4JGYA

Crystal structure of human coxsackievirus a16 uncoating intermediate (space group p4232)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
236
structure length
228
Chain Sequence
NLIETRCVLNHHSTQETAIGNFFSRAGLVSIITMPTTGTQNTDGYVNWDIDLMGYAQLRRKCELFTYMRFDAEFTFVVAKPNGELVPQLLQYMYVPPGAPKPTSRDSFAWQTATNPSVFVKMTDPPAQVSVPFMSPASAYQWFYDGYPTDLDYGQCPNNMMGTFSIRTVGIEKSPHSITLRVYMRIKHVRAWIPRPLRNQPYLFKTNPNYKGNDIKCTSTSRDKITTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Picornavirus uncoating intermediate captured in atomic detail.
pubmed doi rcsb
molecule tags Virus
molecule keywords Polyprotein, capsid protein VP1
total genus 33
structure length 228
sequence length 236
ec nomenclature
pdb deposition date 2013-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4jgyA00
2MEV1 1R093 1VRH2 1RUG1 4PDWC 3NAPB 1FOD2 4YVWC 1PO11 2RR11 5K0UB 4RQPB 4IV1C 5C9AC 3J8F1 4N43A 3ZFFC 2RS53 1QJX1 2RMU2 3VBFC 3ZFGB 4WM7C 1RUJ2 5BNNB 1R1A2 2RS13 4Q4V2 1QJX3 1E57A 5C8CB 1VBC1 3VBUB 1AYN1 4JGYC 1B35A 1ZBA2 1MEC1 1NY71 3VBSC 1POV1 5CFCA 4IV1B 1PO13 1RUF3 1NOVA 3DPRC 1AYM1 3VBUC 1AL23 5BNNA 1X36A 3TN91 1VBD1 4RR3A 1FPN2 4Q4X2 2X5IA 5CFDB 2WZR2 3NAPA 2XBO1 1VBA2 1AR93 1B35B 5J96B 4CDWA 1PGL1 5BNPA 4RS5B 2HWD3 1EV13 4CDXA 1RUD2 1RUE1 2XBO3 3VBSB 2R043 4IV3A 1MQTB 3TN92 1NCQA 4FTBA 2R042 2HWD1 4GH4B 5ABJA 1AR63 1QJY2 5C8CA 1MEC2 1NY72 1RUG3 2FZ1A 3JB4C 1C8M2 2BUKA 1RUJ3 3FBMA 4JGZB 5L7OB 1VBA1 4YVWB 1RHI2 1Z7S2 1ND2A 3J8F2 2BPA2 1AYM3 5BNOC 1D4M1 2HWC3 2PLV1 3JBG2 2BFUL 4PDWB 4GMP3 2R061 1GFF2 4CDXC 4CDUA 5DDJ3 5BNPC 1TME3 2RMU3 4CEWA 1HQNA 4CDUC 4CDQB 1AR91 1ZBA1 1PVC3 1RMU1 1TMF1 2RS31 1QJU2 3ZFEC 3VBHC 2R062 5L7OA 2WS92 2WFF2 5AC93 1W39A 1B35C 2PLV2 4GB32 1NA1A 2WWSA 4Q4W2 3J8F3 5D8AB 4QPIB 5ABJC 3VBRA 1AR61 1AL22 1NA1C 2HWD2 1QJY1 5DDJ1 1TMF3 4IV1A 1H8TC 1TMF2 1AL0G 1NA1B 1X33A 2TBVA 1QJY3 1RVF1 1TME1 5C4WC 4GH4C 1RUI2 2HWC1 5D8AA 3ZFEA 1ND3A 2GSYA 2X5IC 1CJDA 1RUI3 1ZBE3 4Q4Y2 3VBOC 5JZGC 1BBT3 1BEV2 1ND3C 4RHV2 5C4WA 3TN93 2RS52 4FSJA 4Q4X1 1NG0A 3VDDC 3VBSA 3JD73 1RUG2 3IDEA 1COV1 1PO23 5C9AB 4Q4X3 1VBD2 3VDDA 1OOPB 4GB33 5DDJ2 1RMU2 5A32A 4N43B 4BCUA 1R1A1 4QPGA 2XPJA 2HWB2 4PDWA 1C8NA 4AEDA 1R1A3 1RUC1 4QPGC 1K5MC 3VBHA 2HWB3 5BNPB 2BFUS 1D4M2 1EAH3 1NCQC 2WFF1 1SMVA 2HWF3 4IV3C 1AR81 1D4M3 1EAH2 5J98B 4CDQC 4CEYC 1Z7S3 2HWF2 1ZBE2 5JZGB 1FPN1 1PVC1 1HRI2 4CDWC 1HXS3 1AR71 5CFDA 4CEYB 1MEC3 3VBRB 3LOBA 4FTSA 1VAKA 1NCRA 1R092 4CDWB 2WZR3 4N53B 4RR3C 1BMV1 1K5MB 1QJU1 1VBD3 3DPRA 5JZGA 4IV3B 1EAH1 1PGL2 1OHFA 1VBE3 1PVC2 4GH4A 5D8AC 5ABJB 1AYN3 1BEV3 4NWVA 4NWWA 1AUYA 2RM21 2WFF3 5AC92 1AR73 4CDQA 1C8M1 4N43C 2VQ0A 4JGYB 5FOJB 5C9AA 3VDDB 1AR83 1ND2C 1ASJ1 4LLFA 1HRI3 1CD3G 4CDUB 2ZTNA 1R083 1HRV3 3S6PA 2DF7A 1MQTA 1R082 1F2NA 2WZR1 1VBE1 1HRV1 1QQP3 4QPIC 1PO21 1V9U1 4AEDB 4JGZA 1OOPA 1RUC2 1QQP2 3ZXAC 2WS91 5CFDC 1BBT2 4CEWC 2RS32 1R091 1BMV2 4WM7A 2Y26A 2WS93 1C8M3 3M8LA 1ASJ3 1HXS2 4Q4V1 2QQPA 3VBOA 3ZFFA 1ASJ2 5BNNC 3VBUA 4AEDC 1VBC2 1QJX2 2RMU1 2R073 3JBG3 3JB8A 4WM8C 1ND2B 1ZBA3 1H8TB 4Q4W1 4Y5Z0 2X5IB 3VBRC 3CJIB 1ND3B 1HX6A 1RUH2 1RMU3 4EJRA 2RR12 1RUH3 5BNOB 1POV3 1RVF2 2HWB1 1WCDJ 1QJU3 1FOD3 4YVSB 1RVF3 4WM7B 4RHV3 1FMD3 2R071 4Y4YA 4RFT0 3NAPC 2RS11 1ZBE1 5K0UA 1PIV1 4WM8A 2PLV3 1V9U3 1AR72 1VBB1 1PO22 4Q4V3 1HRV2 3ZFGA 1V9U2 4CDXB 1COV2 1RB8G 1H8TA 5FMOS 1RHI3 2HWE1 1QJZA 1VBE2 3JBG1 1RHI1 1FMD1 1PIV2 4Q4Y1 5BNOA 1VBB2 3DPRB 2FZ2A 5LK7B 1DDLA 1VBB3 2RM23 1TME2 1PGW1 2RS12 4RS5C 3VBOB 5AC91 4Q4Y3 4FTEA 1RUC3 1EV12 5C8CC 1MQTC 1VBC3 5L7OC 2RS51 3CJIC 1FMD2 2RS33 4RS5A 1RUJ1 3JD72 2HWE3 3HAGA 1PO12 5ACA1 5CFCB 1HRI1 5A33A 1RUH1 1M06G 2HWE2 4GB31 4YVSC 1VRH3 2R072 1AYM2 1RUF2 1AL21 1HXS1 4SBVA 1AYN2 2MEV2 4YVSA 1POV0 3VBFB 3ZFGC 2BBVA 5CFCC 1BBT1 1OOPC 1VB4A 4QPGB 2HWF1 4JGYA 1AR92 5ACA3 5K0UC 3CJIA 2RM22 4RQPA 3JD71 1OPOA 5C4WB 1AR82 1VRH1 3VBFA 1FOD1 1RUE3 5GKAC 4Z92B 1RUI1 2HWC2 1PGW2 3ZFEB 4CEYA 1Z7S1 1PIV3 1VB2A 5A32B 1IHMA 1COV3 2IZWA 1EV11 2ZZQA 1K5MA 2RR13 4CEWB 4Q4W3 4RQPC 1QQP1 1RUD3 4N53C 4RR3B 4GMP0 2MEV3 3ZFFB 1A6CA 5FMOL 1VBA3 2WLPA 3VBHB 1AR62 5A33B 2GH8A 5ACA2 2XBO2 2ZAHA 4RHV1 1NCRC 1BEV1 1NCQB 1R081 4GMP1 2R063 4JGZC 4WM8B 4QPIA 1NCRB 1RUD1 1RUE2 1F8VA 4N53A 1FPN3 4YVWA 1RUF1 2R041
chains in the Genus database with same CATH superfamily
2D43A 1DFQA 1GOGA 3MO4A 2EXKA 2EXHA 2EVXA 3WDVA 3W5NA 2WSVA 3GZAA 2ZEZA 3NWKA 5IVCA 3QBQA 4H2AA 2ZMNA 2GU9A 1RUG1 4IEOA 4MOAA 2PAEA 4Z1VA 3AP4A 2D3SA 3MPBA 5K0UB 4PHZA 3J8F1 4IEUA 1VMFA 4N9IA 4YM2A 1N3PA 3U78A 4CUAA 3PVNA 4YM0A 3WW2A 3D8CA 3N7LA 4LE3A 4LKDA 2JEMA 3ZN6B 3VBFC 4XC9A 3ZLIA 4WM7C 2CWMA 3TAYA 1R1A2 1YI9A 1S0JA 3N35A 3T09A 2FDJA 2VXJA 5FR3A 1W03A 5C8CB 4YGCA 4AHXA 3BKZA 4CZSA 1VBC1 4E8CA 2FCTA 4NE9A 1GP5A 1B35A 4LE4A 4D3WA 1MEC1 1W28A 1N1SA 1OKQA 4FCAA 1PMIA 3HBZA 3HNBM 5JOZA 3VZMA 3IIIA 1AYM1 3VBUC 1DCSA 5F5CA 3TN91 1VBD1 1JBCA 4RR3A 5A3PA 3HT1A 3RMXA 2ADDA 2X5IA 4XYXA 5FMCA 5LCWL 4P5YA 2YY1A 1DG6A 5A1LA 1AR93 5B4XA 5FMBA 1DZQA 2O8QA 4CCNA 4GZ9A 1ULDA 4MHRA 3OCPA 4RS5B 4DUWA 1EV13 3B69A 3V65A 4QX5A 3ZYBA 2QFEA 5F3EA 1GZCA 2AC1A 4YRDA 3DCQA 1YIFA 4FOYA 1NCQA 4KU8A 4M3CE 5LASA 4FTBA 1EPZA 2R042 4A3ZA 1AR63 4EZ4A 1XNCA 2UWAA 5K7PA 1G8WA 2PMWB 1GP4A 2XJPA 4U2AA 2WZPP 5C8CA 1NY72 4OUMA 4JGZB 2I74A 1RUJ3 2JE9A 2VZVA 3FBMA 1S0EA 3WQBA 1VBA1 1WW4A 2VMIA 4MGZE 2VMDA 1H0BA 1US2A 4R9AA 1XE0A 1XYPA 4CUCA 3R0RA 3OYWB 2VBDA 4OI4A 5IFTA 1AYM3 1LRHA 5A1AA 4J1XA 1ODNA 1LGNA 3NQHA 2DCKA 3HBKA 1RL3A 3G6JB 3T4VA 2WNVA 1O8SA 1GFF2 2AR6A 3PUSA 4LO4B 4UBGA 4ZPIA 3T08A 4XVHA 3ZXDA 4BLIA 4D7SA 5I91A 5DDJ3 5BNPC 4L0PA 1TME3 3DN7A 4MUVA 4E4ZA 1RIRA 4CEWA 1LHNA 3LA3A 3GCXA 5T5OA 3U11A 4OMDA 4CDUC 4E27A 1AR91 1SDDB 1W6MA 4KWJA 2DYCA 1RMU1 2XHNA 4BU2A 2HH9A 4TWTA 2RS31 3MPPG 5A7NA 5JXHA 4IETA 2VUDA 3FFQA 2ZKNA 4BQ5A 2Q5TA 2WQ4A 3VUOA 1YQCA 2R062 1WBLA 1BJQA 5FLHA 4CCJA 3V0BB 2ZGQA 4CXYA 2JIGA 2PAMA 5DAQA 3A0NA 4JRAA 5DAVA 3WT3A 2VUCA 3UKTA 1W0PA 4LO7A 4GB32 1UXZA 1XOYA 4QB1A 1NA1A 1RUOA 4W50A 1ST8A 2TNFA 5E6HA 1QXPA 4XF0A 2ET1A 5ABJC 1SPPA 5FP4A 2W92A 5F6LB 1SLTA 2VQUA 5IVYA 4LJHA 4MGTA 4C1WA 2BNNA 4LK7A 1AL22 1T2XA 5IVEA 4TYSA 5DDJ1 4I2OA 1TMF3 4IV1A 2IXIA 2GNMA 1X8EA 3R4SA 1NXMA 1H8TC 4AQ6A 1JUHA 2ATFA 2BNOA 4S2DA 5KXEA 4DS0A 2X29A 2JDNA 3MV01 4LBNA 1LOFC 1EUUA 1RVF1 4OUSA 1TME1 2HWC1 3ZFEA 4OQ8A 2W5FA 1ZX5A 4YGBA 3ZMOA 3VB9A 1H9PA 2DV9A 4YARA 3D82A 4XTMA 1RUI3 3POGA 1AXYA 1YQ5A 4LT5A 4P9WA 3IPVA 5EFUA 1PVXA 4RHV2 4O65A 1AF9A 3W21A 4AFDA 1UPIA 4CU9A 1ULPA 5A1FA 5JSRA 4Q4X1 1WLTA 1RJ8A 1NG0A 3FHQA 3H0OA 3N7MA 2ZX2A 2IXJA 2D6KA 3SHRA 1P8JA 3WR0A 4IGQA 1QMJA 2V5DA 1LU1A 1VBD2 2IXCA 3O5SA 3VDDA 2P3YA 1H4GA 2WO1A 4IERA 1YQ8A 2CGPA 5FRAA 2FHRA 1HN0A 1RMU2 4LIUA 4QMAA 5A32A 3KF5A 2H6BA 2W68A 2E7QA 3FLTA 1UO9A 1LEDA 2JD4A 5HCBA 1QF3A 3SCGA 1L7LA 3TNQA 3M2MA 4RGGA 5EQUA 3VKLA 1CAUB 2Z42A 4CU7A 1W9SA 5LB6A 4YZ2A 2D44A 1UYZA 2D6MA 2HWB2 3GJBA 4AEDA 4B1LA 1R1A3 1X9PA 4A7KA 3U0ZA 1K5MC 2ES3A 4LKSA 3S0MA 4IEYA 5IVFA 2BFUS 2C4XA 1EAH3 3WZ1A 2BQPA 4AYUA 1YI7A 5HXVA 1HJGA 1GICA 2B39A 2VCBA 2XVGA 2JECA 2RE9A 2JDHA 1Z7S3 5GJ6A 4CEYC 4F8AA 4P02B 1AVBA 1RITA 1PK6B 2KA3A 4L11A 3WHTA 1PVC1 1Q8OA 1CAWB 1HRI2 2OZJA 2FMYA 3KZ4C 3NV3A 5I0UA 2B4KA 3WNPA 2GMPA 5CFDA 2DFBA 2MNGA 4XMIA 1IS6A 2VOKA 3RWKX 5D21A 1TE1B 4RR3C 3VHOA 1W8FA 4E2QA 1X50A 2IFWA 4MADA 1NQDA 4QQPA 2PA7A 4P9JA 1QXJA 5LK5A 3IDCB 3WP3A 1IQDC 2VMHA 4UBHA 5JZGA 2VH9A 1EAH1 1OI6A 4DXZA 1JZ8A 1OURA 1BHGA 4CCMA 4K1ZA 1KJLA 4BWOA 3E6BA 5FMDA 2XL9A 3CKHA 1WBFA 4Q8LA 2DCZA 4FFHA 1HKDA 2VAUA 3A7QA 1BEV3 3K3OA 4ZONA 4JCKA 1HB3A 5H9PA 1SCSA 4JDMA 2WWJA 1SDWA 4LKFA 4Y26A 4ZXEA 1OF3A 2JIJA 5AC92 1Q5OA 4IEZA 2PXJA 4QX0A 4XBQA 4ZU4A 4P00B 1UMIA 3NO8A 4N43C 3LAGA 3PVBB 4JGYB 5FZ4A 5FOJB 2VZ3A 5C33A 5C9AA 3ZXGA 1XU1A 1TVGA 4X8PA 5FZBA 4YPJA 4PI2A 1U5ZA 3V0BA 4JTNA 4COVA 3I97A 1HRI3 2ARCA 3WDWA 1UKRA 4AEKA 2CV6A 4DNYA 1DQ1A 3B94A 2YU1A 4NPMA 5FYMA 1XNKA 3FC0A 1CQ9A 1YNAA 5DXDA 3PUIA 1LESA 5KXCA 4QQOA 3P3NA 2WYSA 5FXZA 4HZFA 1QQP3 4OI1A 1N1TA 2P17A 4P5HA 4PQ9A 2ZCWA 1W0OA 5GM0A 3T2OA 2W08A 4YW7A 1OVSA 3ZXAC 3GXUA 1DQ4A 2EA7A 3DECA 4LO5B 4BOWA 1O3TA 5A3OA 3IN9A 1REDA 4QXHA 4BQ1A 1QEXA 4CEWC 4K6BA 4DQAA 2WQ8A 3O0WA 3N3HA 3GDBA 1ASJ3 4ZKTB 2QQPA 2YGLA 2OPWA 2BW8A 3VBOA 1FV3A 4IEVA 4Y1YA 4Y20A 2A6YA 3E97A 2ZGPA 3SEPA 2WN2A 2XUMA 5FYTA 2ID4A 5GZDA 4LMFA 4ITCA 4LNVA 1YLLA 3DGTA 1S2EA 2R073 4H55A 1QDCA 1E5RA 4G3YC 4WM8C 3N9QA 1DQ5A 1ZRCA 3NW4A 3FLRA 5FZMA 4Y5Z0 5C3OA 2VVEA 4Q5OA 3OGGA 3MFAA 2ZZJA 1C3HA 1A78A 2BP6A 1BLZA 4F3JA 2QQLA 3CJIB 4I0BA 2VW2A 4PI0A 2R1BA 5IT6A 3RZKA 1LCLA 1RMU3 3A0KA 2QQWA 1JYVA 3OPTA 4N90A 4QT6A 4CCKA 2RG4A 1AX1A 2HWB1 2VBBA 1OFNA 1WCDJ 5I0RA 1QJU3 1FOD3 4FPGA 3I3BA 3MYXA 1CAUA 2A75A 4L97A 4XACA 3THCA 5F2SA 2R071 3VZOA 3KT4A 1REFA 2A3YA 2VULA 1MS9A 1O59A 3NNLA 4QAWA 1SFNA 3FUOA 3M3IA 2FDFA 4K3UA 1ZZ7A 5K0UA 1PIV1 4D6SA 2Y60A 5JOWA 5LWBA 2X53S 1PO22 3GBWA 4S2GA 5JOXA 4GWIA 2H0BA 2BZDA 3U75A 2JKXA 4CDXB 1LHVA 1H8VA 2QBXA 1J83A 3W20A 1HV1A 1HW5A 2R0HA 3AYAA 2E9QA 4XJUA 2FCVA 4Q0QA 4NRQA 5CISA 1ZZBA 3ZOIA 3B3QE 1VBE2 4AVVA 1F5FA 5SV8A 3WNLA 1H1MA 4YLZA 2A6WA 1EP0A 3WP5A 1RHI1 4PF1A 2GALA 2YPJA 4FOWA 4Q4Y1 4D7YA 4FVVA 5FYSA 2G9GA 1OLRA 3WG1A 5FV3A 2RM23 1TME2 2RS12 2ZGNA 5EWSA 3SC7X 1RUC3 1UF2C 2W46A 5C8CC 5CNAA 1U5XA 5EP9A 4O61A 3CLPA 3WP6A 2IC1A 1ZYBA 4TLFA 3PMSA 1FMD2 4LBQB 4OUEA 4RS5A 4YYOA 2J7MA 3ZYFA 2VL4A 3PJQA 1JYTA 3JD72 1GSLA 1GZWA 3HAGA 1PO12 4I01A 3QOPA 4JHZA 3ORJA 3LSEA 5FWEA 2DUPA 4CP2A 5ANNA 1PGSA 3LEMA 4NUBA 1XRUA 3AXDA 3GALA 5SV5A 2HWE2 1OD3A 4BB3A 5FZFA 1AXZA 3GCWA 5K4LA 1HLCA 3NKTA 3H9AA 4INDA 1JHNA 3SCHA 1G9BA 2VOTA 3OD4A 4AWDA 4J6GA 3ZSLA 2WN3A 2XGXA 5CA6A 4DY3A 3ST7A 1OC1A 4JV4A 2W3JA 5KC6A 4XCBA 4M0HA 2XG3A 1SFYA 1RINA 3OGJA 2XONA 3WHUA 3HPNA 5CAZA 4CE8A 3ATGA 2IVJA 3LDBA 4QPGB 2Q1FA 3QD6A 5T52A 4FPLA 1AR92 3GZTB 4BA6A 1PZ9A 4CYDA 1CAVB 1OPOA 2ZHNA 4BQ2A 3GBGA 1A3KA 3FN9A 3WW3A 2ZAAA 2BGCA 5F39A 4OHWA 3VBFA 2X10A 2WLQA 5A3UA 2HWC2 1XSRA 3S57A 2TEPA 1W9WA 2XVKA 2QQOA 5C3PA 1W3XA 4UT5A 3R6SA 4Q0SA 3WF2A 4CEYA 1SLBA 2WYFA 4DMIA 1Z7S1 3ZSJA 5BNQA 4ZHNA 3E1F1 2LUWA 3S7IA 1YIPA 3MICA 1COV3 4AFAA 5A6XA 3IAPA 4DUXA 1K5MA 1APNA 2UWBA 1W2OA 2EXJA 2OQ6A 2D6LX 4MG2A 2SLIA 3TRSB 3ZYPA 1CGPA 5F1RA 1WLCA 4N53C 1C28A 5AVAA 4GMP0 2C6SA 3J7NA 3ZM8A 4TXWA 5A3LA 3O7OA 2Y6KA 4A4AA 4OHYA 4LUKA 4L2NA 4UFHA 4D0QA 4GKXA 3HJRA 2VW1A 2Y38A 1Y9GA 3QH6A 2DU1A 3GGLA 4ASMB 1WCUA 1DQ0A 1WW7A 1BEV1 3AKQA 4RYDA 2A6XA 4GXLA 3S30A 2R063 3THDA 4FPFA 4JGZC 4DOUA 1GU3A 2VCAA 4HG6B 1HQWA 5A7QA 1RTVA 4TTGA 2A7AA 2AH2A 1UU4A 2WO7A 4AF9A 2NMOA 3UK9A 4ZY9A 5FJKA 2P3KA 4YVWA 1RUF1 1HB1A 2NLRA 1YC61 5DQ0A 5FLIA 5GALA 4CVUA 4YZ3A 3IDBB 2YG0A 4IEQA 1DP0A 4KQ7A 4UW5A 2VOXA 3LDRA 4XBLA 1VRH2 5DUVA 4BM8A 5GZGA 5C3SA 2JG9B 2QQKA 4PDWC 5CVRA 4FQZA 3NAPB 1FOD2 3DKQA 4YVWC 1PO11 3OPZA 5IK4A 2EF6A 4QGNA 4RQPB 2YB7A 5FLJA 1WZXA 4MHUA 2DVAA 3CIHA 3RYPA 3T4HB 3O1OA 3VD5A 4BK4A 1DYKA 3C7GA 3MDPA 1I5PA 4BYYA 4OYUA 4KGGA 3PMEA 2RMU2 4Y1VA 3ACIA 3BTAA 4MV2A 5HV0A 4AAXA 1OLMA 5BNNB 1F31A 2RS13 2G9FA 4PT6A 2LW8A 4Q4V2 5JMOA 4HT1T 2RDRA 2EIDA 1X82A 3M3CA 5A6ZA 1QJX3 3NJXA 3L2HA 2PQSA 1BXHA 2XJTA 3LOIA 2Q8OA 3VBUB 1HIXA 3FHAA 3HQRA 2E63A 5JR2A 1POV1 2N7GA 1W99A 1SQ4A 3B01A 3VDAA 4NHYA 5CFCA 1PO13 1RUF3 4S2HA 4FFGA 3S7EA 4P9YA 1NOVA 2VMFA 5EZWA 3ZN6A 4QHZA 4ZZ8A 2EICA 4UF0B 5FKBA 4D69A 1CAWA 1O7FA 1FPN2 3CF6E 4CA9A 1CX1A 5CFDB 5FAXA 4XIKA 3NAPA 2HYXA 4Q0VA 3H7JA 3FBYA 3ZSEA 5JOYA 1B35B 4P9IA 1W6NB 3LSDA 5BNPA 2ZGLA 4WVZA 5BY5A 1RUD2 1RUE1 1W8HA 2XBO3 1X7NA 2W0XA 1BK1A 3EO6A 3T1MA 5JSPA 5EJ1B 5LA9A 2CAUA 5DZFA 5FZ9A 5LA1A 2JG8A 4E4DX 4PBPA 4E4SA 3CDZB 2HWD1 4XW3A 1SEFA 4AEJA 3GF6A 5BV6A 1ULFA 2ENRA 1BKZA 1UNBA 2FZ1A 3JB4C 2LROA 1CAXA 2BUKA 5EHDA 3J7HA 1I6XA 3ZYRA 1YXWA 2CAVA 1W6QA 5DABA 2VMEA 3NVCA 3VKOA 3GZEA 1Z7S2 2B8MA 3J8F2 1PMJX 3ACFA 5F5QA 3RMYA 2OQ7A 3I2FA 5FZKA 1DBNA 5FPAA 4XTPA 2HWC3 3ACLA 1W6PA 1N3QA 2CSGA 3MV11 4GA9A 4Q0PA 1PX4A 1DYOA 1S0BA 2W1WA 3ES4A 4BXSV 2JG9C 4PDWB 1DGWX 4W65A 4GMP3 1JYIA 3CL1A 3LA2A 3AMMA 4ZU7A 2XOMA 3PIJA 4CDXC 1W6NA 2XJRA 1GNZA 2KXLA 4YM3A 2RMU3 5F6KA 2BVVA 5FYCA 1UY1A 3E6DA 1SCRA 2BVBA 2W94A 1HDKA 5KBFA 4AR2A 1KXGA 5B4NA 3T2QA 2XJSA 5CEHA 4AXOA 5FZ0A 2J1SA 4LO8A 2I2SA 2YBPA 1JZ7A 4UYBA 2WT0A 1NLRA 1MZ6A 4Q2FA 5FJHA 5C3QA 2LALA 2WFF2 3AJYA 5J36A 1LB2A 5FZGA 2VOVA 3EB7A 1Q8VA 1H6XA 3CHXA 4PIXA 1UOBA 4CTEA 1ACCA 3KV5A 3OF1A 5FZIA 3ES1A 2BOJA 4N8MA 4PF5A 5T5LA 1MS8A 3W58A 3ZR6A 4BISA 5FK7A 5IVJA 2WWSA 2ADEA 3J8F3 5D8AB 1T6GC 4FXKB 1LGCA 5C7GA 3ILRA 3AVSA 3THTA 3OG2A 4IEPA 5FUIA 4RD7A 4OLLA 5F7UA 5KXDA 3W5MA 2VNVA 2HWD2 4BQ3A 2P4EA 3H8XA 1D4VB 4LBJA 1PNFA 3WQ1A 3K48A 4DEQA 3LE0A 2JKBA 4XABA 5A6QA 2QQIA 1K42A 1TMF2 3CJXA 4LBMA 5EJ3A 1X33A 1NA1B 3A22A 3WY6A 1GKBA 2TBVA 1QJY3 3R4DB 4KU7A 3BVCA 1CX4A 1J84A 4GH4C 1RUI2 1UU6A 2GSYA 3RG0A 3VL9A 2VBPA 4BQYA 5LA0A 3WV6A 4FQ4A 3TEZA 1NZIA 5EPAA 3UGHA 1OQEA 2YFZA 4KNCA 2OA2A 4HN0A 4Q4Y2 1ND3C 1AX0A 1QXRA 2WIIB 3ETQA 3TN93 4BLJA 1G7YA 2RS52 4JC1A 4FSJA 2VVDA 1UY4A 2GN7A 3KCCA 3C7FA 3VBSA 1ONAA 2Q30A 2BDRA 4HVRA 1MVEA 3ZR5A 1PMHX 2E7TA 4CU6A 2D5FA 5G04L 1OOPB 5JXIA 1NT0A 4ASLA 3KGZA 4NN0A 2E31A 3OY8B 3ENRA 4ARXA 4XFAA 4Y4RA 4Y1UA 2E33A 3KCYA 2J42A 3U1XA 3FFZA 3Q8CA 4AFMA 1UZWA 4N43B 3I49A 1XE7A 2W87A 5LBBA 3O1SA 1Y7BA 4I0AA 4QM9A 4R4XA 3DYMA 2YU2A 3DL3A 3LGRA 4LR4A 3VN4A 2WO3A 2B9VA 4Q29A 3AJZA 5A3MA 4FP3A 2XPJA 2OUHA 2XQRA 1JOBA 3IB3A 2Y6FA 4XDOA 5T55A 3LKJA 5C8WA 4UXAA 1IZ3A 2ARAA 5DZEA 4KBBA 5BNPB 1OH4A 3WF1A 1ZREA 3RZLA 3VZKA 4A6SA 2J22A 1ULCA 2HWF3 5FBZA 5I8SA 4C91A 1EAH2 5J98B 1PZ7A 4NMIA 1CESA 4G9SB 4XXAA 4XF4A 3MUY1 4XETA 1ZBE2 3ZO0B 2X09A 4ASKA 2YHJA 1CN1A 2PAKA 1DF0A 3JU9A 1O3SA 2EXIA 1UOFA 2F17A 1AR71 3D3AA 4MGIE 3BU0A 1KDKA 1S2BA 3VBRB 4EE2A 5GLUA 3IMNA 1G86A 1XYOA 1VAKA 4HANA 4K1YA 5FP7A 4XJ9A 5C5UA 3V0AB 5HCHA 1W6OB 1X8MA 2WZR3 5A7SA 2CDOA 1BMV1 2V4VA 3EBRA 1Y3TA 3GHMA 3SH4A 4IW3A 4J1WA 1PZ8A 4J25A 1PGL2 1VBE3 4AE2A 2G1MA 4LXLA 5E88A 4GH4A 5ABJB 3PTYA 4V2VA 5CFCB 1Y9MA 3ETPA 1AYN3 1WMDA 3T30A 2DFCA 5JAXA 1YHFA 3U10A 3LEIA 1AUYA 3N7KA 3WP4A 1Y9QA 4HPKA 1OBNA 1Y4WA 1ULGA 4Y3OA 3RYRA 3B93A 1JODA 1ZRDA 2K2SA 1F35A 1C8M1 1W3VA 1ZRIA 2W9XA 4O9EA 5A3TA 4OQ9A 2DCJA 2VCCA 1DU3D 3SMHA 1CAVA 3AVRA 1K45A 4CXWA 4YSFA 1ND2C 2H0VA 4TLGA 1IKPA 2D7FA 4XUQA 5FZOA 3I2KA 2GAUA 5GLWA 1GNHA 4QQHA 3SITA 3VD7A 4CCDA 4CDUB 3LIGA 3CO2A 5J37A 2O0OA 3WF0A 3WQ7A 4AK3A 5LY1A 4LQRA 4ISQA 1R082 2MHFA 1GUIA 1SHWB 1IKQA 2WQZC 2WZR1 3NKGA 1VBE1 4EV0A 1HRV1 1MS4A 2VQTA 5FIXA 4EYUA 4AI8A 3ZMNA 1OH3A 4JGZA 2VZPA 5M0TA 4MXVA 1RUC2 2ZGOA 3ZXLA 4YW2A 4OZXA 4UFLA 5FFOC 1W90A 2V73A 1ZZCA 3AMHA 4HPKB 5CKQA 4QGMA 2RS32 4E2GA 1CZVA 3I59A 4COUA 2DWRA 5IVVA 2Y26A 4CP9A 3POIA 2WS93 2R16A 1C8M3 3H3ZA 3POWA 4C0HA 4DZGA 1ASJ2 1BCXA 3ZXEA 1DIWA 1VMHA 4XUPA 4YFZA 2E26A 4IUGA 2RV9A 5ISLA 2VR4A 4AEDC 5F9TA 1VBC2 1QJX2 5KR7A 4KG0A 4G4FA 4AHZA 1D0HA 3JBG3 3ILNA 3JB8A 2GP5A 5FZ1A 2AENA 1ZBA3 3K4ZA 3I7DA 5LY2A 3WDTA 5H9SA 3ZIXA 2NM1A 4K8RB 3VBRC 2XKPA 4AOCA 4RA0A 4XFCA 2V4AA 1ND3B 2JG8C 2UWCA 3FJSA 1HX6A 5APAA 1RUH2 5A80A 2WRAA 2VJXA 3WNNA 1IG3A 2QZ2A 1SLCA 3FHIB 1GQHA 3Q9OA 5FZLA 3IBMA 3N9MA 3H7YA 1I9RA 2QE3A 2SBAA 2F4LA 2WT1A 3AZWA 3KVAA 4A44A 2W47A 4DO0A 1MACA 4Y4YA 4RFT0 5FP9A 3NAPC 2ZS6B 4IGOA 2WC2A 1ZBE1 4A41A 1AJOA 1OXCA 1QJFA 2I07B 2R1DA 4DEVA 3GJAA 4NPRA 5CZKA 3K4DA 1VBB1 3SXWA 3FX3A 4FPCA 3SCFA 2ZABA 1HRV2 3BTXA 1V9U2 4F83A 3THPA 5A7WB 1LKNA 5IFPA 1COV2 2ORZA 2HBTA 3OPWA 3VL8A 3VZJA 4UW6A 5DUUA 1RB8G 3NNGA 2X05A 3CZJA 3MW4A 4HKWA 5KWRA 3E6CC 2Q1ZB 3POBA 4KI5M 4ORFA 3T0AA 3C2UA 5KHKA 3AKTA 1QJZA 2BWCA 2VZUA 3JBG1 4N7IA 1UL9A 3VKNA 4AQTA 4BZ4A 4D7TA 1CJPA 4E8DA 2JDZA 3RQ0A 2VZRA 3WSOA 1JN2P 2OW4A 2XJQA 4GWMA 1XXNA 1PIV2 1VJ2A 4MX3A 2AGSA 3WUDA 1KGYA 2OT7A 1LHOA 2VUAA 2FZ2A 4GWJA 4UW3A 5LK7B 1H2KA 1F5JA 2EIGA 5IUQA 1DDLA 2OVUA 1VBB3 5GZFA 1MZFA 1YFUA 5FZHA 4RS5C 3WD5A 3O1MA 3WF4A 2XKOA 5FY9A 5DPNA 2DU0A 3MF6A 5K9YA 3N4MA 2BGPA 4FPHA 4KWKA 2PN5A 1IS5A 3LA7A 1QIQA 4Y5TA 2D40A 5L7OC 2VZTA 2RS51 3G7DA 1CVNA 4MLOA 4QX3A 1RUJ1 5GLZA 5EXOA 3RPQA 1G9DA 4JVAA 2XJVA 1HRI1 5A33A 1LHWA 3HN3A 5EYXA 2QZ3A 1RUH1 1AZDA 4KMQA 4EWEA 5F3IA 1ZVFA 4YVSC 2NPIA 4MXWB 4BH9A 2CYFA 1W8ZA 5FQ0B 4CCLA 1IGOA 2C26A 1C4RA 2R072 2QKDA 4C90A 2JDPA 3DYOA 3A21A 4MH0E 4EWAA 4YG0A 1RUF2 4A3XA 1AL21 1GZWB 1HXS1 2K9ZA 3DEMA 4QDSA 5JMCA 3ZPYA 4YVSA 2WINB 2J1AA 3DYPA 2QDRA 4QXKA 3ZFGC 3BI3A 3I2JA 1UCXA 4QXBA 4XILA 2HWF1 2YMZA 3KQRA 3KV6A 5BUVA 3E5UA 4P14A 3HIFA 1CIWA 4HKLA 1UX6A 4UOJA 3EQEA 3OTFA 5IK7A 3AK0A 5DG1A 1Q56A 5C4WB 5HI0A 3GYDA 4HMZA 3TWIA 2WDBA 4CRQA 1L7RA 5DZGA 1FOD1 1JU3A 2KD7A 2AEZA 1WWYA 1V6NA 2A3WA 2VCMA 4K9SA 5DUWA 3WX5A 5FPBA 1Q8SA 1EY2A 5FO8B 3MFCA 3B00A 3KT1A 4LHSA 3C3VA 1PGW2 4XZUG 3KT7A 1PIV3 1W9FA 2HBUA 4Z82A 2VZOA 4LA2A 1MVQA 4KG8A 3BOWA 3VZLA 3LWCA 4A42A 2QDNA 3D5OA 1BZWA 4DRRA 3ZIWA 1RUD3 1GZ9A 4RR3B 4B4PA 5HV4A 3VLBB 4NHMA 2EIBA 4IE6A 4QQLA 1FI2A 2MEV3 3ZFFB 3C8XA 1DHKB 4K7JA 4BDVB 3VBHB 1G9FA 2RJLA 1VALA 4R9DA 4CCEA 2WKKA 1PM7A 2W1UA 2XLAA 2GH8A 5ACA2 1GQPA 2E7AA 3I3DA 3NJYA 2L9LA 3K51A 1O5LA 5CYYA 3RGBA 3FUQA 3UJOA 5A70A 2DUQA 2RVAA 1NCQB 5BPXA 4Y22B 5FKCA 3T0BA 3OSDA 3UETA 2F4PA 5FDBA 3WINE 4O9GA 3WQ0A 2HEWF 5FUNA 5EJZB 4CUBA 1VAMA 3PJYA 3M7AA 1NCRB 4QPIA 4YW5A 1KQRA 3H50A 1RUD1 1RUE2 2ZXQA 2D5HA 5F5IA 5F5AA 4FAHA 2VVFA 4N53A 5LRRA 1N1VA 2F6BA 3WNXA 1XU2A 2PHLA 1RUNA 1XNDA 2PHTA 1R093 2ZEXA 2VXRA 3RNSA 3PDQA 5AVPA 4R9BA 1JMUB 2Q4SA 1W9YA 3EXUA 2B5HA 3PNAA 5T5PA 3N9NA 3C7OA 3UV9A 4ATEA 5FTTC 3UESA 4Y33A 5JR7B 2WNVB 4XDQA 1STMA 5C9AC 4KWUA 4XF3A 5LATA 1MS3A 4N43A 2P34A 3SQOA 2V5YA 1W06A 2VZSA 3ZFGB 5I0SA 1RUJ2 3Q8BA 3U4SA 3T2PA 3OBRA 3CZUA 2IXHA 4XIOA 3MHZA 1SPPB 4PIYA 4UFKA 2A71A 4DINB 1HV0A 4HVOA 1LULA 1NY71 1HJFA 3GNEA 3MZHA 2HEVF 1DGRN 2ARXA 4IV1B 2VZQA 1H1AA 2DCYA 2YZ4A 4BQXA 2ERFA 2P2KA 3ZYHA 4HVQA 4BE3A 5BNNA 1X36A 3P5BA 2GNTA 2VW0A 1J3PA 4RGKA 3IKWA 4LBOA 5GLVA 2WA3A 2ZPXA 2WNUC 4LUMA 2WR9A 2HLEA 4NAMA 4R4ZA 4GAZA 4LA3A 5J96B 2J1TA 1PGL1 2NYYA 1OPMA 2VTXJ 3IPVB 3NNMA 4Y1XA 5FZCA 4URAA 4IEWA 4CDXA 5L73A 1YYNA 3WG3A 3LFIA 1ENQA 3DXUA 1ENXA 1MQTB 2J1EA 3LDKA 3TN92 1NLQA 1EPWA 3AMNA 3B9IA 5FYYA 3BIEA 2VC9A 4GH4B 5ABJA 4QX7A 3ECQA 2FDHA 4V2WA 1JHJA 1GWMA 1MEC2 2R7EB 5L7OB 1C8M2 3OOXA 1QOOA 2Y33A 1RHI2 3M1HA 4LKEA 3ZYIB 1ND2A 1QNWA 2BPA2 1DZTA 2Y8KA 3MLKA 4QDQA 1IPJA 5BNOC 4M00A 3QH7A 4QD2A 3WLUA 1GZTA 1D0GA 1D4M1 4AL9A 3JBG2 2BFUL 1IPKA 2ARBA 2YGMA 3WF3A 3IT8A 4DPNA 2K0GA 4BMEA 4XQDA 4QPIB 4WVVA 1UIKA 1ZNPA 3U37A 1WLDA 2R061 2R49A 4LEJA 4EWDA 4U36A 5FYHA 2OS2A 2WT2A 4FI9A 3H8OA 1SG3A 1OT5A 2YFUA 4URTA 3UT0A 2RDNA 4CDUA 1K12A 2VY0A 3RZZA 1HQNA 5L9BA 1CZSA 4IE4A 2FCUA 5FXWA 4M4RA 4D94A 1UOGA 1NQJA 4Y24A 3VHNA 1N3OA 3MIEA 3VZNA 3OUHA 5DG2A 4UWDA 2A73B 3RI8A 4IQPA 4XUNA 3VBHC 3ZFEC 5C70A 5L7OA 1R1ZA 4H14A 3I2HA 1UYXA 4LULA 5LW9A 3UGFA 2J1RA 3HNMA 3NSTA 1UZVA 2LRPA 5KHHA 2ETEA 3I59B 2GMMA 2VNOA 1QNYA 3ZVXA 2YYOA 1WW5A 3OBAA 4Y22A 5JIUA 2LM3A 5T54A 3C7HA 1U5YA 3SISA 3RVHA 4A45A 2C5DA 3I8TA 5FZ3A 1QWRA 1W9TA 1S0IA 3BPSA 3KF3A 3MIGA 1WMXA 1A8DA 2ZOEB 3IAQA 4HETA 4HSLA 4UFMA 4P08A 1CPMA 5T3NA 5FPVA 5I93A 1NA1C 4PIZA 2X8KA 1TQ5A 1ZZ8A 3BTYA 2UYBA 1GYKA 4TSVA 1G9CA 4LHLA 2W91A 5IHRA 3LD8A 4AG4A 1AL0G 3WUCA 1C1FA 1DQ6A 1W05A 3H8UA 3KLSA 5D8AA 5C4WC 4AQSA 1ND3A 2X5IC 3AZYA 4FP2A 1RXFA 4OI0A 4KWLA 4M3CF 3VBOC 2ZX0A 1OUXA 5JZGC 1J1TA 1BEV2 5FYBA 3AYEA 3H42B 3TOJA 1GP6A 4R9CA 4DXTA 5FYZA 3I54A 4AI2A 3OGRA 4PBOA 3BUCA 1ULEA 1CONA 2NZ9A 3BCWA 1FXZA 3CNAA 1D2QA 4ISRA 4MSVA 5DAWA 3RS6A 5CBLA 1KRIA 1H6YA 4WZFA 3BYWA 1PHMA 1RUG2 1VR3A 4OHXA 1COV1 1PO23 2XWJB 5C9AB 1LR5A 3IM0A 4Q4X3 4BHPA 2UU8A 3BPZA 5CKMA 3IDAA 4L9BA 4NIGA 4FFIA 3EMRA 1KJRA 4GB33 1GLHA 5DDJ2 5JSOA 4XJAA 1VMJA 4ARYA 4XUOA 4LOSA 5FO7B 5JIAA 3DXTA 1W6MB 1R1A1 4N7UA 4RGAA 5E16A 1DGLA 1URXA 2YXSA 1NAEA 1WCKA 4LBKA 2WNUB 1YRZA 1EYBA 1LGBA 3OUJA 4TN7A 1C8NA 3U4XA 4QKFA 2HEYF 2Z79A 1RUC1 3KGLA 1C5IA 4FPKA 4JRLA 4QDRA 2GMEA 1VP6A 1D4M2 3WCSA 1DLLA 2I45A 1NCQC 2E32A 4XJ8A 2WFF1 4AVSA 1AR81 4XDPA 4AGRA 1YJLA 3PVOA 5IVBA 1OFSA 2ZHMA 2HWF2 2J1VA 1LTEA 4META 1H4HA 3WDXA 2UYAA 5FK8A 2WO2A 1MEC3 1PM4A 4FXGB 3LOBA 1JYXA 2ET7A 1ODMA 3CEWA 3EHKA 5FPXA 2D6PA 2Z4FA 4OMCA 5FREA 4CDWB 2ZX4A 1SBDA 2EALA 3NNJA 1UY2A 1FNZA 3K3NA 3SLIA 3O1UA 4DXSA 3NV2A 3FE5A 2ZGKA 1VBD3 2PQQA 3NV4A 3AKSA 3SEEA 4XHXA 2IWGB 4IV3B 1XC6A 3UL2A 2WZEA 4MXWA 1OHFA 4QWNA 1PVC2 1CZTA 1O91A 2IFRA 1SACA 2DVGA 1V0AA 3LZZA 4JX0A 5D8AC 4NIIA 2XHKA 3HMYA 4BK5A 4XPVA 5JWPA 1UY0A 1O3QA 2Y6LA 3N9PA 4X6QB 1I1EA 4NWVA 2B7YA 1S2KA 4N9HA 1OD5A 1F15A 4HK8A 4NJ4A 1KEXA 2WFF3 1AR73 4QB2A 5FWJA 2NMNA 2OKXA 1W8UA 2VMGA 2VQ0A 4HBNA 3RWNA 4A7YA 4OHVA 1OVPA 5LBEA 5AFEA 5KC5A 2YROA 3L2YA 1GV9A 2PHWA 2ZMLA 3VDDB 1AR83 2GP3A 3ZKYA 1Q8QA 4L92A 3OB8A 2VECA 3QACA 3WDYA 1CD3G 4HSJA 3POYA 1NE6A 2RHPA 3H1YA 1R083 3UKVA 2JE8A 3S6PA 2WNEA 4C8DA 4ATFA 2A6ZA 2AYHA 3HNYM 4XF1A 1S0DA 5FPUA 4PJYA 2JJ6A 3B7MA 4HLTA 2JXAA 4HN1A 4R8HA 4AI3A 4E9KA 3VDBA 4QM8A 4QPIC 2D3PA 5EV7A 4AEDB 3IIAA 3VHRA 4A7ZA 4YZ5A 2XUEA 2LS6A 3B9CA 1ZA4A 4FPOB 2P5BA 4B8EA 5FP3A 2TUNA 1H9WA 1BBT2 3BN6A 4BIOA 1JTZX 2WABA 2QNKA 4RN5A 3K2OA 3USSA 1DGRA 5HCAA 3SKVA 3CQOA 1BMV2 1W6PB 4C0BA 2O1QA 3M8LA 3INAA 4Q4V1 2JG8B 2D98A 4E2SA 1GBGA 1UW8A 3ZFFA 5FXXA 1H1IA 3I3QA 3BU7A 3AYDA 2WAOA 3AFGA 1TNFA 3H3UA 5H9RA 4BJ0A 4NPLA 4L99A 4QHOA 4LK6A 4Q26A 2JDMA 2FDGA 1V6JA 4QGLA 1NXD1 4YGEA 5L9RA 2DVFA 2DBIA 2A5ZA 1DYPA 4Q4W1 5D2AA 3DF0A 2Y0IA 3AL5A 1IPSA 1PK6A 2X5IB 2XB6C 2GC1A 2C1FA 1BK0A 3WDUA 2RJ2A 4FO9A 5I0TA 3UNPA 1WCQA 2C0ZA 2W1SA 2ZGTA 1OA2A 3MIHA 1UXXX 2EAAA 2ZA9A 3LB9A 2YBSA 4NIDA 1RUH3 1V6KA 3OUIA 1POV3 4UFIA 4DB5A 5BNOB 3TB0A 4CPBA 3WNKA 1MS5A 1S1AA 3ITQA 2YDEA 2ZBJA 3L9JT 5IYYA 3ZYJB 1RVF3 4B1MA 1CWPA 2Q8EA 5L19A 3J26N 4RHV3 4OFGA 1FMD3 1V6LA 1NKGA 1PK6C 2JX9A 1XYNA 1RGSA 2WNUA 5FZ8A 3V64A 1YFXA 2RS11 4GJYA 2PTMA 4B3NA 3R05A 2A70A 4S2FA 4WM8A 4CPBD 2G19A 2PLV3 1V9U3 5I8YA 3POFA 5C3RA 4Q4V3 1U5IA 5FP8A 1UYYA 3RZJA 3ZFGA 3VHPA 1VLNA 4P9GA 3USUB 5CADA 3IMMA 4NRPA 5C5TA 5FMOS 3MW2A 2BERA 1RHI3 4IE5A 4ZS3A 1O5UA 4BQWA 5JCTA 1GANA 2HWE1 2ZACA 4IGPA 4PCRA 1QGLA 2P3JA 5FY4A 2VMCA 4YZ1A 4YW6A 2QQNA 1E5IA 4GALA 1HN1A 1FMD1 1QHDA 1UMHA 4HKOA 3T1LA 1XSQA 1W2UA 2W2IA 1NE4A 1QDOA 3PL0A 3GHNA 5BNOA 1VBB2 5K8SA 2A1XA 3FZ3A 3J4UH 1JZ6A 3OYWA 2C9KA 1SLIA 1GWLA 1PGW1 2C9AA 3MF9A 4LBLA 3VBOB 5AC91 1ZA7A 1JYWA 4Q4Y3 5B2GB 2ZEYA 1YQ2A 3AFKA 4I0WB 3BB6A 3ZXJA 4FTEA 4CU8A 2GDFA 3W59A 3OGVA 3RYKA 1YO8A 1JUIA 3VV1A 3ZSMA 3PURA 1OLME 1H2LA 4XMAA 4D6QA 3CJIC 2RS33 2BEOA 3ASIA 5LA2A 3N9OA 3K4AA 1N47A 5EIYB 1XPWA 5ACA1 4IDZA 3USUA 4HOOA 4W6YA 4XFIA 4WZCA 4EN7B 5IK8A 3BIWE 2YBKA 1DLCA 5L36A 2Q8CA 4FPYA 4XFHA 4WBBA 3WG4A 5JI9A 1J59A 3MLLA 1IOAA 4JDOA 5J3UA 3I2IA 4PLMA 3KHCA 3O0XA 3VGIA 2VTXA 2XH6A 5IK5A 4W6XA 3M4FA 3Q8EA 4UW4A 1V6IA 4SBVA 3ZSKA 1POV0 5FY7A 1E5SA 2FD8A 4NAOA 3URFA 3AZXA 2BBVA 4EROA 4DUVA 4AHWA 1BBT1 3ZX7A 4AQ2A 1OOPC 1AX2A 1OQ1A 4KBZA 4HL0A 5A3NA 5FQ0A 2ZJCA 3JUUA 5HPOA 1SZBA 4Q1PA 3CJIA 1FAYA 4AFBA 4AAPA 4YW4A 2RM22 4F7ZA 3OBTA 3JD71 4RQPA 4P9XA 5FZ6A 2BV4A 4LHNA 5CG9A 2GZWA 1AR82 1UN1A 2XLGA 1C1LA 1GQGA 2JDKA 2PHDA 5IJRA 2JICA 1XB9A 3NNFA 4IESA 1XBFA 4O7XA 2GNBA 5GKAC 3O1PA 1MPXA 3KSCA 1UIJA 1JU4A 2B9UA 1YWKA 2DCTA 4XFFA 1N1YA 3ZFEB 2RDSA 4XBNA 4LORA 1RXGA 3ZXFA 1SLAA 2O8OA 1FT9A 5A32B 5IATA 2P3IA 4COYA 3ACGA 2IZWA 1EV11 2D6OX 1Q43A 2IXLA 1NX9A 1W6OA 1ZM1A 2R32A 4W4ZA 4OI2A 1U0AA 2RR13 4Q4W3 3ZN5A 1SBFA 3PUAA 1LOAA 3M3EA 1F4AA 1QQP1 4BXFA 2AZ5A 4K21A 4H7MA 1IS3A 1WCSA 2MPFA 4C1XA 1WKYA 3OEAA 2EAKA 1A6CA 3WG2A 1MS0A 1H2NA 2BJSA 3AXEA 4LIVA 5FMOL 1VBA3 2WLPA 3I2GA 4R52A 1AR62 1UKGA 2IXKA 1L7QA 2OPKA 3FMGA 3IZOA 2WL1A 3UKNA 1LHUA 4UFJA 4QKNA 3AKPA 1A8MA 2HYKA 5L9VA 4XHBA 4A6OA 2W1QA 3C7EA 2WFPA 2XBO2 3P6BA 1XNBA 2VD7A 4RHV1 1NCRC 4KGQA 3VD9A 4D6RA 3POJA 3TBDA 1H2MA 1R081 4CXXA 2FBEA 1UQXA 1LECA 3D6EA 4Y1ZA 4B7EA 2XXZA 2NP0A 4WM8B 2J1UA 5JPMB 1CAXB 3AKRA 3NMBA 1F8VA 1UD1A 3EJKA 1FPN3 2KM2A 1W6QB 4AEMA 3ME2A 4W8JA 5E89A 5FPZA 3S5QA 2MEV1 3ABZA 1OKOA 4QKBA 2VO5A 2B46X 1AJKA 4Q1RA 4XAAA 4XEZA 3SNMA 4XFBA 3WNMA 5KHGA 5DN2A 2Y6HA 1WA6X 4FAGA 3ZXKA 4AVTA 2JENA 2FDKA 2RR11 3O0VA 1G6NA 2B42B 2VM9A 2WUHA 4FPJA 4IV1C 4XOGA 3D4KA 1A34A 1U12A 3AZZA 4UAPA 3ZFFC 4ZXKA 2RS53 1QJX1 2GH2A 3I4IA 4V1PA 1UZ0A 2Y64A 2QVSB 2ZMKA 3PU8A 1W8WA 3JQWA 3GZUC 4QXCA 3NJZA 4A2UA 3O1VA 1Z78A 2PHXA 3KB5A 1UZZA 2V09A 3AP6A 4L8QA 4XE9A 4CCOA 3KD4A 1E57A 1LOEA 4YM1A 5CIRA 3DKWA 1D7PM 1AYN1 1VRBA 4JGYC 5LBFA 5F2WA 1ZBA2 3VBSC 4IE7A 2JDYA 4NRMA 4ZZ5A 3K46A 2Z5WA 5CG8A 3DPRC 4NHKA 1AL23 1T6BX 2VU9A 3T3YA 1W8NA 5AFBA 1W8TA 1IG0A 1F4HA 1KFXL 3JZVA 4M4PA 4Q4X2 1O4TA 2WZR2 4XQWA 4LO6B 2C24A 5C6CA 3ZYGA 2XBO1 3RSJA 1VBA2 3M70A 3OGSA 3ELNA 4KH9A 4Q0UA 4QU2A 4X8NA 3WVJA 3NL1A 2XMLA 4CDWA 3D0SA 2PFWA 1VIWB 2RJKA 1RJ7A 1KFUL 3LPGA 3OJBA 1LODA 4AFCA 4DXRA 1I3HA 2HWD3 2QQMA 2WAAA 2CWSA 2VPVA 2QQJA 3MIDA 1H30A 3VBSB 4BMBA 2WNVC 1S55A 2R043 4IV3A 3AB0A 1CPNA 1IS4A 4QQ2A 5ERLA 2W52A 3I3MA 4NIHA 5J7MA 1GWKA 2GC3A 1KS4A 1QJY2 2DUOA 1RUG3 5LEJA 2R6QA 3AMPA 4MGYE 4FT8A 5T5JA 1UZYA 2OZ6A 4CP1A 4YVWB 5A6YA 1ULOA 2ZX1A 3U07A 3B02A 4AI1A 2W39A 1S4CA 3NRUA 5J1XA 1ALYA 1MZ5A 1WMEA 1XE8A 2LTNA 2PLV1 4EN0A 4EN6B 2E6VA 3M3OA 2KR2A 3V56A 3WXPA 3PUQA 4M01A 3RZMA 1O4ZA 3ON7A 4B29A 3ZDVA 3AMQA 3I3EA 4LLOA 1W8OA 2HJIA 3I2DA 3KMHA 2UY9A 4Y20B 4NHLA 4I09A 1TZOA 4DY5A 2JWPA 1O6UA 4NR1A 3AP9A 5E1RA 4LTAA 5A7OA 3ZN4A 2AREA 4OCTA 1GOFA 2ZGUA 1L3JA 4CDQB 1YUDA 1WD4A 1ZBA1 1PVC3 5FY0A 4GD4A 3KQ4B 1FATA 1JXNA 4EN9B 1TMF1 1W2TA 1QJU2 4QX2A 3JQXA 1OMIA 5JLVA 1WGPA 3DUIA 3E5QA 4BQ4A 1C5HA 5JXJA 3LF7A 4JKLA 2CNAA 3LPFA 2WS92 3OEBA 5AC93 1W2AX 3HEIA 1B35C 1W39A 4NHXA 5F8PA 5FY5A 3UGGA 3HOBA 3AP7A 4NROA 2ZHLA 2CTVA 2PLV2 1KD7A 2YC4A 3AX4A 2E53A 3NV1A 4M3CB 4YNIA 5FZEA 3KS7A 1VAVA 3EYPA 5FBJA 5CB7A 2IUWA 5IWFA 4Q4W2 2BGOA 4MGSA 2CY6A 5FO9B 2ORXA 2ZGMA 1XNAA 3VBRA 1AR61 1NLSA 1UOJA 4E4HA 4Q27A 4Z2AA 3PUHA 3SH5A 3TEXA 1UU5A 1QJY1 3P3PA 1RYYA 5DAPA 2BTVC 1PX3A 3ZPOA 2BBAA 4B4QA 5JXGA 3RRDA 2ZKLA 4I30A 3TEWA 2VOWA 5LEKA 2VNRA 2JB4A 3Q8AA 4MGQA 1JOJA 1V00A 5IAXA 4NVPA 1QU0A 2ILMA 3MGUA 3AYCA 1CJDA 2B45X 5HCFA 1ZBE3 3DV8A 1LAJA 1BBT3 1JZ3A 1WA4A 1NYWA 5C4WA 2NN8A 3RJ2X 3QCWA 4TZDA 1LOGA 1LOFA 5F37A 1XQNA 4JKMA 3VDDC 4HFSA 2WNOA 1K3IA 3F95A 3JD73 2QCSB 1UYPA 5A3WA 4MGKE 3IDEA 1OQDA 1J3RA 3LQCA 4HONA 4RL7A 2CDPA 2BNMA 2VG9A 4UI9L 5KXBA 3M3QA 3HQUA 2PYTA 2VQAA 3AZVA 2BWAA 4QKDA 4ONUA 2Z2SB 4ES9A 3CMGA 4LBQA 3HWJA 4LOTA 3PU3A 4MVTA 2OXBA 3N36A 4WVMB 1ENRA 4ET7A 2GN3A 4MYEA 3KM5A 4YFWA 3UJQA 5JPNB 1LU2A 4B7KA 1QOSA 3FWEA 4BCUA 1O8PA 4QPGA 5HBAA 3T0DA 3GBFA 3N7JA 5FYVA 4COZA 1DQ2A 1J1LA 4LBQD 4PDWA 4YGDA 4HXCA 1D2SA 4Z2WA 1YEWA 4QPGC 3FL7A 3VBHA 2HWB3 3MI8A 4H7LA 2QTWB 4KL1A 2O14A 5J48A 4IL7A 3RZHA 1SMVA 4PLNA 4IV3C 1E5HA 4XQ4A 1D4M3 2K46A 2EIEA 4CDQC 4I3GA 4GKYA 1BVP1 5H9QA 5LBCA 1QOTA 5JZGB 1FPN1 4FBFA 3WNOA 2DVBA 1IQAA 2AUYA 4CDWC 4DIQA 2G4IA 1HXS3 3KCXA 2XQXA 3SH3A 2Y6GA 4CSWA 4JAAA 4WVWA 4CEYB 3I2OA 1AXKA 2JE7A 3AC0A 4FTSA 1OA4A 1NCRA 2NQYA 3PTRB 1NUKA 1R092 4IEXA 3R4UA 3W9AA 1KDMA 2YV8A 4N53B 4GJZA 4NIAA 3PIGA 1K5MB 2XDVA 1JS9A 1QJU1 4GULA 4WVMA 4OHZA 4JZRA 2VNGA 3DPRA 2D3RA 4LHKA 2FMDA 3B5LB 2XLFA 3MEPA 1TNRA 2BOIA 4RSUA 4AVCA 5BXXA 3KV4A 3OD0A 3P1IA 5KHIA 2DTWA 2W95A 3H1WA 3LIHA 3MIFA 1DZRA 3HQXA 1FYUA 2ZGSA 1J58A 4H3WA 4Y5SA 4AGVA 4BIFA 4NWWA 1JH5A 2WSUA 4COWA 2CGNA 2RM21 3N9LA 2GC0A 4CDQA 3OBZA 4AGGA 2XVLA 3TEYA 5F3GA 1CR7A 3ZDSA 1S0GA 4DFSA 4XAEA 1I5ZA 3J9SA 2XJUA 1Y43B 2UURA 2BYVE 1VE0A 5I8TA 1ASJ1 1DGWA 2WJSA 4LLFA 2VUJA 4BPZA 2DDUA 1V70A 4AVAA 2HKXA 2ZTNA 4ES8A 3RDIA 1HRV3 4QB6A 2DF7A 1MQTA 2P1BA 4GWNA 5A7WA 1QKQA 2YUEA 3WCRA 3JCIA 3HT2A 1F2NA 3O1RA 3WW4A 2QQUA 4XZPA 3ZKUA 3A4UA 4GIQA 1PO21 1V9U1 4I3PA 3SKJE 1JYNA 1OOPA 4YZ4A 1O3RA 2VZ1A 5IAVA 1QQP2 4W6WA 1GR3A 3PHMA 1W2NA 4Z07A 2VGDA 2WS91 4OZOA 4CUGA 5CFDC 1BVVA 1CIYA 2OYZA 2OUJA 3TNPB 4Q8KA 2CGOA 5FPLA 1V6OA 4M0NA 1KS5A 1R091 5IW0A 4WM7A 2E51A 1BYHA 1ZRRA 3ALQA 3E5XA 4AHYA 1HXS2 1VPHA 5DAXA 4EQVA 1Q3EA 1RC6A 1QH7A 2JG9A 1JZ4A 2GNDA 5BNNC 3VBUA 2RDQA 1S0CA 3K75B 3CBNA 1OUSA 2Y34A 4QPWA 2FDIA 2RMU1 3O12A 5CU1A 5FY1A 4P9LA 3H8RA 4YW1A 4JHTA 4UF0A 1ND2B 1WW6A 2AEYA 3BALA 1FV2A 1H8TB 1YCIA 3MIBA 1KITA 5FYUA 3H1MA 4XF9A 5ANQA 4MO3M 1UAIA 1PNGA 3RI9A 1HQLA 1GNYA 3V0AA 1HB4A 4EJRA 2PHFA 2RR12 4FFFA 4XCAA 4GQ7A 3LEKA 4IE0A 1RVF2 4QPYA 1WUVA 4YVSB 2ZHKA 1WD3A 4YW3A 1UY3A 2FQPA 4FOQA 3PLQA 4WM7B 1R64A 3POSA 2BRTA 2V72A 1OSGA 5J09A 1ZRFA 3A23A 3J7LA 3K77A 1FNYA 5LRSA 2Q1MA 3ACHA 1O4YA 1UMZA 3KV9A 2P6HA 4K8FA 1AR72 5E8AA 3ILFA 2DURA 4AW7A 2H6CA 4XURA 5GZCA 1YFWA 2WZ8A 2R0FA 4Z8BA 5A7PA 4JQTA 3ROUA 1H8TA 2YC0A 1NZCA 1JI6A 2Y0OA 4D8MA 4AVBA 4PQQA 1QH6A 4LPLA 5EYYA 3U14A 3WOGA 4AI9A 3HR9A 2A3XA 5F3CA 2OIIA 5DMYA 4OVEA 4PLOA 2G9ZA 1GOHA 1REEA 5I0DA 4QX1A 1XNTA 5FZOB 1K5JA 5BYNA 4ZS2A 1LEMA 1GMMA 1JZ2A 3CU7A 2P6CA 3F2ZA 2P37A 3DPRB 2YPDA 2JDUA 2ZX3A 2ZGRA 1HB2A 2ZEWA 3KVBA 3POEA 2VE1A 1OLQA 5JVVA 3T2TA 4CP9B 2Q8DA 1US3A 3AM2A 2R30A 5FY8A 4X6RB 5TSWA 3VDCA 3LCPA 2JB8A 2PELA 2Q0AA 3TYJA 4LITA 1EV12 1MQTC 1XJAA 1LNSA 2IVIB 3Q8FA 1W04A 1VBC3 2JD9A 4YWAA 3BTZA 5JI7A 4XXPA 4FPEA 1C57A 4YG6A 2XWBB 3LFMA 1S0FA 3KWVA 4JQRA 2HWE3 4QX8A 1JOPA 1YFYA 3QLQA 3UYJA 5F32A 5GZEA 4EN8B 1M06G 2JDAA 4WV8A 3O1TA 5D1IA 4GB31 5G05L 5FZAA 4XUTA 4CCCA 3RZGA 4NO4A 1F9KA 1LOCA 1VRH3 1ENSA 3O14A 3WEZA 3MW3A 4FOVA 3RJRA 1WMFA 1SBEA 1AYM2 3HD8B 5FUPA 2WWUA 2GC2A 1LJ7A 5T50A 3WW1A 1AYN2 4ZU5A 2MEV2 1ZZ6A 4MZUA 2UY8A 3AP5A 4XJWA 3VBFB 1UX7A 1TG7A 5CFCC 1YJKA 4DRVA 1VB4A 4XJZA 4JGYA 3MBWA 5FZDA 1MS1A 1OA3A 3D0JA 5ACA3 5K0UC 4HK9A 2WA4A 2BU9A 5C71A 5FCCA 4SLIA 1Z0HA 1VRH1 3X29B 1POQA 1M4WA 4NOTA 1FX5A 5GLTA 3LEGA 1G9AA 1RUE3 4Z92B 2D6NA 5DUXA 1RUI1 3VD4A 5FYIA 4XFGA 3FLPA 1Q8PA 1LENA 1VB2A 2PHUA 1IHMA 5KHJA 1SFPA 1ZZ9A 3NJVA 5JDBA 4YG3A 3BOPA 2D93A 2ZZQA 1LOBA 3HN1A 2DTYA 2YC2A 5LZ6A 4CEWB 4OULA 4M3CA 4QHBA 1UPSA 2QJVA 2DVDA 1V6MA 3APBA 3JXSA 4JDNA 2CL2A 4JKKA 4RQPC 2QQVA 2AACA 2WBKA 1JZ5A 1YQ6A 1BQPA 4EZHA 3BGAA 4K40A 3MUZ1 1X9TA 3PVEA 5HXMA 3S5AA 4CP0A 2DBNA 4AZZA 3OY8A 1EUTA 5CKNA 2Z69A 3BODA 5FZ7A 1MZEA 2D97A 4IXLA 5A33B 1MR5A 3H3LA 1JW6A 1QY4A 4I02A 3VD3A 2CHHA 1B09A 1J3QA 4QU1A 2ZAHA 5FOBB 1QJEA 1JYCA 2Y6JA 3VKFC 3AL6A 1OF4A 3GM8A 5FXVA 1SLLA 2VTFA 4K20A 4GMP1 1UWWA 3HVDA 1TEIA 1WLWA 2CU5A 3KHBA 1AHSA 2PHRA 3RFRA 4B4RA 2OX0A 2A6VA 1W0NA 2QUOA 3MLJA 4JTOA 3IWZA 4AI0A 4RFRB 3J7MA 5JUVA 2XR4A 2R041 3VKMA 2XL7A
chains in the Genus database with same CATH topology
2D43A 1DFQA 2EXKA 2EXHA 2EVXA 3WDVA 2WSVA 3GZAA 3NWKA 3QBQA 2ZMNA 2GU9A 1RUG1 4IEOA 2PAEA 4Z1VA 3AP4A 2D3SA 3MPBA 5K0UB 3J8F1 4IEUA 4N9IA 4YM2A 1N3PA 3PVNA 4YM0A 3WW2A 3D8CA 3N7LA 4LE3A 2JEMA 3ZN6B 3VBFC 4WM7C 2CWMA 3TAYA 1R1A2 1YI9A 1S0JA 3N35A 5C8CB 4YGCA 4AHXA 4CZSA 1VBC1 4D3WA 1B35A 4LE4A 1MEC1 1N1SA 1OKQA 4FCAA 1PMIA 3HBZA 5JOZA 3VZMA 1AYM1 3VBUC 3TN91 1VBD1 1JBCA 4RR3A 3HT1A 3RMXA 2X5IA 4XYXA 2YY1A 1DG6A 1AR93 1DZQA 2O8QA 1ULDA 4RS5B 3OCPA 1EV13 3B69A 3V65A 4QX5A 2QFEA 1GZCA 4YRDA 1YIFA 4FOYA 1NCQA 4KU8A 4M3CE 4FTBA 1EPZA 2R042 1AR63 1XNCA 2UWAA 5K7PA 1G8WA 2WZPP 2XJPA 4U2AA 5C8CA 1NY72 4OUMA 4JGZB 2I74A 1RUJ3 2JE9A 3FBMA 1S0EA 1VBA1 1WW4A 2VMIA 4MGZE 1H0BA 4R9AA 1XYPA 3R0RA 3OYWB 4OI4A 1AYM3 1LRHA 4J1XA 1LGNA 2DCKA 1RL3A 3G6JB 2WNVA 1GFF2 2AR6A 4LO4B 4UBGA 3ZXDA 4D7SA 5I91A 4BLIA 5DDJ3 5BNPC 1TME3 3DN7A 4MUVA 4E4ZA 1RIRA 4CEWA 1LHNA 3LA3A 5T5OA 3U11A 4CDUC 4E27A 1AR91 1W6MA 4KWJA 2DYCA 1RMU1 4TWTA 2RS31 3MPPG 4IETA 3FFQA 3VUOA 2ZKNA 2Q5TA 2WQ4A 2R062 1WBLA 1BJQA 5FLHA 3V0BB 2ZGQA 2PAMA 3A0NA 4JRAA 3WT3A 3UKTA 1W0PA 4LO7A 4GB32 1RUOA 1NA1A 2TNFA 1QXPA 4XF0A 2ET1A 5ABJC 5F6LB 1SLTA 4C1WA 2BNNA 1AL22 4TYSA 5DDJ1 4I2OA 1TMF3 4IV1A 2IXIA 2GNMA 1X8EA 3R4SA 1NXMA 1H8TC 4AQ6A 1JUHA 2ATFA 2BNOA 4S2DA 5KXEA 4DS0A 2X29A 4LBNA 1LOFC 1RVF1 4OUSA 1TME1 2HWC1 3ZFEA 1ZX5A 4YGBA 3ZMOA 1H9PA 2DV9A 4YARA 3D82A 4XTMA 1RUI3 1AXYA 4LT5A 4P9WA 3IPVA 5EFUA 1PVXA 4RHV2 4AFDA 1AF9A 1UPIA 5JSRA 4Q4X1 1WLTA 1RJ8A 1NG0A 3H0OA 3N7MA 2ZX2A 2IXJA 2D6KA 3SHRA 3WR0A 1QMJA 1LU1A 1VBD2 2IXCA 3O5SA 3VDDA 1H4GA 4IERA 2CGPA 5FRAA 2FHRA 1RMU2 4QMAA 5A32A 2H6BA 2W68A 2E7QA 3FLTA 1LEDA 2JD4A 5HCBA 1QF3A 3SCGA 3TNQA 3M2MA 4RGGA 3VKLA 1CAUB 2Z42A 4YZ2A 2D44A 2D6MA 2HWB2 4AEDA 1R1A3 4A7KA 3U0ZA 1K5MC 2ES3A 3S0MA 4IEYA 2BFUS 3WZ1A 1EAH3 2BQPA 4AYUA 1YI7A 5HXVA 1GICA 2B39A 2XVGA 2JECA 2RE9A 5GJ6A 1Z7S3 4CEYC 4F8AA 1AVBA 1RITA 1PK6B 2KA3A 4L11A 3WHTA 2OZJA 1PVC1 1Q8OA 1CAWB 1HRI2 2FMYA 3KZ4C 3NV3A 5I0UA 2GMPA 5CFDA 2DFBA 2MNGA 4XMIA 1IS6A 2VOKA 1TE1B 4RR3C 3VHOA 4E2QA 1X50A 2IFWA 4QQPA 1NQDA 2PA7A 4P9JA 1QXJA 5LK5A 3IDCB 3WP3A 2VMHA 4UBHA 5JZGA 2VH9A 1EAH1 1OI6A 4DXZA 4K1ZA 1KJLA 4BWOA 3E6BA 2XL9A 4Q8LA 1WBFA 2DCZA 1HKDA 1BEV3 4JCKA 5H9PA 1SCSA 4JDMA 1SDWA 4Y26A 5AC92 1Q5OA 4IEZA 4XBQA 4ZU4A 3NO8A 4N43C 3LAGA 3PVBB 4JGYB 5FOJB 5C33A 5C9AA 3ZXGA 1XU1A 4X8PA 1U5ZA 3V0BA 4JTNA 4COVA 1HRI3 3WDWA 4AEKA 1UKRA 4DNYA 2CV6A 1DQ1A 3B94A 1XNKA 3FC0A 1CQ9A 1YNAA 5DXDA 1LESA 5KXCA 4QQOA 3P3NA 4HZFA 1QQP3 4OI1A 1N1TA 2P17A 4P5HA 4PQ9A 2ZCWA 1W0OA 5GM0A 2W08A 3ZXAC 1DQ4A 2EA7A 4LO5B 4BOWA 1O3TA 3IN9A 1REDA 4BQ1A 4CEWC 4K6BA 4DQAA 3O0WA 3N3HA 1ASJ3 4ZKTB 2QQPA 2YGLA 3VBOA 2BW8A 1FV3A 4IEVA 4Y1YA 4Y20A 2A6YA 3E97A 2ZGPA 2XUMA 5GZDA 4LNVA 4ITCA 1YLLA 3DGTA 2R073 4H55A 1QDCA 4G3YC 4WM8C 1DQ5A 1ZRCA 3NW4A 3FLRA 4Y5Z0 2VVEA 3OGGA 3MFAA 2ZZJA 1C3HA 1A78A 4F3JA 3CJIB 4I0BA 2VW2A 2R1BA 5IT6A 1LCLA 1RMU3 3A0KA 4QT6A 4N90A 1AX1A 2HWB1 1OFNA 1WCDJ 5I0RA 1QJU3 1FOD3 4FPGA 3MYXA 1CAUA 2A75A 4L97A 2R071 3VZOA 3KT4A 1REFA 2A3YA 2VULA 1MS9A 1SFNA 3FUOA 3M3IA 4K3UA 1ZZ7A 5K0UA 1PIV1 5JOWA 2X53S 1PO22 3GBWA 4S2GA 5JOXA 2H0BA 4CDXB 1LHVA 1H8VA 1HV1A 1HW5A 2R0HA 3AYAA 2E9QA 4XJUA 4Q0QA 1ZZBA 3B3QE 1VBE2 4AVVA 1F5FA 5SV8A 1H1MA 4YLZA 2A6WA 1EP0A 3WP5A 1RHI1 2GALA 2YPJA 4FOWA 4Q4Y1 4D7YA 4FVVA 1OLRA 2G9GA 3WG1A 2RM23 1TME2 2RS12 2ZGNA 5EWSA 1RUC3 1UF2C 5C8CC 5CNAA 1U5XA 3WP6A 3CLPA 2IC1A 1ZYBA 4TLFA 3PMSA 1FMD2 4LBQB 4RS5A 4YYOA 3PJQA 3JD72 1GSLA 1GZWA 3HAGA 1PO12 4I01A 3QOPA 4CP2A 5CFCB 3LSEA 2DUPA 5SV5A 1PGSA 1XRUA 3AXDA 3GALA 2HWE2 1AXZA 1HLCA 3NKTA 3H9AA 4INDA 1JHNA 3SCHA 1G9BA 3OD4A 4AWDA 4J6GA 3ZSLA 5CA6A 2XGXA 4DY3A 3ST7A 4JV4A 5KC6A 4M0HA 2XG3A 1SFYA 1RINA 3OGJA 3WHUA 5CAZA 3ATGA 4QPGB 3QD6A 5T52A 4FPLA 1AR92 3GZTB 4BA6A 1PZ9A 4CYDA 1CAVB 1OPOA 2ZHNA 3GBGA 1A3KA 3WW3A 2ZAAA 2BGCA 4OHWA 3VBFA 2WLQA 2HWC2 2TEPA 2XVKA 3R6SA 4Q0SA 4CEYA 1SLBA 4DMIA 5BNQA 1Z7S1 3ZSJA 2LUWA 3S7IA 1YIPA 3MICA 1COV3 4AFAA 1K5MA 1APNA 2UWBA 2EXJA 2D6LX 2SLIA 3TRSB 3ZYPA 1CGPA 5F1RA 1WLCA 4N53C 1C28A 5AVAA 4GMP0 5A3LA 3O7OA 4OHYA 4LUKA 4L2NA 4GKXA 2VW1A 2Y38A 3QH6A 2DU1A 4ASMB 1DQ0A 1WW7A 1BEV1 3AKQA 2A6XA 4GXLA 3S30A 2R063 4FPFA 4JGZC 4DOUA 1HQWA 1RTVA 2A7AA 2AH2A 1UU4A 4AF9A 2NMOA 3UK9A 2P3KA 4YVWA 1RUF1 2NLRA 5FLIA 5GALA 4YZ3A 3IDBB 4IEQA 4UW5A 4KQ7A 2VOXA 4XBLA 1VRH2 5DUVA 4BM8A 5GZGA 2JG9B 4PDWC 5CVRA 4FQZA 3NAPB 1FOD2 4YVWC 1PO11 3OPZA 5IK4A 2EF6A 4QGNA 4RQPB 5FLJA 2DVAA 3RYPA 1DYKA 3MDPA 4BYYA 4KGGA 3PMEA 2RMU2 4Y1VA 4MV2A 3BTAA 5BNNB 1F31A 2RS13 2G9FA 4Q4V2 4HT1T 1X82A 3M3CA 1QJX3 3L2HA 1BXHA 2XJTA 3LOIA 2Q8OA 3VBUB 1HIXA 2E63A 1POV1 2N7GA 1SQ4A 3B01A 5CFCA 1PO13 1RUF3 4S2HA 3S7EA 3ZN6A 4P9YA 1NOVA 5EZWA 4D69A 1CAWA 1O7FA 1FPN2 3CF6E 5CFDB 5FAXA 4XIKA 3NAPA 4Q0VA 3H7JA 3FBYA 3ZSEA 5JOYA 1B35B 4P9IA 1W6NB 3LSDA 5BNPA 2ZGLA 4WVZA 5BY5A 1RUD2 1RUE1 2XBO3 3EO6A 1X7NA 2W0XA 1BK1A 3T1MA 5JSPA 2CAUA 5DZFA 2JG8A 4E4DX 4PBPA 4E4SA 2HWD1 4XW3A 1SEFA 4AEJA 3GF6A 5BV6A 1ULFA 2ENRA 1BKZA 3JB4C 2FZ1A 1CAXA 2BUKA 3ZYRA 1I6XA 1YXWA 2CAVA 1W6QA 3NVCA 3VKOA 1Z7S2 2B8MA 3J8F2 5F5QA 3RMYA 1DBNA 4XTPA 2HWC3 3ACLA 1W6PA 1N3QA 4GA9A 4Q0PA 1S0BA 3ES4A 2JG9C 4PDWB 1DGWX 4W65A 4GMP3 1JYIA 3CL1A 3LA2A 3AMMA 4ZU7A 4CDXC 1W6NA 2XJRA 1GNZA 2KXLA 4YM3A 2RMU3 5F6KA 2BVVA 3E6DA 1SCRA 2BVBA 1HDKA 5KBFA 1KXGA 2XJSA 4AXOA 4LO8A 2I2SA 2WT0A 1NLRA 1MZ6A 4Q2FA 2LALA 2WFF2 3AJYA 5J36A 1LB2A 2VOVA 1Q8VA 4PIXA 4CTEA 3OF1A 5T5LA 3ES1A 4PF5A 3W58A 4E2SA 1MS8A 2WWSA 3J8F3 5D8AB 1T6GC 4FXKB 1LGCA 3ILRA 3THTA 4IEPA 4RD7A 4OLLA 5KXDA 2HWD2 1D4VB 4LBJA 1PNFA 3WQ1A 3K48A 2JKBA 3CJXA 1TMF2 4LBMA 5EJ3A 1X33A 1NA1B 3WY6A 1GKBA 2TBVA 1QJY3 3R4DB 4KU7A 1CX4A 4GH4C 1RUI2 1UU6A 2GSYA 3RG0A 3VL9A 3WV6A 4FQ4A 1OQEA 4KNCA 4Q4Y2 2OA2A 4HN0A 1ND3C 1AX0A 1QXRA 2WIIB 3ETQA 3TN93 4BLJA 1G7YA 2RS52 4JC1A 4FSJA 2VVDA 2GN7A 3KCCA 3VBSA 1ONAA 2Q30A 4HVRA 1MVEA 2E7TA 2D5FA 1OOPB 4ASLA 3KGZA 4NN0A 3OY8B 3ENRA 4XFAA 4Y1UA 3KCYA 4AFMA 3FFZA 4N43B 1XE7A 1Y7BA 4I0AA 4QM9A 4R4XA 3DL3A 3LGRA 4LR4A 3VN4A 4Q29A 3AJZA 5A3MA 4FP3A 2XPJA 2OUHA 5T55A 3LKJA 5C8WA 4UXAA 1IZ3A 5DZEA 4KBBA 5BNPB 1ZREA 3VZKA 1ULCA 2HWF3 5FBZA 5I8SA 4C91A 1EAH2 5J98B 1PZ7A 1CESA 4G9SB 4XXAA 4XF4A 4XETA 3ZO0B 1ZBE2 2YHJA 1CN1A 1DF0A 2PAKA 3JU9A 1O3SA 2EXIA 1AR71 4MGIE 1KDKA 1S2BA 3VBRB 5GLUA 3IMNA 1G86A 1XYOA 1VAKA 4HANA 4K1YA 3V0AB 4XJ9A 1W6OB 1X8MA 2WZR3 1BMV1 3EBRA 1Y3TA 3GHMA 3SH4A 4J1WA 1PZ8A 1PGL2 1VBE3 4AE2A 5E88A 4GH4A 5ABJB 3PTYA 1AYN3 1WMDA 2DFCA 5JAXA 1YHFA 3U10A 1AUYA 3N7KA 3WP4A 1Y9QA 4HPKA 1ULGA 3RYRA 3B93A 1ZRDA 2K2SA 1C8M1 4O9EA 2DCJA 1DU3D 3SMHA 1CAVA 4YSFA 1ND2C 2H0VA 1IKPA 2D7FA 5GLWA 2GAUA 1GNHA 4QQHA 3SITA 4CDUB 3CO2A 5J37A 2O0OA 3WQ7A 4AK3A 4ISQA 1R082 2MHFA 1IKQA 2WQZC 2WZR1 3NKGA 1VBE1 4EV0A 1HRV1 1MS4A 4AI8A 3ZMNA 4JGZA 4MXVA 1RUC2 2ZGOA 3ZXLA 4YW2A 4OZXA 5FFOC 2V73A 1ZZCA 3AMHA 4HPKB 4QGMA 2RS32 4E2GA 3I59A 4COUA 2DWRA 2Y26A 2WS93 2R16A 1C8M3 3H3ZA 3POWA 4C0HA 4DZGA 1ASJ2 1BCXA 3ZXEA 1DIWA 4YFZA 4AEDC 5F9TA 1VBC2 1QJX2 4KG0A 4G4FA 1D0HA 3JBG3 3ILNA 3JB8A 2AENA 1ZBA3 3I7DA 3WDTA 5H9SA 3ZIXA 2NM1A 3VBRC 2XKPA 4RA0A 4XFCA 1ND3B 2JG8C 2UWCA 3FJSA 1HX6A 1RUH2 2QZ2A 1SLCA 3FHIB 1GQHA 3Q9OA 3IBMA 3H7YA 1I9RA 2QE3A 2SBAA 2WT1A 3AZWA 1MACA 4Y4YA 4RFT0 3NAPC 2ZS6B 2WC2A 1ZBE1 1AJOA 2I07B 2R1DA 4NPRA 3SXWA 1VBB1 3FX3A 4FPCA 3SCFA 2ZABA 1HRV2 1V9U2 4F83A 3THPA 1LKNA 1COV2 3VL8A 3VZJA 4UW6A 5DUUA 1RB8G 4HKWA 3MW4A 5KWRA 3E6CC 2Q1ZB 4ORFA 5KHKA 3C2UA 3AKTA 1QJZA 2BWCA 3JBG1 4D7TA 4N7IA 1UL9A 3VKNA 4AQTA 4BZ4A 1CJPA 2JDZA 3RQ0A 1JN2P 2OW4A 2XJQA 4GWMA 1PIV2 1XXNA 1VJ2A 4MX3A 2AGSA 3WUDA 2VUAA 1LHOA 2FZ2A 4UW3A 5LK7B 1H2KA 1F5JA 2EIGA 5IUQA 1DDLA 2OVUA 1VBB3 5GZFA 1MZFA 1YFUA 4RS5C 3WD5A 2XKOA 2DU0A 3MF6A 5K9YA 3N4MA 4KWKA 4FPHA 2PN5A 1IS5A 3LA7A 2D40A 5L7OC 2RS51 3G7DA 1CVNA 4MLOA 5GLZA 1RUJ1 1G9DA 5EXOA 3RPQA 4JVAA 2XJVA 1HRI1 5A33A 1LHWA 5EYXA 2QZ3A 1RUH1 1AZDA 4EWEA 1ZVFA 4YVSC 2NPIA 4MXWB 4BH9A 2CYFA 5FQ0B 1IGOA 1C4RA 2R072 2QKDA 4C90A 4MH0E 4EWAA 4YG0A 1RUF2 4A3XA 1AL21 1GZWB 1HXS1 2K9ZA 5JMCA 3ZPYA 4YVSA 2WINB 2QDRA 4QXKA 3ZFGC 1UCXA 4XILA 2HWF1 2YMZA 3KQRA 5BUVA 3E5UA 4P14A 3HIFA 1CIWA 4HKLA 1UX6A 3EQEA 3OTFA 5IK7A 3AK0A 5DG1A 1Q56A 5C4WB 5HI0A 3GYDA 4HMZA 3TWIA 4CRQA 5DZGA 1FOD1 2A3WA 1V6NA 5DUWA 3WX5A 4K9SA 1Q8SA 1EY2A 5FO8B 3MFCA 3B00A 3KT1A 3C3VA 1PGW2 3KT7A 1PIV3 4Z82A 4LA2A 1MVQA 4KG8A 3BOWA 3VZLA 3LWCA 2QDNA 3D5OA 1BZWA 4DRRA 3ZIWA 1RUD3 1GZ9A 4RR3B 4B4PA 3VLBB 4NHMA 4QQLA 1FI2A 2MEV3 3ZFFB 1DHKB 4K7JA 3VBHB 1G9FA 2RJLA 1VALA 4R9DA 2WKKA 1PM7A 2XLAA 2GH8A 5ACA2 2E7AA 3K51A 1O5LA 3FUQA 3UJOA 2DUQA 1NCQB 5BPXA 4Y22B 2F4PA 5FDBA 3WINE 4O9GA 3WQ0A 2HEWF 1VAMA 3PJYA 3M7AA 1NCRB 4QPIA 4YW5A 1KQRA 3H50A 1RUD1 1RUE2 2D5HA 4FAHA 2VVFA 4N53A 5LRRA 1N1VA 2F6BA 3WNXA 2PHLA 1XU2A 1RUNA 1XNDA 2PHTA 1R093 2VXRA 3RNSA 5AVPA 4R9BA 2Q4SA 3PNAA 3EXUA 5T5PA 2B5HA 3UV9A 4ATEA 5FTTC 5JR7B 2WNVB 4XDQA 5C9AC 4XF3A 1MS3A 4N43A 2P34A 2V5YA 3ZFGB 5I0SA 1RUJ2 3OBRA 2IXHA 4XIOA 4PIYA 2A71A 4DINB 1HV0A 4HVOA 1LULA 1NY71 3GNEA 3MZHA 2HEVF 1DGRN 2ARXA 4IV1B 1H1AA 2DCYA 2YZ4A 2ERFA 2P2KA 4HVQA 4BE3A 5BNNA 1X36A 2GNTA 2VW0A 1J3PA 3IKWA 4LBOA 5GLVA 2WA3A 2ZPXA 2WNUC 4LUMA 4R4ZA 4LA3A 5J96B 1PGL1 2NYYA 1OPMA 3IPVB 4Y1XA 4IEWA 4CDXA 5L73A 1YYNA 3WG3A 1ENQA 1ENXA 1MQTB 3TN92 3AMNA 1EPWA 3B9IA 4GH4B 5ABJA 3ECQA 1MEC2 5L7OB 1C8M2 1QOOA 1RHI2 3M1HA 3ZYIB 1ND2A 1QNWA 2BPA2 1DZTA 3MLKA 1IPJA 5BNOC 4M00A 3QH7A 4QD2A 3WLUA 1D0GA 1D4M1 3JBG2 2BFUL 1IPKA 2ARBA 2YGMA 4DPNA 3IT8A 2K0GA 4BMEA 4XQDA 4WVVA 1UIKA 1ZNPA 1WLDA 2R061 2R49A 4LEJA 4EWDA 4U36A 2WT2A 4CDUA 4URTA 2VY0A 3RZZA 1HQNA 4D94A 1NQJA 4Y24A 3VHNA 1N3OA 3MIEA 3VZNA 5DG2A 3RI8A 2A73B 4IQPA 3VBHC 3ZFEC 5L7OA 1R1ZA 4H14A 4LULA 3NSTA 5KHHA 2ETEA 3I59B 2GMMA 2VNOA 1QNYA 3ZVXA 2YYOA 1WW5A 4Y22A 5JIUA 2LM3A 5T54A 1U5YA 3SISA 2C5DA 3I8TA 1QWRA 3MIGA 1S0IA 4HETA 4QPIB 1A8DA 2ZOEB 4HSLA 1CPMA 5T3NA 5I93A 1NA1C 4PIZA 2X8KA 1TQ5A 1ZZ8A 2UYBA 1GYKA 4TSVA 1G9CA 4LHLA 4AG4A 1AL0G 3WUCA 1C1FA 1DQ6A 3H8UA 3KLSA 5D8AA 5C4WC 4AQSA 1ND3A 2X5IC 3AZYA 4FP2A 4OI0A 4KWLA 4M3CF 3VBOC 2ZX0A 5JZGC 1J1TA 1BEV2 3AYEA 3TOJA 4R9CA 4AI2A 3I54A 4PBOA 1ULEA 1CONA 2NZ9A 3BCWA 1FXZA 3CNAA 1D2QA 4ISRA 4MSVA 3RS6A 1KRIA 5CBLA 4WZFA 1PHMA 1RUG2 1VR3A 4OHXA 1COV1 1PO23 2XWJB 5C9AB 1LR5A 3IM0A 4Q4X3 4BHPA 2UU8A 3BPZA 4L9BA 1KJRA 4GB33 1GLHA 5DDJ2 5JSOA 4XJAA 5JIAA 5FO7B 1W6MB 1R1A1