4JGYA

Crystal structure of human coxsackievirus a16 uncoating intermediate (space group p4232)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
236
structure length
228
Chain Sequence
NLIETRCVLNHHSTQETAIGNFFSRAGLVSIITMPTTGTQNTDGYVNWDIDLMGYAQLRRKCELFTYMRFDAEFTFVVAKPNGELVPQLLQYMYVPPGAPKPTSRDSFAWQTATNPSVFVKMTDPPAQVSVPFMSPASAYQWFYDGYPTDLDYGQCPNNMMGTFSIRTVGIEKSPHSITLRVYMRIKHVRAWIPRPLRNQPYLFKTNPNYKGNDIKCTSTSRDKITTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyprotein, capsid protein VP1
publication title Picornavirus uncoating intermediate captured in atomic detail.
pubmed doi rcsb
molecule tags Virus
total genus 33
structure length 228
sequence length 236
ec nomenclature
pdb deposition date 2013-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4jgyA00
4IV3B 2HWC1 1AL21 1QJZA 5CFCB 1MQTA 2HWB2 1RMU3 4WM7A 4AEDA 3TN92 3J8F1 2ZAHA 3JD72 5CFCA 2WZR1 1AYN1 2RM22 2WFF1 1NY72 3JBG3 1RHI1 4Q4X1 1ZBE2 5AC92 1DDLA 4CEWA 1VAKA 1PO12 1K5MB 2HWC2 1AL22 1RUH3 1RMU1 1ND3C 1X36A 1RUF3 1K5MA 4N53C 1NCRB 1HXS3 3J8F2 3JBG1 5BNOC 1AYN2 4Q4X2 2WFF2 4YVWC 1RHI2 1FPN1 3VBRA 1RUE1 4QPIC 4RQPB 2R071 4Z92B 2WWSA 1RMU2 2HWD3 5BNPB 2RS11 4RR3C 2XPJA 4RQPA 5J96B 1V9U2 3JBG2 5BNPA 1RVF3 1ASJ3 5CFDB 2RS51 1FPN2 1RUE2 5K0UB 2HWD1 2R072 5DDJ3 5ACA1 3VBFB 2R041 2RS12 5A32B 4WM8B 1FOD3 1ND3A 1RUJ3 4JGZC 1R081 1FMD3 1OPOA 2RS52 4N53A 1QJY3 1NCQB 3DPRC 5C8CC 5ACA2 5GKAC 2R042 1FOD1 5C9AB 5FOJB 1RUJ1 4PDWC 1FMD1 1QJY1 1R082 4RR3A 1POV3 3ZFFC 2RR13 2HWE3 4CDXB 1FOD2 1AL0G 1RUJ2 1QJY2 1POV1 3JB8A 1MQTC 1AR61 2BFUS 4FTEA 4JGZA 3ZFGB 4IV3C 5CFCC 1RUI3 2BBVA 1PO22 3DPRA 2MEV1 4PDWB 1RB8G 5C8CA 3ZFFB 4PDWA 1AR62 1PGL1 2RS31 1WCDJ 4Q4Y3 3ZFFA 2MEV2 4N43B 4GMP3 1NCRC 2HWF3 5A33B 1QJX1 1VBC3 1COV1 1QJU3 4NWVA 1E57A 5A33A 4RQPC 5J98B 5ABJB 1PGL2 1F2NA 5BNNB 2RS32 5BNPC 2R063 4IV3A 1H8TB 1VBC1 1RUC3 1AR93 1QJX2 1COV2 1R1A1 5CFDC 1M06G 5K0UC 1R093 1VRH3 5D8AB 1HRV3 3ZFEC 4RHV3 2WS93 3VBFC 1NOVA 1RUC1 4WM8C 2WZR2 3VBSB 1R1A2 4GMP0 1Z7S3 1NCRA 1RUH1 1NCQC 1BEV3 3FBMA 1HRV1 4Q4W3 1BMV1 3VBSA 1RUF1 3S6PA 1BBT3 1F8VA 1HXS1 1VBB3 5C9AC 1VBA3 4CEYB 2DF7A 1Z7S1 1PVC3 4GB33 4CDQB 1RUH2 4Q4W1 2WLPA 3ZFEB 1HRV2 5FMOL 1AR83 5CFDA 4QPGB 1AR73 1ZBA3 1RUF2 4RS5B 5K0UA 1HXS2 2X5IB 1VBE3 4CDXC 1A6CA 1VBA1 3VBOB 3ZFEA 1RVF1 1ASJ1 4IV1C 3VBFA 4GB31 5A32A 2XBO3 2X5IA 4WM8A 1C8NA 1NA1B 4Q4W2 5DDJ1 2HWD2 3VDDC 1AR71 3ZFGC 1MEC3 1RUD3 1NCQA 1VBE1 1VBA2 2GH8A 1RVF2 1ASJ2 3CJIB 4FSJA 2XBO1 4GB32 2GSYA 5C9AA 3M8LA 1IHMA 1TMF3 5DDJ2 1MEC1 1ND2B 1AR72 5JZGB 1RUD1 1PGW1 1X33A 1VBE2 4LLFA 1AYM3 4IV1B 4N43C 2FZ1A 1FMD2 2XBO2 4CDXA 1QQP3 3VBHC 3VDDB 4IV1A 1B35B 2RR11 2HWE1 1MEC2 1CD3G 1RUD2 5ABJC 5BNNC 2RMU3 4GH4B 3VDDA 1AUYA 3ZFGA 1OOPC 4CDWB 5C4WB 1H8TC 1W39A 4FTSA 1QQP1 1RUG3 4GH4A 3ZXAC 2RR12 2HWE2 5LK7B 1RUI1 2BPA2 4RFT0 5D8AC 2PLV3 1VBD3 1SMVA 4JGYB 2BUKA 4YVSB 5L7OB 1RUG1 2FZ2A 3TN93 1QQP2 4NWWA 3VBHB 3VBSC 4N43A 1EV13 1RUI2 4Q4Y1 3NAPB 2PLV1 1VBD1 3VBHA 1PO13 1OOPB 4GMP1 2HWF1 3IDEA 5ABJA 3VBUB 5BNNA 1RUG2 4CEYC 1OOPA 1QJU1 1EV11 1H8TA 1AYN3 4CDQC 4Q4Y2 2PLV2 3LOBA 4QPGC 2R061 4RS5C 1AR91 2HWF2 2X5IC 1VBC2 1EAH3 4SBVA 5D8AA 3VBOC 5FMOS 4CEWB 1QJU2 1R091 1EV12 1VRH1 1V9U3 1NA1C 1FPN3 4RHV1 2WS91 1RUE3 2R062 1EAH1 2R073 1RUC2 1AR92 3VBRB 2RS13 3CJIC 1V9U1 1BEV1 1R092 1VRH2 1BBT1 4CEYA 1BMV2 2RS53 1ND2C 4RHV2 2WS92 5JZGC 1VBB1 4CDQA 1EAH2 5ACA3 4QPGA 1PVC1 2R043 1D4M3 4RS5A 1Z7S2 1BEV2 3VBOA 1AR81 1B35C 1R083 1ZBA1 1BBT2 1ND3B 1VBB2 1NA1A 3HAGA 4GH4C 4CDWC 4CDUC 5C4WC 1D4M1 1C8M3 4N53B 1PVC2 1VB4A 2IZWA 5BNOB 4YVWB 4QPIB 1AR82 1ZBA2 3JB4C 1OHFA 3CJIA 5BNOA 4YVWA 4Y4YA 2ZZQA 4QPIA 1C8M1 1ND2A 5JZGA 4RR3B 4Q4V3 1D4M2 4JGYC 1PO23 4YVSC 5L7OC 1TMF1 1TME3 1PGW2 2QQPA 1AR63 3NAPC 1HQNA 1AYM1 1B35A 4CDUB 4EJRA 4Q4V1 1C8M2 4FTBA 1PO21 4Y5Z0 3VBUC 2MEV3 1TMF2 4JGZB 4CDWA 5C4WA 4CDUA 1PIV3 1TME1 4BCUA 1HX6A 1HRI3 2TBVA 4WM7C 2RMU1 1CJDA 3DPRB 4AEDC 5C8CB 1AYM2 1VB2A 4Q4V2 2HWB3 2RS33 1NG0A 4CEWC 2Y26A 1PIV1 3JD73 2VQ0A 1HRI1 1QJX3 1TME2 2RM23 4JGYA 4YVSA 1COV3 1ZBE3 5AC93 5L7OA 2ZTNA 2RMU2 1K5MC 2HWC3 1AL23 2HWB1 1POV0 2BFUL 3NAPA 3TN91 3VBRC 3JD71 1GFF2 1PIV2 2RM21 1NY71 3J8F3 1MQTB 1ZBE1 2WZR3 1HRI2 3VBUA 5AC91 4Q4X3 2WFF3 4WM7B 1RHI3 1R1A3 1PO11 4AEDB 1VBD2
chains in the Genus database with same CATH superfamily
1REEA 1W6MA 4R9CA 4J1XA 5TSWA 5LA0A 2DTYA 1W6PA 1ZM1A 1RMU3 3MO4A 4WM7A 4LE4A 3C3VA 2WNVB 1DZRA 4FO9A 5T5PA 2ZS6B 1C4RA 2D6PA 3IM0A 5FO7B 4A6SA 5A70A 1CZSA 1WKYA 1EPWA 1ZYBA 3POSA 5FREA 1LAJA 1ENXA 3VZMA 1NZCA 1LOBA 2A6VA 1U5XA 4IEXA 1OQEA 3KV5A 5AC92 5JR2A 1QWRA 4ASLA 1UXZA 2Q8OA 5DPNA 1VAKA 4AF9A 1K5MB 1PMHX 1W06A 2JG9B 1AL22 1B09A 5C3PA 1BK1A 3N9MA 2VUDA 4AQTA 5JOYA 4NPRA 4JKKA 5LWBA 3ZXKA 4YNIA 5FMCA 2CV6A 4HLTA 1STMA 5LA1A 2YV8A 1BLZA 2Q5TA 2YUEA 3JBG1 1K42A 5IVVA 2YG0A 2YROA 1AYN2 2WFF2 3VBRA 3AYDA 4BYYA 1CGPA 1DBNA 1S0BA 5FZIA 3CJXA 4Q2FA 1G9CA 1D2SA 3QACA 4K20A 3CMGA 1OBNA 1EUUA 4F7ZA 3C7OA 4Z92B 5C5TA 5FXWA 1ZRCA 2PHRA 2AYHA 3PTYA 2XPJA 1Z0HA 4GJYA 3D3AA 2QZ2A 1NQJA 1NZIA 1FPN2 5FYZA 1XE0A 1HW5A 3H3LA 3NSTA 4I01A 4AGVA 5IFPA 1V6KA 2AR6A 3SHRA 2QJVA 1E5IA 4JRLA 4LHKA 1VLNA 4HN0A 2J1VA 5ACA1 5JSOA 3VBFB 1CPMA 2ZHNA 5EV7A 4JDOA 4FXGB 1RC6A 1ULDA 1BVP1 3IDCB 2DYCA 3MF9A 4FXKB 4IGQA 4OHXA 3RZJA 3NV3A 2JECA 4LBMA 3S57A 1IS3A 3K75B 3B5LB 3KMHA 3EJKA 1ZREA 3ZXGA 2RS52 4LMFA 4N53A 5EFUA 3GZTB 1NCQB 4GALA 3WR0A 3DF0A 4EQVA 2YYOA 4QX0A 1DFQA 4QDRA 3J9SA 2WNOA 4QB2A 4Y24A 2JB4A 2J1UA 4L97A 3ES1A 3MYXA 2C26A 2H6CA 2VCBA 2A75A 2FBEA 4YWAA 3ILNA 1UAIA 2ILMA 2OYZA 4FFGA 4A6OA 1HIXA 3TAYA 4NR1A 3ZSMA 3POJA 2RR13 4QHOA 2CHHA 2OUJA 3HJRA 4LHSA 4XJ8A 1AL0G 1CX4A 1RUJ2 2ZEXA 1SG3A 2A3YA 2CTVA 4XUOA 3U10A 5DQ0A 1UZVA 1OURA 3WSOA 1SBEA 2EF6A 3I2IA 2NN8A 3MIDA 4FOQA 3KCCA 2VZUA 1ONAA 1H0BA 2CAUA 2D6OX 4UWDA 4FTEA 5CFCC 2AZ5A 2P1BA 4YW3A 1X82A 1PO22 1ENRA 3DPRA 4MHUA 1W05A 3WLUA 4MUVA 4I3PA 3PNAA 2EIBA 1D4VB 2WC2A 3N9QA 4WZCA 4DUXA 1GSLA 1KITA 1HB2A 4GWMA 2HYKA 4AQSA 2D6MA 2GC2A 5T5JA 2WRAA 1JYVA 2JE8A 4I30A 3BOWA 5F8PA 4RL7A 3A0KA 1UKGA 1WCDJ 4Q4Y3 3E5XA 3BU0A 5FK7A 2MEV2 4KBBA 1VMJA 4N43B 1W0OA 1RIRA 5FZLA 1NCRC 2HWF3 4WV8A 2ZEWA 1VBC3 3LDRA 3M3OA 1T6GC 3AKPA 3N35A 4JX0A 4XHXA 1BVVA 4R52A 5LBEA 3WNMA 2AGSA 2VXJA 4AI9A 1YJLA 2VGDA 3ABZA 1GOGA 1E57A 4RQPC 3FBYA 1PGL2 5C8WA 1W8TA 2ZGSA 4NE9A 5FYMA 1VR3A 3I3QA 4E2GA 5IK8A 3ZYIB 2JD9A 4FFIA 1YFYA 2XLGA 4YM0A 5FPAA 1FAYA 1V70A 1COV2 4QX5A 4CP9B 5C3OA 4TZDA 1XSQA 4OQ9A 5IT6A 1BHGA 1RYYA 2E51A 3HIFA 4ZPIA 2D6LX 4J25A 5GZCA 1M06G 1MACA 4YPJA 1OD3A 2YB7A 2WNUC 5DG1A 2W94A 3ZFEC 4AI2A 3PU8A 2ZACA 3M70A 4LQRA 4QDQA 2WS93 1UOBA 3AZVA 1OVSA 4TLGA 4WM8C 1MPXA 2WZR2 4LBQB 5B4XA 1F9KA 4OHVA 4DFSA 2G4IA 3HN3A 5DZFA 4AR2A 3T30A 1R1A2 2ZA9A 1YFXA 2W2IA 1Z7S3 1OPMA 4D0QA 1K3IA 1BEV3 2E7TA 3FJSA 4GZ9A 3C2UA 3ZXLA 4BZ4A 2A71A 5F32A 1RUF1 3S6PA 1BBT3 1WD4A 4NROA 4AE2A 2F4PA 1HXS1 5JXIA 2WR9A 5KHIA 4KG0A 3KF5A 3J7LA 2BJSA 2G9FA 2DF7A 5I0TA 3ZO0B 4LBOA 3BTXA 4FFHA 5FBJA 1OI6A 4Q4W1 1O91A 4A44A 2WUHA 3ZFEB 1NX9A 1HRV2 4MVTA 1CAXB 4ISRA 2KXLA 4FPFA 5JSPA 2ZABA 4CCNA 2VMDA 3BIWE 4IGPA 1VBE3 4IE0A 4D6SA 4W65A 1VBA1 5FP9A 1RVF1 1EY2A 2Y60A 4P5YA 3UYJA 3VBFA 2D3RA 2DV9A 4IGOA 4ISQA 4XAAA 4Q27A 5D21A 5FUIA 3ELNA 2OZJA 2XBO3 2X5IA 3UKVA 2FDIA 4K7JA 1C8NA 1SLAA 3LEKA 5AFEA 1GUIA 1XSRA 3I2HA 3VL8A 1OF3A 4AI8A 2IXJA 1J3RA 3GJBA 1NCQA 1OD5A 4AHYA 1FATA 1REDA 4KGGA 4UW6A 3WW3A 1VAMA 4UYBA 2HKXA 2ADDA 4FSJA 3LQCA 4HKLA 4Q5OA 1GKBA 2GSYA 3Q8EA 4BQ2A 3KT7A 3M8LA 5G05L 2VBDA 3MEPA 2VCAA 2QBXA 3KD4A 1MEC1 1ND2B 3FFZA 1RUD1 1JZ2A 1Y7BA 3QH7A 3N9NA 2LALA 4Q29A 2Z2SB 1X33A 4AVVA 3UL2A 4LLFA 5AVAA 3HQXA 3SH4A 3BIEA 4P02B 3S0MA 3PLQA 4CZSA 4K3UA 3ZMOA 1QNYA 4B4QA 2PHFA 5FYSA 3H7YA 3VBHC 3P1IA 4IV1A 5SV5A 4YLZA 2HWE1 1N3QA 1DLCA 1H4GA 5ABJC 1PHMA 3PMEA 2PAMA 4CUCA 1J1LA 4GH4B 5DABA 2EIGA 3WNOA 4ZS2A 4DEQA 1AUYA 4P9WA 5IK5A 4CDWB 1DZQA 1TZOA 4YM3A 1RJ8A 1UW8A 1W39A 3ZN4A 1ULGA 1UY4A 4XW3A 4BISA 2K46A 2P3IA 4YRDA 4OUMA 4QX8A 5F9TA 1QQP1 2MNGA 3FFQA 2R1DA 4BE3A 4QT6A 1FXZA 2RR12 5C7GA 5B2GB 2WYFA 5LK7B 1SLIA 2BPA2 5FZFA 1VBD3 3FWEA 1YEWA 4N7UA 5FJHA 3UJOA 3MUY1 3ZR5A 1ZZCA 3SCHA 4Y3OA 5HBAA 4WBBA 3T4VA 5L7OB 3TWIA 5EYYA 1RUG1 1YFWA 4R4ZA 4AFBA 5JPMB 1NXD1 4LE3A 5GLWA 4NWWA 3VBHB 3ME2A 4CCEA 5LCWL 2OS2A 2VZTA 2ID4A 1YUDA 4N43A 5JUVA 1WA4A 2AUYA 2ZGUA 4AVCA 3RZZA 1EV13 2DTWA 3GBGA 3PU3A 4H2AA 5JI9A 3DECA 3J7NA 5HCBA 4NHYA 3AFKA 2QZ3A 4P9JA 1GOFA 2ZMLA 3VBUB 1W6NB 1GZTA 5FZGA 4LO6B 2GALA 1UY1A 1S0FA 3LOIA 4Y5TA 2NMNA 1I3HA 1QJU1 3ACLA 1ZZBA 2ZHKA 4QGMA 3OSDA 4DB5A 4CP9A 3RZMA 1RITA 4Q4Y2 1PK6B 1GZWB 4QPGC 2Y64A 2VZSA 4RS5C 1SPPB 4YFWA 1AR91 2HWF2 1JOPA 1VBC2 3RSJA 2BGPA 5FCCA 5IYYA 1U5ZA 2WQ4A 3VBOC 3ZYHA 4AG4A 5A1FA 5FMOS 4ZS3A 1W3XA 4UBHA 4UI9L 1OQDA 2BWAA 4YW6A 5EPAA 1OSGA 4XABA 1GQPA 3H50A 4UFHA 4OHYA 3ZSJA 1UU5A 2CWMA 1VJ2A 1JW6A 2QKDA 1O5LA 4P9LA 2QQNA 4TXWA 4JV4A 4AI0A 4UW4A 2I45A 1DQ6A 1IG3A 2VNOA 2ZEZA 3Q8BA 2YFZA 1ZA4A 3CJIC 3OB8A 3RMYA 1V9U1 3D0JA 2RJKA 3ACGA 4E4HA 1F4AA 3WQ7A 4XMIA 4CU8A 4ZXEA 2WS92 1XXNA 1CESA 5JZGC 4XETA 3BVCA 3NW4A 5FUPA 3TEZA 2W68A 5FYUA 1WMXA 3K3OA 3MFAA 2W3JA 4FOYA 4LEJA 5ACA3 2HBUA 1UIKA 1Z7S2 2HH9A 1CAWB 2ZX2A 1BEV2 3JXSA 1BK0A 4YZ3A 1W6OB 4K8FA 1ZBA1 4BMBA 1BBT2 2GP3A 1ZRIA 4FPJA 3OCPA 3VUOA 4XTMA 3V0BA 4DINB 4HT1T 1QKQA 3IDBB 1O3QA 2J1RA 2JKBA 2J1EA 4GJZA 1D7PM 3GHNA 4K6BA 2QQIA 5LEKA 5IAVA 2IZWA 1OKQA 1DGWA 1ZNPA 2BGCA 2VBBA 2WN3A 3QLQA 4M3CB 4LITA 4XHBA 4ZY9A 5CG8A 1WCQA 2ORZA 4X8PA 1US2A 4ES9A 3NJXA 4A41A 2YGMA 4YZ1A 5BNOA 1T6BX 4QXCA 2MPFA 4V1PA 3S5AA 5L9VA 4QPIA 2J1SA 1ND2A 2V5YA 2C6SA 2O0OA 4RR3B 4AFMA 3RJRA 1VMHA 2VG9A 3MGUA 1LESA 4JGYC 1TMF1 1LOEA 4PIXA 3VKOA 5FKCA 1ZVFA 4BOWA 3LD8A 1DGRA 1R1ZA 2AENA 3LWCA 4NOTA 1C1FA 1OLRA 4QDSA 1I9RA 5IAXA 2HEVF 1PGW2 5JWPA 2SBAA 1RJ7A 2QQPA 4CU7A 2MHFA 4PI0A 4D69A 1OC1A 1AZDA 3K77A 4OI1A 3VKNA 4C91A 4DUVA 3B7MA 1C8M2 4QXKA 5FOBB 4FTBA 2IXCA 3PURA 2YDEA 4Y5Z0 1J1TA 1BCXA 4BQ1A 3LPFA 3MPPG 5DAXA 3MIHA 4JGZB 3D82A 4INDA 1YI9A 1MVQA 4BJ0A 4BQXA 4OI4A 3WP6A 3OBRA 4CDWA 5CNAA 4Q0PA 1EPZA 1OLQA 1HX6A 4COVA 5A80A 2TBVA 4WM7C 3H9AA 2VTFA 3D6EA 4KU8A 4HPKB 3CO2A 1MS1A 2DVDA 4Q4V2 3E1F1 3DYMA 5FWEA 4AW7A 4H7MA 1SBDA 1OUSA 2C0ZA 1FYUA 3OUJA 4IESA 4S2GA 2JDKA 3UGHA 1TME2 3Q8FA 2WSUA 4J1WA 4IUGA 5AC93 4OMDA 2WINB 4RGAA 5L7OA 1VALA 2E9QA 4YW2A 3OYWA 4TWTA 2A5ZA 5BXXA 2WZPP 3VHNA 5M0TA 3H8OA 1AL23 2HWB1 1K45A 1QOSA 2BFUL 2LTNA 3T2OA 3VBRC 3IB3A 1UYZA 1VAVA 3UT0A 1W6MB 3MIEA 4BIOA 3FMGA 1GFF2 2RM21 1W8FA 3VBUA 1W6NA 4XQWA 4WM7B 2WFF3 1O3SA 1HJFA 1PO11 1VBD2 5A7OA 4IV3B 5FZ6A 4CUBA 4G4FA 1QJZA 3ST7A 3WG4A 4QU2A 1MQTA 4QM9A 4MGIE 4XZUG 3POBA 3MF6A 2WYSA 4E9KA 1PK6A 4Z1VA 3T4HB 3LEGA 5A7SA 3A7QA 2ZAHA 3J8F1 4CCKA 4CVUA 1SPPA 3THCA 4R9BA 1NY72 1RHI1 4MHRA 2DU1A 3WUDA 4C1XA 5FAXA 1HN1A 4ZZ8A 2OW4A 1XQNA 2V09A 3NNMA 3UJQA 2P6HA 3A23A 2ZGTA 5ANQA 1GNHA 4RD7A 4Y26A 3GZAA 3MW4A 3OGGA 1RUF3 3CL1A 4N53C 1HXS3 2VUJA 2WL1A 4QKDA 2D5FA 4YVWC 4AXOA 4UFLA 5LY1A 2XJSA 1TEIA 4Z2AA 1H1IA 1J83A 1RUE1 1UOFA 3MW2A 5DN2A 1KQRA 1QDCA 4XOGA 3EBRA 1W9TA 4ZU4A 1LOCA 2VH9A 2XH6A 3CBNA 1TG7A 2HWD3 5DAVA 5FPVA 3WG2A 4B1MA 1H9PA 4CCMA 1IOAA 4PJYA 2VOWA 3U11A 2NZ9A 2RS11 2X10A 3WNKA 3BCWA 1CPNA 4XTPA 2EAKA 3URFA 1VPHA 3JBG2 3PUAA 2ZMKA 1RVF3 5BNPA 4LK7A 3O0VA 4PBPA 4ZU7A 4CE8A 2Z5WA 3Q9OA 5K0UB 1O3RA 2A3WA 3LGRA 1W9FA 1R64A 3LEMA 4F8AA 4IE4A 3WNPA 4B4PA 1W6OA 1ST8A 2B39A 3ECQA 2JENA 4WZFA 4YZ2A 4FQ4A 2YBKA 5A32B 1XNDA 1AVBA 1Q3EA 2XMLA 4BQ5A 3B69A 4IW3A 1SLLA 3Q8CA 1RUJ3 1HJGA 1W2OA 2Y38A 1R081 1FMD3 4M3CE 2GC1A 1ZX5A 4PCRA 5DZGA 5CG9A 3T0BA 3U14A 1WBLA 3AMPA 4AFAA 4CP2A 3DPRC 4M3CA 4D94A 3VKFC 3OF1A 4LOSA 1S0JA 5ACA2 1W8NA 2PFWA 3U78A 3VHOA 4A7ZA 3VDBA 4L92A 1FOD1 2BGOA 5C9AB 2E31A 3BODA 5GLUA 3MDPA 3WNNA 1JYIA 2XLFA 1QJY1 4O61A 2XG3A 4RR3A 1SDWA 2C4XA 2Z4FA 2ZGLA 5FZMA 1POV3 2W1UA 4LBKA 4XBNA 3SC7X 3WCRA 2ENRA 4KGQA 2IXKA 3AYEA 5JVVA 5JXJA 2HWE3 3C7GA 3HQRA 4NRQA 3WF3A 1E5RA 4X6QB 4NPMA 4BWOA 4XJUA 3ZOIA 2GN7A 3WQBA 4CYDA 1NXMA 2EA7A 1C1LA 3JB8A 3KLSA 3A21A 3NRUA 1AR61 2HBTA 2RE9A 3DYPA 3H0OA 4I09A 4M0HA 4EZ4A 5FLJA 2ZHMA 1PM4A 4JGZA 1IG0A 4EZHA 2VCMA 3WD5A 5F2WA 3K48A 4YGCA 5IVJA 3ENRA 4JDNA 1NYWA 2XB6C 2BBVA 2Y6HA 4IERA 3AVRA 4OMCA 4PIYA 4L9BA 3IDAA 4AHZA 5A1AA 4Y33A 3POFA 4XJAA 3VB9A 3O1UA 1WA6X 2W1SA 3NJZA 1PZ9A 2EXKA 2HLEA 4Q8LA 1DYOA 2YBSA 2JDMA 4RFRB 1J3QA 2JG9C 3ZIWA 4NAOA 4ZZ5A 3ZFFA 2VMGA 2ZHLA 3AVSA 4YGEA 4ZONA 5I0UA 2VM9A 4XFIA 2CYFA 1QXJA 1CONA 5LRSA 4HBNA 5J1XA 2IXHA 3AP4A 5JIUA 1G9AA 1X9TA 4Q1RA 3MBWA 4CP1A 1UPIA 4QHZA 5FZBA 3LA3A 1QJU3 4KWUA 2J1AA 4NWVA 2DVAA 1MZ6A 2XGXA 3M2MA 3H8XA 3AMQA 1HLCA 1W2NA 4B7KA 1AXKA 1WD3A 4IV3A 4FCAA 2R1BA 5C33A 1CQ9A 2D3PA 1RUC3 1AR93 3CHXA 4DXZA 5FP4A 2X8KA 4RGGA 1PZ7A 2CU5A 4UW5A 1BZWA 3ACHA 5CA6A 1KEXA 1FV3A 2XJTA 4IXLA 3VHPA 4KG8A 3ILRA 5D8AB 1HRV3 3KGZA 5CADA 3HD8B 3WNXA 1LOFA 1OVPA 3W5MA 2JWPA 3VBFC 2TEPA 3WP5A 1T2XA 1A78A 4QPWA 1NOVA 1KD7A 3H1WA 1TNRA 3SMHA 5HV4A 5I8YA 3WDUA 4C8DA 1IKPA 4RYDA 3CF6E 4ZXKA 3WP4A 1FT9A 1VIWB 2F17A 1GWMA 2X53S 5IWFA 4AAXA 1XNKA 1Z78A 4QX1A 5T5LA 1RUH1 1NCQC 1W2UA 3BN6A 3MI8A 4H55A 1S0EA 1AX2A 4Q0SA 2JD4A 2QQOA 3H3ZA 3I3DA 3HT1A 1YLLA 4LIVA 3VBSA 2ZPXA 3PJYA 4CA9A 3SQOA 2EIEA 2OUHA 1E5SA 3KZ4C 1YQ2A 2BU9A 3RZKA 4JHZA 1WZXA 4HMZA 5K4LA 3O7OA 3OGJA 2Z79A 4CEYB 1UZYA 2ARBA 2EIDA 4XQDA 3PTRB 1DCSA 2W52A 1G9DA 4ASMB 3RWKX 4CDQB 2GNBA 1WMEA 2WLPA 4AFDA 2NYYA 2D5HA 3I2GA 2VOXA 1H9WA 1ZBA3 2D97A 1FNYA 1PM7A 1RUF2 3OEAA 3P5BA 5EWSA 2QQLA 5FP8A 5K0UA 5IVYA 1HXS2 4QXHA 2X5IB 5FY8A 3JU9A 1A6CA 1ASJ1 4IV1C 2DBIA 3ACIA 4UFIA 4NIGA 3MPBA 2P3JA 4GB31 4LOTA 1UZ0A 5A32A 2P3KA 1VP6A 2VTXA 3I8TA 3VD3A 3RZGA 2YPDA 4Q4W2 5DDJ1 5FXVA 2HWD2 1REFA 3PUQA 1AR71 2Y6LA 4YG6A 1HN0A 2LROA 3WUCA 2YY1A 3RS6A 3T08A 4URAA 4EWEA 2VZRA 5F1RA 2FDFA 4OUEA 1VBA2 1RVF2 4FP3A 1JU4A 1UD1A 1DGWX 2QVSB 1XU2A 3LFMA 5C9AA 1IHMA 1TMF3 1WW5A 4W8JA 1LENA 2VUAA 4Z07A 2YC4A 3F2ZA 4F83A 3T0DA 5A7PA 4WVZA 1SQ4A 5EQUA 4BM8A 1SFPA 2DCKA 2XQRA 4IV1B 4P9GA 1DF0A 4N43C 4PT6A 3NJYA 1FMD2 3PVBB 3CU7A 2V4VA 2VULA 5CU1A 1MS8A 1VRBA 2VW0A 5A3OA 5FPLA 3N36A 2PYTA 2BW8A 3MFCA 1B35B 1GZCA 4R9AA 4MX3A 1MEC2 3KV4A 3POIA 1GP5A 1S55A 3IAPA 1LHWA 1RUD2 1IQAA 2ZGQA 3WCSA 2VW1A 1GNYA 2DUPA 2ARXA 2OQ7A 2WKKA 3VDAA 3WDTA 1LU2A 3VDDA 1MZ5A 4QX3A 2VOKA 5C4WB 3GXUA 4FPOB 2PAKA 3DUIA 5FZ3A 1JYNA 4YYOA 3EYPA 4FTSA 3N7MA 4K40A 4D6RA 2IUWA 2BNNA 2UWAA 3WOGA 4M4PA 3AYAA 3EHKA 4FOWA 4R4XA 2VMEA 1NUKA 3L2HA 3ZPYA 4B7EA 4CCDA 3PVOA 3NNLA 3C7HA 1YQ6A 2HWE2 2JXAA 2OX0A 2OZ6A 1HB4A 2Y0IA 4L8QA 4TSVA 5FZKA 5A3PA 3GDBA 4RFT0 3E6CC 2VTXJ 4H3WA 3IKWA 1YFUA 5FMDA 3I3BA 4A7YA 5FR3A 2VL4A 1SMVA 5IHRA 3ZYPA 1H6XA 4JCKA 4YVSB 3NV2A 3OEBA 3GCXA 2VVEA 5IFTA 5KHJA 1PNGA 1QQP2 1RUNA 3SH5A 2JEMA 1SLCA 1S2BA 1WCUA 1WLDA 3APBA 4Q0VA 5I8SA 2OKXA 1QEXA 3GNEA 5FJKA 5FPZA 2KR2A 1UN1A 2PLV1 2V73A 2VO5A 3AFGA 3LDKA 3NAPB 4K1ZA 5DAQA 3WY6A 4A3XA 1PO13 5CAZA 3LE0A 2WSVA 4GMP1 3ZDVA 3ZPOA 1D2QA 4YGBA 3RZHA 3VZNA 5L36A 4MGTA 1QGLA 4BIFA 4HVRA 1RUG2 2CNAA 2R0HA 2CGPA 1F35A 3USUA 4E8CA 4NIDA 3IIAA 3S7IA 3LPGA 2BOJA 3AZYA 2DCJA 3ES4A 1WLWA 5FXZA 1MR5A 2OPWA 2R32A 3WINE 5KXDA 1WBFA 2NQYA 3AMHA 3OUIA 4JQTA 5LB6A 5BYNA 1LB2A 2GP5A 1LRHA 3I97A 2P2KA 1WW6A 4XFGA 1JS9A 2QCSB 2Y33A 3SH3A 2F4LA 5FQ0A 5D8AA 5K7PA 3AZZA 3SXWA 4Y5SA 5BY5A 1QJU2 1R091 2ZZJA 1W9WA 4IEUA 4IEYA 1G9BA 1SFYA 2FCUA 3GF6A 4ES8A 5FIXA 3KHCA 2ES3A 3OD4A 1RUE3 1SCSA 1SHWB 2VMIA 2VVDA 1QJEA 1UMZA 3LA7A 4XZPA 1ULEA 3E6BA 1EAH1 3MLLA 1RUC2 1AR92 1LKNA 4RN5A 4HFSA 2RS13 4YZ5A 4Q0QA 1AHSA 1QMJA 2JB8A 4TLFA 1IPKA 5FZ0A 2DCYA 3U4XA 3GBWA 4CEYA 1BMV2 1QDOA 1ND2C 2BWCA 2QDNA 1UKRA 1DP0A 3PMSA 4KI5M 4TYSA 1SACA 1YYNA 5FZ1A 4BU2A 5JAXA 3ZIXA 4CDQA 1Q8QA 2GZWA 3RYPA 4EN7B 2VMFA 4ZKTB 4YW4A 4COYA 5D1IA 3WF2A 2X29A 4YZ4A 1KGYA 1PVC1 2C5DA 4NO4A 3WZ1A 3V0BB 1YRZA 3K46A 3ZSKA 2A3XA 5HCHA 5FYYA 4HKWA 1AR81 4XF4A 1R083 3J7MA 1NE6A 4OFGA 1ND3B 1CN1A 4CCLA 4JKMA 3POEA 1DQ0A 1PX3A 1D0HA 2E26A 4GH4C 3HMYA 4CDWC 3VZLA 1D4M1 1C8M3 1WMDA 4MH0E 4AQ2A 2XVLA 4QKNA 1VB4A 4ZHNA 4YSFA 4QQLA 5BNOB 4YW5A 4EE2A 2XHNA 2FHRA 3EXUA 4QPIB 3HEIA 3G6JB 1ZBA2 1OHFA 1DQ1A 1QXRA 2DCTA 2BEOA 2YU1A 2Y8KA 3RYRA 3KCXA 3AL5A 3H8RA 1XNAA 5LRRA 5AFBA 2JDPA 1OQ1A 2RDQA 1M4WA 1W8HA 2DVFA 2W0XA 3UKNA 4CCCA 2WJSA 4XFHA 4EROA 4Q4V3 3UGFA 3R4UA 3O1MA 2E7AA 1XYOA 5L7OC 2VNGA 2VR4A 3FN9A 4PQQA 1ZA7A 3NV4A 3TBDA 4IE6A 4XPVA 4ATEA 1TME3 3SCGA 5LA2A 3BTZA 4W50A 4FBFA 1AR63 3H8UA 1RL3A 4LXLA 5FZ8A 5LBBA 3THTA 1B35A 4AWDA 2RG4A 1Q56A 5KXEA 1OLME 1PO21 4AI1A 3VBUC 1CAVB 2YHJA 1JYWA 3HBKA 5KBFA 1GMMA 1TMF2 1YNAA 2W1QA 1OLMA 3O1TA 5C4WA 2BNMA 3M3IA 1JN2P 4BMEA 2UWCA 4LO5B 2RMU1 1CJDA 3HNBM 4LBNA 1SLTA 5JPNB 5FZDA 5C8CB 1PK6C 2VPVA 3SISA 1VB2A 3T3YA 3DN7A 2VQUA 3JCIA 3AXDA 2E33A 3OYWB 4NRMA 1MS5A 3LSEA 1ENSA 5H9RA 3GZEA 3MIGA 4XE9A 1PIV1 1MS0A 3DKWA 2D7FA 2ZXQA 2VQ0A 4YM2A 3A0NA 1HRI1 3OGVA 4YVSA 5DUVA 2O14A 3FX3A 3L9JT 3ZN6B 1AX1A 5JLVA 5CISA 1C5IA 3SNMA 2DBNA 4AVSA 4LR4A 1TVGA 1GZ9A 5FYHA 3NAPA 5JXHA 3TN91 3K51A 2RHPA 1ZRRA 3LEIA 3JD71 4A3ZA 1S0DA 2WWJA 3P3PA 4HOOA 5DMYA 1MQTB 1ZBE1 4LORA 1W90A 3H42B 3LF7A 3EQEA 4QD2A 1UY3A 1JMUB 1XBFA 2LM3A 5FRAA 2CAVA 1BKZA 1FV2A 1UYYA 2HWC1 5A3WA 5LBFA 3OPZA 4LPLA 1HQLA 2YFUA 2HWB2 2R0FA 3KB5A 4XIOA 4BLIA 1O4YA 4E2SA 4W6XA 5HXVA 3WW2A 2ZEYA 4AEDA 1JZ8A 5GLTA 5CFCA 4L11A 5F3EA 2WZR1 5FY4A 2RM22 3M4FA 4Q4X1 3JBG3 2QQMA 3K2OA 5FTTC 5FZOA 1UWWA 1DDLA 3O0XA 1Q43A 3UNPA 5C70A 2C9KA 1PO12 2VE1A 4PLMA 5FY9A 5CB7A 4M00A 4I02A 4JRAA 2A6ZA 1RUH3 3D4KA 3N7LA 5EJZB 1RMU1 3OBTA 3VZJA 4DUWA 5A7NA 2W92A 4XUQA 3H1YA 3C7FA 4JAAA 1LOAA 3GJAA 1OH4A 2D44A 3J8F2 3ZXJA 1XYPA 4UBGA 1W3VA 1RHI2 3BTAA 5L9BA 4BQYA 5K9YA 2CGOA 3GZUC 1I6XA 2D6KA 3SLIA 4FVVA 4NHMA 4OULA 2D43A 2R071 1RXGA 1BJQA 2WAOA 5BNPB 4NHXA 1HQWA 3LKJA 4BH9A 4U36A 2PHXA 3KWVA 2P37A 4XURA 2DFCA 4RR3C 3WQ1A 1YJKA 4RQPA 1I5ZA 4D3WA 3R4SA 3BTYA 2CWSA 4V2WA 4MLOA 2D6NA 2Q30A 1ASJ3 4EWAA 5CFDB 3FE5A 4OHWA 1JZ6A 2AACA 2DDUA 4BQWA 1RUE2 4BB3A 1W0NA 3H1MA 4NHKA 5L19A 3KF3A 1U0AA 4LBJA 2PAEA 1FNZA 4KWJA 2DVGA 2I07B 5DDJ3 5KC6A 4N8MA 5A6XA 4GQ7A 3I2FA 4H7LA 2JKXA 4BK4A 2R041 3POYA 4EN0A 1GICA 2NPIA 2RS12 3OPTA 4QGLA 2XUEA 1ND3A 4XXAA 2CDOA 4Y1XA 5E88A 1NE4A 2GN3A 2XJVA 4JGZC 4N9IA 5KHGA 4ORFA 3FLRA 3UETA 1YO8A 4LLOA 3WF4A 3VKMA 2W91A 3SITA 2OT7A 3U0ZA 3MV11 3B93A 5I91A 1J3PA 1U5IA 2PHWA 1ULOA 4RSUA 1JOBA 4FFFA 3ITQA 4HZFA 5FZAA 2ATFA 2RDSA 3BOPA 5FOJB 4LT5A 2Q8CA 4IEWA 5DZEA 2OQ6A 2ZGOA 1O4ZA 3KQRA 1IKQA 1QOOA 4FPEA 1CWPA 1R082 2VQAA 1GWLA 2W47A 3FL7A 3RDIA 1Q8VA 5T54A 1H30A 3ZFFC 2NM1A 4OQ8A 4AQ6A 1IQDC 2VMHA 5FYVA 1BXHA 2AEZA 2WBKA 5F6KA 2LUWA 4KL1A 1JU3A 1Y4WA 3SKVA 4AGGA 4CDXB 1YIPA 1FOD2 4NVPA 3GM8A 3TEWA 2VZ3A 1KFUL 4QQ2A 3H3UA 2AEYA 5GZGA 1ODMA 1K5JA 1O8PA 4ATFA 5LW9A 3V56A 1QJY2 2VECA 1CAVA 5FXXA 2VVFA 4GULA 4IETA 4CSWA 4AK3A 4O7XA 4YFZA 3AKQA 1W8WA 3ZR6A 3ZFGB 4WVMA 4IV3C 1MZEA 5IVEA 1L7RA 2JG8B 2O1QA 1MS3A 2XHKA 3VD5A 4B3NA 4ONUA 3Q8AA 4XBLA 4S2FA 4Y4RA 1QH6A 2QTWB 4Y1UA 3WF0A 3WHTA 5C8CA 3IMMA 4AEJA 4QM8A 5CKNA 2B5HA 4CXWA 3O1SA 2UY9A 4QQOA 5JR7B 5ISLA 4K9SA 1UL9A 3HWJA 5FFOC 1DYPA 3W20A 4CU9A 3ZFFB 4PDWA 5A3UA 1AR62 1LOFC 2WN2A 4Z2WA 2HJIA 3T09A 2XJPA 1W8UA 2ETEA 2RS31 4RA0A 2A1XA 3DXUA 4DNYA 5C3SA 3I59A 4OI2A 2G1MA 3ZN6A 2OIIA 3N3HA 1TQ5A 3KSCA 4GMP3 2IXIA 2GAUA 1ZZ8A 4LKDA 4QPYA 3LCPA 1QJX1 2XUMA 3MIFA 2QUOA 5FLHA 4C1WA 4CCJA 1J59A 4NIHA 4A4AA 3SEEA 3W58A 1L3JA 3N4MA 1F31A 1S2EA 2YXSA 2PHLA 5HXMA 2YU2A 5A33A 3ON7A 3WV6A 5J98B 3KHBA 2ZX3A 1F2NA 3KM5A 4HKOA 4P14A 5CVRA 5SV8A 4BDVB 5BNNB 3WDYA 1V6MA 1ZZ9A 5KC5A 4YG3A 3RZLA 5IW0A 1H8TB 3HR9A 1VBC1 2Q8EA 5I8TA 5FZ7A 3TRSB 4WVVA 5FZCA 3DKQA 3I3EA 1BYHA 2LS6A 4LHNA 1V6LA 2TNFA 4MADA 3DYOA 5E8AA 5A6YA 1H4HA 5KXCA 1W0PA 2XKOA 3I2JA 4HONA 4IE5A 1R093 5HCFA 5CIRA 5K0UC 4PLOA 1XC6A 4CP0A 2IVIB 3AYCA 3HBZA 3CZJA 5IK7A 4XXPA 3HQUA 3NVCA 1POQA 3WW4A 3NNFA 3OD0A 5CZKA 4XYXA 2HEYF 3WVJA 3IMNA 3VBSB 1JUIA 1LEDA 4YW1A 4HETA 4Y1YA 4GMP0 4DS0A 2P3YA 3CNAA 4UOJA 5FP7A 4EV0A 3WF1A 3R0RA 5DUXA 3ASIA 3FBMA 2CDPA 4HN1A 4Q4W3 1UMHA 5DG2A 5KR7A 2XVGA 2YPJA 3PIGA 5J36A 4MGQA 1N1TA 4XF1A 4IEPA 1YCIA 4LK6A 5EJ1B 5C9AC 2QQUA 2W46A 4X6RB 2WO7A 1VBA3 1AJOA 1H2KA 3JUUA 2VXRA 1JI6A 1Z7S1 1PVC3 1XU1A 1OUXA 1UXXX 1JZ7A 1PMIA 4N7IA 1RUH2 4P9IA 2GH2A 1C5HA 2UYBA 1Y9QA 5FMOL 3RWNA 1AR83 5CFDA 2DWRA 3HN1A 4QXBA 5JCTA 3BKZA 1KRIA 5GLZA 4FOVA 3V0AB 3BALA 3OTFA 5EHDA 4E27A 2QQJA 3FUQA 2ADEA 4B29A 4BK5A 4BXSV 1DU3D 5L73A 4E4SA 1RTVA 5E89A 4AEKA 2JICA 2YMZA 3AB0A 1NA1B 1UNBA 3BU7A 4FPYA 2WWUA 3VDDC 3ZYJB 3LZZA 1MEC3 2Z42A 2W39A 5E6HA 1E5HA 5D2AA 4AZZA 1RUD3 2Q1FA 1CX1A 1KXGA 1VBE1 4AOCA 3O1RA 2KA3A 5J09A 4KWKA 2WABA 4XAEA 4LKSA 4CUAA 5FWJA 2GH8A 4HVOA 1JYTA 1ASJ2 2EXHA 4D7SA 3VD9A 3IT8A 1DZTA 2XBO1 1KS4A 4GB32 2H0VA 5L9RA 5B4NA 1LGBA 1US3A 1YWKA 3AKRA 2ARAA 5EP9A 3ZYBA 5BUVA 3B9IA 5DDJ2 1V6NA 2D98A 4IEQA 1AR72 2SLIA 3IN9A 1PGW1 1ULFA 3VD4A 2ERFA 3X29B 3OG2A 4UFJA 4SLIA 3P3NA 3AZXA 3T0AA 3QBQA 2G9ZA 4CCOA 1CIWA 4Z8BA 2JIJA 3B9CA 3OJBA 4E4DX 4CDXA 4IEVA 1QQP3 1IPJA 2OA2A 4Q1PA 4YG0A 1O8SA 3VDDB 4P00B 4B8EA 4BA6A 5J37A 2R16A 1KJRA 2WT0A 4XFAA 2Q0AA 5JMCA 3HOBA 2F6BA 4LNVA 5AVPA 2GNTA 2RMU3 5LY2A 1KS5A 1LCLA 4MO3M 3ZFGA 4DEVA 1V0AA 3MIBA 1LEMA 2WO2A 1AX0A 2JG8A 1F15A 2JJ6A 2Y6JA 3JZVA 4MZUA 4XJ9A 3RYKA 4BHPA 2FCVA 1W6QB 2Q8DA 1RUG3 1Q8OA 3A22A 2ORXA 1W9YA 2W95A 4FI9A 4MXVA 2B9VA 3CLPA 3RI8A 1RUI1 2DU0A 4GKYA 4XF9A 3WXPA 4XVHA 5D8AC 1PVXA 4Y20B 1OF4A 4W6WA 1EP0A 2UWBA 1LHVA 1O5UA 2BUKA 4HVQA 3H7JA 3TN93 5T55A 2B9UA 3O14A 5JDBA 2DUQA 1K12A 1Y43B 2TUNA 4D7TA 4EN8B 4Y1VA 1NAEA 3N7JA 2QQWA 4GKXA 3KT4A 1VBD1 2Q1ZB 3VDCA 1F4HA 3USUB 4FAHA 3M3EA 3AP9A 2FCTA 5FYCA 3QD6A 2JDNA 4YW7A 5BNNA 1WLTA 2A7AA 2DUOA 2PTMA 4MGYE 3MICA 1DGLA 2H0BA 2BTVC 3FHAA 2WO3A 1OOPA 3MV01 1CZTA 2J7MA 4CEYC 5A3NA 4L2NA 4OYUA 1EV11 1H8TA 4KBZA 5LZ6A 1GV9A 3AM2A 1KJLA 4CDQC 1CJPA 1O6UA 3AZWA 5FQ0B 2PLV2 3TB0A 2R061 3GGLA 4YARA 2J42A 3TOJA 4LO4B 1N3OA 3S5QA 4XF3A 1GQGA 2X5IC 4SBVA 2VOTA 5F5CA 4JKLA 4CEWB 4DO0A 4GD4A 1A8DA 4P9XA 3ZXDA 1DQ2A 3T2TA 2BV4A 1VRH1 1OFSA 1V9U3 2JE7A 2ZOEB 1NT0A 4LHLA 4F3JA 2L9LA 4AGRA 5FBZA 3GBFA 4RHV1 3ZLIA 3GHMA 1V6IA 2FDHA 2XQXA 3S7EA 4CTEA 2R073 5F37A 1QU0A 5DUUA 4LUMA 4B1LA 3MLJA 4QHBA 3WG1A 3AL6A 2IFWA 4DXTA 3AKSA 3KV9A 1R092 2P34A 1UX7A 4DXRA 1UYXA 3S30A 5A6QA 4NPLA 2A70A 1LGCA 4OCTA 5F5AA 2FDGA 2ZCWA 1VBB1 2YC2A 1WCSA 4XQ4A 3M7AA 3OOXA 1DIWA 1EAH2 3INAA 3T1MA 3WDVA 3IWZA 3D0SA 2Y6GA 3O1PA 3WEZA 1ULCA 2VMCA 2WIIB 1PNFA 2R043 4WVWA 2ZKNA 3V0AA 1IS5A 5FYIA 2IWGB 1V00A 5GZFA 1W28A 4M01A 1UCXA 4RGKA 2WA3A 1B35C 2VZ1A 3UGGA 3AXEA 3I4IA 5F7UA 3M1HA 4PF1A 1A8MA 2VC9A 2Z69A 1NA1A 2B8MA 2D40A 3HAGA 5FYTA 3E6DA 1JOJA 1SBFA 1XNTA 3FUOA 3OY8A 5C4WC 3R05A 1DQ4A 1OT5A 5FDBA 2XL9A 4DMIA 1PVC2 1I5PA 2LRPA 2BVVA 2AREA 3R4DB 2JX9A 1N1YA 4LKFA 2VJXA 4MG2A 1LULA 3PUIA 1AR82 2D3SA 2AH2A 2ZGKA 3JB4C 4XUTA 4NRPA 4DIQA 3I3MA 4YVWA 4Y4YA 2CY6A 3B3QE 4HL0A 1HV1A 3B02A 5LK5A 5T5OA 3T2PA 2C1FA 1MVEA 3OUHA 3QCWA 4MGSA 4DPNA 1D4M2 4YVSC 1QNWA 3N9PA 1A34A 1OA4A 5FY0A 3HNYM 3GALA 3KVAA 2XJRA 2JIGA 3V64A 4P08A 2ZMNA 4COZA 3W59A 3NAPC 1BQPA 1H8VA 5KHKA 4LO8A 2ET7A 1AYM1 2Q1MA 5FK8A 3V65A 3LAGA 2FMDA 4C0BA 4EJRA 3RNSA 1QOTA 4NN0A 1S4CA 4ZU5A 4AVAA 1IGOA 3ATGA 4QKFA 3U07A 1VE0A 2Y34A 1HKDA 1OFNA 2R6QA 4UT5A 2C9AA 5T52A 1SLBA 4CDUA 2W5FA 4LJHA 2VU9A 3CEWA 4KWLA 4URTA 3IBMA 4BCUA 5EIYB 5K8SA 2EXJA 2O8OA 5IATA 1W6QA 1JZ3A 3O1OA 3NJVA 2B46X 4AEDC 3PHMA 3UV9A 1DGRN 4JQRA 1O7FA 3CKHA 1JH5A 4QX2A 1CAUA 2HWB3 2RS33 2ZJCA 3RG0A 4GXLA 3O0WA 2JDHA 2OXBA 3I7DA 1GP4A 4PF5A 4Y20A 3OBZA 2Y26A 4O9EA 5FZ4A 3SKJE 1IS6A 4JVAA 1CR7A 1EUTA 4PHZA 4UFKA 1AJKA 2FDJA 1QJX3 2RM23 4FP2A 4A2UA 1SFNA 3KV6A 3JQXA 3RPQA 2RMU2 5IUQA 1O4TA 1ZZ7A 1IPSA 1WW4A 4O9GA 4OVEA 2YZ4A 2ZGRA 2VZVA 3PVNA 1PZ8A 4ASKA 3D8CA 2X05A 5GM0A 1DG6A 1PIV2 3J8F3 3W9AA 4CRQA 5AC91 1YQCA 1HRI2 4HSJA 3THPA 2JDZA 1RHI3 4XCBA 3PDQA 4AEDB 1YI7A 5F5IA 3VKLA 1AL21 5T3NA 5CFCB 1QXPA 5FKBA 2QE3A 3MHZA 5LBCA 1S0GA 4JZRA 2ZX0A 3PVEA 2R49A 5KWRA 5FZOB 2B4KA 2Y0OA 5GJ6A 3E97A 3TN92 4BQ4A 3QH6A 3JD72 4HANA 3IIIA 1AYN1 2WFF1 3MW3A 1ZBE2 2WNVA 3TEYA 1XOYA 1CVNA 2KM2A 4D6QA 4CEWA 5BPXA 4LULA 4DY3A 2A6YA 3AJYA 2HWC2 4MXWB 5H9SA 3HT2A 1ND3C 2VZPA 1W04A 3OPWA 1X36A 2BYVE 1LOGA 4JC1A 5FLIA 2BBAA 1K5MA 2IVJA 3J7HA 1NCRB 5FV3A 1X8EA 2JG9A 3LSDA 3RJ2X 5I0SA 1AF9A 2PHUA 1PX4A 1LHNA 5BNOC 5F3CA 4Q4X2 2VQTA 4XJWA 1VMFA 1FPN1 1JTZX 2I2SA 4S2DA 2WT2A 4QPIC 3CZUA 4XC9A 4YGDA 3A4UA 3NMBA 1W2AX 4GWIA 1GBGA 3EB7A 3K3NA 4IE7A 4RQPB 3VV1A 5LEJA 2WWSA 1RMU2 1URXA 4L0PA 1UY0A 3B00A 1ENQA 3ZSLA 4LA2A 1PGSA 3RMXA 2WQ8A 1UIJA 4S2HA 3G7DA 5A7WB 5J96B 5JIAA 4COWA 1LU1A 1V9U2 2WQZC 5KHHA 5C3QA 5FPUA 2RS51 1OH3A 3ORJA 3RQ0A 4XBQA 1CZVA 2CL2A 3DXTA 2R7EB 5EJ3A 1UOJA 2WNUB 2HWD1 3NO8A 2R072 2W08A 5E1RA 5FZ9A 3THDA 3BPSA 2PMWB 4XFBA 1APNA 1ZZ6A 1C28A 1N47A 1X8MA 2VW2A 4K1YA 3TYJA 1JBCA 1UY2A 4GWJA 4AEMA 3R6SA 2XL7A 1FOD3 4WM8B 5J48A 2VZQA 4PBOA 5A6ZA 4NIIA 4D7YA 3GYDA 2N7GA 5JOXA 1UQXA 1OPOA 2YC0A 4I2OA 4AYUA 1QJY3 1FI2A 5I0DA 3B01A 3VHRA 2VCCA 2A6WA 1W99A 4O65A 4XEZA 5CYYA 4DZGA 5C8CC 3FHQA 5GKAC 4LIUA 1YQ8A 2R042 2G19A 2IFRA 3TNQA 2WNEA 2ZX4A 4Z82A 1RUJ1 3L2YA 4PDWC 2BOIA 2GNDA 4Y1ZA 4QQPA 1FMD1 5KXBA 1JYXA 4OI0A 5CKQA 1RGSA 1U12A 2CSGA 5FPBA 1X7NA 2GNMA 1DLLA 3KS7A 2Y6KA 1N1VA 2RDNA 3KQ4B 1AXZA 3J26N 4N90A 2NP0A 5FUNA 2RJ2A 5GLVA 3SCFA 3OGRA 3T2QA 3LA2A 4UXAA 1F5FA 3UK9A 5F3IA 3MLKA 4IDZA 3AP5A 5J3UA 2BDRA 1GWKA 3VLBB 3LIHA 1FX5A 2ZAAA 4WVMB 4LO7A 4XIKA 2HEWF 4HSLA 5JXGA 3ZKYA 1POV1 2ET1A 1MQTC 1W8ZA 2PQSA 2BFUS 5A3MA 3RRDA 4MGKE 4KQ7A 4XACA 1JHNA 1L7QA 5EZWA 4DRRA 1H1MA 1JXNA 3PIJA 2XWBB 4QU1A 1RUI3 1HV0A 1KDKA 1WCKA 2WDBA 2MEV1 4PDWB 4W6YA 1RB8G 4JTNA 3BB6A 3BUCA 2GC0A 2RVAA 3FLPA 5H9QA 2WT1A 3HVDA 3IZOA 4QX7A 2J1TA 3U75A 3I59B 3ZN5A 4UF0B 5JOZA 3I2KA 1KFXL 4DOUA 3FZ3A 5FYBA 1NLQA 5I0RA 1PGL1 5LATA 3POWA 4QB1A 4BPZA 3IAQA 1SEFA 4HXCA 1P8JA 3ZXEA 4NAMA 1ZRFA 3T1LA 4C90A 5A33B 4EWDA 1Y3TA 4TTGA 1COV1 4LBLA 5F5QA 1RINA 2VZOA 1S2KA 3U37A 3IPVB 3PL0A 4HG6B 3C8XA 1LNSA 5DAWA 1Q8PA 5ERLA 4FPCA 2UURA 5ABJB 1W8OA 2RS32 2VOVA 1LHOA 4AVTA 4BXFA 3EO6A 4AVBA 5BNPC 4IEZA 2BNOA 5C5UA 2R063 5A7QA 2QNKA 1G6NA 5FY5A 1NQDA 1QJX2 2P6CA 3M3QA 4JHTA 1GQHA 1LECA 1R1A1 3DCQA 3W21A 5CFDC 3DV8A 1WUVA 2DFBA 4XDOA 3ZYGA 4EN6B 1XB9A 2E32A 4FT8A 1GNZA 2VAUA 1VRH3 2P4EA 4AI3A 4RHV3 3VZOA 1XNBA 2D93A 1TNFA 4MXWA 4QQHA 1RUC1 1QF3A 4W4ZA 5HV0A 2BRTA 3FC0A 5FY1A 4G3YC 5FP3A 1XPWA 5APAA 5G04L 4NJ4A 3AK0A 3AC0A 4OZOA 3WW1A 3BI3A 1NCRA 1DQ5A 1X50A 1GYKA 1XYNA 3DEMA 4LBQA 4XMAA 1HRV1 2JDUA 2W1WA 1BMV1 1XNCA 1H2MA 1F8VA 1QJFA 1OMIA 4QMAA 4XDQA 3O1VA 4ITCA 1J84A 1VBB3 1WGPA 2VUCA 5GALA 1QIQA 4PI2A 1JUHA 2XJQA 1Q8SA 3WHUA 3KCYA 4XJZA 2UYAA 4I0WB 4GB33 4NUBA 5FMBA 4NIAA 5A7WA 1S1AA 1RUOA 1MS9A 4XCAA 4COUA 2RDRA 1NLRA 1WW7A 2WLQA 3CQOA 4X8NA 4QPGB 1AR73 5EXOA 5F6LB 1SCRA 4RS5B 3NL1A 1WMFA 5T50A 4EN9B 4CDXC 2WNUA 1F5JA 3VBOB 3ZFEA 1XE7A 2K9ZA 4GWNA 1CAXA 3N7KA 4AFCA 1JYCA 1UU6A 2B7YA 2PHTA 4GIQA 4WM8A 1OXCA 3AKTA 1GOHA 1NLSA 2PQQA 4Q26A 1UOGA 3ZFGC 2EXIA 3AJZA 4XFCA 4QKBA 2JG8C 3M3CA 2VNVA 2AC1A 3E5QA 2EAAA 1YC61 1OKOA 4OHZA 2XKPA 3U1XA 5DXDA 4CPBA 5I93A 2XWJB 3N9OA 2V5DA 3CJIB 3LFIA 3WDXA 5CEHA 3ZMNA 2FD8A 2PXJA 1W9SA 2DCZA 4M0NA 4OZXA 1WLCA 5BNQA 5DAPA 2BP6A 4A45A 5FO8B 5JZGB 1J58A 2GMEA 1LR5A 4R8HA 1LGNA 1VBE2 3TNPB 1JHJA 5FO9B 4TN7A 1UO9A 1AYM3 3KVBA 1CIYA 2FZ1A 3WQ0A 1LHUA 1N3PA 3K4AA 5H9PA 5IVBA 4PLNA 4N9HA 3ROUA 2XBO2 3ZYFA 3O12A 5FZHA 1AXYA 3VZKA 2B42B 4I0AA 2E7QA 3D5OA 3GCWA 4GA9A 3AMMA 4PQ9A 1GLHA 2RR11 3LB9A 4Q0UA 5E16A 2GDFA 1CD3G 1YHFA 3WNLA 3ZDSA 4BLJA 5BNNC 3KGLA 3NKGA 3ZX7A 4ARXA 2WZ8A 3NWKA 1OOPC 1Q5OA 4DY5A 1H8TC 3ETQA 2K2SA 1L7LA 4CUGA 4XF0A 2A73B 5DUWA 5ANNA 2YBPA 4GH4A 3ZXAC 2X09A 2V72A 4IL7A 5FPXA 5IVCA 5IVFA 1UZWA 4Y22B 5J7MA 3E5UA 3O5SA 4XUNA 2BERA 5CBLA 3QOPA 4MOAA 2E53A 1G8WA 1XJAA 2DVBA 1LTEA 2PLV3 3WT3A 4UF0A 4E4ZA 2JDAA 1UMIA 2RV9A 1HDKA 3AMNA 4JGYB 4YM1A 4Q8KA 5JSRA 4CXYA 2FZ2A 4XFFA 3VBSC 3ACFA 3BGAA 4CXXA 3WDWA 1YIFA 2I74A 1SDDB 4P9YA 2J22A 2PELA 2NLRA 4XDPA 1RUI2 2V4AA 4Q4Y1 1JODA 2A6XA 3PUSA 2G9GA 2KD7A 2HYXA 3F95A 3IPVA 2E6VA 3VBHA 1OOPB 4BQ3A 1O3TA 2HWF1 5F2SA 2XR4A 3IDEA 2OPKA 1V6JA 5ABJA 3RFRA 4ARYA 1KDMA 2CGNA 3VN4A 4QB6A 2ZX1A 1G7YA 2WZEA 2VNRA 4FPLA 3WG3A 5A3LA 3ZSEA 2ARCA 5LASA 1W6PB 3OBAA 3I54A 4V2VA 1H2NA 3VD7A 2R30A 1AYN3 2XVKA 2W9XA 3AX4A 4OLLA 5IJRA 3ZYRA 2XJUA 4UW3A 1H1AA 3FHIB 2UY8A 3LOBA 1DHKB 1LODA 1S0CA 2B45X 2Q4SA 1MS4A 3J4UH 4LKEA 4D8MA 1GR3A 5F39A 3N9LA 4DQAA 2XONA 2PHDA 1ULPA 1EAH3 3TEXA 4AAPA 3ZVXA 1TE1B 1GZWA 3ALQA 1ZRDA 1JZ4A 2GMPA 4MGZE 5HPOA 3ETPA 4META 1EV12 4K8RB 4DXSA 4R9DA 2WA4A 1NA1C 4AHWA 3MZHA 1FPN3 3ZXFA 1I1EA 2P5BA 2DURA 1ALYA 2W87A 2WS91 2XDVA 3I2DA 4P5HA 5FY7A 2R062 2FDKA 1W2TA 1G86A 2WO1A 3ZKUA 1MZFA 2OVUA 1Y9GA 3VBRB 5C6CA 1OA3A 1NKGA 4U2AA 3ZM8A 1G9FA 1JZ5A 4OUSA 1WWYA 3WX5A 1D0GA 1BEV1 3AP6A 4FPGA 4M4RA 3PJQA 4QGNA 1VRH2 1YXWA 4LBQD 4LA3A 4XUPA 2NMOA 1BBT1 3MUZ1 2RS53 2FQPA 3RI9A 4RHV2 4KMQA 3UKTA 2ZGMA 3USSA 4IEOA 4ET7A 4CU6A 2GC3A 3LDBA 2VY0A 1H6YA 5A3TA 5BV6A 4QPGA 1N1SA 5EYXA 1QHDA 1W03A 1D4M3 5C71A 4RS5A 3P6BA 3FLTA 4A42A 1IZ3A 2UU8A 3POGA 4FQZA 3VBOA 1DYKA 3UESA 3OY8B 3PUHA 3KT1A 4LTAA 4QWNA 1HB1A 1S0IA 4UAPA 1CAWA 1VBB2 4I3GA 4HK8A 1PMJX 1QY4A 4E8DA 2XXZA 1QH7A 3VGIA 1Y9MA 4CDUC 4N53B 3BPZA 3C7EA 4PIZA 3NQHA 4HK9A 1UU4A 2ZBJA 3AP7A 2XLAA 3NKTA 3OGSA 1RXFA 4YVWB 3VL9A 1EYBA 4MSVA 4C0HA 4NHLA 2BVBA 1ACCA 3NNGA 3U4SA 4AHXA 1GP6A 1C57A 3CJIA 4LUKA 2EICA 2O8QA 4FPHA 2P17A 1YQ5A 2QQVA 2ZZQA 1H2LA 2JDYA 2WFPA 1C8M1 4CPBD 5JZGA 5HI0A 1U5YA 4KH9A 1PO23 3LIGA 2QDRA 4IQPA 3ILFA 2BQPA 1GANA 4KU7A 3W5NA 3CDZB 5A1LA 3BYWA 2C24A 4GAZA 1UX6A 2XOMA 3DL3A 5GZEA 1HB3A 4MYEA 1HQNA 2ZGPA 3B94A 4I0BA 1O59A 3NV1A 5JI7A 1GU3A 2WAAA 4CDUB 3EMRA 1UPSA 4NMIA 2EVXA 4Q4V1 3WP3A 3I49A 2ZKLA 1IS4A 2Y6FA 4DRVA 2ZGNA 2MEV3 2PA7A 4B4RA 2GU9A 4QAWA 4AL9A 1PIV3 1TME1 3I2OA 1C3HA 1V6OA 1CAUB 1HRI3 3DPRB 1UYPA 4G9SB 2E63A 3NNJA 2QQKA 4UFMA 5GZDA 2VBPA 2IXLA 1AYM2 3K4DA 4Y22A 5F3GA 2RJLA 1SZBA 3HNMA 4KNCA 2EALA 4L99A 1XRUA 4E2QA 1NG0A 5LA9A 2FMYA 4A7KA 2WNVC 2JE9A 5FZEA 3RVHA 1UF2C 4M3CF 4CEWC 5JOWA 3JD73 3JQWA 4HPKA 4FAGA 3K4ZA 1ODNA 4JGYA 4FPKA 5IK4A 5HCAA 1COV3 1ZBE3 5JMOA 3RGBA 2LW8A 3SEPA 2ZTNA 5CKMA 4EYUA 2QFEA 1K5MC 3HPNA 2HWC3 2VD7A 3DGTA 1POV0 2H6BA 1OA2A 4K21A 1LJ7A 2BZDA 4J6GA 4MV2A 1UZZA 2PN5A 2GMMA 2IC1A 4H14A 2K0GA 5C3RA 4JDMA 2YGLA 4XILA 1NY71 1X9PA 2WZR3 1A3KA 1XE8A 4Q4X3 4JTOA 1R1A3 3CIHA
chains in the Genus database with same CATH topology
1REEA 1W6MA 4R9CA 4J1XA 5TSWA 2DTYA 1W6PA 1ZM1A 1RMU3 4WM7A 4LE4A 3C3VA 2WNVB 1DZRA 4FO9A 5T5PA 2ZS6B 1C4RA 2D6PA 3IM0A 5FO7B 1EPWA 1ZYBA 3POSA 5FREA 1ENXA 3VZMA 1NZCA 1LOBA 2A6VA 1U5XA 4IEXA 1OQEA 5AC92 1QWRA 4ASLA 2Q8OA 1VAKA 4AF9A 1K5MB 2JG9B 1AL22 1B09A 1BK1A 4AQTA 5JOYA 4NPRA 3ZXKA 4YNIA 2CV6A 4HLTA 2YV8A 2Q5TA 2YUEA 3JBG1 2YROA 1AYN2 2WFF2 3VBRA 3AYDA 4BYYA 1CGPA 1DBNA 1S0BA 3CJXA 4Q2FA 1G9CA 1D2SA 3QACA 4K20A 4F7ZA 4Z92B 1ZRCA 2PHRA 2AYHA 3PTYA 2XPJA 1Z0HA 2QZ2A 1NQJA 1FPN2 1HW5A 3NSTA 4I01A 4AGVA 1V6KA 2AR6A 3SHRA 2QJVA 4JRLA 4LHKA 1VLNA 4HN0A 5ACA1 5JSOA 3VBFB 1CPMA 2ZHNA 5EV7A 4JDOA 4FXGB 1RC6A 1ULDA 1BVP1 3IDCB 2DYCA 3MF9A 4FXKB 4OHXA 3NV3A 2JECA 4LBMA 1IS3A 1ZREA 3B5LB 3KMHA 3EJKA 3ZXGA 2RS52 4N53A 5EFUA 3GZTB 1NCQB 4GALA 3WR0A 3DF0A 2YYOA 1DFQA 3J9SA 4Y24A 4L97A 3ES1A 3MYXA 2H6CA 2A75A 2FBEA 3ILNA 1UAIA 2ILMA 2OYZA 1HIXA 3TAYA 4NR1A 3ZSMA 2RR13 2OUJA 4XJ8A 1AL0G 1CX4A 1RUJ2 2A3YA 2CTVA 3U10A 1SBEA 2EF6A 2NN8A 3MIDA 4FOQA 3KCCA 1ONAA 1H0BA 2CAUA 2D6OX 4FTEA 5CFCC 2AZ5A 4YW3A 1X82A 1PO22 1ENRA 3DPRA 3WLUA 4MUVA 4I3PA 3PNAA 2WC2A 1D4VB 4WZCA 1GSLA 1KITA 4GWMA 2HYKA 4AQSA 2D6MA 2GC2A 5T5JA 4I30A 3BOWA 4RL7A 3A0KA 1UKGA 1WCDJ 4Q4Y3 3E5XA 2MEV2 4KBBA 4N43B 1W0OA 1RIRA 1NCRC 2HWF3 4WV8A 1VBC3 3M3OA 1T6GC 3AKPA 3N35A 4XHXA 1BVVA 4R52A 2AGSA 1YJLA 2VGDA 1E57A 4RQPC 3FBYA 1PGL2 5C8WA 2ZGSA 4E2GA 1VR3A 5IK8A 3ZYIB 1YFYA 2XLGA 4YM0A 1FAYA 1V70A 1COV2 4QX5A 4TZDA 5IT6A 1M06G 3HIFA 2E51A 2D6LX 5GZCA 1MACA 2WNUC 5DG1A 3ZFEC 4AI2A 2ZACA 3M70A 2WS93 3AZVA 4WM8C 4LBQB 2WZR2 1F9KA 4OHVA 4DFSA 2G4IA 5DZFA 1R1A2 2ZA9A 1YFXA 1Z7S3 1OPMA 1BEV3 2E7TA 3FJSA 4BZ4A 3C2UA 3ZXLA 2A71A 1RUF1 3S6PA 1BBT3 1WD4A 4AE2A 2F4PA 1HXS1 5KHIA 4KG0A 2G9FA 2DF7A 5I0TA 3ZO0B 4LBOA 1OI6A 4Q4W1 1O91A 3ZFEB 1HRV2 4MVTA 1CAXB 4ISRA 2KXLA 4FPFA 5JSPA 2ZABA 3BIWE 1VBE3 4W65A 1VBA1 1RVF1 1EY2A 3WOGA 3VBFA 2D3RA 2DV9A 4ISQA 3UKVA 4Q27A 3ELNA 2OZJA 2XBO3 2X5IA 4K7JA 1C8NA 1SLAA 5AFEA 3VL8A 4AI8A 2IXJA 1J3RA 1NCQA 1OD5A 4AHYA 1FATA 1REDA 4KGGA 4UW6A 3WW3A 1VAMA 2HKXA 4FSJA 4HKLA 1GKBA 2GSYA 3KT7A 3M8LA 3MEPA 3KD4A 1MEC1 1ND2B 3FFZA 1RUD1 1Y7BA 3QH7A 4Q29A 2LALA 2Z2SB 1X33A 4AVVA 3UL2A 4LLFA 5AVAA 3HQXA 3SH4A 3S0MA 3PLQA 4CZSA 4K3UA 3ZMOA 1QNYA 4B4QA 2PHFA 3H7YA 3VBHC 4IV1A 5SV5A 4YLZA 2HWE1 1N3QA 1H4GA 5ABJC 1PHMA 3PMEA 2PAMA 1J1LA 4GH4B 2EIGA 5IK5A 1AUYA 4P9WA 4CDWB 1DZQA 4YM3A 1RJ8A 1UW8A 1W39A 3ZN4A 1ULGA 4XW3A 2P3IA 4YRDA 4OUMA 5F9TA 1QQP1 2MNGA 3FFQA 2R1DA 4BE3A 4QT6A 1FXZA 2RR12 5B2GB 5LK7B 1SLIA 2BPA2 1VBD3 3FWEA 4N7UA 3UJOA 1ZZCA 3SCHA 5HBAA 4WBBA 5L7OB 3TWIA 5EYYA 1RUG1 1YFWA 4R4ZA 4AFBA 5JPMB 1NXD1 4LE3A 5GLWA 4NWWA 3VBHB 3ME2A 1YUDA 4N43A 1WA4A 2AUYA 2ZGUA 4AVCA 3RZZA 1EV13 2DTWA 3GBGA 5JI9A 5HCBA 3AFKA 2QZ3A 4P9JA 2ZMLA 3VBUB 1W6NB 4LO6B 2GALA 1S0FA 3LOIA 2NMNA 1I3HA 1QJU1 3ACLA 1ZZBA 2ZHKA 4QGMA 4DB5A 1RITA 4Q4Y2 1PK6B 1GZWB 4QPGC 4RS5C 4YFWA 1AR91 2HWF2 1VBC2 3RSJA 5FCCA 1U5ZA 2WQ4A 3VBOC 4AG4A 5FMOS 4UBHA 1OQDA 2BWAA 1OSGA 3H50A 4OHYA 3ZSJA 1UU5A 2CWMA 1VJ2A 1JW6A 2QKDA 1O5LA 4P9LA 4JV4A 4AI0A 4UW4A 2I45A 1DQ6A 2VNOA 3CJIC 1ZA4A 3RMYA 1V9U1 3D0JA 2RJKA 3WQ7A 4XMIA 2WS92 1XXNA 1CESA 5JZGC 4XETA 3NW4A 2W68A 3MFAA 4FOYA 4LEJA 5ACA3 1UIKA 1Z7S2 1CAWB 2ZX2A 1BEV2 4YZ3A 1W6OB 4K8FA 1ZBA1 4BMBA 1BBT2 4FPJA 3OCPA 3VUOA 4XTMA 3V0BA 4DINB 4HT1T 1QKQA 3IDBB 1O3QA 2JKBA 3GHNA 4K6BA 5LEKA 2IZWA 1OKQA 1DGWA 1ZNPA 2BGCA 3QLQA 4XHBA 4M3CB 5CG8A 4X8PA 4ES9A 2YGMA 4YZ1A 5BNOA 2MPFA 4V1PA 4QPIA 1ND2A 2V5YA 2O0OA 4AFMA 4RR3B 3RJRA 2VG9A 3MGUA 1LESA 4JGYC 1TMF1 1LOEA 4PIXA 3VKOA 4BOWA 1ZVFA 1DGRA 1R1ZA 2AENA 3LWCA 4NOTA 1C1FA 1OLRA 1I9RA 2HEVF 1PGW2 5JWPA 2SBAA 1RJ7A 2QQPA 2MHFA 4D69A 1AZDA 4OI1A 3VKNA 4C91A 3B7MA 1C8M2 4QXKA 5FOBB 4FTBA 2IXCA 4Y5Z0 2YDEA 1J1TA 1BCXA 4BQ1A 3MPPG 3MIHA 4JGZB 3D82A 4INDA 1YI9A 1MVQA 4CDWA 4OI4A 3WP6A 3OBRA 5CNAA 4Q0PA 1EPZA 1OLQA 1HX6A 4COVA 2TBVA 4WM7C 3H9AA 3D6EA 4KU8A 4HPKB 3CO2A 1MS1A 2DVDA 4Q4V2 4AW7A 4H7MA 1SBDA 2C0ZA 1FYUA 4S2GA 4IESA 1TME2 2WSUA 4J1WA 5AC93 5L7OA 2WINB 4RGAA 1VALA 2E9QA 4YW2A 3OYWA 4TWTA 2A5ZA 5BXXA 2WZPP 3VHNA 1AL23 2HWB1 1QOSA 2BFUL 2LTNA 3VBRC 1VAVA 1W6MB 3MIEA 4BIOA 3FMGA 1GFF2 2RM21 3VBUA 1W6NA 4XQWA 4WM7B 2WFF3 1O3SA 1PO11 1VBD2 4IV3B 4G4FA 1QJZA 3ST7A 3WG4A 4QU2A 1MQTA 4QM9A 4MGIE 3MF6A 4E9KA 1PK6A 4Z1VA 3J8F1 2ZAHA 4R9BA 1NY72 1RHI1 2DU1A 3WUDA 4C1XA 5FAXA 2OW4A 1XQNA 2V09A 3UJQA 2ZGTA 1GNHA 4RD7A 4Y26A 3GZAA 3MW4A 3OGGA 1RUF3 3CL1A 4N53C 1HXS3 2VUJA 2WL1A 2D5FA 4YVWC 4AXOA 2XJSA 1TEIA 1H1IA 1RUE1 3MW2A 1KQRA 1QDCA 4XOGA 3EBRA 4ZU4A 1LOCA 2VH9A 2XH6A 2HWD3 3WG2A 1H9PA 1IOAA 4PJYA 2VOWA 3U11A 2NZ9A 2RS11 3BCWA 1CPNA 4XTPA 2EAKA 3URFA 3JBG2 2ZMKA 1RVF3 5BNPA 3O0VA 4PBPA 4ZU7A 2Z5WA 3Q9OA 5K0UB 1O3RA 2A3WA 3LGRA 4F8AA 4B4PA 1W6OA 2B39A 3ECQA 2JENA 4WZFA 4YZ2A 4FQ4A 5A32B 1XNDA 1AVBA 1Q3EA 3B69A 1SLLA 1RUJ3 2Y38A 1R081 1FMD3 4M3CE 2GC1A 1ZX5A 4PCRA 5DZGA 5CG9A 4AFAA 1WBLA 3AMPA 4CP2A 4D94A 3DPRC 4M3CA 3VKFC 3OF1A 1S0JA 5ACA2 2PFWA 3VHOA 4A7ZA 4L92A 1FOD1 5C9AB 3BODA 5GLUA 3MDPA 1JYIA 2XLFA 1QJY1 2XG3A 4RR3A 1SDWA 2ZGLA 1POV3 4LBKA 4XBNA 3WCRA 2ENRA 4KGQA 2IXKA 3AYEA 5JVVA 2HWE3 4X6QB 4BWOA 4XJUA 2GN7A 4CYDA 1NXMA 2EA7A 1C1LA 3JB8A 3KLSA 1AR61 2RE9A 3H0OA 4I09A 4M0HA 5FLJA 2ZHMA 4JGZA 3WD5A 3K48A 4YGCA 3ENRA 4JDNA 1NYWA 2XB6C 2BBVA 4IERA 4PIYA 4L9BA 4AHZA 4XJAA 3NJZA 1PZ9A 2EXKA 4Q8LA 1J3QA 2JG9C 3ZIWA 3ZFFA 2VMGA 2ZHLA 4YGEA 5I0UA 4XFIA 2CYFA 1QXJA 1CONA 5LRSA 4HBNA 2IXHA 3AP4A 5JIUA 1G9AA 4Q1RA 4CP1A 1UPIA 3LA3A 1QJU3 4NWVA 2DVAA 1MZ6A 2XGXA 3M2MA 3AMQA 1HLCA 4B7KA 1AXKA 1WD3A 4IV3A 4FCAA 2R1BA 5C33A 1CQ9A 2D3PA 1RUC3 1AR93 4DXZA 2X8KA 4RGGA 1PZ7A 4UW5A 1BZWA 5CA6A 1FV3A 2XJTA 4IXLA 3VHPA 4KG8A 3ILRA 5D8AB 1HRV3 3KGZA 5CADA 3HD8B 3WNXA 1LOFA 3VBFC 2TEPA 3WP5A 1A78A 1NOVA 1KD7A 3H1WA 1TNRA 3SMHA 5I8YA 3WDUA 1IKPA 4ZXKA 3CF6E 3WP4A 1FT9A 1VIWB 2X53S 1XNKA 1Z78A 5T5LA 1RUH1 1NCQC 1W2UA 3MI8A 4H55A 1S0EA 1AX2A 4Q0SA 2JD4A 3H3ZA 3HT1A 1YLLA 3VBSA 2ZPXA 3PJYA 2OUHA 3KZ4C 4HMZA 3O7OA 3OGJA 2Z79A 4CEYB 1UZYA 2ARBA 4XQDA 2W52A 1G9DA 4ASMB 4CDQB 2GNBA 1WMEA 2WLPA 4AFDA 2NYYA 2D5HA 2VOXA 1H9WA 1ZBA3 2D97A 1FNYA 1PM7A 1RUF2 5EWSA 5K0UA 1HXS2 2X5IB 3JU9A 1A6CA 1ASJ1 4IV1C 3MPBA 2P3JA 4GB31 5A32A 2P3KA 1VP6A 3I8TA 4Q4W2 5DDJ1 2HWD2 1REFA 1AR71 4YG6A 3WUCA 2YY1A 3RS6A 4EWEA 5F1RA 1VBA2 1RVF2 4FP3A 1UD1A 1DGWX 2QVSB 1XU2A 5C9AA 1IHMA 1TMF3 1WW5A 1LENA 2VUAA 4Z07A 4F83A 4WVZA 1SQ4A 4BM8A 2DCKA 4IV1B 4P9GA 1DF0A 4N43C 1FMD2 3PVBB 3CU7A 2VULA 5CU1A 1MS8A 2VW0A 3N36A 2PYTA 2BW8A 3MFCA 1B35B 1GZCA 4R9AA 4MX3A 1MEC2 1S55A 1LHWA 1RUD2 1IQAA 2ZGQA 3WCSA 2VW1A 2DUPA 2WKKA 2ARXA 3WDTA 1LU2A 3VDDA 1MZ5A 2VOKA 5C4WB 4FPOB 2PAKA 3DUIA 4YYOA 4FTSA 3N7MA 4K40A 2BNNA 2UWAA 4B7EA 3AYAA 3EHKA 4FOWA 4R4XA 3ZPYA 3L2HA 3PVOA 2HWE2 2JXAA 2OZ6A 2Y0IA 4L8QA 4TSVA 4RFT0 3E6CC 4H3WA 3IKWA 1YFUA 4A7YA 1SMVA 3ZYPA 4JCKA 4YVSB 3NV2A 2VVEA 5KHJA 1PNGA 1QQP2 1RUNA 3SH5A 2JEMA 1SLCA 1S2BA 1WLDA 3APBA 4Q0VA 5I8SA 3GNEA 5FPZA 1UN1A 2PLV1 2V73A 3AFGA 3NAPB 5CAZA 4K1ZA 3WY6A 4A3XA 1PO13 2WSVA 4GMP1 1D2QA 4YGBA 3VZNA 5L36A 1QGLA 4BIFA 4HVRA 1RUG2 2CNAA 2R0HA 2CGPA 3USUA 3IIAA 3S7IA 3AZYA 2DCJA 3ES4A 1WLWA 1MR5A 2R32A 3WINE 5KXDA 1WBFA 2NQYA 3AMHA 5BYNA 1LB2A 1LRHA 2P2KA 1WW6A 4XFGA 2QCSB 3SH3A 5FQ0A 5K7PA 5D8AA 3AZZA 3SXWA 5BY5A 1QJU2 1R091 2ZZJA 4IEUA 4IEYA 1G9BA 1SFYA 3GF6A 4ES8A 2ES3A 3OD4A 1RUE3 1SCSA 2VMIA 2VVDA 1UMZA 3LA7A 4XZPA 1ULEA 3E6BA 1EAH1 3MLLA 1RUC2 1AR92 1LKNA 4HFSA 2RS13 4YZ5A 4Q0QA 1AHSA 1QMJA 4TLFA 1IPKA 3U4XA 2DCYA 3GBWA 4CEYA 1BMV2 1QDOA 1ND2C 2BWCA 2QDNA 1UKRA 3PMSA 4TYSA 5JAXA 1SACA 1YYNA 3ZIXA 4CDQA 1Q8QA 2GZWA 3RYPA 4EN7B 4ZKTB 4YW4A 4COYA 5D1IA 2X29A 4YZ4A 1PVC1 2C5DA 4NO4A 3WZ1A 3V0BB 1YRZA 3ZSKA 2A3XA 4HKWA 1AR81 4XF4A 1R083 1NE6A 4OFGA 1ND3B 1CN1A 1DQ0A 1D0HA 4GH4C 3HMYA 4CDWC 3VZLA 1D4M1 1C8M3 1WMDA 4MH0E 4AQ2A 2XVLA 1VB4A 4YSFA 4QQLA 5BNOB 4YW5A 2FHRA 3EXUA 4QPIB 3G6JB 1ZBA2 1OHFA 1DQ1A 1QXRA 2DCTA 2BEOA 3RYRA 3KCXA 5LRRA 5AFBA 1OQ1A 1M4WA 2DVFA 2W0XA 3UKNA 2WJSA 4XFHA 4EROA 4Q4V3 3R4UA 2E7AA 1XYOA 5L7OC 2VNGA 3NV4A 3TBDA 4XPVA 4ATEA 1TME3 3SCGA 4FBFA 1AR63 3H8UA 1RL3A 3THTA 1B35A 4AWDA 1Q56A 5KXEA 1PO21 4AI1A 3VBUC 1CAVB 2YHJA 5KBFA 1TMF2 1YNAA 5C4WA 2BNMA 3M3IA 1JN2P 4BMEA 2UWCA 4LO5B 2RMU1 1CJDA 4LBNA 1SLTA 5JPNB 5C8CB 1PK6C 2VPVA 3SISA 1VB2A 3DN7A 3JCIA 3AXDA 3OYWB 1MS5A 3LSEA 1ENSA 5H9RA 3MIGA 4XE9A 1PIV1 1MS0A 3DKWA 2D7FA 2VQ0A 4YM2A 3A0NA 1HRI1 4YVSA 5DUVA 3FX3A 3L9JT 3ZN6B 1AX1A 5JLVA 1C5IA 3SNMA 4AVSA 4LR4A 1GZ9A 3NAPA 3TN91 3K51A 2RHPA 1ZRRA 3JD71 1S0DA 3P3PA 1MQTB 1ZBE1 3EQEA 4QD2A 5FRAA 2LM3A 2CAVA 1BKZA 1FV2A 2HWC1 3OPZA 1HQLA 2HWB2 2R0FA 3KB5A 4XIOA 4BLIA 1O4YA 4E2SA 4W6XA 5HXVA 3WW2A 4AEDA 5GLTA 5CFCA 4L11A 2WZR1 2RM22 3M4FA 4Q4X1 3JBG3 5FTTC 1DDLA 3O0XA 1Q43A 1PO12 4PLMA 5CB7A 4M00A 4I02A 4JRAA 2A6ZA 1RUH3 3D4KA 3N7LA 3VZJA 1RMU1 3OBTA 3H1YA 4JAAA 1LOAA 2D44A 3J8F2 3ZXJA 1XYPA 4UBGA 1RHI2 3BTAA 5K9YA 2CGOA 3GZUC 1I6XA 2D6KA 3SLIA 4FVVA 4NHMA 4OULA 2D43A 2R071 1BJQA 5BNPB 1HQWA 3LKJA 4BH9A 4U36A 2PHXA 2P37A 2DFCA 4RR3C 3WQ1A 1YJKA 4RQPA 1I5ZA 4D3WA 3R4SA 2CWSA 4MLOA 2D6NA 2Q30A 1ASJ3 4EWAA 5CFDB 3FE5A 4OHWA 1RUE2 3H1MA 4NHKA 5L19A 1U0AA 4LBJA 2PAEA 1FNZA 4KWJA 2DVGA 2I07B 5DDJ3 5KC6A 4GQ7A 4H7LA 2R041 3POYA 4EN0A 2RS12 1GICA 2NPIA 4QGLA 1ND3A 4XXAA 4Y1XA 5E88A 1NE4A 2GN3A 2XJVA 4JGZC 4N9IA 5KHGA 4ORFA 3FLRA 1YO8A 4LLOA 3VKMA 3SITA 3U0ZA 3B93A 5I91A 1J3PA 1U5IA 2PHWA 4RSUA 5FOJB 4HZFA 4LT5A 2ATFA 3BOPA 4IEWA 5DZEA 2ZGOA 1O4ZA 3KQRA 1IKQA 1QOOA 4FPEA 1R082 2VQAA 3RDIA 1Q8VA 5T54A 1H30A 3ZFFC 2NM1A 4AQ6A 2VMHA 1BXHA 5F6KA 2LUWA 4KL1A 4AGGA 4CDXB 1YIPA 1FOD2 4NVPA 1KFUL 4QQ2A 3H3UA 5GZGA 4ATFA 3V56A 1QJY2 2VECA 1CAVA 2VVFA 4GULA 4IETA 4AK3A 4YFZA 3AKQA 3ZFGB 4WVMA 4IV3C 1MZEA 2O1QA 2JG8B 1MS3A 2XHKA 4B3NA 4ONUA 4XBLA 4S2FA 4Y1UA 1QH6A 3WHTA 5C8CA 4AEJA 4QM8A 2B5HA 2UY9A 4QQOA 5JR7B 4K9SA 1UL9A 3HWJA 5FFOC 1DYPA 3ZFFB 4PDWA 1AR62 1LOFC 4Z2WA 2HJIA 2XJPA 2ETEA 2RS31 4RA0A 4DNYA 3I59A 4OI2A 3ZN6A 2OIIA 3N3HA 1TQ5A 3KSCA 4GMP3 2IXIA 2GAUA 1ZZ8A 4QPYA 5FLHA 3LCPA 1QJX1 2XUMA 3MIFA 2QUOA 4C1WA 1J59A 3W58A 1L3JA 3N4MA 1F31A 2YXSA 2PHLA 5A33A 3WV6A 5J98B 3KM5A 2ZX3A 1F2NA 4HKOA 5BNNB 4P14A 5CVRA 5SV8A 3WDYA 1V6MA 1ZZ9A 5KC5A 4YG3A 1H8TB 3HR9A 1VBC1 5I8TA 3TRSB 4WVVA 4LHNA 1BYHA 1V6LA 2TNFA 5E8AA 1H4HA 5KXCA 1W0PA 2XKOA 5HCFA 5K0UC 1R093 5CIRA 4PLOA 4CP0A 3AYCA 3HBZA 5IK7A 4XXPA 3NVCA 3WW4A