS A;  2HV1 A;  4EES A;  3EQV A;  4E04 A;  4NKP A;  4OOM A;  2A24 B;  4XT2 B;  1KOU A;  2EWW A;  1T18 A;  2J3W A;  3LR3 A;  4CQH A;  2W3D A;  3E0Y A;  1YAX A;  3E4P A;  4HJ3 A;  3VE4 A;  3KX0 X;  4Q0I A;  3RFB A;  1OT9 A;  4H6J B;  4BBU A;  4M4X A;  3D72 A;  2PD8 A;  3T50 A;  1T19 A;  3IS2 A;  2VKS A;  1XJ3 A;  2QYB A;  3EGD C;  3C30 A;  4HQA A;  1IFQ A;  3R7W B;  1MKM A;  4WF0 A;  3HJI A;  3NOP C;  4CLC C;  2PR6 A;  4AFI A;  4P6Z M;  2EWV A;  2L0W A;  3LIE A;  4EQ1 A;  2P04 A;  1VHM A;  2QKP A;  2W1T B;  2Y79 A;  3KSF A;  1OT6 A;  1G28 A;  1YSP A;  4FSF A;  4HIA A;  4DJ3 A;  5J3W A;  5J7E A;  4G3K A;  3LIC A;  3MQ0 A;  3EGX C;  3T4S A;  2A24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...