4JGYA

Crystal structure of human coxsackievirus a16 uncoating intermediate (space group p4232)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
236
structure length
228
Chain Sequence
NLIETRCVLNHHSTQETAIGNFFSRAGLVSIITMPTTGTQNTDGYVNWDIDLMGYAQLRRKCELFTYMRFDAEFTFVVAKPNGELVPQLLQYMYVPPGAPKPTSRDSFAWQTATNPSVFVKMTDPPAQVSVPFMSPASAYQWFYDGYPTDLDYGQCPNNMMGTFSIRTVGIEKSPHSITLRVYMRIKHVRAWIPRPLRNQPYLFKTNPNYKGNDIKCTSTSRDKITTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyprotein, capsid protein VP1
publication title Picornavirus uncoating intermediate captured in atomic detail.
pubmed doi rcsb
molecule tags Virus
total genus 33
structure length 228
sequence length 236
ec nomenclature
pdb deposition date 2013-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4jgyA00
4JGYA 1H8TB 1FPN3 1R091 2RMU2 1BEV3 2X5IC 4QPGA 1VBD3 1GFF2 2MEV1 2WZR2 4CEWB 2ZZQA 1EAH2 1RMU1 3DPRC 3J8F3 1QJZA 4FTSA 1RUG2 3ZFGC 1MQTC 1FMD2 4CEYA 2HWB3 5ACA3 5C8CA 1AL21 2R063 1VBB3 5DDJ1 1AR72 1VRH1 1OHFA 4YVSC 3ZFFB 5BNOA 4IV1C 4WM8A 5AC92 4Q4V3 2HWE3 2RS53 1COV2 4EJRA 4IV3C 4CEWC 1NCRB 4Q4X2 1QJU3 1PIV3 4FTEA 1RUH1 1VBE3 2HWF1 2RS13 4N53C 1EV12 2BFUS 1AR83 5C9AB 5J96B 4WM7B 1RUC2 1PGL1 2QQPA 3ZFFC 1FOD1 1RUI1 1PVC2 1R082 3VBRB 5D8AB 2XBO1 1POV0 2RMU3 4N43B 1NG0A 1ZBA1 2R071 1QJY2 2WS93 2RM22 1ND3B 1RUI2 2WZR3 1AR61 2FZ2A 1EAH3 5C9AC 4WM7C 5BNOC 1RHI1 1V9U1 1HX6A 2PLV1 4GMP0 4RQPA 1AR92 1RUJ2 2GSYA 1FMD3 3JB4C 1NA1B 2X5IA 1K5MB 1AR73 3VBHB 1RUF1 5D8AC 5K0UA 5AC93 1X33A 1RVF1 1PO21 1COV3 1ZBE2 2R042 3DPRA 2R061 2WFF2 4Q4X3 1AYN2 3VBFA 1MQTA 4AEDB 1RUE2 1BMV2 1HXS1 3NAPB 2TBVA 2HWE1 1PO22 1EV13 1NY72 1H8TA 1NA1C 1DDLA 3JD72 1RUC3 1VBA1 4Y5Z0 3VBHC 1VAKA 3JBG2 5A33B 4CEWA 5BNPB 1TME1 1TMF2 1HRV2 1PVC3 1AR81 1R083 1BBT2 3CJIB 4RQPC 4AEDC 4RR3B 1QJY3 2RM23 1SMVA 4Q4Y2 3ZFFA 1W39A 1Z7S1 2HWD2 1WCDJ 5K0UC 1AR93 1RUJ3 5BNPC 1R1A1 1MEC1 1R092 1ND2B 3VBFC 2MEV2 1RB8G 1Z7S2 1POV1 1VBC3 2BUKA 4RR3C 1RMU2 5C9AA 1H8TC 1R1A2 4WM7A 1D4M1 1ZBE3 2R043 4Y4YA 4RHV1 2WFF3 1C8M1 3ZXAC 1AYN3 3ZFEB 1E57A 1ASJ1 1RUE3 4GMP1 1AL22 5DDJ2 3TN91 1VRH2 4CDQB 3VBRA 5D8AA 4N43A 1ND2C 3JD73 4PDWB 4FTBA 2BPA2 3JBG3 5CFDB 5CFCB 1TMF3 2RS31 1RUH2 1QQP1 1HRV3 2HWF2 2HWC1 1AYM1 1BBT3 2RR11 1NCRC 1CJDA 2IZWA 1NA1A 3VBUB 1QJX1 1PGL2 1K5MA 4Q4Y3 3VBOB 3VDDB 1RUD1 3VBHA 1FOD2 4RS5B 4SBVA 4CDQC 4GB31 4PDWC 2HWD3 4Q4W1 1PO11 1HRI1 1M06G 5LK7B 1IHMA 5CFDC 5CFCC 1QJX2 2XBO2 1R093 1FPN1 1RUG3 1BEV1 1ZBA2 2R072 2DF7A 4AEDA 1VBD1 3VBSB 2MEV3 1OOPB 1AR62 1RMU3 3VBRC 1RHI2 1V9U2 1PGW1 4N43C 3J8F1 3VBOC 2PLV2 4RS5C 5A33A 5BNPA 2BBVA 1ND3C 2HWB1 5ACA1 1AL23 1VBC1 5DDJ3 1VBB1 1VRH3 1RUF2 3CJIA 4YVWB 5JZGB 4Q4V1 1RVF2 3VBSC 4RR3A 2RS51 5FMOL 5A32B 2R062 1K5MC 1QJU1 1PIV1 1VBB2 1RUH3 1VBE1 4GH4B 5ABJB 2HWF3 1HXS2 2RS11 3S6PA 2HWE2 4Z92B 1B35B 4LLFA 1ND2A 1VBA2 1NCQB 5FOJB 1FOD3 4YVWC 3NAPC 1TME2 1RUI3 1NOVA 5L7OB 1AR82 2XBO3 2RMU1 3ZFEA 1ZBA3 2R073 4CDXB 4GH4C 4NWWA 1NCRA 2ZTNA 2WS91 3ZFGB 2WZR1 1AR63 4JGZB 4CDQA 1EAH1 5C4WB 1RHI3 3CJIC 1V9U3 4PDWA 4CDWB 4YVSB 5BNNB 1NCQC 2ZAHA 4IV1B 2PLV3 1RUG1 1MEC2 2WS92 4CDUB 1FMD1 5CFDA 5CFCA 4IV3B 1VB4A 4NWVA 5L7OC 5J98B 1OPOA 1AR71 1RUF3 4CDXC 4N53B 3HAGA 5AC91 5FMOS 1RVF3 1PO23 4QPIB 1COV1 1F8VA 1D4M2 3VBUA 4JGYB 3JB8A 4JGZC 4RHV2 1C8M2 4Q4X1 3VDDA 4RS5A 3VBOA 1ASJ2 5C4WC 4CDWC 1ND3A 4QPGB 5BNNC 1HXS3 3TN92 4CDUC 1EV11 2VQ0A 1RUC1 1VBA3 3ZFEC 3IDEA 3VBSA 4FSJA 1OOPA 2FZ1A 4CEYB 1TME3 2RS32 5C8CB 1QQP2 4QPIC 2HWC2 1PVC1 5GKAC 1R081 4JGYC 1AYM2 5BNOB 4WM8B 2RR12 4QPGC 2WLPA 1QJY1 2RM21 1RUD2 4YVWA 5JZGA 1Z7S3 4GB32 3NAPA 4Q4W2 1PO12 1VB2A 1HRI2 1AR91 1RUJ1 3VBUC 4CEYC 1R1A3 5A32A 1MEC3 5C8CC 1X36A 1FPN2 3VDDC 1BEV2 4GH4A 5ABJA 1VBD2 4RFT0 1POV3 4WM8C 2Y26A 1B35A 1D4M3 1PGW2 1ZBE1 3J8F2 2R041 1NCQA 4RHV3 1C8M3 2WFF1 1AYN1 1ASJ3 3FBMA 2HWB2 1OOPC 5ACA2 1BMV1 1RUE1 4GMP3 1VBC2 1CD3G 3TN93 1A6CA 5L7OA 1NY71 2WWSA 4CDXA 4Q4V2 3JD71 2RS52 4RQPB 3ZFGA 1AL0G 3JBG1 1QJU2 4JGZA 1PIV2 2RS33 1TMF1 4BCUA 1QQP3 1HRV1 1VBE2 5C4WA 2X5IB 3LOBA 2HWC3 5JZGC 2RS12 4CDWA 4YVSA 5BNNA 4IV1A 1AYM3 1BBT1 5K0UB 2RR13 3M8LA 4CDUA 4IV3A 1C8NA 1QJX3 2BFUL 3DPRB 1F2NA 4Q4Y1 5ABJC 1RUD3 3VBFB 1AUYA 1HQNA 2XPJA 4GB33 1MQTB 4N53A 2HWD1 4Q4W3 1PO13 2GH8A 4QPIA 1HRI3 1B35C
chains in the Genus database with same CATH superfamily
3N9OA 5JDBA 2X29A 4FPCA 5C7GA 4A44A 3AP6A 1U5XA 2IWGB 3K4AA 3NKGA 4JHZA 3USUB 2VNOA 4N7UA 4KH9A 2NPIA 1US3A 2J1EA 2ZZQA 3KF3A 1WW5A 5GJ6A 2RDSA 1E5HA 2XKOA 5DAXA 2QDRA 3J8F3 2GH2A 5IW0A 3O1OA 4E27A 2HEWF 1H4HA 3I2GA 3VB9A 3ZFGC 4OUEA 5E16A 1EYBA 3GBGA 1GU3A 3E5XA 4KWUA 5F2WA 4CEYA 5C8CA 2OQ6A 3PJQA 4QDQA 1AL21 2R063 3ZXGA 5A70A 4YGCA 5HV4A 4PLNA 1IZ3A 4N8MA 1AR72 5K8SA 2DFCA 1VRH1 3I4IA 5A1AA 3WW1A 2Y6HA 4WVMA 3ZYGA 3QD6A 3IT8A 5DG1A 2GC0A 4Q4V3 3T0DA 1LTEA 4XF0A 1NX9A 2HWE3 4AFBA 2E7TA 4I02A 2D97A 1W6QB 5A7NA 1QOTA 4PIYA 4Z07A 3ZN4A 4BK5A 4CYDA 1KS4A 4Y3OA 5GLWA 2I07B 1CESA 5K7PA 4Q0SA 2JG9A 3FUOA 5B4XA 3NNJA 3D6EA 5CKQA 1WCKA 2A6VA 4Q29A 1FAYA 1VBE3 1QXRA 2UYBA 4D8MA 2HWF1 3U78A 4RGAA 1LCLA 4OVEA 2VUJA 2E32A 5FV3A 2GNDA 2VTFA 5FZ4A 3WW4A 1WCSA 1CAVA 1SPPA 5J96B 2D6LX 4RYDA 1LEMA 2YBPA 1RUC2 3IAQA 2R1BA 2R0FA 5KHIA 1PGL1 2QQPA 1O3RA 3ACLA 2MHFA 2CAUA 5A6YA 3ACGA 1X9TA 2D6KA 3THCA 1NE4A 2O8QA 3P5BA 1MS0A 4FPGA 3T2QA 3MPPG 5I0DA 1UZWA 3J4UH 5LK5A 1DG6A 2FCUA 3V56A 5CVRA 4BISA 3MIEA 2HEVF 3N9QA 3KVAA 4AAXA 1PNFA 3IDCB 2R32A 3MW2A 4CCJA 3DYOA 4LKEA 3VZMA 1OQ1A 1UF2C 3O1MA 5FWJA 3VBRB 1K42A 2XBO1 1POV0 1C5IA 4KL1A 3RJRA 1NG0A 1ZBA1 1I9RA 2W46A 3HMYA 5KR7A 2E33A 3WOGA 2QQKA 1WW6A 4P9LA 1GZ9A 4OI4A 1GYKA 5J7MA 4TXWA 4MYEA 1EAH3 2PXJA 3M4FA 4WM7C 5BNOC 1V9U1 3J7HA 3I2JA 4BZ4A 4RA0A 5TSWA 1LHNA 4XJWA 1FYUA 1BVVA 3ZPYA 4AI2A 4M3CA 2NM1A 2GSYA 4W4ZA 3T2OA 4LORA 1FMD3 2VBPA 3BCWA 3JB4C 4P9XA 5IVVA 4B3NA 4LBQB 1W2UA 3WDYA 3WW3A 4A6SA 4NO4A 2ET7A 2YHJA 1QOSA 3HT2A 4MH0E 3VZNA 4OHWA 3VBHB 5FBJA 1HB1A 3O12A 1RUF1 3I3BA 2JDHA 3ZKUA 4DO0A 1ZRIA 1GQGA 4FPFA 4FPOB 3KGLA 3MUY1 5FPUA 3IAPA 3DPRA 3SMHA 4Z1VA 4QX1A 3ZXLA 5JIAA 2R061 2WFF2 3WNLA 1O3TA 4IEYA 2JDKA 1HXS1 1PZ8A 2FHRA 4H55A 2XJQA 2ZEXA 4OI0A 2HWE1 1KS5A 1AHSA 4FQ4A 2ERFA 1CJPA 5K4LA 5LEKA 4C1XA 2XHKA 3MO4A 5FZ3A 4Y5Z0 2F6BA 1VAKA 4D6QA 3JBG2 1Q8OA 5A33B 4CEWA 4Y1VA 3JQXA 1TMF2 2KXLA 3VDAA 1HRV2 1W6PB 2CDOA 3IIAA 1IS4A 4QQ2A 3WDWA 3T09A 3RFRA 4HVOA 1N47A 4K1YA 4ZU4A 3CJIB 4AG4A 4RQPC 1LULA 5A3MA 1V6LA 4AEDC 1H2MA 2WWJA 5JPNB 2XG3A 4RR3B 1UZZA 4B4RA 2FDFA 1QJY3 5B4NA 2JDAA 4R52A 4Y5SA 4LO4B 2Q30A 2ZX0A 2OVUA 2VQTA 4X8NA 5FO8B 2JDMA 2ZGOA 4DRVA 5F3EA 4Y22B 1N3QA 2AYHA 4EZHA 1PMHX 3I59A 1QY4A 1YJLA 2CNAA 2XXZA 3EB7A 3PIJA 4GXLA 1W8ZA 4NPRA 4K1ZA 3WR0A 5BNPC 1R1A1 3R6SA 5KXBA 1V0AA 2WO3A 2B8MA 2RVAA 4LKFA 5LASA 1FATA 4ES8A 1SBDA 2VD7A 3NV1A 1JU4A 4QKBA 2J22A 4QAWA 3N9PA 1UOJA 3SCFA 1RB8G 1Z7S2 5GLUA 4EN6B 4XEZA 1UL9A 3DF0A 3V0BB 5C9AA 1H8TC 1SLIA 2F4LA 4M01A 3RPQA 2R043 3MUZ1 3MICA 4FVVA 5DUUA 4RHV1 1C8M1 1DZTA 1NQDA 3I2DA 2O14A 5FYMA 5F32A 5B2GB 2BNNA 3B00A 4AVAA 5HBAA 1AL22 3WQ7A 4NIDA 1YJKA 3AL6A 2WNVB 1MZEA 2DV9A 2G4IA 4Q1RA 1H2LA 4XDQA 5LRSA 1VRH2 2CAVA 2WNEA 1QH7A 5FYYA 5EYYA 3AL5A 2DWRA 4JC1A 1ND2C 3BYWA 1XYPA 4I0AA 1GNZA 2EXKA 3BB6A 3LWCA 2WZPP 3OGJA 5FYSA 5JOXA 4FFIA 1W6MB 4AHYA 3OUJA 3LDKA 2RS31 3ES4A 1JI6A 2BWAA 4DPNA 2ATFA 2Y34A 4TLGA 3WF1A 4A3ZA 2HWF2 5JR2A 4L99A 1IS5A 2A3YA 1N1SA 1W0OA 2YPJA 3E6BA 1BBT3 2XJUA 2YMZA 4FCAA 3U07A 3S7EA 3ZN6A 1NKGA 2RR11 1UNBA 4B1LA 3I2FA 1W05A 4YZ5A 1ONAA 2HYKA 1O6UA 1WD4A 1NUKA 2HJIA 1XXNA 3KQ4B 1PGL2 1K5MA 1BZWA 1XYNA 4HVRA 4Q4Y3 5KHKA 5FZGA 3VBOB 3BUCA 5FPBA 5APAA 1WD3A 4PDWC 2HWD3 5HCBA 4A7KA 1VMJA 4AW7A 2L9LA 5LK7B 1X9PA 3V65A 3K3NA 1IHMA 4B29A 1IG0A 1QJX2 2UWCA 2WIIB 2XBO2 3WNXA 1RUG3 1BEV1 1ZBA2 3U10A 2DF7A 4H14A 4LHNA 4LBMA 1C28A 5C3OA 5I8SA 4XCBA 1H9WA 2ID4A 2X8KA 1YQCA 3LSEA 2QQOA 2Q8CA 3U11A 2W91A 3M7AA 3UL2A 5KXDA 4DB5A 5E88A 1RMU3 3I3EA 3D8CA 1V9U2 1PGW1 2W94A 2W1SA 1WLWA 4DNYA 3R4SA 1KDMA 3POSA 1IQAA 4XE9A 5GLZA 4KG8A 4I0WB 3VGIA 1ND3C 3CU7A 4K21A 2XQXA 5ACA1 1UYPA 5FZBA 2XJTA 4P02B 3VD9A 4PIXA 5DDJ3 1VBB1 3OYWA 2IXKA 4Y1XA 1XU1A 2E9QA 5ANNA 1RL3A 4FFHA 1RUF2 3SKVA 5KC5A 4IEWA 4CXXA 4IEPA 2RS51 3I2IA 3TWIA 4K7JA 3C7EA 3ZOIA 2JDUA 2PMWB 2R062 3NNLA 4H7LA 1QJU1 1O5LA 1UMZA 2GMPA 4NRMA 1CGPA 4BLJA 1HXS2 1CAWB 2RS11 2VCAA 2JB4A 4LA3A 3RYPA 5EYXA 2HWE2 2AZ5A 4XFIA 3UGFA 2G1MA 5FZKA 2IFWA 5L19A 3RG0A 2P3YA 4Q1PA 1NCQB 2EA7A 3URFA 1R1ZA 5EQUA 3MLKA 4DRRA 5A1LA 1VJ2A 1PK6A 1RUI3 4FFGA 5LWBA 1JZ8A 1IKPA 5LY2A 3OJBA 2WFPA 4AFDA 4V2VA 4UYBA 3SEPA 4FOYA 5IHRA 3FHIB 1BK1A 2QCSB 5ISLA 3ZFEA 2YGMA 4UFMA 2EXIA 1NCRA 1V6KA 2P34A 2PHRA 2RJLA 2W1WA 2W68A 2ZHKA 2ZTNA 3CDZB 2WS91 3ZFGB 1FV2A 3ZYHA 1DHKB 1HJGA 4KU7A 1AR63 3APBA 4IESA 3KS7A 2AR6A 2XUEA 1XU2A 4IEOA 3E5UA 1RHI3 3BTZA 4FFFA 4CU9A 4QB6A 4CCOA 1RUG1 1W99A 4CTEA 2ORZA 4DS0A 2ZOEB 5DUXA 2I74A 1AJOA 1ZZ8A 4AVBA 5CFDA 5CFCA 2C5DA 1LR5A 4LBKA 1CAUB 3C7GA 4XXPA 2VMHA 2DVAA 1GNYA 4MGKE 3ZN5A 3HVDA 3HJRA 5F5IA 2GNMA 1W9YA 1BJQA 4CDXC 3OBZA 5FMOS 4CE8A 4DXZA 4QU2A 3RZZA 1SACA 4GIQA 1AXZA 1KFXL 3N7JA 1XNCA 4AQSA 5FZLA 2D3SA 3RGBA 3VKNA 5FQ0A 1F8VA 1UY1A 4YWAA 4RHV2 1D0HA 1C8M2 3FMGA 4Q4X1 4XABA 1AXYA 4JKKA 4YM1A 1SLAA 4QXKA 4CDWC 3BIWE 5BNNC 3WNKA 2CWMA 4CCMA 1CAXB 3NKTA 4LHSA 5FUNA 4F8AA 3VHNA 5M0TA 2XLGA 3PHMA 1MVQA 4PI0A 4CDUC 1EV11 3PUSA 3MLLA 1DF0A 4E2GA 1KJRA 1IS6A 2J1RA 1WA6X 2WYSA 3TOJA 1VBA3 2VZOA 2K46A 3VBSA 1W8OA 4NN0A 2VMFA 3AP4A 5CU1A 4NUBA 1OOPA 2FZ1A 2VMGA 2A6WA 3SITA 3H1MA 3RI9A 2RS32 1HDKA 5GLVA 4XETA 5HCHA 4OULA 1PVC1 5CNAA 1R081 5H9QA 2NP0A 2W95A 1U5ZA 2D44A 4HONA 4AAPA 4EZ4A 5BNOB 5CADA 4GAZA 2VY0A 2RR12 3PL0A 4QM9A 2W87A 5FKCA 1GLHA 3FN9A 5FZOB 4ZS3A 1ZRDA 2OZJA 2DVDA 5HI0A 1F5FA 4Z8BA 2Q5TA 3OPZA 4IW3A 4Q0UA 4DQAA 3WQBA 3AKSA 4R9AA 4GD4A 1G9BA 4LOSA 4AGVA 4CZSA 1GZWA 5H9PA 1AR91 4PI2A 1RUJ1 1C1FA 1MS9A 1Q43A 2YGLA 2XVKA 3VBUC 2WRAA 4CEYC 1MEC3 5C8CC 1D7PM 1JODA 2ZGKA 1X36A 1CN1A 2PA7A 3MIBA 4EWAA 3VDDC 1BEV2 3TB0A 4I3PA 4HOOA 4XC9A 2YUEA 2EXJA 5ABJA 3NMBA 2VU9A 4L8QA 4GQ7A 1POV3 1W03A 2Y26A 1YCIA 2XKPA 5IVBA 2QZ3A 4HZFA 2ZGQA 4LKDA 1PGW2 2B46X 4N9HA 5CG9A 1Q8QA 2JG9C 3ZX7A 5JXJA 4E2QA 1RGSA 4BIOA 2D6NA 1OA3A 4CUGA 1YI7A 5ACA2 2GC3A 1BMV1 2PHFA 1BYHA 2C0ZA 3OD4A 5CA6A 5JMCA 4LOTA 1VP6A 3H0OA 1APNA 3TN93 4AE2A 4Y26A 1JBCA 1W9SA 4HXCA 3WQ1A 2VQAA 3ST7A 2C1FA 4YW6A 5F3GA 2WWSA 4CUCA 1Y43B 4XFAA 3PUAA 2RS52 2Y64A 3A4UA 4K3UA 4ZY9A 4BA6A 4RQPB 5BY5A 4QX8A 1F15A 3O0WA 3AYCA 4EV0A 1QJU2 4JGZA 4JQRA 1EY2A 4NR1A 4QD2A 4A45A 4BCUA 4G3YC 1QWRA 1WMDA 5C4WA 1W04A 2RS12 5CIRA 3D0SA 5IATA 4XFBA 2D6MA 1AYM3 4WV8A 4EQVA 1IPSA 1ULPA 3ZSLA 1YQ6A 1FV3A 3ZYIB 4S2GA 4IV3A 3N36A 2GMEA 2CGNA 2BFUL 4PQQA 3WG4A 3CO2A 2HEYF 3BPSA 2QVSB 4QXBA 1S0CA 4Y33A 1F31A 3NRUA 1GICA 4N53A 1MQTB 4LTAA 2ARCA 4OYUA 5F3CA 4Q4W3 5AVPA 1PO13 2GH8A 3JZVA 4QPIA 4Y20B 3K4ZA 3RDIA 1OURA 5LRRA 4JGYA 1H8TB 2VMCA 1FPN3 1R091 1XJAA 3L2HA 3NWKA 5F5AA 1ENQA 3Q8BA 1DYPA 2VG9A 5A80A 3NV2A 1GFF2 2MEV1 4X8PA 1GOGA 5T5LA 1L7QA 3OY8A 1LHVA 1Q5OA 2XMLA 1WCUA 3BALA 1QMJA 1VAVA 1RUNA 1VLNA 3RNSA 1PZ9A 2ZHLA 3U4SA 3BOWA 3DPRC 4DZGA 1QJEA 5D21A 2C4XA 1QJZA 2ARXA 2VL4A 3PVEA 1RUG2 2DU1A 1JUIA 2C26A 5JXHA 3UJOA 3C3VA 4JKMA 1J58A 1ULCA 2P17A 4DY5A 4Q5OA 3WCRA 3UKNA 3KCYA 4XFFA 5FJHA 3T2TA 1WBFA 4YVSC 3J7NA 3ZFFB 3ZR6A 2VBDA 4WM8A 1UMIA 3RZJA 1BCXA 3KT1A 2SBAA 4QX3A 1OA2A 1W6OB 4BOWA 3Q8FA 1O4YA 4EJRA 4TWTA 1C3HA 1HB2A 4CEWC 5F2SA 5FUIA 4Q4X2 1PIV3 4A4AA 4FTEA 1RUH1 1JXNA 4LJHA 3UT0A 4XPVA 1J3PA 1I5ZA 4Y5TA 4RN5A 4WBBA 5JOZA 1W0PA 4Y1YA 2BVBA 1EV12 1AR83 4LIVA 3AB0A 4Q27A 1ZVFA 3O5SA 4K9SA 1Z0HA 4LBNA 4TTGA 4HSLA 2DCJA 1GP5A 3KLSA 1ULFA 5CYYA 4QDRA 4LHKA 4GJYA 1FOD1 2VW0A 5IJRA 4NHLA 3UV9A 1AZDA 2FCTA 2VOTA 2A70A 5JOYA 1DCSA 2WNUC 1VPHA 2V4AA 1PVC2 4YG0A 2ZS6B 1R082 2OS2A 1O5UA 1VMHA 2K2SA 5FP8A 3RWKX 3LDBA 3PUIA 4K8FA 3U37A 4QX5A 2NLRA 4Q2FA 4JX0A 4WVZA 2RMU3 3I8TA 5D8AB 2R071 5GM0A 1VIWB 1SCRA 2PN5A 1S55A 5FCCA 1ND3B 1RUI2 2WZR3 4ET7A 2Y6KA 3RMYA 2FZ2A 3I3QA 2JE9A 2WLQA 3WNOA 3GGLA 4XIOA 4EROA 5C9AC 1S0FA 3WUDA 2E7AA 2VUDA 1NT0A 1HX6A 4GMP0 4YZ2A 3H8UA 1AR92 4JDMA 1RUJ2 4XURA 5IVYA 5I0SA 4L0PA 3RZLA 4I01A 1JZ4A 2RDNA 1ULOA 2LS6A 3SXWA 4QHOA 4YM2A 1NA1B 2X5IA 2JKBA 3MGUA 4ZPIA 3RYRA 1K12A 1LOFA 2W3JA 1AVBA 1SLCA 1NYWA 5LBEA 2P3IA 1OSGA 3KGZA 4XZUG 4YGDA 2CY6A 4AQ6A 4URAA 5AC93 1GP6A 1WWYA 5FR3A 1RVF1 1COV3 4QB1A 5LA9A 3K4DA 3VHPA 4UF0B 3N4MA 4MGZE 3MYXA 1ZRRA 3ZSKA 1UU5A 3LZZA 3T1LA 4LULA 3AMMA 3SEEA 3VBFA 2O0OA 1C5HA 5IYYA 1LHWA 1BMV2 2XH6A 3C7HA 4MSVA 1HB3A 2VCBA 2TBVA 3FWEA 1GWKA 4M3CF 1KJLA 4URTA 1JS9A 3K77A 2ZGPA 4UI9L 3DKQA 2V4VA 3POYA 4H2AA 4AEKA 2JG8C 3BI3A 3B5LB 1CIWA 2A6XA 4ZZ5A 3WF2A 3N7MA 4ASKA 4GJZA 3RRDA 4C90A 1FX5A 1NXMA 4CPBD 4EN9B 3LEKA 4IGOA 1HKDA 4WZFA 5FZ1A 1TME1 1OF4A 5FP9A 3RYKA 2Q1ZB 4R9BA 3NJVA 4MV2A 2UURA 2ZGUA 1AR81 2VBBA 1GP4A 4HPKB 1DIWA 2CHHA 1A34A 2YG0A 2PAMA 4C1WA 3NO8A 5CISA 3TNQA 2RM23 2JE7A 2NN8A 4E4SA 1AX1A 2IXCA 3WDVA 4NIGA 1J3RA 2YV8A 3ROUA 5J37A 3ZIXA 1Z7S1 1WMFA 1XNDA 3HOBA 1WCDJ 5FYIA 5CKNA 1H1AA 5K0UC 4NIHA 1T6BX 5G04L 1YFYA 5LATA 2W92A 1J84A 1W6QA 2QKDA 3R0RA 2BOJA 1K5JA 1UZVA 4AFMA 1SHWB 3VD4A 1R092 5KWRA 2FDHA 3ZM8A 2WNOA 1DU3D 2MEV2 4B8EA 5LBFA 4UWDA 2Q8EA 4YNIA 2DCTA 5A3PA 4NPLA 2Y33A 4HG6B 3NNMA 3LFMA 1GV9A 2BBAA 5GLTA 3T3YA 1D4M1 1ZBE3 1JZ6A 3OEBA 4Q26A 5H9RA 2VW1A 2XHNA 1AYN3 4IXLA 1ASJ1 5FY4A 3NJZA 2GZWA 1RUE3 4Z82A 5FYZA 5DG2A 3V0AB 2JX9A 1LENA 2VVEA 3CZUA 2D6PA 2RHPA 4LA2A 2XWJB 1T6GC 2DVGA 5J3UA 4MHUA 4CDQB 1EPWA 3VBRA 3WF3A 5E8AA 1W2NA 4CUAA 2RJ2A 2ZAAA 2QE3A 3JD73 2DDUA 3I54A 1IGOA 2NZ9A 3VDCA 2BPA2 3LEGA 3I49A 3EO6A 1BHGA 3DYMA 2V09A 4PBPA 3ZYRA 1RUH2 4X6RB 3U0ZA 1I5PA 1CZSA 3U4XA 2C9KA 1F35A 4AL9A 4OQ9A 1ZZ7A 1KRIA 4XOGA 1CX1A 5BPXA 4B7EA 3MW3A 4UFIA 5C3RA 4YGBA 3CHXA 1NCRC 2ZHNA 3WT3A 1CJDA 4XQWA 3GJAA 1LJ7A 4XUPA 4LBQA 2ARAA 1LGNA 1QJX1 3AKPA 4FOQA 5DUVA 3VBUB 3S30A 5EZWA 5KHGA 4BJ0A 3VBHA 3VDDB 2YB7A 1FOD2 3LEMA 4RS5B 3EXUA 3RQ0A 3LFIA 3OGGA 1WA4A 3IN9A 4YLZA 2WAAA 2J42A 3K2OA 5E89A 2WA4A 1OT5A 1HRI1 4PF1A 4DMIA 5IK4A 5CFDC 5A6ZA 5CFCC 1LODA 1OLRA 1IPKA 4BXSV 1BVP1 2R072 3IPVB 4OUMA 4LHLA 1SZBA 3POFA 4OZXA 2JDYA 1G9AA 5FP3A 1LB2A 1SEFA 5IK8A 2XWBB 1J1LA 2WJSA 4BIFA 1SDWA 4N90A 1VAMA 4XUNA 5I91A 3DCQA 3KV4A 1UZYA 3AYEA 2TUNA 1N1YA 3DECA 1QJFA 3HEIA 1H9PA 3KB5A 4N43C 1XYOA 3J8F1 4Q0PA 2VCCA 5EV7A 3VL9A 3KHBA 4JV4A 2VXJA 3OBRA 4QX7A 1NAEA 3FHAA 3W9AA 4XJZA 3WX5A 5A33A 3O1RA 4CCCA 2BBVA 2ZBJA 1PX3A 1W6NB 4BB3A 4GKYA 3RWNA 3FUQA 1ZNPA 1WW7A 3MV11 4LKSA 4XFGA 2ZACA 4CP0A 3WF0A 3CJIA 4YVWB 5IVCA 4UAPA 3C2UA 3KM5A 4Q4V1 2N7GA 1JYXA 1RVF2 3VBSC 3LE0A 4IE4A 2F17A 4RR3A 1OLME 3DYPA 4XYXA 5FPAA 2C24A 2KM2A 3E5QA 4XFCA 5F3IA 4P5YA 2NYYA 2W2IA 4QQOA 2PHUA 4L97A 1A78A 5FAXA 1VBE1 4GH4B 4Y22A 4HFSA 5DAPA 3ME2A 3WF4A 3ZSMA 3W20A 5FZIA 4O7XA 4A3XA 4J1XA 2WL1A 1S0IA 1OFNA 4DUXA 4CP9B 1HLCA 1UCXA 4QU1A 4YRDA 5BV6A 1WZXA 2IVIB 4HK8A 4IL7A 3TEWA 4BWOA 5FZ7A 1SLTA 2ZX2A 1BKZA 4LIUA 3AMNA 4OHVA 5BXXA 4Q8KA 1S4CA 1TME2 2IUWA 3J26N 3R05A 3CL1A 3V0BA 4HBNA 1Z78A 1NOVA 3B93A 3GHNA 1AR82 5L7OB 4AFAA 2VZ3A 4NOTA 1A3KA 4MHRA 2ZCWA 3H7JA 1OXCA 3M3CA 3MV01 3WDTA 5IAXA 2GC1A 4NWWA 2Z4FA 1IS3A 1WUVA 1W8UA 2VTXJ 3ACFA 1G7YA 2WNVA 4GWNA 3MIGA 1JYWA 4LK7A 1EAH1 4XQ4A 2XVGA 4HN0A 4YVSB 5T55A 5LA0A 2PLV3 2J1SA 5FY7A 1JYCA 1W6MA 1FMD1 2GAUA 4EWEA 1C1LA 4X6QB 4P5HA 5F8PA 2WO2A 3SNMA 2RV9A 2ZEZA 3UNPA 3ZVXA 3HPNA 3POWA 1ZYBA 2BP6A 4QXHA 2W08A 2VO5A 1CR7A 4MVTA 4MGIE 1LU1A 5A3LA 5JUVA 1GSLA 1PO23 5T52A 1D4M2 4JTOA 4LT5A 1UOBA 4AGGA 2AGSA 3EMRA 1XNKA 2CGOA 4JGZC 3VBOA 2A73B 4AI0A 3HIFA 2B42B 1M4WA 1ASJ2 5C4WC 1PGSA 5FP4A 4QPGB 4QT6A 2OZ6A 5LY1A 3QLQA 3KWVA 2C9AA 1ZZ9A 2VZRA 1ALYA 4DEVA 3MZHA 1ULGA 2WNUB 3OSDA 5FKBA 2VZVA 4ASMB 2OPWA 1JYIA 1W8WA 2EAAA 2W9XA 3PJYA 4P9JA 2B9UA 5I93A 1YI9A 3IDEA 1VRBA 3NQHA 4KMQA 5H9SA 1J83A 1OC1A 1YXWA 5LBBA 3ZXEA 4XBLA 3K3OA 4S2HA 4R4ZA 4BM8A 2ZMLA 3KCCA 3ZDSA 4QPIC 4N9IA 5DZGA 5F1RA 3OG2A 4JGYC 1LRHA 2B45X 1OLQA 3MF6A 3IZOA 3WHTA 4XZPA 5DAWA 2JIJA 1A8DA 5HV0A 3WD5A 4DUVA 3FX3A 1P8JA 5C8WA 2WLPA 3TNPB 1QJY1 2ET1A 3FE5A 4TN7A 1G6NA 3ZMNA 5FYVA 1QNWA 3M1HA 4V2WA 1V6NA 4P9YA 4D6RA 3PURA 3T4HB 1JZ5A 4XUQA 5FUPA 3D0JA 4N7IA 1RUOA 3NAPA 4H7MA 5LA2A 2QQNA 1HRI2 2BDRA 4IEZA 3W58A 1LECA 3ZXFA 1L7LA 2LTNA 3ETPA 4CP1A 3MIDA 5KHJA 2QJVA 3KVBA 4D7TA 2DFBA 1UO9A 1XE8A 4CCLA 1W8HA 4UFJA 1O91A 4AVCA 5CB7A 3NW4A 4AZZA 3I3MA 1CAWA 2EAKA 4HL0A 4BMBA 2QBXA 4RFT0 4WM8C 4LK6A 5T5OA 4CVUA 3S5QA 2A7AA 2W52A 4LO6B 1CONA 2J1TA 2R041 3AKTA 3J8F2 4GZ9A 4XF9A 5DN2A 1NCQA 2JG8B 5GZFA 3TEXA 1S0BA 1K3IA 2AEYA 1DZQA 2C6SA 3NSTA 4GMP3 4PCRA 4YFWA 2GMMA 2QFEA 3NL1A 3AMQA 1JU3A 3D82A 5HCAA 2FMDA 3FFZA 2JDPA 5C3PA 2BV4A 2X53S 4Q4V2 4FPYA 3LA3A 2AH2A 3CMGA 3ZFGA 1AL0G 3PMSA 1REDA 2AACA 3S5AA 2VE1A 4FPJA 1QQP3 1VBE2 4CXWA 2HWC3 3HN3A 5JZGC 3AZZA 3BN6A 4QGMA 4HVQA 5FY9A 2VJXA 1BBT1 4K6BA 1N3PA 5K0UB 4ZU7A 5SV5A 2YFUA 1LNSA 2EIBA 5FLJA 5GZEA 4L92A 4QHBA 1CWPA 4Q4Y1 4ZONA 1RUD3 2ZGLA 2KA3A 2ZX3A 1GR3A 1KXGA 3WZ1A 4E4ZA 2XOMA 4GB33 1WMEA 2HWD1 4NIIA 3AP7A 4PJYA 1H1IA 1B35C 2EVXA 2K0GA 4FT8A 5FXXA 4PLMA 1VR3A 2R6QA 4HSJA 3WV6A 4A42A 2WT1A 5ANQA 2AREA 4XDPA 4A6OA 2X5IC 4DXRA 4F83A 1JW6A 2XR4A 3ZYFA 1VBD3 1LOFC 1W9FA 3A7QA 1CAXA 3DL3A 3OB8A 2FDJA 3WEZA 4AVVA 2J1VA 3B9CA 4AOCA 3LCPA 4MADA 4MXVA 5L9VA 4COVA 4R9DA 1G86A 1EAH2 3NNFA 1EUTA 1RMU1 5J09A 3BVCA 4RSUA 1A8MA 1YFXA 1AXKA 3H7YA 4PHZA 2ZMKA 4BH9A 1H4GA 1FNYA 3FLPA 5KXEA 3E6CC 1DQ1A 1FMD2 5A6XA 2HWB3 2YC4A 4JTNA 5FRAA 1HB4A 1X50A 3ZSJA 1ZZBA 4COWA 5DDJ1 4XF4A 2JDZA 2E53A 5EHDA 5BNOA 5F37A 4CA9A 4IV1C 3WHUA 4OI2A 4QGLA 3AK0A 3ENRA 5E1RA 2Z69A 4MXWB 1EUUA 1W9WA 2A1XA 5A7PA 1NCRB 3H8XA 1WBLA 5FY1A 2W39A 4CCEA 2Y60A 4EE2A 2WAOA 4UW4A 2VZ1A 2IXIA 3MF9A 2D40A 4YPJA 1QHDA 3M3IA 2OQ7A 3Q9OA 3WLUA 1W90A 2XLFA 3WNNA 4BQXA 4D69A 2JKXA 4IE6A 1KFUL 1SG3A 1LOEA 4WM7B 3ZPOA 2VNVA 3USSA 3Q8AA 3MDPA 1S2BA 2OPKA 2YU2A 4IETA 2BNOA 4OLLA 4OI1A 4B7KA 3H42B 5FLIA 1LGCA 1H6XA 1RUI1 3THDA 1XPWA 1KITA 4Q0VA 2JICA 1S0JA 1UKGA 3LPGA 4LBOA 3M3QA 4N43B 4AQTA 2WT0A 2XJPA 3O0XA 2EIDA 2YZ4A 3GJBA 3WG2A 2ADDA 3VZLA 1QJY2 2P6HA 2GU9A 3AX4A 3PIGA 5BNQA 1CPMA 2YROA 2OA2A 1AR61 1XNBA 1HV1A 3F95A 4DFSA 2DCZA 1RHI1 3S57A 4HT1T 2VTXA 2WO1A 4FO9A 2QQJA 4RQPA 1WKYA 4W8JA 4Z2WA 1W9TA 5AFEA 3ILNA 1YNAA 1YIPA 4OUSA 5FYHA 2A71A 3LSDA 3ES1A 1AR73 1FNZA 3N7LA 5FYCA 5KXCA 4W65A 4QKDA 5A1FA 1OUSA 1H2KA 4AEJA 5FIXA 1IPJA 5FZDA 3O1PA 3ZO0B 3D3AA 3DV8A 3K51A 5A3TA 3QCWA 5BYNA 1V6OA 2R042 2ORXA 3AZVA 3NV3A 3OUHA 4R9CA 4MOAA 2ZGMA 3VLBB 4MGQA 2ZA9A 3B02A 1MQTA 4AEDB 5G05L 4Y20A 3ABZA 2HYXA 1XE0A 5FYBA 2EIGA 1RC6A 1PO22 2WN2A 1H30A 3PNAA 3UKTA 4AQ2A 4FI9A 4XUTA 1H8TA 4BQ1A 5C5TA 1JHJA 1QIQA 2XJRA 3L2YA 4NAMA 3KD4A 1RUC3 4YW5A 2A6YA 1VBA1 1OH4A 2PQQA 4CCNA 2BYVE 2E6VA 3OGSA 1XBFA 3PTYA 3VBHC 2XDVA 3ZXDA 1UX6A 1FI2A 5BNPB 3ZXKA 1NZIA 2IVJA 4NHXA 1DGRN 4FOWA 2OKXA 1ULEA 3VZJA 3AXDA 4RGGA 3TAYA 3BU0A 1ENRA 5FZCA 2BEOA 3EBRA 4UBGA 1JUHA 1BBT2 3WP3A 1MS5A 3D4KA 1OD5A 3CIHA 2VUCA 4BLIA 1YQ8A 2PHXA 2VNRA 3G7DA 4IEVA 4IGQA 5LCWL 5IVEA 3P1IA 1DLLA 3E1F1 1E5RA 4Q4Y2 5DPNA 3A21A 2VOVA 1UD1A 1LOCA 5JR7B 3ZFFA 4D7SA 3BODA 1O4TA 3T30A 2HWD2 2FBEA 3MFCA 5D2AA 1OF3A 2ARBA 4YFZA 1W6OA 4LO5B 5A7WB 2VUAA 1JOJA 4LITA 4AGRA 4DXSA 1H2NA 1OUXA 4EN7B 4Z2AA 3HT1A 3AZWA 1HN0A 2VZSA 2ZZJA 1MEC1 3AFGA 3ZYBA 2W1QA 1GWMA 1KQRA 3GZUC 5FZMA 3O1UA 3RVHA 4LUKA 2EICA 4YM3A 1ND2B 5F6LB 1DQ0A 1Y9GA 1DZRA 1NLRA 4NHKA 2CU5A 4CU8A 2XONA 1KGYA 4OFGA 3HNBM 1POV1 2WINB 2D7FA 1XE7A 2BW8A 3OEAA 3OGRA 1FXZA 2BUKA 4BU2A 5GALA 4A2UA 2J1AA 4BQYA 4RR3C 4O9EA 1RMU2 1ZA7A 2YFZA 4NROA 1W2OA 3GCXA 5C3SA 1YEWA 2WFF3 3CJXA 3IWZA 2CSGA 5IVFA 1E57A 2OUJA 2VCMA 2VXRA 2ZPXA 3TRSB 5EWSA 5I8TA 3AMHA 5FWEA 1Q8PA 2BJSA 2TNFA 3SCGA 2Y6FA 3SKJE 5DDJ2 4IEUA 3T4VA 4META 3TN91 4QQPA 1VALA 4GA9A 4XBQA 1OQDA 3W21A 2WKKA 5C6CA 1OD3A 4HANA 5D8AA 3RI8A 3GZEA 4KQ7A 4PDWB 3SQOA 5DQ0A 1J59A 3OGVA 4Q0QA 1I6XA 3JBG3 2GC2A 1U12A 3A0KA 2UWAA 5LBCA 5CKMA 2HKXA 3ITQA 4ZU5A 2WQZC 3BIEA 2D3RA 1LESA 1NZCA 1GUIA 1TMF3 2SLIA 1CZVA 4RFRB 4XJ9A 5F5QA 1HRV3 1GANA 4L2NA 1MS3A 4OHXA 1RINA 2JJ6A 2OW4A 2R0HA 3Q8EA 3M70A 1WCQA 1AYM1 2YPDA 1D2QA 3INAA 4QHZA 2PTMA 2Q8DA 2IZWA 1NA1A 2WNVC 2JB8A 5JXGA 3NJYA 1RXFA 3N9MA 2P4EA 2A6ZA 2V72A 2ZMNA 4D3WA 4SBVA 1DFQA 4JHTA 3B94A 3H50A 4Q4W1 1NQJA 2RDRA 5IT6A 1PO11 2R16A 4YG6A 4B4PA 3CF6E 1GQHA 2H0BA 1W2TA 2WA3A 3LB9A 2ZGTA 4KBZA 5A7QA 1PVXA 1UW8A 3HNYM 1DBNA 3N9NA 1TZOA 2CV6A 3O0VA 2P37A 3PVNA 3P6BA 4FQZA 4ATEA 1FPN1 1HJFA 3POEA 3KMHA 2ZXQA 4CU7A 3SH4A 1S2KA 2DCYA 1J1TA 4EWDA 5C5UA 2FDGA 1OPMA 4OQ8A 1AR62 3B7MA 3UGHA 1RHI2 1UZ0A 2DTYA 2JIGA 3KSCA 4H3WA 2ZGRA 4XW3A 1JYNA 2G9GA 1ZRCA 2VZQA 3WDXA 3VBOC 2YU1A 3KV9A 3AP9A 3PTRB 2WR9A 4XHBA 3THPA 1TEIA 2ZX4A 3NVCA 4XIKA 3FZ3A 5T50A 5FOBB 1ZREA 1Q56A 1S2EA 1DQ4A 4LMFA 4U2AA 1AL23 3WCSA 4AEMA 4AFCA 1OA4A 4KGQA 3AZYA 5FMDA 1L7RA 3PLQA 2VGDA 4AHXA 1VRH3 5JZGB 4A7YA 1V6IA 1WMXA 3LOIA 3GXUA 3VV1A 4AK3A 1REFA 2I2SA 3FJSA 3K46A 5FMOL 3PVOA 5A32B 3C7OA 1K5MC 4RD7A 1PIV1 1QKQA 2P6CA 3KZ4C 1DYKA 3USUA 2HWF3 2V5YA 2W1UA 1DQ2A 3LQCA 3JQWA 2WT2A 3T08A 3BU7A 5JSPA 3S6PA 4AVSA 3EHKA 4D0QA 2VZPA 3QH7A 1PMIA 1SFYA 2G9FA 4KG0A 3GF6A 4P9WA 4XCAA 3RSJA 4Z92B 1B35B 4FAGA 2CGPA 4DINB 1VBA2 5F5CA 1S1AA 4I0BA 1TNRA 5FOJB 4CP2A 1SFPA 3NAPC 3OPTA 5L9BA 1DP0A 2QNKA 1JZ2A 1G9CA 4FXKB 1JZ7A 2LW8A 1XSRA 1H6YA 2XB6C 1XQNA 1RYYA 4J25A 4QM8A 5FZ9A 2E63A 2XBO3 4XXAA 5DAQA 4BE3A 2RMU1 3VUOA 1ZBA3 1MACA 4HKLA 4CDXB 1SLLA 1YIFA 2GN3A 1AF9A 3V0AA 3O1SA 4J1WA 3DEMA 1UIKA 1U0AA 4FPKA 2WZR1 3CQOA 2Q8OA 3I2HA 4CDQA 4OMCA 1I1EA 1YQ2A 5EJ3A 2ZHMA 4COUA 1SFNA 2H0VA 4EN8B 1V9U3 1QNYA 4CDWB 1MVEA 3V64A 4HETA 5BNNB 1NCQC 2ZAHA 3EQEA 4IV1B 2DURA 1UPSA 4OHYA 1V6MA 3E97A 5JLVA 1SDDB 1MEC2 2V5DA 4ZXEA 4CDUB 1IKQA 4GWMA 1VB4A 1US2A 4GALA 4AI8A 2FDKA 4NWVA 2QQMA 4SLIA 2VZTA 1PHMA 3BGAA 1RJ8A 2WN3A 4P00B 4XHXA 5A7SA 5F9TA 2PHWA 2DBIA 1RUF3 4LO8A 4I2OA 5FMCA 1AJKA 2HH9A 5DAVA 1DGRA 1W8FA 2NMOA 4GWJA 1OKQA 3TBDA 4CSWA 5AC91 4KU8A 1COV1 5FPLA 3HR9A 3VBUA 2VZUA 4NRPA 2EF6A 5HXMA 3JB8A 3VZOA 4OCTA 1JOPA 5JCTA 3VDDA 2KR2A 4RS5A 1OKOA 1YC61 5FFOC 1UOGA 2JECA 5GZGA 3O1TA 4IE5A 4DUWA 1ENXA 3PU8A 1HXS3 1PK6C 3CZJA 4QKFA 4TYSA 5IFTA 4QX0A 3TN92 3KT7A 4ATFA 3KT4A 2O8OA 5GZDA 2Y6JA 3H3LA 2A3WA 4YW7A 2VQ0A 2XL9A 3ATGA 4JAAA 1OVPA 3IPVA 3WY6A 5L36A 1I3HA 3SH5A 3ZFEC 1MZFA 2GP5A 4XQDA 3SISA 3FLRA 1V6JA 3HQUA 4OZOA 1LU2A 5L9RA 3UETA 4CEYB 5D1IA 5C8CB 2H6BA 3TYJA 3ZIWA 2WZEA 4HKOA 3IMNA 1GOHA 2WWUA 3ASIA 2AEZA 2ETEA 4YW1A 1RIRA 4ZZ8A 1AYM2 4CCKA 1Y3TA 5I8YA 2Z42A 4WVMB 1UYYA 3FC0A 4XTPA 2JD9A 4RGKA 4AI3A 2EIEA 1W6NA 1F4AA 2X09A 3AZXA 5A3OA 3RZKA 1PM7A 4EN0A 2A75A 4L11A 2RM21 2F4PA 2I45A 2JG9B 3G6JB 4Q8LA 5FZFA 4CXYA 4YVWA 3UYJA 1PM4A 2RJKA 2D43A 4YZ4A 2KD7A 4Q4W2 1STMA 1G9FA 2QQUA 5KBFA 1PO12 1VB2A 4FOVA 5C33A 2YBSA 4A41A 1MPXA 1U5YA 5EXOA 1JN2P 5A3UA 1G8WA 1R1A3 4ITCA 2W5FA 2ENRA 1CAVB 1SPPB 2WUHA 3KCXA 1FPN2 4NMIA 1E5IA 3VD7A 3BTAA 3VL8A 1OLMA 1O8PA 1GMMA 3I3DA 4GH4A 3UKVA 3WINE 1TG7A 1LGBA 4INDA 3UESA 3LA7A 1W6PA 5C71A 1UOFA 1XRUA 3WUCA 1UAIA 5FZ8A 4BQ4A 3AKQA 5FO9B 5FY5A 1YLLA 4CP9A 1JTZX 2ZGSA 2OT7A 1ZBE1 3Q8CA 4XMAA 4ZKTB 1GQPA 1X7NA 2G19A 2P1BA 4RHV3 4XAEA 1C8M3 3SCHA 4A7ZA 1GWLA 3AYDA 1AYN1 2UY8A 3FBMA 3HNMA 4W6YA 2IC1A 3H3UA 1OOPC 2YXSA 5LA1A 1RUE1 3H8RA 1CD3G 1UWWA 2W0XA 1LEDA 3N3HA 5L7OA 4JRLA 4E4HA 1NY71 3KF5A 4M3CE 1OFSA 1BXHA 2FQPA 1Y4WA 1HIXA 3JD71 1XNAA 2YBKA 2WZ8A 4R4XA 2O1QA 4BQ2A 5JMOA 4M3CB 4MX3A 3I97A 3P3PA 4C0BA 3W5NA 1PIV2 1IQDC 2RS33 3C7FA 2Q4SA 4J6GA 3CNAA 4DOUA 3OOXA 4ARYA 2Q1FA 3LIGA 4LE3A 4YVSA 3VD3A 5JSRA 1H8VA 1X8EA 2DBNA 2P2KA 2RR13 3K48A 5EJ1B 4YW4A 4RL7A 4AR2A 1YWKA 3NV4A 2CWSA 3PMEA 2UYAA 4CRQA 4JVAA 2D5HA 3DPRB 2VOKA 5IAVA 5KHHA 5ABJC 5FMBA 1CZTA 2ZEWA 2ZKLA 4B1MA 3JUUA 1AUYA 1HQNA 5CAZA 2XPJA 4KGGA 1QH6A 4XILA 4PT6A 1OMIA 3J9SA 3JU9A 2B4KA 5A6QA 1HN1A 4WVWA 5FJKA 5FK7A 4BK4A 3MHZA 2CL2A 2RMU2 1ZRFA 1BEV3 5SV8A 1VE0A 3BOPA 2DTWA 5F6KA 4QPGA 2BGOA 3POIA 4LEJA 1JMUB 4B4QA 2LM3A 4PLOA 2WZR2 1AX2A 3WP6A 4MGYE 4HN1A 4CEWB 2WNUA 2BRTA 5FXWA 2E26A 2GDFA 4FXGB 3U14A 5FPZA 4IEQA 3FBYA 5FLHA 4ES9A 4LLOA 4FTSA 1LAJA 3HQRA 3WP5A 1MQTC 2ZABA 3W59A 5ACA3 2B7YA 1CX4A 2VMIA 1IOAA 4K8RB 4JDOA 1GZCA 1R64A 3A0NA 4MO3M 3OCPA 4FBFA 5JXIA 1VBB3 2DVFA 2WSVA 1UPIA 1JZ3A 3B01A 3FL7A 1OHFA 2IXJA 2RE9A 2RG4A 3GALA 4E9KA 3HWJA 4M0HA 3DXUA 2WABA 4UW3A 5AC92 1OI6A 1ZA4A 4GWIA 3WNPA 2LRPA 2RS53 1COV2 4E8DA 3I59B 4IV3C 5J36A 2WDBA 3PUHA 3B69A 1TE1B 4L9BA 1QJU3 2BTVC 2PAEA 4FPEA 2XVLA 2UU8A 4F3JA 4UFKA 4HK9A 2EALA 2RS13 2Z2SB 4N53C 2PYTA 4XUOA 3ZMOA 4TZDA 2BFUS 3ECQA 1F4HA 1UXZA 4UFHA 4QQHA 3LPFA 5C9AB 4DEQA 2OX0A 4CU6A 3ZFFC 3S7IA 2OYZA 1EPZA 4XJ8A 4GULA 4COZA 2VH9A 2PHLA 1ULDA 3HBKA 4FPLA 2WQ8A 4P08A 2YDEA 3ILRA 4NE9A 2JG8A 1OBNA 2ZEYA 2VR4A 3CEWA 1SQ4A 1OVSA 2X10A 3NNGA 3T1MA 4YZ3A 2WS93 2RM22 1TVGA 1W06A 2XQRA 5EJZB 5F39A 5I0TA 5J48A 1XNTA 1QGLA 1ACCA 3VD5A 3IIIA 3FHQA 4BXFA 1DYOA 2Y38A 3GM8A 4CCDA 2TEPA 4XAAA 3RMXA 2AENA 2IXHA 4YSFA 3D5OA 1Y7BA 2PHTA 3A22A 2PLV1 4IUGA 1L3JA 1UYXA 4LBQD 4NPMA 3ZN6B 3ZYJB 4AF9A 3O14A 5IK7A 5EFUA 4MUVA 3AJYA 3LAGA 1S0DA 2A5ZA 2VULA 3NJXA 5EPAA 5T54A 1FT9A 1K5MB 3RJ2X 4D94A 5A3NA 1D4VB 2XL7A 3IM0A 1DQ5A 4O9GA 5D8AC 2VMEA 3ETQA 4UXAA 5K0UA 5FXVA 1X33A 2BGPA 3N35A 1ZX5A 1PO21 5F7UA 5AVAA 5FYTA 1ZBE2 3ZXJA 3MBWA 4PQ9A 1H0BA 5ERLA 4O61A 3AP5A 5FXZA 4Q4X3 1AYN2 4LQRA 4YW2A 5KC6A 1NE6A 1S0EA 2D5FA 1DGWA 4QKNA 2DYCA 5FZ0A 1RUE2 3N7KA 3ZLIA 3ELNA 4Y4RA 4C91A 2QQWA 5CBLA 3NAPB 2VPVA 2Y8KA 5FTTC 4QMAA 1UYZA 1EV13 1NY72 3ZDVA 1D2SA 2YY1A 2CYFA 2VVDA 1NA1C 4YGEA 1DDLA 3JD72 3SLIA 4LR4A 1W3XA 4MGSA 3E6DA 2WO7A 4P9GA 1UMHA 3SHRA 1IG3A 4PBOA 3I2KA 3CBNA 1CAUA 4M0NA 4NHMA 3P3NA 3B9IA 1ZZ6A 3IBMA 1PVC3 3OYWB 1R083 1UKRA 1S0GA 2Q0AA 4AI1A 5IVJA 3RS6A 4YG3A 4JRAA 2ZJCA 3DKWA 4AYUA 2QUOA 2D93A 2DUQA 3FFQA 4FP3A 4QGNA 4ISRA 1N1VA 4XDOA 5E6HA 4COYA 5LEJA 1CIYA 3BKZA 1SMVA 5FY8A 3TEZA 2Y0OA 4BQ3A 2Y6LA 3LIHA 1W39A 5IWFA 2RDQA 3AYAA 4PIZA 1QOOA 3VN4A 4QQLA 2WC2A 4LBJA 1CPNA 4MXWA 1V70A 3DN7A 1AR93 3QOPA 1RUJ3 3MI8A 4LUMA 3ACIA 2QQLA 1LKNA 2CTVA 4ORFA 1OQEA 4QB2A 5FBZA 1ENSA 4BQWA 2OIIA 5GZCA 1YFWA 2E31A 1JHNA 3T0BA 2VC9A 3VBFC 3ZKYA 4LE4A 1YYNA 4BQ5A 1BK0A 4DIQA 1ODMA 4V1PA 4P14A 2D6OX 4R8HA 5JI9A 4JQTA 3GNEA 1VBC3 2BNMA 1YO8A 1PK6B 4NJ4A 3AC0A 3OD0A 2P3JA 2Z5WA 4XVHA 3WDUA 1R1A2 4WM7A 2FD8A 2JE8A 1B09A 3N9LA 4Y4YA 1SLBA 3ZXAC 2EXHA 5FZOA 3HD8B 1O8SA 3ZFEB 5FO7B 4AVTA 1J3QA 2D98A 2DUPA 2IXLA 2VM9A 3HBZA 3ZYPA 4GMP1 5EP9A 1AX0A 4NHYA 3LGRA 1CQ9A 4QXCA 5IFPA 1X8MA 3O7OA 1UY4A 4ASLA 4UW5A 2BU9A 5DXDA 4XF3A 3GYDA 1NLSA 4N43A 3VZKA 1O4ZA 5LZ6A 1Q8SA 4FTBA 3LD8A 4K40A 1KD7A 1YQ5A 4LO7A 3L9JT 2DCKA 3PVBB 4QX2A 3JXSA 1SCSA 2CDPA 2QQIA 1G9DA 2QDNA 1F5JA 5HXVA 1Y9MA 4MG2A 4YW3A 5C70A 5CFCB 5CFDB 1YFUA 1QQP1 2VOWA 3RZGA 1W0NA 1WLCA 2HWC1 1WLDA 1T2XA 4BPZA 5FK8A 3O1VA 3U75A 1UQXA 2ADEA 3KV5A 4KBBA 5AFBA 4UT5A 3ZR5A 3W5MA 1W8NA 5FQ0B 1DGLA 1BQPA 1DQ6A 3PUQA 4DXTA 2HLEA 3R4DB 4CDQC 1RUD1 1W3VA 2BGCA 4IERA 2XJSA 4I09A 5L73A 1XC6A 2R49A 3BTXA 1ST8A 1KDKA 4GB31 4C0HA 1O3QA 3QH6A 3LEIA 3UK9A 1UN1A 3J7LA 3AVRA 5FZAA 1XB9A 2QQVA 3J7MA 2Y6GA 4QPWA 2B5HA 3GBWA 4HKWA 4HMZA 5FREA 1R093 2BQPA 1UXXX 2JDNA 3SH3A 2BWCA 1XOYA 3ORJA 1RTVA 4AEDA 5EIYB 1VBD1 3ACHA 3VBSB 2MEV3 3M2MA 4E4DX 1O3SA 1LHUA 5J1XA 1QXJA 1OOPB 1HQWA 2BVVA 2WSUA 2PHDA 2LROA 3AMPA 3PU3A 4XBNA 1UX7A 1W28A 2NQYA 1N1TA 3VBRC 2HBTA 1TNFA 2J1UA 3C8XA 4ONUA 3VDBA 1NLQA 5HCFA 2PLV2 4P9IA 4RS5C 4E2SA 4JCKA 2VECA 3OBAA 5FP7A 5BNPA 3DXTA 1RJ7A 2GP3A 1C57A 1D0GA 2HWB1 2P3KA 3DUIA 3MIHA 2FMYA 3IKWA 3OUIA 1VBC1 4CPBA 3GDBA 4JZRA 3VKMA 3PDQA 1UY0A 4LBLA 3WSOA 2D3PA 5A7OA 1JH5A 4CUBA 4AXOA 2ZX1A 4IE7A 5C3QA 2DVBA 4LXLA 5T3NA 1PZ7A 2VMDA 2PAKA 2XUMA 3UGGA 4PF5A 2X05A 3MEPA 5BUVA 3TEYA 4AI9A 3VKLA 1GZWB 3AM2A 3H1YA 3S0MA 4IGPA 4M4PA 2AC1A 4XMIA 4BHPA 3GHMA 4AHZA 1VBB2 3H3ZA 1RUH3 4IDZA 4OMDA 1XSQA 1QU0A 2PQSA 4NIAA 5ABJB 4Y1UA 3AXEA 3POBA 5A7WA 1QXPA 3IDBB 3T2PA 2YC2A 5FZ6A 2JXAA 1HW5A 3KV6A 4K20A 3I7DA 1VMFA 4S2FA 4XACA 3WQ0A 4LLFA 4QWNA 5LB6A 1ND2A 4NVPA 2FCVA 1FOD3 3H9AA 4YVWC 4XJAA 4ZXKA 5CEHA 3MIFA 2ILMA 1N3OA 4ZHNA 5LW9A 3AFKA 3IMMA 2GN7A 3H1WA 1GKBA 1C4RA 5IUQA 1POQA 1MZ5A 1LOBA 4I3GA 3MFAA 4KWLA 2UY9A 2XLAA 2WBKA 4FPHA 1WLTA 4DY3A 2R073 1W8TA 4GH4C 3VKOA 2R1DA 3MPBA 4NAOA 1MS1A 2H6CA 1QF3A 3WG3A 1LOGA 1U5IA 2HBUA 2K9ZA 3DGTA 4JGZB 2Q1MA 2ES3A 2G9ZA 5JI7A 3WP4A 1KEXA 4TSVA 4UBHA 2GALA 5A3WA 3CJIC 5C4WB 2XGXA 4ISQA 4PDWA 5JOWA 3BTYA 1GOFA 5JVVA 3LF7A 2XJVA 3AKRA 4W6WA 2ZGNA 4Y1ZA 5JPMB 3VKFC 2JD4A 1WW4A 2WS92 3ILFA 3T0AA 2QTWB 3MW4A 2GNTA 1DGWX 3QBQA 2Y0IA 2ZKNA 4G9SB 1GZTA 4IV3B 4Y24A 5JIUA 5L7OC 1URXA 5J98B 3KQRA 1GNHA 3WNMA 1OPOA 1PX4A 2BOIA 3GZTB 1HQLA 1Q3EA 1AR71 2E51A 2PFWA 2A3XA 2VOXA 1UIJA 4IEXA 5FPXA 4UFLA 2BERA 1H1MA 4N53B 3HAGA 1PNGA 3HQXA 5DABA 2DUOA 1RVF3 2FDIA 2OXBA 3ALQA 4QPIB 1O59A 4LPLA 3U1XA 1LHOA 4BYYA 4JGYB 5FY0A 1QEXA 4YARA 4D7YA 3OBTA 3OTFA 3IDAA 4AHWA 4G4FA 1W2AX 1YRZA 1DLCA 1ND3A 4FAHA 3LDRA 3AVSA 4YYOA 1Y9QA 3OY8B 5T5PA 5IK5A 2NMNA 4WVVA 4ZS2A 4O65A 3ZSEA 1K45A 4TLFA 3WG1A 1X82A 5CG8A 3AJZA 1RUC1 1UY2A 2VVFA 1HV0A 1SBEA 2IFRA 4GKXA 4QPYA 3GCWA 1LOAA 4FSJA 2MNGA 1MZ6A 4MZUA 1TME3 1QDCA 3POJA 3X29B 1QQP2 2VAUA 4ARXA 5K9YA 2WQ4A 4OHZA 1RXGA 1E5SA 1JOBA 2HWC2 3CKHA 1GBGA 4UW6A 5GKAC 2MPFA 3KHCA 5FPVA 2BZDA 4WM8B 5T5JA 4KNCA 2QZ2A 2DU0A 4QPGC 4LNVA 4UF0A 2JWPA 4EYUA 4YZ1A 1QDOA 3A23A 3VHOA 4NRQA 2GNBA 3LKJA 1YUDA 3GZAA 2E7QA 1RUD2 3WXPA 4M4RA 3POGA 5FYUA 5JZGA 1Z7S3 2LUWA 4GB32 4QDSA 2V73A 4XF1A 1TQ5A 3BPZA 1YHFA 2AUYA 4KI5M 4YM0A 1CVNA 1REEA 4MGTA 4S2DA 3K75B 5A32A 1JYTA 1JYVA 4XJUA 1RITA 4WZCA 2YYOA 3HN1A 3OPWA 3I2OA 5I0UA 1VBD2 3THTA 4JKLA 1ODNA 3FLTA 4IQPA 1MR5A 4W6XA 3M3EA 2JEMA 2Z79A 2R30A 2W47A 5CZKA 4HPKA 1B35A 3R4UA 1D4M3 4JDNA 3F2ZA 3EYPA 5FZEA 4C8DA 1M06G 1ZM1A 3UJQA 4BDVB 2WFF1 3M3OA 2B9VA 1UY3A 1UU4A 2JENA 5JWPA 2VQUA 1ASJ3 1O7FA 2HWB2 1ZZCA 1VBC2 2VW2A 1A6CA 3GBFA 1MS8A 1V00A 2YC0A 4IE0A 1F9KA 1UU6A 3QACA 2B39A 4CDXA 1NXD1 2J7MA 2R7EB 3H8OA 5DZFA 5DMYA 4KWJA 5I0RA 3JBG1 3ON7A 4E8CA 2VNGA 4BMEA 1PMJX 4AWDA 1TMF1 3WW2A 1HRV1 3SC7X 2PELA 2X5IB 4HLTA 3LOBA 4CDWA 1MS4A 4UOJA 3CLPA 2LALA 4W50A 4IV1A 4XFHA 1SBFA 3B3QE 1Q8VA 5BNNA 5HPOA 2WYFA 5FZHA 3RZMA 1OH3A 4MLOA 5FDBA 5DZEA 1EP0A 3M8LA 4KWKA 4CDUA 4U36A 4XTMA 4F7ZA 1C8NA 1QJX3 2UWBA 4FP2A 3RZHA 3LA2A 5DUWA 4I30A 3WVJA 1F2NA 3JCIA 2P5BA 3IB3A 3OF1A 3MLJA 1BLZA 3VBFB 1WGPA 3VHRA 2OUHA 4D6SA 4M00A 3EJKA 5JSOA 5JAXA 1HRI3
chains in the Genus database with same CATH topology
5JDBA 2X29A 4FPCA 3AP6A 1U5XA 2IWGB 3NKGA 3USUB 2VNOA 4N7UA 4KH9A 2NPIA 2ZZQA 1WW5A 5GJ6A 2XKOA 2QDRA 3J8F3 2GH2A 4E27A 2HEWF 1H4HA 3ZFGC 5E16A 1EYBA 3GBGA 4CEYA 3E5XA 5C8CA 3PJQA 1AL21 2R063 3ZXGA 4YGCA 4PLNA 1IZ3A 1AR72 5K8SA 2DFCA 1VRH1 3I4IA 3WW1A 4WVMA 3ZYGA 3QD6A 3IT8A 5DG1A 2GC0A 4Q4V3 1LTEA 4XF0A 2HWE3 4AFBA 2E7TA 4I02A 2D97A 1W6QB 1QOTA 4PIYA 4Z07A 3ZN4A 4CYDA 1KS4A 5GLWA 5K7PA 2I07B 1CESA 4Q0SA 2JG9A 3FUOA 3D6EA 1WCKA 2A6VA 4Q29A 1FAYA 1VBE3 1QXRA 2UYBA 2HWF1 4RGAA 1LCLA 4OVEA 2VUJA 2GNDA 3WW4A 1WCSA 1CAVA 5J96B 2D6LX 5KHIA 1LEMA 1RUC2 2R1BA 2R0FA 1PGL1 2QQPA 1O3RA 3ACLA 2MHFA 2CAUA 2D6KA 1NE4A 2O8QA 1MS0A 4FPGA 3MPPG 3J4UH 5LK5A 3V56A 1DG6A 5CVRA 3MIEA 2HEVF 1O3TA 1PNFA 3IDCB 2R32A 3MW2A 3VZMA 1OQ1A 1UF2C 3VBRB 2XBO1 1POV0 1C5IA 4KL1A 3RJRA 1NG0A 1ZBA1 1I9RA 3HMYA 3WOGA 1WW6A 4P9LA 1GZ9A 4OI4A 1GYKA 5J7MA 4MYEA 1EAH3 3M4FA 4WM7C 5BNOC 1V9U1 4BZ4A 4RA0A 5TSWA 1LHNA 4XJWA 1FYUA 1BVVA 3ZPYA 4AI2A 4M3CA 2NM1A 2GSYA 1FMD3 3JB4C 3BCWA 4P9XA 4B3NA 4LBQB 1W2UA 3WDYA 3WW3A 4NO4A 2ET7A 2YHJA 1QOSA 3HT2A 4MH0E 3VZNA 4OHWA 3VBHB 3O12A 1RUF1 1GQGA 4FPFA 4FPOB 3KGLA 3DPRA 3SMHA 4Z1VA 3ZXLA 5JIAA 2R061 2WFF2 4IEYA 1HXS1 1PZ8A 2FHRA 4H55A 2XJQA 4OI0A 2HWE1 1KS5A 1AHSA 4FQ4A 2ERFA 1CJPA 5LEKA 4C1XA 2XHKA 4Y5Z0 2F6BA 1VAKA 3JBG2 1Q8OA 5A33B 4CEWA 4Y1VA 3JQXA 1TMF2 2KXLA 1HRV2 1W6PB 3IIAA 4QQ2A 1IS4A 3WDWA 4HVOA 1N47A 4K1YA 4ZU4A 3CJIB 4AG4A 4RQPC 1LULA 5A3MA 1V6LA 4AEDC 1H2MA 5JPNB 2XG3A 4RR3B 1UZZA 4B4RA 1QJY3 4R52A 4LO4B 2Q30A 2ZX0A 2OVUA 4X8NA 5FO8B 2ZGOA 4DRVA 4Y22B 1N3QA 2AYHA 3I59A 1QY4A 1YJLA 2CNAA 4GXLA 4NPRA 3WR0A 5BNPC 4K1ZA 1R1A1 3R6SA 5KXBA 2B8MA 4ES8A 1FATA 1SBDA 3NV1A 3SCFA 1RB8G 1Z7S2 5GLUA 4EN6B 4XEZA 1UL9A 3DF0A 3V0BB 5C9AA 1H8TC 1SLIA 4M01A 3RPQA 2R043 3MICA 4FVVA 5DUUA 4RHV1 1C8M1 1DZTA 1NQDA 3I2DA 5B2GB 2BNNA 3B00A 4AVAA 5HBAA 1AL22 3WQ7A 1YJKA 2WNVB 1MZEA 2DV9A 2G4IA 4Q1RA 1H2LA 4XDQA 5LRSA 1VRH2 2CAVA 2WNEA 1QH7A 5EYYA 2DWRA 4JC1A 1ND2C 4I0AA 1XYPA 1GNZA 2EXKA 3BB6A 3LWCA 2WZPP 3OGJA 5JOXA 1W6MB 4AHYA 2RS31 3ES4A 2BWAA 4DPNA 2ATFA 2HWF2 4L99A 1IS5A 2A3YA 1N1SA 1W0OA 2YPJA 3E6BA 1BBT3 2XJUA 2YMZA 4FCAA 3U07A 3S7EA 3ZN6A 2RR11 4YZ5A 1ONAA 2HYKA 1WD4A 2HJIA 1XXNA 1PGL2 1K5MA 1BZWA 1XYNA 4HVRA 4Q4Y3 5KHKA 3VBOB 1WD3A 4PDWC 2HWD3 5HCBA 4A7KA 4AW7A 5LK7B 3V65A 1IHMA 4B29A 1QJX2 2UWCA 2WIIB 2XBO2 3WNXA 1RUG3 1BEV1 1ZBA2 3U10A 2DF7A 4H14A 4LHNA 4LBMA 1C28A 5I8SA 1H9WA 2X8KA 3LSEA 3U11A 3M7AA 3UL2A 5KXDA 4DB5A 5E88A 1RMU3 3D8CA 1V9U2 1PGW1 1WLWA 4DNYA 3R4SA 1KDMA 3POSA 1IQAA 4XE9A 5GLZA 4KG8A 4I0WB 3VGIA 1ND3C 3CU7A 4K21A 5ACA1 2XJTA 4PIXA 5DDJ3 1VBB1 3OYWA 2IXKA 4Y1XA 1XU1A 2E9QA 1RL3A 1RUF2 5KC5A 4IEWA 4IEPA 2RS51 3TWIA 4K7JA 2R062 4H7LA 1QJU1 1O5LA 1UMZA 2GMPA 1CGPA 4BLJA 1HXS2 1CAWB 2RS11 4LA3A 3RYPA 5EYXA 2HWE2 2AZ5A 4XFIA 2IFWA 5L19A 3RG0A 4Q1PA 1NCQB 2EA7A 3URFA 1R1ZA 3MLKA 4DRRA 1VJ2A 1PK6A 1RUI3 1IKPA 3OJBA 2WFPA 4AFDA 4FOYA 3FHIB 1BK1A 2QCSB 3ZFEA 2YGMA 2EXIA 1NCRA 1V6KA 2P34A 2PHRA 2RJLA 2ZHKA 2W68A 2ZTNA 5KHGA 2WS91 3ZFGB 1FV2A 1DHKB 4KU7A 1AR63 3APBA 4IESA 3KS7A 2AR6A 1XU2A 4IEOA 3E5UA 1RHI3 1RUG1 4CTEA 4DS0A 2ZOEB 5DUXA 2I74A 1AJOA 1ZZ8A 4AVBA 5CFDA 5CFCA 2C5DA 1LR5A 4LBKA 1CAUB 4XXPA 2VMHA 2DVAA 4MGKE 3ZN5A 2GNMA 1BJQA 4CDXC 5FMOS 4DXZA 4QU2A 3RZZA 1SACA 4GIQA 1AXZA 1KFXL 3N7JA 1XNCA 4AQSA 5FQ0A 2D3SA 1F8VA 3VKNA 4RHV2 1D0HA 1C8M2 3FMGA 4Q4X1 1AXYA 4YM1A 1SLAA 4QXKA 4CDWC 3BIWE 5BNNC 2CWMA 1CAXB 3NKTA 4F8AA 3VHNA 2XLGA 3PHMA 1MVQA 4CDUC 1EV11 3MLLA 1DF0A 4E2GA 1KJRA 1IS6A 3TOJA 1VBA3 3VBSA 4NN0A 5CU1A 3AP4A 1OOPA 2FZ1A 2VMGA 2A6WA 3SITA 3H1MA 3RI9A 2RS32 1HDKA 5GLVA 4XETA 4OULA 1PVC1 5CNAA 1R081 5H9QA 2NP0A 1U5ZA 2D44A 5BNOB 5CADA 2VY0A 2RR12 4QM9A 1GLHA 1ZRDA 2OZJA 2DVDA 5HI0A 1F5FA 2Q5TA 3OPZA 4Q0UA 4DQAA 3AKSA 4R9AA 1G9BA 4AGVA 4CZSA 1GZWA 5H9PA 1AR91 1C1FA 2YGLA 1MS9A 1Q43A 1RUJ1 2XVKA 3VBUC 4CEYC 1MEC3 5C8CC 2ZGKA 1X36A 1CN1A 2PA7A 3MIBA 4EWAA 3VDDC 1BEV2 3TB0A 4I3PA 2YUEA 2EXJA 5ABJA 2VU9A 4L8QA 4GQ7A 1POV3 2Y26A 1YCIA 2XKPA 2QZ3A 4HZFA 2ZGQA 1PGW2 2B46X 4N9HA 5CG9A 1Q8QA 2JG9C 3ZX7A 4E2QA 1RGSA 4BIOA 2D6NA 1OA3A 1YI7A 5ACA2 2GC3A 1BMV1 2PHFA 1BYHA 2C0ZA 3OD4A 5CA6A 5JMCA 1VP6A 3H0OA 1APNA 3TN93 4AE2A 4Y26A 1JBCA 3WQ1A 2VQAA 3ST7A 2C1FA 2WWSA 1Y43B 4XFAA 4BA6A 2RS52 4K3UA 3A4UA 5BY5A 4RQPB 3O0WA 3AYCA 4EV0A 1QJU2 4JGZA 4JQRA 1EY2A 4NR1A 4QD2A 4BCUA 4G3YC 1QWRA 1WMDA 5C4WA 2RS12 5CIRA 3D0SA 4XFBA 2D6MA 1AYM3 4WV8A 3ZSLA 3ZYIB 1FV3A 4S2GA 4IV3A 3N36A 2GMEA 2CGNA 2BFUL 3WG4A 3CO2A 2HEYF 2QVSB 1S0CA 1F31A 1GICA 4N53A 1MQTB 4LTAA 4Q4W3 5AVPA 1PO13 2GH8A 3JZVA 4QPIA 4Y20B 3RDIA 5LRRA 4JGYA 1H8TB 1FPN3 1R091 3L2HA 3NWKA 1ENQA 1DYPA 2VG9A 3NV2A 1GFF2 2MEV1 4X8PA 5T5LA 3OY8A 1LHVA 1Q5OA 3BALA 1QMJA 1VAVA 1RUNA 1VLNA 3RNSA 1PZ9A 2ZHLA 3BOWA 3DPRC 4DZGA 1QJZA 2ARXA 3PVEA 1RUG2 2DU1A 1JUIA 3UJOA 3C3VA 1J58A 1ULCA 2P17A 4DY5A 3WCRA 3UKNA 3KCYA 4XFFA 3T2TA 1WBFA 4YVSC 3ZFFB 4WM8A 1BCXA 3KT1A 2SBAA 1OA2A 1W6OB 4BOWA 1O4YA 4EJRA 4TWTA 1C3HA 4CEWC 4Q4X2 1PIV3 4FTEA 1RUH1 1JXNA 4XPVA 1J3PA 1I5ZA 4WBBA 5JOZA 1W0PA 4Y1YA 2BVBA 1EV12 1AR83 4Q27A 3AB0A 1ZVFA 3O5SA 4K9SA 1Z0HA 4LBNA 4HSLA 2DCJA 3KLSA 1ULFA 4LHKA 1FOD1 2VW0A 4NHLA 3UV9A 1AZDA 5JOYA 2A70A 2WNUC 1PVC2 4YG0A 2ZS6B 1R082 1O5UA 2K2SA 4K8FA 4QX5A 2NLRA 4Q2FA 4WVZA 5D8AB 2RMU3 3I8TA 2R071 5GM0A 1VIWB 1SCRA 2PN5A 1S55A 5FCCA 1ND3B 1RUI2 2WZR3 3RMYA 2FZ2A 2JE9A 2WLQA 4XIOA 4EROA 5C9AC 1S0FA 3WUDA 2E7AA 1HX6A 4GMP0 4YZ2A 3H8UA 1AR92 4JDMA 1RUJ2 5I0SA 4I01A 3SXWA 4YM2A 1NA1B 2X5IA 2JKBA 3MGUA 3RYRA 1LOFA 1AVBA 1SLCA 1NYWA 2P3IA 1OSGA 3KGZA 4YGDA 2CY6A 4AQ6A 5AC93 1RVF1 1COV3 3VHPA 3N4MA 4MGZE 3MYXA 1ZRRA 3ZSKA 1UU5A 3LZZA 3T1LA 4LULA 3AMMA 3VBFA 2O0OA 1C5HA 1LHWA 1BMV2 2XH6A 4MSVA 2TBVA 3FWEA 4M3CF 1KJLA 4URTA 2ZGPA 3POYA 4AEKA 2JG8C 3B5LB 1CIWA 2A6XA 4C90A 3N7MA 3RRDA 1FX5A 1NXMA 4EN9B 1HKDA 4WZFA 1TME1 3RYKA 2Q1ZB 4R9BA 4MV2A 2UURA 2ZGUA 1AR81 4HPKB 1DIWA 2PAMA 4C1WA 3NO8A 3TNQA 2RM23 2JE7A 2NN8A 4E4SA 1AX1A 2IXCA 3WDVA 1J3RA 2YV8A 3ROUA 5J37A 3ZIXA 1Z7S1 1WMFA 1XNDA 1WCDJ 1H1AA 5K0UC 1YFYA 1W6QA 2QKDA 3R0RA 4AFMA 1R092 5KWRA 1DU3D 2MEV2 4B8EA 4YNIA 2DCTA 1GV9A 5GLTA 1D4M1 1ZBE3 4Q26A 5H9RA 2VW1A 1AYN3 4IXLA 1ASJ1 3NJZA 2GZWA 1RUE3 4Z82A 5DG2A 3V0AB 2JX9A 1LENA 2VVEA 2D6PA 2RHPA 4LA2A 2XWJB 1T6GC 2DVGA 5J3UA 4CDQB 1EPWA 3VBRA 5E8AA 2ZAAA 3JD73 2QE3A 3I54A 1IGOA 2NZ9A 2BPA2 3EO6A 2V09A 4PBPA 3ZYRA 1RUH2 4X6RB 3U0ZA 3U4XA 1ZZ7A 1KRIA 4XOGA 5BPXA 4B7EA 3MW3A 4YGBA 1NCRC 2ZHNA 3WT3A 1CJDA 4XQWA 1LJ7A 4LBQA 1LGNA 1QJX1 3AKPA 4FOQA 5DUVA 3VBUB 3S30A 5EZWA 3VBHA 3VDDB 3RQ0A 1FOD2 4RS5B 3EXUA 3OGGA 1WA4A 3IN9A 4YLZA 5E89A 2WA4A 1HRI1 4DMIA 5IK4A 5CFDC 5CFCC 1LODA 1OLRA 1IPKA 1BVP1 2R072 3IPVB 4OUMA 4LHLA 4OZXA 1G9AA 1LB2A 1SEFA 5IK8A 2XWBB 1J1LA 2WJSA 4BIFA 1SDWA 4N90A 1VAMA 5I91A 1UZYA 3AYEA 2TUNA 1N1YA 3KB5A 5EV7A 1H9PA 4N43C 3VL9A 1XYOA 3J8F1 4Q0PA 4BYYA 4JV4A 3OBRA 3W9AA 3WX5A 4XJZA 5A33A 2BBVA 2ZBJA 1W6NB 4GKYA 3RWNA 3FUQA 1ZNPA 1WW7A 4XFGA 2ZACA 4CP0A 3CJIA 4YVWB 3C2UA 3KM5A 4Q4V1 2N7GA 1RVF2 3VBSC 4RR3A 4XYXA 2KM2A 3E5QA 4XFCA 2NYYA 4QQOA 2PHUA 4L97A 1A78A 5FAXA 1VBE1 4GH4B 4Y22A 4HFSA 3ZSMA 3ME2A 4A3XA 4J1XA 2WL1A 1S0IA 1OFNA 1HLCA 1UCXA 4YRDA 5BV6A 4HK8A 4IL7A 4BWOA 1SLTA 2ZX2A 1BKZA 3AMNA 4OHVA 5BXXA 4Q8KA 1TME2 3J26N 3R05A 3CL1A 3V0BA 4HBNA 1Z78A 1NOVA 3B93A 3GHNA 1AR82 5L7OB 4AFAA 4NOTA 1A3KA 2ZCWA 3H7JA 3M3CA 3WDTA 2GC1A 4NWWA 1IS3A 1WUVA 4GWNA 1G7YA 2WNVA 3MIGA 1EAH1 4XQ4A 2XVGA 4HN0A 4YVSB 5T55A 2PLV3 1JYCA 1W6MA 1FMD1 2GAUA 4EWEA 1C1LA 4X6QB 4P5HA 3SNMA 3ZVXA 3POWA 1ZYBA 2W08A 1CR7A 4MVTA 4MGIE 1LU1A 5A3LA 1GSLA 1PO23 5T52A 1D4M2 4JTOA 4LT5A 4AGGA 2AGSA 1XNKA 2CGOA 4JGZC 3VBOA 2A73B 4AI0A 3HIFA 2B42B 1M4WA 1ASJ2 5C4WC 1PGSA 4QPGB 4QT6A 2OZ6A 3QLQA 2C9AA 1ZZ9A 1ALYA 3MZHA 1ULGA 2WNUB 4ASMB 1JYIA 2EAAA 3PJYA 4P9JA 2B9UA 5I93A 1YI9A 3IDEA 5H9SA 1YXWA 3ZXEA 4XBLA 4BM8A 4S2HA 4R4ZA 2ZMLA 3KCCA 3ZDSA 4QPIC 4N9IA 5DZGA 5F1RA 4JGYC 1LRHA 2B45X 1OLQA 3MF6A 3WHTA 4XZPA 1A8DA 3WD5A 3FX3A 5C8WA 2WLPA 3TNPB 1QJY1 2ET1A 3FE5A 3ZMNA 1G6NA 1QNWA 3M1HA 1V6NA 4P9YA 3D0JA 4N7IA 1RUOA 3NAPA 4H7MA 1HRI2 4IEZA 3W58A 1LECA 3ZXFA 2LTNA 4CP1A 3MIDA 5KHJA 2QJVA 4D7TA 2DFBA 1XE8A 1O91A 4AVCA 5CB7A 3NW4A 1CAWA 2EAKA 4HL0A 4BMBA 4RFT0 4WM8C 5T5OA 2A7AA 2W52A 4LO6B 1CONA 2R041 3AKTA 3J8F2 4XF9A 1NCQA 2JG8B 5GZFA 1S0BA 1DZQA 3NSTA 4GMP3 4PCRA 4YFWA 2GMMA 2QFEA 3NL1A 3AMQA 3D82A 5HCAA 2FMDA 3FFZA 2X53S 4Q4V2 4FPYA 3LA3A 2AH2A 3ZFGA 1AL0G 3PMSA 1REDA 4FPJA 1QQP3 1VBE2 2HWC3 5JZGC 3AZZA 4QGMA 4HVQA 1BBT1 4K6BA 1N3PA 5K0UB 4ZU7A 5SV5A 5GZEA 5FLJA 4L92A 4QHBA 4Q4Y1 1RUD3 2ZGLA 2KA3A 2ZX3A 1GR3A 1KXGA 3WZ1A 4E4ZA 4GB33 1WMEA 2HWD1 3AP7A 4PJYA 1H1IA 1B35C 2K0GA 2EVXA 4FT8A 4PLMA 1VR3A 2R6QA 4HSJA 3WV6A 2WT1A 2AREA 2X5IC 4F83A 1JW6A 1VBD3 1LOFC 3DL3A 1CAXA 4AVVA 3B9CA 3LCPA 4MXVA 4COVA 4R9DA 1G86A 1EAH2 1RMU1 5J09A 4RSUA 1A8MA 1YFXA 1AXKA 3H7YA 4BH9A 2ZMKA 1H4GA 1FNYA 3FLPA 5KXEA 3E6CC 1DQ1A 1FMD2 2HWB3 4JTNA 5FRAA 1X50A 3ZSJA 1ZZBA 4COWA 5DDJ1 4XF4A 2JDZA 2E53A 5BNOA 4IV1C 4OI2A 4QGLA 3AK0A 3ENRA 5E1RA 2Z69A 4MXWB 1NCRB 1WBLA 2W39A 4UW4A 2IXIA 3MF9A 2D40A 1QHDA 3M3IA 3WLUA 3Q9OA 2XLFA 4D69A 1KFUL 1LOEA 4WM7B 3USSA 3MDPA 1S2BA 2OPKA 4IETA 2BNOA 4OLLA 4OI1A 4B7KA 5FLIA 1LGCA 1RUI1 1KITA 4Q0VA 2JICA 1S0JA 1UKGA 4LBOA 3M3QA 4N43B 4AQTA 2WT0A 2XJPA 3O0XA 3WG2A 2YZ4A 3VZLA 1QJY2 3AX4A 2GU9A 5BNQA 1CPMA 2YROA 2OA2A 1AR61 1XNBA 1HV1A 4DFSA 2DCZA 1RHI1 4HT1T 4FO9A 4RQPA 4Z2WA 5AFEA 3ILNA 1YNAA 1YIPA 4OUSA 2A71A 3LSDA 3ES1A 1AR73 1FNZA 3N7LA 5KXCA 4W65A 1H2KA 4AEJA 1IPJA 3ZO0B 3DV8A 3K51A 3QCWA 5BYNA 1V6OA 2R042 3AZVA 3NV3A 4R9CA 2ZGMA 3VLBB 2ZA9A 3B02A 1MQTA 4AEDB 4Y20A 3UKTA 1RC6A 2EIGA 1PO22 3PNAA 1H30A 4AQ2A 4BQ1A 1H8TA 2XJRA 3L2YA 3KD4A 1RUC3 4YW5A 2A6YA 1VBA1 2PQQA 2BYVE 2E6VA 3PTYA 3VBHC 3ZXDA 1UX6A 1FI2A 5BNPB 3ZXKA 1DGRN 4FOWA 1ULEA 3VZJA 3AXDA 4RGGA 3TAYA 1ENRA 3WP3A 2BEOA 3EBRA 4UBGA 1JUHA 1BBT2 1MS5A 3D4KA 1OD5A 4BLIA 2VNRA 2PHXA 3G7DA 4IEVA 1DLLA 4Q4Y2 2VOVA 1UD1A 1LOCA 5JR7B 3ZFFA 4D7SA 3BODA 1O4TA 2HWD2 2FBEA 3MFCA 4YFZA 2ARBA 1W6OA 4LO5B 4AGRA 2VUAA 1JOJA 4EN7B 1H2NA 3HT1A 3AZWA 2ZZJA 1MEC1 3AFGA 1KQRA 3GZUC 4LUKA 4YM3A 1ND2B 5F6LB 1DQ0A 1DZRA 1NLRA 4NHKA 4OFGA 1POV1 2WINB 2D7FA 1XE7A 2BW8A 1FXZA 2BUKA 5GALA 4A2UA 4RR3C 4O9EA 1RMU2 2WFF3 3CJXA 3IWZA 1E57A 2OUJA 2VXRA 2ZPXA 3TRSB 5EWSA 5I8TA 3AMHA 1Q8PA 2TNFA 3SCGA 5DDJ2 4IEUA 3TN91 4META 4QQPA 1VALA