4JGYB

Crystal structure of human coxsackievirus a16 uncoating intermediate (space group p4232)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
244
structure length
239
Chain Sequence
ACGYSDRVAQLTIGNSTITTQEAANIVIAYGEWPEYCPDTDATAVDKPTRPDVSVNRFFTLDTKSWAKDSKGWYWKFPDVLTEVGVFGQNAQFHYLYRSGFCVHVQCNASKFHQGALLVAVLPEYVLGTIAENSHPPYATTQPGQVGAVLTHPYVLDAGIPLSQLTVCPHQWINLRTNNCATIIVPYMNTVPFDSALNHCNFGLLVIPVVPLDFNTGATSEIPITVTIAPMCAEFAGLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyprotein, capsid protein VP1
publication title Picornavirus uncoating intermediate captured in atomic detail.
pubmed doi rcsb
molecule tags Virus
total genus 43
structure length 239
sequence length 244
ec nomenclature
pdb deposition date 2013-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4jgyB00
1COV3 3CJIB 4RS5C 3VBUC 1R081 2ZZQA 2HWF3 2HWC3 4CDXB 1BMV2 1RUJ2 1TMF3 3NAPA 2RM23 5AC92 1NY71 1OHFA 1X36A 1RVF2 1QJX1 5ABJC 1RHI1 1B35C 1PO23 1RUE2 2HWE3 2MEV1 5C8CA 1RUG1 1AYM2 2WS93 4RQPC 4CDQC 1RUC2 2XBO1 2WZR1 4RHV2 3ZFGB 4FTEA 3VBSA 2RS53 1MQTB 1PVC3 4YVWC 5BNNA 3IDEA 1DDLA 1C8M3 4YVSB 2BBVA 1R082 5BNPC 2HWB3 5K0UA 3VBHC 4WM8C 1AR93 4SBVA 1AUYA 4CDWA 1NY72 1COV1 2GH8A 1QJX2 2X5IC 2ZTNA 4RS5B 3VBRA 1RHI2 1RB8G 3VBUB 2MEV2 2HWC1 1NCQA 1ZBA1 5L7OC 3DPRA 1TMF1 2R061 2WZR2 2XBO2 4Z92B 1W39A 1IHMA 3TN92 1F2NA 1TME3 2BFUS 1PIV3 4CDUA 1PO21 1RUJ3 5ABJB 4IV3B 2HWE1 1VBC3 5AC93 4JGYA 1PGW1 1MEC1 1NG0A 4RQPB 4CDQB 1PVC1 5GKAC 1COV2 1RUE3 4YVWB 4QPGC 1BEV1 4CEWB 5CFCC 4RHV3 2HWF2 3HAGA 5BNPB 3CJIC 5D8AA 2HWC2 1ZBA2 3VBHB 4WM8B 1TMF2 2R062 4PDWA 1K5MC 4GB31 3ZFFC 2X5IB 4Q4Y3 1QJZA 1PO22 1OOPC 2HWE2 1ND2C 4GH4A 1PGW2 1NCRC 1MEC2 1QJX3 1PVC2 2MEV3 5DDJ1 1C8NA 4WM7A 1D4M3 1RUG3 4N43A 1PIV1 1BEV2 1VBC1 1FPN1 5A33A 1WCDJ 4Y5Z0 4YVSC 1QQP1 1H8TA 1RUD1 5J96B 5JZGB 1F8VA 4GB32 4FSJA 4QPGB 1EV11 1B35A 4QPIC 4N53A 5CFCB 4AEDC 4Q4W3 1RUI3 5CFDC 1VRH1 1X33A 2RR13 1VBA3 5DDJ2 1K5MB 1TME2 1ZBA3 1PIV2 4Q4Y1 3ZFFB 2R063 4JGZC 1VBC2 1OOPB 1FPN2 1ND2B 2IZWA 1NCRB 1RUD2 4RFT0 4IV1A 4IV3C 1OPOA 1Z7S3 1D4M1 1ZBE1 1MEC3 1EV12 1VB2A 1RMU1 5FOJB 4EJRA 3VBOA 2RS31 5L7OA 4CEWC 1VRH2 1BEV3 1HRI3 1VBB3 2WFF3 4Q4Y2 1POV0 1ND3C 4Y4YA 4QPIB 4AEDB 4Q4W1 4GB33 1RUI1 5CFDB 2RR11 4BCUA 1VBA1 1FOD3 1D4M2 1RUG2 5C4WA 3NAPC 5BNOB 1GFF2 4RR3A 1NA1B 4JGZB 1R093 1POV1 3CJIA 5A32B 4Q4V1 5DDJ3 2RS32 1AR73 3ZFEB 1QJY1 5C8CC 1Z7S1 1FPN3 4CDXA 5JZGC 1M06G 1QQP3 1RUD3 1ND2A 4Q4W2 1E57A 1RUI2 1HXS3 1EV13 1HRI1 2RR12 1VBB1 1VBA2 2WFF1 3VBFB 4CDWC 1BBT3 3ZFGA 1ND3B 1VRH3 1MQTA 4Q4V2 1AL23 1HRV1 1QJY2 2HWD3 4YVSA 4NWWA 2XPJA 1FOD1 1Z7S2 2Y26A 3DPRC 2WLPA 2R071 2R043 3NAPB 1R091 3VDDC 1ZBE3 1AR71 4RS5A 4CDUC 1SMVA 1HRI2 1RMU3 3VBUA 4JGYC 1VBB2 1VBE1 2WFF2 2GSYA 5C8CB 1AR63 2RS33 5FMOS 1PGL1 3VBSB 5BNNB 5A32A 1AR83 3JD71 1HXS1 5ABJA 5D8AC 4IV3A 1FOD2 2WWSA 4NWVA 5K0UB 1BMV1 2R072 3JBG1 4PDWC 1BBT1 1PO11 4RQPA 4CDQA 4CDWB 3J8F1 1R092 1FMD3 1VBD1 1AL0G 4YVWA 1AL21 1AR72 5BNOC 1V9U3 2HWD1 3VBRB 4CEWA 1NA1C 2PLV1 4GH4C 1VB4A 5BNPA 1VBE2 1POV3 1NCQB 2BPA2 2R041 3DPRB 4Q4V3 3ZFEC 3VBHA 4WM8A 1HX6A 1QQP2 1PGL2 1QJY3 4WM7C 5ACA3 5FMOL 1CJDA 3VDDB 4N43C 5C9AC 2X5IA 3JD72 1HXS2 4CDUB 4CEYC 2VQ0A 4GMP1 4JGYB 2QQPA 1RUF3 2FZ2A 1AR61 3FBMA 1H8TC 3JBG2 1BBT2 2RS11 1PO12 1ASJ1 3J8F2 1VBD2 3VBFC 1AL22 1AR81 2RMU3 2HWD2 4N53C 3JB4C 2PLV2 1R1A1 5D8AB 1RUH1 2R042 5JZGA 4PDWB 1HRV3 1HQNA 1FMD1 3TN91 1EAH1 5J98B 1AYN3 1ZBE2 1VAKA 1V9U1 4QPGA 2R073 3S6PA 1RMU2 5CFCA 4GH4B 1AR62 2RS12 4IV1C 4Q4X1 1ASJ2 1QJU1 5ACA1 1VBE3 1K5MA 4WM7B 1AR82 1NOVA 4N43B 3ZFFA 5C9AB 3VBSC 4CEYB 2HWF1 1R1A2 2TBVA 5BNNC 1OOPA 1RUF1 3VBOC 4FTBA 5A33B 1RUH2 1NCRA 1H8TB 2RM21 3JD73 3JB8A 1FMD2 1EAH2 3VDDA 5K0UC 2RMU1 1V9U2 3JBG3 1PO13 1B35B 4N53B 3J8F3 1VBD3 2WS91 1RVF3 5LK7B 3VBRC 4FTSA 4Q4X2 2RS51 1A6CA 1QJU2 5ACA2 2PLV3 1NCQC 5C4WC 1AYN1 3ZXAC 1C8M1 2ZAHA 1AYM3 4RR3C 3M8LA 1RUC3 2HWB1 4QPIA 1RUF2 4AEDA 3LOBA 1AR91 2RM22 4IV1B 5CFDA 1R083 4GMP3 4CDXC 2FZ1A 2RMU2 4LLFA 5BNOA 2RS13 1NA1A 1ASJ3 2BFUL 4JGZA 1CD3G 2WS92 3VBOB 5L7OB 3ZFEA 1HRV2 1RHI3 2BUKA 2RS52 1R1A3 1AYN2 1TME1 1C8M2 3ZFGC 1RUH3 5C9AA 1RUJ1 2XBO3 2WZR3 2HWB2 1MQTC 4CEYA 5AC91 3TN93 1EAH3 2DF7A 1RVF1 1AR92 4GMP0 1RUE1 1AYM1 5C4WB 3VBFA 1RUC1 4RHV1 4RR3B 4Q4X3 1ND3A 1QJU3
chains in the Genus database with same CATH superfamily
1COV3 3I3EA 5FTTC 1UL9A 4WZFA 2QQIA 3ZYPA 4IEQA 1R081 2E9QA 2TEPA 2ZZQA 4YWAA 5KXCA 2HWF3 4E2SA 2WINB 4LO4B 1O3TA 4M3CE 1NLRA 1XNAA 1BCXA 1ST8A 1JYCA 2VW0A 3CF6E 4FPFA 5F5QA 3OYWB 4LTAA 5A3WA 1PK6B 2ZGNA 1OHFA 2GC2A 2V09A 2ZX3A 3LEGA 4CU9A 1G8WA 5IVEA 2AZ5A 3H3ZA 3B9IA 1RIRA 1UOGA 3GGLA 3DYPA 2A6YA 4EZ4A 1WCSA 2MEV1 3QH6A 2OW4A 2VZVA 3MV11 5C8CA 3RJRA 4YM2A 1FX5A 4XQDA 1C5HA 2BOIA 5BY5A 1RUC2 2XLFA 2WKKA 4RHV2 3PHMA 3ZSMA 1MQTB 1PVC3 4NVPA 4OHYA 4BXSV 4I30A 5EWSA 1GWMA 5FPBA 3FHAA 5DQ0A 4HKLA 4S2GA 1W8TA 5IAXA 1LTEA 1KITA 1MPXA 1NQJA 4GQ7A 2VD7A 4PBOA 4QWNA 5FBZA 3VBHC 1YJLA 1MS3A 4SBVA 2A6WA 1Y3TA 4ASKA 4XQWA 4CDWA 5FYBA 4WZCA 3QLQA 1XE8A 2WN2A 3MPBA 2F4PA 2CTVA 4NAOA 2ZTNA 4RS5B 1S2BA 2VZTA 3VBRA 1RHI2 3G6JB 4AVVA 1RB8G 2D6OX 1XPWA 3GCWA 4O9EA 3T3YA 3VBUB 5J36A 4OMCA 4FFFA 2HWC1 1ZBA1 2ARAA 1REDA 2B9UA 3B02A 3TYJA 1TMF1 2WZR2 1RTVA 2XBO2 5G04L 1JZ2A 2GH2A 1W39A 3QD6A 4NHMA 5FZFA 2YDEA 3VHPA 1BYHA 3KF5A 1RUNA 4YW5A 2YMZA 3AVSA 5ABJB 1LNSA 3K4AA 1MVEA 1LJ7A 4EN0A 3RQ0A 4OUSA 3BTZA 1JI6A 2ZHKA 2XGXA 1SLCA 4EN9B 2UY8A 1LAJA 4AI8A 1W05A 1GBGA 2PXJA 1BLZA 1J3RA 3QCWA 4A42A 4GJZA 1O5LA 4LKFA 1JYNA 3SQOA 2O8QA 3N9LA 1OURA 1ZRIA 3T2OA 3R6SA 3AVRA 4M3CF 5KHKA 2NMOA 2J1SA 2VNGA 1WW6A 1A8MA 3C2UA 1CX4A 2QE3A 3GF6A 3HPNA 4WM8B 2DFBA 1JXNA 4ORFA 4FXKB 2ID4A 4H7LA 5LW9A 1L7LA 1ZYBA 2YFZA 2X5IB 4ES8A 1PO22 4XYXA 3ACLA 4UFHA 1XNBA 2GC3A 5FP3A 4GH4A 1PGW2 1YC61 3OGSA 2ENRA 4HN1A 5FYMA 4Z1VA 1QJX3 1W8ZA 2FMDA 3ACGA 1FYUA 4IGOA 4M4RA 5A3NA 1ZREA 2QJVA 1PHMA 2BERA 3OF1A 3GYDA 4H55A 1Y9GA 1V6LA 2OQ6A 4AG4A 1C8NA 3PDQA 2EIEA 2C24A 1D0GA 3POFA 3WNMA 1OLQA 3KGLA 1VIWB 2D3SA 4QDQA 1KXGA 3M3QA 2VMEA 1K12A 1LB2A 4KG0A 4JRLA 5SV8A 2VZ1A 3U4SA 2R30A 4HN0A 1MS4A 4YG3A 4RA0A 2OA2A 5DN2A 2WDBA 3E5XA 3JZVA 1W6MA 4Q1RA 5B4NA 3M2MA 1H1MA 1UYXA 2JICA 5FYTA 2ZGLA 1M4WA 4GB32 1N3QA 2FHRA 3ZO0B 1ZZ6A 1EV11 4DO0A 2XONA 1B35A 3OEAA 2K9ZA 4XFFA 4AEDC 4AGVA 4AL9A 1S4CA 4D7YA 3UK9A 3O7OA 4IEPA 4CYDA 4Q4W3 1PZ8A 3FUQA 3GALA 1DFQA 2WO2A 1RUI3 2JE8A 5FY7A 5DDJ2 3WT3A 5KXDA 1HB1A 3VD5A 2VOKA 4Q4Y1 3AB0A 4ZS2A 2WRAA 2R063 1GLHA 4B3NA 5F3CA 1UZ0A 1BK0A 5DAVA 1CZTA 1OOPB 1ND2B 2QQKA 3O1RA 4HVQA 5HV0A 2D97A 4A3XA 2JDNA 5A1FA 1ENRA 1XYOA 1RUD2 2EICA 3C8XA 4IV1A 1GMMA 4G9SB 5C3QA 3E6CC 4Q8KA 3I97A 5IJRA 4QPWA 1EUUA 1D4M1 1W6OB 4ISRA 1X9TA 1PMHX 5FXWA 1GU3A 2BZDA 1GNYA 3BIWE 4NRQA 5JOXA 4MLOA 1RMU1 2ZKNA 5JOZA 3BU0A 3LIHA 3NNFA 5JI9A 1J58A 4Y1YA 4FAGA 3HNYM 2RS31 2ZMNA 5L7OA 2YBKA 3GJAA 1CJPA 4CPBA 3S0MA 1BEV3 1AXYA 5BUVA 4I01A 2YGLA 2FDJA 1VBB3 3SCGA 3AYAA 3KWVA 3PL0A 2GMMA 3RI8A 4AAPA 4P14A 3P3NA 3V56A 4AFCA 4R9CA 5BYNA 3IB3A 3IDBB 5FYZA 2F4LA 4DZGA 4BOWA 4XHXA 2HEVF 2P6HA 4QPIB 4OVEA 1CAWA 1NXD1 3BTAA 4UF0B 2DYCA 4K40A 4UXAA 2D93A 5CFDB 4AQTA 5CZKA 1DQ6A 4COWA 1GZCA 4HLTA 3WDWA 1MS0A 2XDVA 4FOVA 4Q0VA 5A3PA 1O3SA 4UOJA 3BU7A 4LLOA 3ACIA 2W0XA 2YU1A 1NA1B 4AXOA 1SEFA 4CA9A 2WN3A 3ZXLA 1JZ6A 2RDQA 3DKQA 4W65A 2Y6KA 1OBNA 4Q4V1 1JZ8A 3LA2A 1QJY1 4IE0A 1MR5A 5DAWA 4PIYA 3S7IA 5C8CC 2DCTA 2A3YA 4XXPA 1A8DA 4BA6A 2R1DA 2KD7A 2VOTA 5HXVA 2AEYA 5B2GB 1D2SA 3T0DA 1VMJA 4AEKA 3OYWA 3H3LA 3TEWA 1PK6A 4QX7A 5A7SA 1JMUB 4ASMB 3ZR5A 4Z82A 4C90A 3VKMA 2Y8KA 3ELNA 3EXUA 1QH7A 5GZGA 4MGSA 4CUBA 3EHKA 3U14A 4IDZA 1HRI1 2DV9A 2W5FA 1F5FA 5J48A 1XBFA 2WFF1 3POIA 2BJSA 2IXHA 3HN1A 2P6CA 4BMBA 4CDWC 4SLIA 5J09A 3K3NA 4YRDA 1LGCA 4DY3A 1VRH3 3R4UA 1MQTA 1MZ6A 4UW4A 3DYOA 4E27A 1CN1A 2JDAA 3E5UA 3AXDA 5LY2A 2X8KA 2IFWA 3KV6A 3N9NA 4NWWA 3ZIWA 2XPJA 1Z7S2 1XQNA 2J1EA 3MGUA 5C3OA 3DL3A 3VL9A 5A7NA 2WLPA 2R071 4MUVA 3ZDSA 3NAPB 2H0BA 1MS8A 4Q0UA 2Y6GA 2CGPA 2W94A 3DEMA 1ULGA 2BU9A 2Q4SA 1J84A 1ZBE3 4RS5A 3MIFA 1JODA 1W2OA 4LITA 3VBUA 1SLTA 2Y60A 5FZGA 2GSYA 1NXMA 1HN1A 4QGNA 3ILFA 4YM3A 2ZEWA 2VUCA 2VBPA 1ULEA 1S2KA 1JUIA 2R0FA 5L9RA 5A6QA 4F8AA 1HV1A 2C5DA 4NUBA 4FPYA 4OHZA 3MFAA 3FHIB 2XJUA 5EQUA 5I91A 1AR83 4Y3OA 1ULOA 2YYOA 4MSVA 5ABJA 5JMCA 2PHXA 1ZRDA 3PLQA 4Y22B 2ILMA 5ANNA 4K1YA 1UU6A 4GWJA 5K0UB 2VUAA 4AI9A 1DGRA 2X29A 4AF9A 3PNAA 4ZU5A 1UPIA 4XBQA 4UFMA 2CDOA 1WCQA 3VDCA 4ATFA 1AR72 1UYYA 1RJ7A 4LHLA 5BNOC 1V9U3 3ALQA 3ETPA 2VU9A 2L9LA 3A0KA 3ZN6B 2PLV1 4GH4C 4AHYA 1VBE2 1W6NB 1POV3 1Y4WA 4J1WA 2HBTA 3B93A 3ZFEC 3DPRB 3WF0A 5KHHA 4WM8A 1HX6A 1PZ7A 1XNCA 2GP5A 3A4UA 2A73B 3UESA 3SISA 4LO8A 4IEZA 4AOCA 4BISA 1PGL2 1UU5A 1HQLA 5ACA3 3KT4A 5FMOL 3ZN4A 5FZIA 2QQWA 4XAAA 5EFUA 1QMJA 2VC9A 2X5IA 3H50A 1HXS2 4QKNA 4BQXA 4CEYC 4NIGA 3BOWA 1DG6A 3UNPA 4GWIA 2IXIA 1RUF3 2OZ6A 2A70A 1TE1B 3T1LA 4YW4A 3S57A 3J26N 3FL7A 4YW1A 2RS11 1PO12 4HPKB 4HBNA 1ASJ1 2FDKA 1J1LA 2J42A 1VBD2 2ARXA 1NT0A 4NAMA 5FZDA 5IVBA 4NRMA 4BK4A 2CWMA 3VBFC 1AL22 2J22A 2RMU3 2BYVE 2HWD2 5FZCA 4F7ZA 3ZYRA 4R9AA 1XXNA 2VZSA 3ILRA 5AVPA 5I93A 2B39A 4UFKA 2YPDA 3AC0A 4LEJA 2KXLA 2R042 4RFRB 1HRV3 3B01A 1UOBA 4AYUA 1HQNA 1VR3A 1H9PA 1NKGA 3TN91 4XUQA 5J98B 1GKBA 5L19A 1VAKA 4HK8A 4J6GA 1RMU2 2O14A 4FFHA 3BI3A 5DAPA 3PJYA 3MIHA 1OLME 2GMPA 3APBA 3UT0A 4PT6A 4E9KA 4IV1C 5C5TA 5J37A 2BV4A 1UIKA 2UYBA 1J3PA 1F4HA 1ZZ9A 2JJ6A 2WC2A 1S0DA 2Z69A 3QBQA 4AHWA 2FD8A 1X50A 4N43B 5CAZA 2DUPA 4Q0QA 5I0RA 2JWPA 2X09A 1R1A2 2TBVA 5LRRA 5A1AA 4OLLA 1OOPA 2QBXA 4IETA 4DIQA 3DV8A 2P37A 1QH6A 3WDTA 1RUH2 4GJYA 4YFZA 1OF4A 2DTYA 1I3HA 3CLPA 4QPYA 4QU2A 4P9WA 1H8TB 2RM21 4S2FA 1ZA7A 1REEA 5JVVA 2D6PA 1EAH2 3T0BA 1IS5A 3ORJA 4OFGA 1W6OA 4XABA 2D5HA 1IQDC 1HW5A 4XAEA 5L9BA 2HJIA 4FFGA 1YI9A 5EIYB 1GICA 4Z07A 1ZZ7A 1DHKB 1XB9A 3JBG3 3RFRA 3T4HB 2EIDA 1EUTA 3CO2A 3EQEA 3KV9A 4JQTA 4N53B 4PLOA 2WS91 4W50A 2YC2A 3TRSB 4A45A 2VZOA 2FMYA 3RWNA 5HXMA 4Q4X2 1UX7A 4BB3A 3GBFA 1LECA 3VV1A 3O1TA 3I3MA 5IW0A 1A6CA 4DEVA 3GZTB 2LRPA 3POEA 2F6BA 2BNNA 1AYM3 4CPBD 5A3OA 2NPIA 1DQ0A 5CIRA 1Q8QA 3W58A 2P3YA 3BOPA 4QPIA 1Y9MA 1DU3D 3LOBA 4DXSA 4UF0A 2DU0A 4Y33A 5BNQA 2Y6LA 4S2HA 4P9GA 4OI4A 1QXJA 1YHFA 3KF3A 5CFDA 1R083 3AP4A 4FBFA 3IMMA 2FZ1A 2VZUA 2R7EB 3J7NA 1AF9A 1H4GA 3WEZA 3KT1A 1KS4A 2P3IA 1G9FA 3KT7A 1TG7A 1NA1A 3WOGA 1PK6C 3OOXA 5FYUA 5FPXA 3K2OA 3OD0A 4DRRA 1F31A 3WNOA 2Z4FA 1MVQA 3KZ4C 4YFWA 3RYPA 3H7YA 2BWAA 3V64A 2ZGTA 3FLRA 1GWKA 4COYA 1UAIA 2FDIA 2VJXA 2QQOA 1AYN2 4HONA 3MW2A 1WBFA 4LNVA 3TOJA 1W28A 3D5OA 3MYXA 3JU9A 2WWUA 3DCQA 5C9AA 1GUIA 2RV9A 2YB7A 1MQTC 5IVCA 3KCCA 4AQ6A 4P02B 1YQ2A 3PMSA 1S0FA 4AR2A 1UKGA 2ERFA 2WSVA 4GMP0 5FREA 5IVYA 5K4LA 2D6KA 1W90A 2XR4A 3H1YA 3R05A 5FUIA 4YGEA 4DQAA 2FCVA 4DS0A 1H30A 3KV4A 5FJHA 2W68A 3U4XA 3HIFA 2FDFA 5C4WB 2XH6A 4NHKA 3POYA 2BTVC 1RUC1 1MZ5A 2WQ8A 4RHV1 3JUUA 4A7YA 2V73A 3Q8FA 2VVFA 1G6NA 3GNEA 1KDKA 1OUXA 2SBAA 3CJIB 3C7FA 5HCBA 4RS5C 2NLRA 3ITQA 4XW3A 2ARBA 3FC0A 4MGIE 5FK7A 3VBUC 2DWRA 2VXJA 3MLLA 2AEZA 2TUNA 1T6GC 2HWC3 3I2GA 1GSLA 4MH0E 1H1IA 5F2SA 3IDCB 2D7FA 2DUQA 3KV5A 3ZM8A 4CDXB 4AVSA 2ADDA 3NAPA 1TMF3 1GOHA 1VLNA 5FLHA 2WNVB 5CADA 2XHKA 4NO4A 4RN5A 2QDRA 1X36A 1RVF2 2ZGPA 3OY8B 4KWUA 1N3PA 2Z5WA 1IS3A 3ZXDA 3WNXA 5ABJC 2VY0A 1RHI1 1I9RA 3S7EA 4CP1A 1RUG1 5LY1A 4BQ4A 1O8PA 2XBO1 2WZR1 3ZFGB 2C6SA 1V6OA 1URXA 2JDPA 2QQUA 3K75B 3KQ4B 3PUHA 2RS53 3O1UA 4FTEA 5HCHA 4IGPA 1SLLA 1UOJA 3IDEA 3G7DA 1N3OA 1E5RA 3FLPA 1JOJA 4P9LA 4Y5SA 4DUVA 3RZJA 1C8M3 2AUYA 2JG8B 4KQ7A 4LBQB 4YVSB 3ZXJA 2BBVA 1EP0A 4QKFA 4A41A 4Q27A 2YV8A 2WNUC 4M4PA 4Y22A 4I02A 1GZTA 2N7GA 3VZOA 2ZHMA 4XILA 5K0UA 4WM8C 4UBGA 3THTA 1AR93 3NRUA 4QX0A 3O0VA 4AEJA 1AUYA 1W03A 2IVJA 1DYOA 5F6LB 4B4RA 4ZHNA 1VE0A 1QJX2 2O0OA 5K7PA 1ZZBA 4DXZA 1JOPA 2BNOA 2X5IC 3K4DA 4K21A 4M3CB 5D1IA 3VKFC 1GNHA 4BPZA 1GOGA 2JENA 5FRAA 3ZN6A 1IS6A 2G1MA 5EJZB 1W6NA 2F17A 2GNTA 3TAYA 1DQ4A 1NLSA 3DPRA 4LPLA 4N9IA 3WW3A 1JS9A 1ENXA 3NV2A 3SH3A 1IHMA 2RJ2A 1QXPA 4XF1A 3TN92 3VHRA 4OMDA 2GNBA 3H8XA 1TEIA 2B7YA 5H9SA 4BIFA 4P00B 1TME3 5C3PA 1SCSA 1WLTA 2BFUS 1LR5A 2V4VA 4FPCA 1QDCA 1PO21 3OEBA 1RUJ3 4TLFA 5CA6A 4PI2A 5GZCA 4FOQA 4PIZA 1PGW1 1SG3A 1PVXA 2BW8A 2R6QA 4BZ4A 4CCJA 4FQ4A 2G9GA 1SCRA 1HKDA 2WQZC 4RQPB 4HPKA 4HETA 4JQRA 4U2AA 1G9DA 4A7KA 3DGTA 2EVXA 1SQ4A 2PHUA 4WVMB 4A4AA 5LA0A 1YEWA 4HSJA 2QVSB 4XPVA 5JXJA 2GP3A 1AX0A 3C7OA 3RWKX 4LUKA 3HAGA 5CKMA 2WL1A 2AREA 5F32A 4E8DA 5L9VA 2GC0A 1WMXA 1RXGA 3E6DA 2R062 2NYYA 4Q29A 1Q56A 4GZ9A 4X8NA 2CAUA 3OUIA 4NIDA 1U5IA 2D44A 4INDA 2TNFA 2ZZJA 4GB31 4XHBA 1CESA 2Y6FA 4YZ5A 3HVDA 4M01A 2QFEA 2W46A 4Q4Y3 5CYYA 5KBFA 2Q0AA 3CNAA 3H7JA 1OOPC 2HWE2 1ND2C 3VHOA 3ZYHA 4BIOA 5FZ7A 4BQ2A 3OBZA 3I54A 2GALA 3SXWA 2E31A 5KHIA 2B46X 4ZU7A 1QNWA 3O1OA 3I2FA 1NX9A 1UN1A 2DVGA 3ATGA 4LBKA 1DQ2A 5FZ1A 1L7QA 3PURA 3NWKA 5DDJ1 1D4M3 1REFA 1W2TA 4NHYA 1XNKA 2D40A 2XWBB 4N43A 4CU8A 1BEV2 5FYVA 3BGAA 3IMNA 3I2KA 2YPJA 4QD2A 1BK1A 4H2AA 1I5ZA 1VMFA 1WCDJ 2YFUA 1HN0A 3H1WA 1UPSA 4YGBA 3WDUA 2XKPA 4BXFA 4HFSA 1LCLA 3A21A 1H8TA 1RUD1 5F6KA 1F8VA 3T2QA 1W9SA 1CR7A 3N9OA 4XF3A 4RL7A 3MEPA 5JPNB 1O8SA 3NSTA 1J3QA 2UY9A 4QPGB 3WX5A 1RINA 4QPIC 4N53A 1AJOA 5GZEA 3ZIXA 2XJQA 4TSVA 4QHZA 3RZHA 5LA9A 4MO3M 5CKQA 2ORZA 5CFDC 4EWDA 4HMZA 1DQ5A 5GALA 1NUKA 3DUIA 3GZEA 5KR7A 4JC1A 1K5MB 3E1F1 1DZQA 4O61A 3CIHA 3RVHA 2W52A 1PIV2 2DCYA 5LB6A 3ZFFB 4UFIA 4BHPA 1NE4A 1VBC2 2P3KA 1F15A 1HQWA 2IZWA 2CV6A 4ARYA 3HQUA 4AHZA 4X6QB 1O3RA 1UD1A 4IV3C 2RHPA 1U5YA 5CU1A 4QM8A 1OPOA 1MS5A 3MIEA 1CGPA 4WBBA 1MEC3 1NYWA 2DU1A 4JKMA 3CBNA 3PU8A 2B45X 1KD7A 3HMYA 1W9WA 2GNMA 3GXUA 3A23A 4IQPA 1V6IA 4CEWC 2DCJA 1UQXA 2A71A 1VRH2 1C1LA 1HRI3 3H42B 3U10A 1JH5A 1IGOA 4FOWA 5FJKA 5TSWA 1SLAA 2WFF3 5F39A 1KJLA 4IE4A 4I3PA 2CWSA 3LAGA 3LA7A 3N4MA 3VKLA 2OVUA 5JXIA 4RGGA 2CHHA 3ES1A 3ZSKA 3WQ7A 4A6OA 3PIJA 5T5LA 1OLRA 1XSRA 1O4TA 3EO6A 1XNDA 5ERLA 4RYDA 5A7OA 4ASLA 3JQXA 2CNAA 2I2SA 2XJTA 1C3HA 4W6XA 4YW2A 4LBNA 3PJQA 4CP9B 1JZ4A 1LENA 1RUG2 2RG4A 4QX8A 2VQUA 4PCRA 5C4WA 1CX1A 3NAPC 2ZGMA 4GXLA 3VD7A 4W8JA 4Y1UA 3ETQA 3VDAA 3VD9A 1NQDA 1RJ8A 3CJIA 2UU8A 3AKSA 2ARCA 2IWGB 2VMGA 2XUMA 2J1VA 4QKDA 2YHJA 1LULA 2JB8A 4XVHA 5FAXA 1Z7S1 1BVVA 1IS4A 3AJYA 4OZOA 5C7GA 1FPN3 5CVRA 2QQNA 4CDXA 4LJHA 1OPMA 5JZGC 1W8OA 1XU1A 4LBMA 5DAXA 1QQP3 2QQVA 2E7QA 5JMOA 2WNVA 4A44A 5LBBA 3I2OA 4RGAA 3N7LA 1YCIA 5FZOB 3OY8A 5IATA 4YGDA 1PMJX 3X29B 1LESA 2RR12 1VBA2 4N7IA 5C3RA 1FAYA 1W8FA 1WGPA 4IEOA 4C91A 1JYWA 4EN6B 4K1ZA 2RE9A 1TQ5A 3MPPG 1W0PA 3HN3A 4LKSA 3ZFGA 4B7EA 4UT5A 5I8YA 3NO8A 4QXBA 4Y4RA 4BLIA 4ZKTB 2WZEA 1EY2A 1QU0A 2IXKA 1OC1A 2X10A 2OZJA 2JG8A 4L8QA 5DXDA 4LBQA 1KFXL 4YVSA 2BDRA 3WDYA 4Z2WA 1R64A 2WZPP 1ZRRA 3DPRC 1NZCA 2MNGA 2P4EA 4IW3A 2Q8CA 5FMBA 5ISLA 4OQ9A 4I0AA 1BZWA 3A22A 1WA6X 3UGFA 1WA4A 5JSRA 2ZS6B 3HT1A 1BXHA 2JKBA 1Z78A 4MYEA 2ZGUA 5FY9A 1AR71 4M3CA 1SMVA 2BRTA 1ZNPA 5FK8A 3LZZA 3WF1A 4CCKA 1WD4A 1XYNA 4LXLA 1VBE1 3O1SA 5BV6A 3K46A 4UAPA 3ZLIA 2NP0A 2VTFA 1SBEA 1QJFA 1PGL1 4LULA 4C1XA 2PHDA 1FT9A 3VBSB 4LIVA 5JSOA 4FCAA 4D6SA 2RDRA 2GAUA 2W39A 5T5JA 4AI0A 5A32A 5BNNB 1MACA 3WNNA 3H8OA 1X8EA 3VZJA 2YBPA 5C71A 1KFUL 2JB4A 5C8WA 4QHBA 1AJKA 1HXS1 3KCXA 4ET7A 4AEMA 1V6KA 3E97A 3M3EA 5E89A 3LCPA 1FOD2 2WWSA 4W6WA 1H1AA 3EBRA 2BP6A 3POWA 2BBAA 1BMV1 4BQWA 1PO11 4RQPA 5M0TA 3ZXKA 4CCDA 2VZ3A 5JPMB 1R092 2AYHA 1VBD1 4XJWA 1H2NA 1LOFA 3GBGA 4WVMA 3GCXA 4QQLA 1AL21 1UYZA 2OS2A 4JZRA 1WW4A 5AVAA 1G86A 2HWD1 4JX0A 3OGJA 1NE6A 3IT8A 1LHNA 4PLMA 4NIIA 4Q0PA 1NCQB 2XUEA 2YZ4A 4FFIA 1OVPA 2R041 3GBWA 5LK5A 3F2ZA 1OD3A 1QXRA 2VVEA 4YM0A 1Q8OA 4Y1XA 1J59A 1GP5A 5A80A 3FFZA 1O59A 4XF4A 4N43C 3VDDB 1SACA 3ZYBA 4MV2A 1TZOA 4LQRA 1JU4A 2GU9A 3J9SA 4CDUB 3RMXA 5A3TA 2WIIB 3T0AA 5EPAA 1W0NA 1SBFA 1DGRN 2DTWA 2PELA 5A7QA 2QQPA 2FZ2A 2K2SA 2WUHA 2ZXQA 1H8TC 3AL5A 1BBT2 3JBG2 3MW3A 4JKLA 3N9QA 2E7TA 3MLKA 4AVBA 5LWBA 2JECA 3UKNA 2JXAA 4BWOA 4ISQA 4XDOA 4B8EA 4JDMA 4XC9A 2ZEXA 3WD5A 3OUHA 2J1UA 3DF0A 3JB4C 4N53C 5FY8A 1R1A1 4KWJA 4NN0A 4ZY9A 1PMIA 3KQRA 1YQ6A 3ZSEA 4CCNA 4O9GA 4XUTA 1RUH1 2A75A 1JW6A 4LOSA 4PDWB 3UYJA 4CUAA 4LA2A 1YNAA 2VTXA 1EAH1 4JTNA 2IXLA 2W08A 2JEMA 1XNTA 1C5IA 3HR9A 4LT5A 3VZNA 4QPGA 1GYKA 2W9XA 5EZWA 4D69A 3FJSA 3SKJE 1OQEA 4XJ8A 1PNGA 1POQA 3OB8A 4H7MA 4CCCA 4QXKA 4DINB 3ZPYA 4XJ9A 3WG2A 2GZWA 3B3QE 2XKOA 3THDA 1AR62 2E7AA 5IVFA 2XQXA 4LOTA 4M0NA 4N8MA 1N47A 4Q4X1 1RGSA 3ZSJA 1S0CA 4U36A 3S30A 1K5MA 3THPA 3USUB 4HANA 4PF1A 5FPAA 1ZA4A 3WY6A 3ZFFA 5C9AB 2HWF1 2Y34A 5I8SA 4COZA 3LSDA 5A33B 2VOXA 3CZJA 4E2QA 1YXWA 3JD73 1N1YA 3JB8A 1FMD2 1CZVA 4GKYA 2XLAA 1CIYA 3WG1A 2VZRA 2FCUA 1H2LA 3MI8A 3PTYA 3RJ2X 5GZDA 3RNSA 3ABZA 4AQSA 4UFJA 1W04A 4I3GA 3J8F3 4XBLA 3B5LB 3AMNA 5C6CA 5JWPA 5LRSA 5LK7B 1LGBA 3P3PA 4FOYA 3VBRC 1CVNA 2I74A 4XBNA 1QGLA 1UY1A 3CZUA 3T1MA 4WVZA 5FZAA 3I59B 4MXWB 1ZZCA 1AYN1 2CSGA 3GJBA 2QZ3A 4V2WA 2ZAHA 5C4WC 3RZMA 1CWPA 2CDPA 3M8LA 1RUC3 5FKBA 2XHNA 3SH4A 1DQ1A 2XQRA 3MFCA 1UMHA 2BGCA 5A7PA 4O7XA 2PHFA 2AR6A 3A0NA 2D98A 1KJRA 1UKRA 4GMP3 1RC6A 1YQCA 4CP9A 5H9QA 3N35A 4CDXC 3AX4A 5C3SA 4IL7A 3LIGA 3LFIA 1TNFA 2VQTA 4XURA 1US3A 4LLFA 3KLSA 4FI9A 3BIEA 4X6RB 2BFUL 2RDSA 1LHOA 4XTPA 4B7KA 5FZ6A 4LBOA 3AP7A 2R49A 4JRAA 4KH9A 3MUY1 4N9HA 1UW8A 5FZHA 1KS5A 1RHI3 2RS52 2BGOA 5JR7B 4H14A 3RZGA 1K45A 3OCPA 1C8M2 4LK7A 3RZLA 3ZFGC 2P2KA 5CNAA 4P5HA 2XBO3 2WZR3 1ZZ8A 3UV9A 4FAHA 1JU3A 4NOTA 2HYKA 3AMMA 4IERA 4AI1A 2VUDA 2DF7A 2O8OA 1RVF1 1VJ2A 2DFCA 1RYYA 2OT7A 1AR92 2JG8C 2ZEZA 3EB7A 3I2DA 4BDVB 5LBEA 4DMIA 4TYSA 5DUVA 4CSWA 4PLNA 3AYDA 3MF6A 2OQ7A 4AE2A 3HOBA 2JIGA 2CAVA 2EALA 2IVIB 2J1RA 3HBZA 1QJU3 4JVAA 4CUGA 3DYMA 2EXIA 2HYXA 2OKXA 4XMIA 1O3QA 4XOGA 1VPHA 2W1QA 4EV0A 2GN7A 3O1VA 1UIJA 3DN7A 3H8UA 5FZOA 5F5CA 3IWZA 2CGNA 2QQMA 1V6MA 2SLIA 4HG6B 2AENA 4FPOB 1BMV2 5F2WA 1ODMA 3S5AA 2C26A 1RUJ2 3M3OA 1GQHA 3NJYA 3B69A 2EXKA 3SEPA 2D6MA 3FE5A 1W0OA 4LBLA 1QJX1 3GHMA 1V00A 4XFAA 3AZZA 5HBAA 2JDUA 1WLCA 2XOMA 1B35C 4QQHA 1PO23 1OH4A 2J1TA 2QDNA 4QX3A 4NIAA 4AI2A 4CZSA 1FV3A 4EE2A 4HT1T 1GR3A 1SZBA 4RQPC 4MGQA 1DIWA 5FP9A 3O5SA 4R8HA 1X8MA 3VBSA 2DCZA 4QB1A 1LOFC 4QX1A 3LE0A 2JG9B 4URAA 1SPPB 5BNNA 3D4KA 2I07B 1DDLA 4R4XA 4XJAA 3FN9A 4LO7A 3WNKA 3NNGA 4YLZA 3CHXA 2HWB3 1HLCA 2Z2SB 3LPFA 2Y6JA 1G7YA 3OGGA 4MGKE 1S1AA 1W6QB 3VB9A 2PHRA 5HI0A 4IXLA 1F4AA 1W9FA 4EN8B 1NY72 3AMQA 5FP8A 3WP6A 3NQHA 5FY1A 2GH8A 5FZ0A 2D6LX 5T55A 3VD3A 3UL2A 2B4KA 2NZ9A 1W3XA 1GWLA 3AFKA 3PTRB 1YQ8A 1X82A 2E26A 1NCQA 4NPLA 1HJGA 2OX0A 2WT0A 4TXWA 3T2PA 5L7OC 1GZWB 2PAKA 2VH9A 2R061 3AMHA 5C5UA 2WABA 2DURA 3M3IA 1ZX5A 4FPKA 4KBBA 3E6BA 2VECA 2RJLA 5F5IA 4EYUA 5FZ3A 3NV4A 4CDUA 5A7WB 1APNA 3NJVA 3WCSA 1ZVFA 2HWE1 4FPEA 5AC93 4OYUA 1LGNA 1BQPA 4I0WB 1NG0A 4IEVA 5JIUA 3LEKA 1YFWA 2Q30A 5FPZA 5IK8A 3ZMNA 4OQ8A 3OPWA 5GJ6A 2Z79A 4K9SA 4AQ2A 4CDQB 5GKAC 1ULPA 1COV2 1F9KA 1RUE3 4YVWB 5JOYA 1Q3EA 2EIGA 3LB9A 5APAA 2AH2A 4QPGC 3SITA 4FP3A 3NKTA 1BEV1 3I8TA 4AWDA 3ME2A 3GZAA 1STMA 3M3CA 4I2OA 2HWF2 1ALYA 1OF3A 3I3DA 3WF4A 4CTEA 1WUVA 5BNPB 1W9YA 3CQOA 1L7RA 4PDWA 4EQVA 3FHQA 2ZMLA 2B42B 4AFDA 4XIOA 4A6SA 1K5MC 4XETA 1MZEA 2WNEA 5AFBA 2PMWB 4PBPA 4LR4A 3ZFFC 3N9PA 4JTOA 4PHZA 4LE3A 4GD4A 4GULA 3BODA 1UY0A 2WJSA 1OMIA 2BVBA 2Y6HA 2DVAA 3R0RA 1MEC2 2Z42A 3LWCA 2BOJA 1CAXB 3DECA 3T09A 5LA2A 3UETA 4BJ0A 5FY0A 3VL8A 2VPVA 1PVC2 4WVWA 2OUJA 2V72A 4QU1A 1S2EA 2MEV3 2GC1A 3ACHA 3AZVA 3N7JA 3USUA 3AZWA 4WVVA 2R0HA 1X9PA 1PIV1 3LDKA 3ZSLA 4LBJA 1QNYA 4YW6A 1HJFA 5T50A 1VBC1 1S0JA 4QGLA 1A78A 4W4ZA 2UWAA 2W47A 2YBSA 4AI3A 5A33A 3U11A 3UGGA 4MG2A 5IHRA 3UKVA 4Y5Z0 1W6PB 1TNRA 4NJ4A 4YGCA 3SHRA 3TBDA 5A6YA 1NAEA 3AKQA 3VLBB 2ZGOA 4FSJA 2R32A 1BKZA 3JXSA 1UX6A 5FO9B 5CFCB 3U37A 4YNIA 2VZPA 3NVCA 5L73A 4AFMA 5A3MA 3WR0A 1IG3A 4MXVA 1VRH1 2QZ2A 4BE3A 1YI7A 5H9RA 5EYYA 3OSDA 4GA9A 2KR2A 3HD8B 3I59A 4MXWA 3BCWA 4XTMA 1H0BA 5DABA 1KRIA 1ONAA 1ZBA3 1UY3A 2E6VA 1OLMA 5FQ0B 5FKCA 3BUCA 2DCKA 3AKPA 3NNJA 4BQ1A 1QOSA 5FXZA 1FPN2 4YG6A 2YXSA 2WSUA 1NCRB 1IKPA 3FWEA 2VQAA 4D0QA 3MIGA 5I0SA 5IFPA 4LKEA 4XJUA 3H1MA 2C9KA 1Z7S3 4DPNA 4QXCA 1DZTA 1ZBE1 3C3VA 1SFNA 1GANA 4MX3A 2ADEA 3MIDA 2R1BA 2ZHNA 3KCYA 1D0HA 2BVVA 2WAOA 5D2AA 5FOJB 2D3PA 2PHLA 1ZM1A 3AFGA 4XMAA 3ZMOA 4E4SA 3L9JT 3NKGA 2NMNA 2B5HA 4KU7A 1E5SA 5IK4A 4NRPA 4JDNA 1SFYA 3PIGA 3NNMA 4IUGA 1DLLA 2W95A 3CEWA 4KMQA 3C7HA 4XEZA 1POV0 1QOOA 1S0IA 3U07A 3WSOA 3PU3A 4BQ3A 4CCMA 2VCMA 3LDRA 4D7SA 2JE9A 3AP9A 2LTNA 1OA3A 5F9TA 5GLWA 5KWRA 3ASIA 3CDZB 3EJKA 3KS7A 2RJKA 1EPWA 1YIFA 2WA4A 1DYPA 3Q8CA 4LO5B 1K5JA 2RR11 1E5HA 2JDZA 3EYPA 4XACA 5LBCA 1VBA1 4BCUA 5J1XA 1ULCA 4AW7A 1O4ZA 2FQPA 1CQ9A 1IOAA 2XJSA 4QX2A 4F3JA 1HV0A 3ECQA 1OVSA 2VMCA 1GFF2 1OQ1A 3WQ0A 4BQ5A 4P5YA 5BNOB 3OPTA 3Q8EA 4JGZB 5EJ1B 1POV1 2VMHA 1JYIA 5F5AA 5A32B 4XDQA 1UYPA 5DUXA 2D43A 1AR73 3ZFEB 3ZYJB 1Y9QA 5G05L 1OA2A 2LALA 3BN6A 4G4FA 3H0OA 1W8HA 4QB6A 5I8TA 5FFOC 3ZPOA 3N7KA 4YM1A 2CY6A 3J7MA 4Q4W2 3O0WA 4ZZ8A 1GQPA 1RUI2 3KHBA 3OBTA 3J7HA 3WDVA 5JR2A 1HXS3 1EV13 2CU5A 3POGA 3BALA 2CL2A 4HZFA 2Y38A 4PQ9A 4Y5TA 2P34A 3ZKUA 3H8RA 4BH9A 1P8JA 4H3WA 3VBFB 2YC0A 3UKTA 4L0PA 3LF7A 3AYEA 4C1WA 2IFRA 2JE7A 4COUA 1AVBA 1ND3B 3U1XA 1DGLA 3QOPA 2JG9A 5LASA 1SPPA 4E4ZA 4CP2A 1AL23 1YFXA 4IEWA 4MGZE 1HRV1 3VDBA 2HWD3 3PMEA 4G3YC 5LEKA 1AHSA 3IZOA 2W87A 3Q9OA 1FOD1 3R4DB 2Y26A 4Q1PA 3UJOA 1W6QA 2W92A 4M0HA 2AGSA 1GQGA 2R043 3N9MA 1QDOA 1UY2A 5JLVA 4NHLA 1L3JA 3POSA 4K3UA 1R091 2MPFA 1YFUA 3VDDC 4B4QA 4BQYA 3OD4A 3VDDA 5I0TA 3HT2A 2OPKA 3VHNA 3CU7A 3WCRA 3WP3A 5JDBA 2MHFA 4CDUC 4MZUA 5HPOA 1FNYA 2EAAA 3IAQA 4XIKA 4Y26A 1RMU3 3FX3A 1VBB2 5SV5A 3ACFA 1BHGA 4GWMA 4B1MA 1X7NA 5DG2A 2Q8DA 3W59A 1GZWA 2RS33 5FMOS 1F5JA 4V2VA 5IVVA 1R1ZA 1IPSA 1AX2A 3OUJA 4LK6A 2ZA9A 1UWWA 1XRUA 2G4IA 2K0GA 3IIAA 5A7WA 1VP6A 1LOCA 4IESA 4YG0A 1CZSA 2XL9A 3O0XA 2A6VA 2PAMA 4DUXA 3HQRA 4XXAA 3JBG1 1S55A 1BBT1 4PDWC 1IKQA 4CDQA 2G9FA 5CBLA 1UMIA 3NV3A 1WBLA 4LORA 4YVWA 3GZUC 2J1AA 2WLQA 4X8PA 3WQBA 4B29A 4CU7A 1NA1C 5FUNA 3JQWA 4JHZA 1WKYA 1FATA 3OTFA 2WAAA 4I09A 5BNPA 3M1HA 3V0AB 2G19A 1H4HA 5FY5A 1YO8A 2ZACA 2BPA2 1GP4A 2CGOA 4Q4V3 3WW4A 1QJY3 3AZYA 2Q1MA 1N1SA 5IYYA 4TLGA 5JCTA 2H6BA 2JX9A 4F83A 3IIIA 5F37A 4CCOA 5C9AC 1DLCA 4BMEA 3JD72 4K7JA 5IUQA 3RYRA 5A70A 2VQ0A 4QHOA 3T4VA 5FZ9A 4XFBA 4JGYB 1LKNA 3LSEA 4FXGB 4ZXKA 3URFA 1AR61 2W91A 2XL7A 1CAXA 3RMYA 4P9JA 1V0AA 3J8F2 4OHWA 5DG1A 5IT6A 2WFPA 1KQRA 3LD8A 4FT8A 5CG8A 2LROA 4NHXA 3K4ZA 2Q1FA 4UBHA 1UY4A 3PVNA 1XC6A 2VMFA 1U5ZA 4UYBA 2IXJA 1SDWA 1WLDA 4JHTA 1B09A 2W1UA 3INAA 1LEMA 3ZXGA 5D8AB 2VG9A 5KXEA 5DZEA 1FNZA 2H6CA 4PI0A 5BXXA 2VBDA 1DZRA 3TEYA 3LQCA 1DBNA 1W6PA 5FUPA 5LATA 4CCEA 1ULDA 2YUEA 1D4VB 1FMD1 4QDRA 3T08A 2BGPA 2YG0A 4MADA 1AYN3 1ZBE2 3WXPA 4AZZA 5F8PA 2R073 3S6PA 2DBNA 4E8CA 2EXHA 2WT2A 5CFCA 1XOYA 3L2YA 4AVCA 3ZN5A 3PVOA 4L9BA 3RSJA 3RG0A 1Q8VA 4AAXA 1Z0HA 4DNYA 4QT6A 4YW3A 2VUJA 1V70A 4KI5M 4TN7A 3MO4A 3U78A 2WYSA 4WM7B 5FP7A 1AR82 2EXJA 2P17A 5FQ0A 4E2GA 3I2HA 3I2IA 2HEYF 3JCIA 4QB2A 2JDKA 1OD5A 1OFSA 4ZS3A 5GM0A 1UNBA 3NJXA 5A1LA 4FTBA 1NCRA 5KXBA 2EIBA 2JD9A 2PAEA 3KGZA 3THCA 2JDMA 3HJRA 4K20A 1OI6A 4MVTA 1XSQA 3PUSA 5K0UC 3SMHA 2VMIA 4NPRA 1VAMA 3HNBM 3WLUA 1V9U2 4XZUG 1QJEA 4OULA 2ZCWA 3IPVB 4R4ZA 1UZWA 4CUCA 1RVF3 1UF2C 2B9VA 1RUOA 3TNQA 5AFEA 3I49A 1YQ5A 3AKTA 2RS51 1HDKA 1DF0A 1QJU2 5ACA2 2PLV3 4OHVA 2OYZA 5FYIA 2VULA 5CB7A 3SCFA 1C8M1 3O12A 1FXZA 4HKOA 1LU1A 1WD3A 3VKOA 1WCUA 3SLIA 1W2AX 4MHRA 1RUF2 3TEXA 2WNUB 4QQ2A 4XFHA 4P9XA 4XUNA 4OI0A 5EP9A 2NN8A 1AR91 2VNVA 2PQSA 2P3JA 1DGWA 3D8CA 2HBUA 5FZEA 3M70A 4HVRA 3P1IA 1XJAA 2WO1A 1WWYA 4DY5A 2RMU2 4DEQA 2WYFA 4P9IA 5BNOA 4FPJA 1E5IA 2RS13 1O91A 2XVLA 4XFGA 3T30A 2ORXA 1ASJ3 3W5MA 4JGZA 5J3UA 5H9PA 1LRHA 1Q8PA 2QCSB 1ODNA 4DRVA 1DGWX 2A6ZA 3VBOB 2RVAA 3W20A 1H6YA 3ZYIB 3LEMA 5IAVA 3ZFEA 3IKWA 1HRV2 3DXTA 4O65A 5F3EA 4EROA 3GDBA 3WZ1A 1BVP1 1TME1 3FBYA 5CISA 3V0BB 1RUJ1 2IC1A 2HWB2 2PQQA 2ZAAA 4CEYA 3RPQA 4BU2A 2JG9C 3B9CA 1OFNA 5JI7A 5FLJA 3WNLA 3ZX7A 5K8SA 3TN93 2Y64A 2WA3A 4YW7A 1WMEA 1W2NA 2WR9A 3LFMA 2VZQA 4E4HA 5IVJA 3D6EA 5FXVA 1PNFA 4KGQA 3W9AA 2OPWA 3DKWA 4GKXA 3NMBA 3VBFA 1UZVA 5JUVA 1A3KA 1S0GA 4RR3B 5CG9A 1ND3A 1IPKA 3J4UH 2A6XA 1KDMA 3L2HA 3ZYGA 1BJQA 3NNLA 2GN3A 4LHNA 4UW5A 4N7UA 3UGHA 3VD4A 2XJPA 1O7FA 2HEWF 3AL6A 3CL1A 1YWKA 3KD4A 4ONUA 4AFAA 3BB6A 1AZDA 4ITCA 3O1MA 4Y20B 1FI2A 1JOBA 3HWJA 4LIUA 3MIBA 2D6NA 3KVAA 2RM23 5AC92 1NY71 2A7AA 4YZ4A 2D5FA 3WV6A 1DP0A 2VW2A 2HKXA 5F7UA 4CP0A 3FLTA 1J83A 1PM4A 2VE1A 1OKOA 1PX4A 1W99A 1RUE2 1UU4A 2P1BA 2HWE3 3M7AA 2JKXA 3OBRA 4AVTA 4C8DA 3FUOA 1AYM2 2WS93 3V65A 4J25A 4LBQD 4CDQC 1US2A 4NR1A 4IE7A 2VNRA 3AZXA 5JSPA 1UO9A 4YVWC 2AC1A 3ES4A 4KU8A 4Q26A 4OZXA 4AVAA 5FCCA 1QKQA 2IUWA 1R082 2BNMA 4BYYA 5BNPC 2BEOA 2P5BA 5LBFA 4P9YA 1N1VA 3MUZ1 1IZ3A 1CPNA 1LHWA 1K42A 2VCAA 4V1PA 2CYFA 2UWBA 5GLTA 5I0DA 5KHJA 4JAAA 3VZKA 1COV1 2PYTA 2VW1A 3R4SA 5GZFA 2NM1A 1HB3A 1H9WA 1UCXA 3BVCA 4FPGA 4XF0A 4Y1ZA 4COVA 5GLZA 5HCAA 3N36A 1SLIA 1UMZA 3V0AA 3AP6A 4DUWA 2MEV2 5FO7B 1U12A 3AP5A 5KHGA 2PHWA 3AK0A 2A5ZA 4Z92B 5FXXA 2ZEYA 5DUWA 1UOFA 1VAVA 2XLGA 2ZOEB 5GLUA 1F2NA 4KBZA 4CRQA 3CMGA 4GWNA 3GHNA 3P5BA 4QX5A 2YY1A 5DPNA 1PIV3 2W1SA 3DXUA 2ZX1A 4IV3B 1VBC3 4LO6B 4JGYA 5DZGA 1MS9A 1MEC1 3MBWA 1XE0A 4DB5A 5L36A 1PX3A 1V6NA 2Q8EA 4IE6A 1W3VA 1MS1A 3ZDVA 4KGGA 1MZFA 1PVC1 4HVOA 4XE9A 3WF3A 3Q8AA 4ZZ5A 1HB4A 4HKWA 3FFQA 1JYTA 3LKJA 1UXXX 1CAVB 4CEWB 5CFCC 3FMGA 2PFWA 3W5NA 4RHV3 3K48A 2LM3A 5JAXA 1QIQA 1EYBA 1DYKA 2HWC2 3CJIC 3FZ3A 5D8AA 1K3IA 1ZBA2 4R52A 1O4YA 2VXRA 4FTSA 3VBHB 1U5XA 1TMF2 1YRZA 3D0SA 3O14A 3EMRA 1G9AA 2HH9A 4TWTA 1ACCA 2ET7A 4R9DA 4OI2A 1N1TA 2ZX2A 4LHKA 1QJZA 3AKRA 2WNVC 2PA7A 2WBKA 3LPGA 5IK5A 1NCRC 5FWEA 3KHCA 2VNOA 4QMAA 1JHJA 2VOVA 2VCBA 4M00A 4XDPA 4D8MA 1RITA 3WHTA 5DAQA 2Q8OA 1JYXA 2WWJA 2ZX4A 4GAZA 1RUG3 4IEYA 4WM7A 5FMDA 4MOAA 2FDHA 3IN9A 3C7GA 2C4XA 3LGRA 1VRBA 4UI9L 3F95A 1QY4A 1V6JA 4YYOA 3U75A 1FPN1 2BWCA 5FBJA 1XYPA 2ZMKA 1UZZA 4YVSC 1CAUB 1QQP1 5F1RA 3ZXFA 1QOTA 5J96B 3WVJA 5JZGB 4QQPA 2ZGSA 2K46A 3J7LA 1H8VA 1D7PM 2DVFA 1DCSA 3CJXA 3W21A 2JIJA 5EHDA 3IPVA 2VM9A 2E53A 2EA7A 4JCKA 3E5QA 1GZ9A 4META 5J7MA 1XU2A 3ZKYA 3OG2A 3WHUA 1PGSA 1W06A 4KWLA 4QM9A 2XVKA 4Y24A 1X33A 3WP4A 1W8NA 2RR13 1ENQA 4HXCA 1VBA3 5JXHA 1JN2P 1Y7BA 2A3XA 1TME2 2D3RA 2VCCA 2GNDA 3H9AA 4D94A 5FOBB 1YLLA 4Q5OA 4CE8A 4JGZC 3PUQA 1Q5OA 3M4FA 3VGIA 2WNUA 5E6HA 1NZIA 4KWKA 2JDHA 2WT1A 3D82A 1S0EA 4RFT0 1T6BX 1LOAA 2XJVA 5FWJA 3N3HA 3RRDA 3D3AA 4A2UA 5LEJA 3MW4A 3POJA 2EAKA 4NE9A 1JTZX 2OIIA 1EV12 1KGYA 1VB2A 3IM0A 3ZVXA 4QXHA 2KA3A 5CEHA 2Q1ZB 2XWJB 4EJRA 4B4PA 2PN5A 3VBOA 1CPMA 3MLJA 3HQXA 3WF2A 5FYHA 4XUPA 1I1EA 4OUMA 4UFLA 3LA3A 3RI9A 4N90A 3WUCA 3WNPA 1LOEA 3VKNA 1QEXA 4XQ4A 3AM2A 4Q4Y2 3V0BA 3SEEA 2Y0OA 1ND3C 1PM7A 4QAWA 4Y4YA 1I6XA 2JD4A 4AGGA 1C1FA 3OBAA 4ZXEA 1QWRA 5A6ZA 4AEDB 4OCTA 4K6BA 4Q4W1 2Q5TA 4FPHA 3KMHA 1NLQA 1RUI1 1WW5A 4GB33 4LUMA 4L99A 4GIQA 4URTA 5T52A 3SKVA 4Z8BA 3VN4A 3AJZA 4C0HA 4QQOA 1FOD3 4MGYE 3B7MA 1D4M2 2XMLA 3CKHA 4RGKA 5FP4A 3SCHA 4EN7B 4GALA 2OXBA 2ZGKA 2HLEA 4RR3A 1JZ7A 2FCTA 2QQJA 1TVGA 2QTWB 4Y1VA 5KC6A 1R093 1W8WA 3USSA 5DDJ3 5FZBA 1LU2A 2RS32 2WO3A 1WW7A 4ZPIA 2VOWA 3BTYA 4YARA 4OI1A 4Y20A 2X05A 4W6YA 5FYCA 1JBCA 5BPXA 3AXEA 5A3UA 4UWDA 2ZPXA 1M06G 1RUD3 1OKQA 1AXKA 4JV4A 4TZDA 1ND2A 1SLBA 1JZ5A 2EF6A 4HK9A 4AK3A 1GV9A 1E57A 4DOUA 1YUDA 2V4AA 3MZHA 3WP5A 3SC7X 1VBB1 3ENRA 2WO7A 4L92A 4A7ZA 1BBT3 2PHTA 3K3OA 2XG3A 4RSUA 3ST7A 3BKZA 1JYVA 1RXFA 5C70A 4Q4V2 2ET1A 4E4DX 1LOBA 5EV7A 5F3GA 2E33A 5FZ4A 1QJY2 5KC5A 2A1XA 3SH5A 4CVUA 3KSCA 1QF3A 1LHUA 2Y0IA 2BQPA 2ZX0A 3NW4A 4PIXA 4LA3A 3IBMA 3TNPB 3WINE 1FV2A 5DZFA 1GOFA 4PJYA 4AHXA 4FP2A 3NL1A 2QNKA 2UYAA 1G9CA 4JKKA 4ZU4A 1JHNA 1I5PA 2W2IA 2XJRA 2YGMA 5A3LA 3I3QA 5FIXA 2IXCA 1LHVA 2X53S 4BLJA 5FZ8A 5A6XA 2VL4A 2ETEA 4EWAA 5FDBA 2W1WA 5FPUA 3BYWA 2VR4A 2RDNA 4IGQA 1HRI2 4JGYC 4LMFA 2WFF2 1T2XA 5C8CB 5JIAA 1WZXA 2ATFA 4L2NA 2A3WA 4L97A 1AR63 4Q2FA 1SDDB 3PUAA 3WW2A 2WNOA 1YFYA 5FPLA 5C33A 1U0AA 1LODA 2DBIA 2W3JA 1C4RA 4RD7A 5T5PA 3JD71 2LUWA 1WMFA 1KEXA 2UURA 5D8AC 4K8FA 4IV3A 5FPVA 3B00A 2VO5A 3WQ1A 2OUHA 2GMEA 4NWVA 1QHDA 4KL1A 1YIPA 2R072 4IE5A 5FYSA 3ZYFA 3IAPA 4CDWB 2XXZA 1UXZA 3J8F1 5EYXA 2E63A 3SNMA 1FMD3 1AL0G 2ES3A 4D3WA 4D7TA 4ES9A 5LA1A 3BTXA 1IG0A 3OJBA 1CAVA 3KM5A 4L11A 1J1TA 4WV8A 4FPLA 5FY4A 1IPJA 3ILNA 4CEWA 5HV4A 1VB4A 3ON7A 1C57A 2DVBA 3MHZA 3PVEA 5EXOA 4EZHA 1SFPA 3VBHA 5F3IA 1OA4A 1QQP2 3WDXA 2DDUA 5JOWA 3OGVA 1CIWA 2Y33A 4WM7C 1G9BA 1CJDA 1H6XA 5EJ3A 1EPZA 4OUEA 4HL0A 3QH7A 4Z2AA 4UW3A 4GMP1 4CCLA 4QGMA 4UW6A 1VALA 1W9TA 3FBMA 4QDSA 4CXWA 4XFIA 2JDYA 4OHXA 2ZGQA 2WZ8A 3D0JA 3POBA 5E16A 5JXGA 4NMIA 2LS6A 5T54A 5D21A 5FZMA 1WLWA 3PUIA 1AR81 2ZBJA 3MF9A 4TTGA 4MHUA 3MICA 4C0BA 4FQZA 5GLVA 4S2DA 2YC4A 2PLV2 3WG3A 2ZGRA 1ZRFA 2VGDA 5FMCA 5FYYA 4B1LA 1CAUA 5JZGA 4LE4A 4J1XA 3QACA 4XFCA 2E51A 4FVVA 4D6RA 1AXZA 4AGRA 3Q8BA 2VMDA 4YZ1A 3ZOIA 1JZ3A 4Q8LA 4PF5A 1V9U1 3BPSA 4Q0SA 1Y43B 5LCWL 3RYKA 1H2KA 4P08A 5LZ6A 3I2JA 5CKNA 2C0ZA 3AMPA 4GH4B 3U0ZA 3RZZA 5FZKA 4BM8A 1SBDA 1W2UA 2B8MA 4XCAA 2RS12 3LOIA 1ASJ2 1OH3A 2AACA 4R9BA 1GNZA 1RL3A 1QJU1 5B4XA 5ACA1 5FLIA 1JUHA 2XVGA 3AYCA 1CONA 1VBE3 2C9AA 5E8AA 4CU6A 5T3NA 1ENSA 4YZ3A 1NOVA 4ARXA 4LHSA 2VVDA 3LEIA 3I3BA 3VZMA 3WW1A 3VBSC 4CEYB 1ZRCA 3MDPA 1OT5A 1D2QA 5BNNC 2FDGA 1WMDA 1RUF1 3VBOC 3ZXEA 2V5YA 2R16A 5E88A 2KM2A 4K8RB 4XUOA 3S5QA 3NV1A 2YROA 1GP6A 4XF9A 1W6MB 3PVBB 2E32A 3RDIA 2V5DA 1PZ9A 3RS6A 2RMU1 3OPZA 3VZLA 3WUDA 3HBKA 1A34A 1PO13 1ULFA 1B35B 3VUOA 4HSLA 3P6BA 1AX1A 5IWFA 4CXXA 2ZHLA 1VBD3 1HB2A 4BK5A 5FR3A 2FBEA 4DXTA 4A3ZA 3ROUA 4YZ2A 3RGBA 1WCKA 2VAUA 2DVDA 2LW8A 1OXCA 2QKDA 4DFSA 3IDAA 1IQAA 5DUUA 1NCQC 4XCBA 4MGTA 3ZXAC 2ZJCA 1VMHA 4I0BA 3H3UA 1OUSA 4RR3C 2HWB1 2VBBA 1W8UA 3T2TA 4AEDA 3UJQA 3WG4A 5FZLA 3KB5A 4XJZA 4QKBA 1LOGA 2H0VA 2VTXJ 4IEXA 2RM22 4IV1B 3OGRA 3VBRB 4ATEA 4AFBA 2YU2A 5K9YA 2PTMA 5DMYA 2XB6C 4KNCA 2WQ4A 4FO9A 2O1QA 1H2MA 1YJKA 4ZONA 3K51A 2ZABA 4DXRA 2ZKLA 4YSFA 2NQYA 5I0UA 1OQDA 2GDFA 3C7EA 1CD3G 2WS92 3NJZA 5E1RA 1Q8SA 3O1PA 4YPJA 5L7OB 3A7QA 3ZR6A 2BUKA 3I4IA 4HOOA 4EWEA 3TEZA 4NIHA 1R1A3 1S0BA 1HIXA 1C28A 1LEDA 2J7MA 1RUH3 4NROA 5HCFA 3MV01 1O5UA 4XZPA 5IFTA 5AC91 2G9ZA 5IK7A 1CAWB 3HEIA 3TWIA 1EAH3 1SHWB 1OSGA 2DUOA 2QQLA 5ANQA 3RZKA 1O6UA 4D6QA 1UZYA 4JDOA 5FV3A 3HNMA 1YYNA 4PQQA 1Q43A 3B94A 1RUE1 2UWCA 2C1FA 5T5OA 3LDBA 4KG8A 3GM8A 1AYM1 1XE7A 3BPZA 3N7MA 4IEUA 5FO8B 1F35A 4LKDA 3TB0A 3I7DA 3KVBA 4NPMA 4Q4X3 3K77A 2QUOA 4CXYA 2I45A
chains in the Genus database with same CATH topology
1COV3 5FTTC 1UL9A 4WZFA 3ZYPA 4IEQA 1R081 2E9QA 2TEPA 2ZZQA 5KXCA 2HWF3 4E2SA 2WINB 4LO4B 1O3TA 4M3CE 1NLRA 1BCXA 1JYCA 2VW0A 3CF6E 4FPFA 5F5QA 3OYWB 4LTAA 1PK6B 2ZGNA 1OHFA 2GC2A 2V09A 2ZX3A 1G8WA 2AZ5A 3H3ZA 3B9IA 1RIRA 2A6YA 1WCSA 2MEV1 3QH6A 2OW4A 5C8CA 3RJRA 4YM2A 1FX5A 4XQDA 1C5HA 5BY5A 1RUC2 2XLFA 2WKKA 4RHV2 3PHMA 3ZSMA 1MQTB 1PVC3 4NVPA 4OHYA 4I30A 5EWSA 4HKLA 4S2GA 1LTEA 1KITA 1NQJA 4GQ7A 4PBOA 5FBZA 3VBHC 1YJLA 1MS3A 4SBVA 2A6WA 1Y3TA 4XQWA 4CDWA 4WZCA 3QLQA 1XE8A 3MPBA 2F4PA 2CTVA 2ZTNA 4RS5B 1S2BA 3VBRA 1RHI2 3G6JB 4AVVA 1RB8G 2D6OX 4O9EA 5J36A 3VBUB 2HWC1 1ZBA1 1REDA 2B9UA 3B02A 1TMF1 2WZR2 1RTVA 2XBO2 2GH2A 1W39A 3QD6A 4NHMA 2YDEA 3VHPA 1BYHA 1RUNA 4YW5A 2YMZA 5ABJB 1MVEA 1LJ7A 4EN0A 3RQ0A 4OUSA 2ZHKA 2XGXA 1SLCA 4EN9B 2UY8A 4AI8A 1GBGA 1J3RA 3QCWA 1O5LA 2O8QA 3R6SA 4M3CF 5KHKA 2NMOA 2VNGA 1WW6A 1A8MA 3C2UA 1CX4A 2QE3A 3GF6A 4WM8B 2DFBA 1JXNA 4ORFA 4FXKB 4H7LA 1ZYBA 2X5IB 4ES8A 1PO22 4XYXA 3ACLA 1XNBA 2GC3A 4GH4A 1PGW2 4HN1A 2ENRA 4Z1VA 1QJX3 2FMDA 1FYUA 1ZREA 2QJVA 1PHMA 3OF1A 4H55A 3GYDA 1V6LA 4AG4A 1C8NA 1D0GA 1OLQA 3KGLA 1VIWB 2D3SA 1KXGA 3M3QA 1LB2A 4KG0A 4JRLA 5SV8A 2R30A 4HN0A 1MS4A 4YG3A 4RA0A 2OA2A 3E5XA 3JZVA 1W6MA 4Q1RA 3M2MA 1H1MA 2JICA 2ZGLA 1M4WA 4GB32 1N3QA 2FHRA 3ZO0B 1ZZ6A 1EV11 4D7YA 1B35A 2K9ZA 4XFFA 4AEDC 4AGVA 3UK9A 3O7OA 4IEPA 4CYDA 4Q4W3 1PZ8A 3FUQA 3GALA 1DFQA 1RUI3 5DDJ2 3WT3A 5KXDA 2VOKA 4Q4Y1 3AB0A 2R063 1GLHA 4B3NA 1OOPB 1ND2B 4HVQA 2D97A 4A3XA 1ENRA 1XYOA 1RUD2 4IV1A 4G9SB 3E6CC 4Q8KA 1D4M1 1W6OB 4ISRA 3BIWE 5JOXA 4MLOA 1RMU1 2ZKNA 5JOZA 5JI9A 1J58A 4Y1YA 4FAGA 2RS31 2ZMNA 5L7OA 1CJPA 3S0MA 1AXYA 1BEV3 5BUVA 4I01A 2YGLA 1VBB3 3SCGA 3AYAA 2GMMA 3RI8A 4P14A 3P3NA 3V56A 4AFCA 4R9CA 5BYNA 3IDBB 4DZGA 4BOWA 4XHXA 2HEVF 4QPIB 4OVEA 1CAWA 1NXD1 3BTAA 2DYCA 4K40A 4UXAA 2D93A 5CFDB 4AQTA 1DQ6A 4COWA 1GZCA 4HLTA 3WDWA 1MS0A 4FOVA 4Q0VA 1O3SA 3BU7A 4LLOA 2W0XA 1NA1B 4AXOA 1SEFA 3ZXLA 4W65A 4Q4V1 3LA2A 1QJY1 1MR5A 4PIYA 3S7IA 5C8CC 2DCTA 2A3YA 4XXPA 1A8DA 4BA6A 2R1DA 5HXVA 5B2GB 1D2SA 4AEKA 3OYWA 1PK6A 4ASMB 4Z82A 4C90A 3VKMA 3EXUA 3ELNA 1QH7A 5GZGA 3EHKA 1HRI1 2DV9A 1F5FA 5J48A 2WFF1 2IXHA 3HN1A 4BMBA 4CDWC 4SLIA 5J09A 4YRDA 1LGCA 4DY3A 1VRH3 3R4UA 1MQTA 1MZ6A 4UW4A 4E27A 1CN1A 3E5UA 3AXDA 2X8KA 2IFWA 4NWWA 3ZIWA 2XPJA 1Z7S2 1XQNA 3MGUA 3DL3A 3VL9A 2WLPA 2R071 4MUVA 3ZDSA 3NAPB 2H0BA 1MS8A 4Q0UA 2CGPA 1ULGA 2Q4SA 1ZBE3 4RS5A 3MIFA 3VBUA 1SLTA 2GSYA 1NXMA 4QGNA 3ILFA 4YM3A 1ULEA 1S2KA 1JUIA 2R0FA 4F8AA 1HV1A 2C5DA 4OHZA 4FPYA 3MFAA 3FHIB 2XJUA 5I91A 1AR83 2YYOA 4MSVA 5ABJA 5JMCA 2PHXA 1ZRDA 3PLQA 4Y22B 2ILMA 4K1YA 1UU6A 5K0UB 2VUAA 1DGRA 2X29A 4AF9A 3PNAA 4ZU5A 1UPIA 4XBQA 4ATFA 1AR72 1RJ7A 4LHLA 5BNOC 1V9U3 3ALQA 2VU9A 3A0KA 3ZN6B 2PLV1 4GH4C 4AHYA 1VBE2 1W6NB 1POV3 4J1WA 3B93A 3ZFEC 3DPRB 5KHHA 4WM8A 1HX6A 1PZ7A 1XNCA 3A4UA 2A73B 1PGL2 3SISA 4LO8A 4IEZA 1UU5A 1HQLA 5ACA3 3KT4A 5FMOL 3ZN4A 5EFUA 1QMJA 3H50A 2X5IA 1HXS2 4CEYC 3BOWA 1DG6A 2OZ6A 2IXIA 1RUF3 2A70A 1TE1B 3T1LA 4YW4A 3J26N 4YW1A 2RS11 1PO12 4HPKB 4HBNA 1ASJ1 1J1LA 1VBD2 2ARXA 2CWMA 3VBFC 1AL22 2RMU3 2BYVE 2HWD2 4F7ZA 3ZYRA 4R9AA 1XXNA 3ILRA 5AVPA 5I93A 2B39A 4LEJA 2KXLA 2R042 1HRV3 3B01A 4AYUA 1HQNA 1VR3A 1H9PA 3TN91 5J98B 1GKBA 5L19A 1VAKA 4HK8A 4J6GA 1RMU2 3PJYA 3MIHA 2GMPA 3APBA 4E9KA 4IV1C 5J37A 2UYBA 1UIKA 1J3PA 2JJ6A 1ZZ9A 2WC2A 1S0DA 2Z69A 3QBQA 4AHWA 1X50A 4N43B 5CAZA 2DUPA 4Q0QA 5I0RA 1R1A2 2TBVA 5LRRA 4OLLA 1OOPA 4IETA 3DV8A 2P37A 1QH6A 3WDTA 1RUH2 4YFZA 2DTYA 4QPYA 1I3HA 3CLPA 4QU2A 4S2FA 4P9WA 1H8TB 2RM21 3TYJA 1REEA 5JVVA 2D6PA 1EAH2 1IS5A 4OFGA 1W6OA 3VDDA 2D5HA 1HW5A 2HJIA 1YI9A 1GICA 4Z07A 1ZZ7A 1DHKB 3JBG3 3EQEA 3CO2A 4N53B 4PLOA 2WS91 3TRSB 2FMYA 3RWNA 4FTSA 4Q4X2 3GBFA 1LECA 3VV1A 1A6CA 3GZTB 2F6BA 2BNNA 1AYM3 2NPIA 1DQ0A 5CIRA 1Q8QA 3W58A 3BOPA 4QPIA 1DU3D 3LOBA 2DU0A 5BNQA 4S2HA 4P9GA 4OI4A 1QXJA 1YHFA 5CFDA 1R083 3AP4A 4FBFA 2FZ1A 1AF9A 1H4GA 3KT1A 1KS4A 2P3IA 1G9FA 3KT7A 1NA1A 3WOGA 1PK6C 5FPXA 3OD0A 4DRRA 1F31A 1MVQA 3KZ4C 4YFWA 3RYPA 3H7YA 2BWAA 3V64A 2ZGTA 3FLRA 4COYA 1UAIA 4LNVA 3TOJA 1AYN2 3MW2A 1WBFA 3D5OA 3MYXA 3JU9A 5C9AA 1MQTC 3KCCA 4AQ6A 3PMSA 1S0FA 1UKGA 2ERFA 2WSVA 4GMP0 5FREA 2D6KA 3H1YA 3R05A 4DQAA 4YGEA 4DS0A 1H30A 3U4XA 2W68A 3HIFA 5C4WB 2XH6A 4NHKA 3POYA 2BTVC 1RUC1 1MZ5A 4A7YA 4RHV1 3JUUA 2V73A 2VVFA 1G6NA 3GNEA 1KDKA 2SBAA 3CJIB 5HCBA 4RS5C 2NLRA 4XW3A 2ARBA 3FC0A 4MGIE 3VBUC 2DWRA 3MLLA 2TUNA 1T6GC 2HWC3 1GSLA 4MH0E 1H1IA 4CDXB 3IDCB 2D7FA 2DUQA 4AVSA 3NAPA 1TMF3 1VLNA 5FLHA 2WNVB 5CADA 2XHKA 4NO4A 2QDRA 1X36A 1RVF2 2ZGPA 3OY8B 1N3PA 2Z5WA 1IS3A 3ZXDA 3WNXA 5ABJC 2VY0A 1RHI1 1I9RA 3S7EA 4CP1A 1RUG1 2XBO1 2WZR1 3ZFGB 1V6OA 1URXA 4FTEA 2RS53 1SLLA 3IDEA 4P9LA 3G7DA 1N3OA 3FLPA 1JOJA 1C8M3 2AUYA 2JG8B 4KQ7A 4LBQB 4YVSB 3ZXJA 2BBVA 1EP0A 4Q27A 2YV8A 2WNUC 4Y22A 4I02A 2N7GA 3VZOA 2ZHMA 4XILA 5K0UA 4WM8C 4UBGA 3THTA 1AR93 4DNYA 4B4RA 3O0VA 4AEJA 1AUYA 5F6LB 1QJX2 2O0OA 5K7PA 1ZZBA 4DXZA 2BNOA 2X5IC 4BPZA 4K21A 4M3CB 5D1IA 3VKFC 1GNHA 2JENA 5FRAA 3ZN6A 1IS6A 1W6NA 2GNTA 3TAYA 1DQ4A 1NLSA 3DPRA 4N9IA 3WW3A 1ENXA 3NV2A 3SH3A 1IHMA 4XF1A 1QXPA 3TN92 3VHRA 2GNBA 1TEIA 2B7YA 5H9SA 4BIFA 1TME3 1SCSA 1WLTA 2BFUS 1LR5A 4FPCA 1QDCA 1PO21 4TLFA 1RUJ3 5CA6A 5GZCA 4FOQA 4PIZA 1PGW1 1PVXA 2BW8A 2R6QA 4BZ4A 4FQ4A 2G9GA 1SCRA 1HKDA 2WQZC 4RQPB 4HPKA 4HETA 4JQRA 4U2AA 1G9DA 4A7KA 3DGTA 2EVXA 1SQ4A 2PHUA 4WVMB 4HSJA 2QVSB 4XPVA 1AX0A 4LUKA 3HAGA 2WL1A 2AREA 2GC0A 3E6DA 2R062 2NYYA 4Q29A 1Q56A 4X8NA 2CAUA 1U5IA 2D44A 4INDA 2TNFA 2ZZJA 4GB31 4XHBA 1CESA 4YZ5A 4M01A 2QFEA 4Q4Y3 5KBFA 2Q0AA 3CNAA 3H7JA 1OOPC 2HWE2 1ND2C 3VHOA 4BIOA 3I54A 2GALA 3SXWA 5KHIA 2B46X 4ZU7A 1QNWA 1UN1A 2DVGA 4LBKA 3ATGA 1DQ2A 5DDJ1 3NWKA 1D4M3 1REFA 1XNKA 2D40A 2XWBB 4N43A 1BEV2 3IMNA 2YPJA 4QD2A 1BK1A 1I5ZA 3H1WA 1WCDJ 4YGBA 3WDUA 1UPSA 2XKPA 4HFSA 1LCLA 1H8TA 1RUD1 5F6KA 1F8VA 1CR7A 4XF3A 4RL7A 3MEPA 5JPNB 3NSTA 1J3QA 2UY9A 4QPGB 3WX5A 1RINA 4QPIC 4N53A 1AJOA 5GZEA 3ZIXA 2XJQA 4TSVA 5CFDC 4EWDA 4HMZA 1DQ5A 5GALA 3DUIA 4JC1A 1K5MB 1DZQA 2W52A 1PIV2 2DCYA 3ZFFB 4BHPA 1NE4A 1VBC2 2P3KA 1HQWA 2IZWA 2CV6A 4AHZA 4X6QB 1O3RA 1UD1A 4IV3C 2RHPA 1U5YA 5CU1A 4QM8A 1OPOA 1MS5A 3MIEA 1CGPA 4WBBA 1MEC3 1NYWA 2DU1A 2B45X 1KD7A 3HMYA 2GNMA 4IQPA 1V6IA 4CEWC 2DCJA 2A71A 1VRH2 1C1LA 1HRI3 3U10A 1JH5A 1IGOA 4FOWA 5TSWA 1SLAA 2WFF3 1KJLA 4I3PA 2CWSA 3LAGA 3LA7A 3N4MA 3VKLA 2OVUA 4RGGA 3ES1A 3ZSKA 3WQ7A 5T5LA 1OLRA 1O4TA 3EO6A 1XNDA 4ASLA 3JQXA 2CNAA 2I2SA 2XJTA 1C3HA 4W6XA 4YW2A 4LBNA 3PJQA 1LENA 1RUG2 4PCRA 5C4WA 3NAPC 2ZGMA 4GXLA 4Y1UA 3ETQA 1NQDA 1RJ8A 3CJIA 2UU8A 3AKSA 2IWGB 2VMGA 2XUMA 2YHJA 1LULA 5FAXA 1Z7S1 1IS4A 1BVVA 3AJYA 1FPN3 5CVRA 4CDXA 1OPMA 5JZGC 1XU1A 4LBMA 1QQP3 2E7QA 2WNVA 4RGAA 3N7LA 1YCIA 3OY8A 4YGDA 3X29B 1LESA 2RR12 1VBA2 4N7IA 1FAYA 1WGPA 4C91A 4IEOA 4EN6B 4K1ZA 2RE9A 1TQ5A 3MPPG 1W0PA 3ZFGA 4B7EA 5I8YA 3NO8A 4BLIA 4ZKTB 1EY2A 1QU0A 2IXKA 2OZJA 2JG8A 4L8QA 5DXDA 4LBQA 1KFXL 4YVSA 3WDYA 4Z2WA 2WZPP 1ZRRA 3DPRC 1NZCA 2MNGA 4I0AA 1BZWA 5JSRA 1WA4A 2ZS6B 3HT1A 1BXHA 2JKBA 1Z78A 4MYEA 2ZGUA 1AR71 4M3CA 1SMVA 1ZNPA 3LZZA 1WD4A 1XYNA 1VBE1 5BV6A 2NP0A 1SBEA 1PGL1 4LULA 4C1XA 2PHDA 1FT9A 3VBSB 5JSOA 4FCAA 5T5JA 2GAUA 2W39A 4AI0A 5A32A 5BNNB 1MACA 1X8EA 3VZJA 1KFUL 5C8WA 4QHBA 1AJKA 1HXS1 3KCXA 4AEMA 1V6KA 3E97A 3M3EA 5E89A 3LCPA 1FOD2 2WWSA 4W6WA 1H1AA 3EBRA 3POWA 1BMV1 1PO11 4RQPA 3ZXKA 5JPMB 1R092 2AYHA 1VBD1 4XJWA 1H2NA 1LOFA 3GBGA 4WVMA 4QQLA 1AL21 1WW4A 5AVAA 1G86A 2HWD1 3OGJA 1NE6A 3IT8A 1LHNA 4PLMA 4Q0PA 1NCQB 2YZ4A 3GBWA 2R041 5LK5A 2VVEA 1QXRA 4YM0A 1Q8OA 4Y1XA 1J59A 3FFZA 4XF4A 3VDDB 4N43C 1SACA 4MV2A 4CDUB 3J9SA 2GU9A 3RMXA 2WIIB 2QQPA 1SBFA 1DGRN 2DTWA 2PELA 2FZ2A 2K2SA 1H8TC 3JBG2 1BBT2 3MW3A 2E7TA 3MLKA 4AVBA 2JECA 3UKNA 2JXAA 4BWOA 4ISQA 4B8EA 4JDMA 3WD5A 4N53C 3DF0A 3JB4C 1R1A1 4KWJA 4NN0A 1PMIA 3KQRA 3ZSEA 4O9GA 1RUH1 2A75A 1JW6A 4PDWB 4LA2A 1YNAA 1EAH1 4JTNA 2IXLA 2W08A 2JEMA 4LT5A 1C5IA 3HR9A 3VZNA 4QPGA 1GYKA 4D69A 5EZWA 3FJSA 1OQEA 4XJ8A 1PNGA 4H7MA 4QXKA 4DINB 3ZPYA 4XJ9A 3WG2A 2GZWA 3B3QE 2XKOA 1AR62 2E7AA 4Q4X1 4M0NA 1N47A 1RGSA 3ZSJA 1S0CA 4U36A 3S30A 1K5MA 3THPA 3USUB 4HANA 3ZFFA 1ZA4A 3WY6A 5C9AB 2HWF1 5I8SA 4COZA 3LSDA 5A33B 2VOXA 4E2QA 1YXWA 3JD73 1N1YA 3JB8A 1FMD2 4GKYA 2XLAA 3WG1A 1H2LA 3MI8A 3PTYA 3RJ2X 5GZDA 3RNSA 4AQSA 4I3GA 3J8F3 4XBLA 3B5LB 3AMNA 5C6CA 5JWPA 5LRSA 5LK7B 1LGBA 3P3PA 4FOYA 3VBRC 1CVNA 2I74A 4XBNA 1QGLA 3T1MA 4WVZA 3I59B 4MXWB 1ZZCA 1AYN1 5C4WC 2QZ3A 2ZAHA 3M8LA 1RUC3 3SH4A 1DQ1A 3MFCA 2BGCA 2PHFA 2AR6A 3A0NA 2D98A 1KJRA 1UKRA 4GMP3 1RC6A 5H9QA 3N35A 4CDXC 3AX4A 4IL7A 1TNFA 4LLFA 3KLSA 4X6RB 2BFUL 1LHOA 4XTPA 4B7KA 4LBOA 3AP7A 2R49A 4JRAA 4KH9A 4N9HA 1UW8A 1KS5A 1RHI3 2RS52 5JR7B 4H14A 3OCPA 1C8M2 3ZFGC 2P2KA 5CNAA 4P5HA 2XBO3 2WZR3 1ZZ8A 3UV9A 4FAHA 4NOTA 2HYKA 3AMMA 4IERA 4AI1A 2O8OA 2DF7A 1RVF1 1VJ2A 2DFCA 1AR92 2JG8C 3I2DA 4DMIA 4TYSA 5DUVA 4PLNA 3AYDA 3MF6A 4AE2A 2CAVA 2EALA 3HBZA 1QJU3 4JVAA 2EXIA 4XMIA 1O3QA 4XOGA 4EV0A 2GN7A 1UIJA 3DN7A 3H8UA 3IWZA 2CGNA 1V6MA 2SLIA 2AENA 4FPOB 1BMV2 1RUJ2 3M3OA 1GQHA 3B69A 2EXKA 2D6MA 3FE5A 1W0OA 4LBLA 1QJX1 3GHMA 1V00A 4XFAA 3AZZA 5HBAA 1WLCA 4QQHA 1B35C 1PO23 2QDNA 4CZSA 4AI2A 1FV3A 4HT1T 1GR3A 4RQPC 1DIWA 3O5SA 4R8HA 1X8MA 3VBSA 2DCZA 1LOFC 2JG9B 5BNNA 3D4KA 2I07B 1DDLA 4R4XA 4XJAA 4LO7A 4YLZA 2HWB3 1HLCA 2Z2SB 1G7YA 3OGGA 4MGKE 1S1AA 1W6QB 2PHRA 5HI0A 4IXLA 4EN8B 1NY72 3AMQA 3WP6A 2GH8A 2D6LX 5T55A 3UL2A 2NZ9A 3AFKA 1X82A 1NCQA 2WT0A 5L7OC 1GZWB 2PAKA 2VH9A 2R061 3AMHA 2DURA 3M3IA 1ZX5A 4FPKA 4KBBA 3E6BA 2VECA 2RJLA 3NV4A 4CDUA 1APNA 3WCSA 1ZVFA 2HWE1 4FPEA 5AC93 1LGNA 1BQPA 4I0WB 1NG0A 4IEVA 5JIUA 1YFWA 2Q30A 5FPZA 5IK8A 3ZMNA 5GJ6A 2Z79A 4K9SA 4AQ2A 4CDQB 5GKAC 1COV2 1F9KA 1RUE3 4YVWB 5JOYA 1Q3EA 2EIGA 3LB9A 2AH2A 4QPGC 3SITA 4FP3A 3NKTA 1BEV1 3I8TA 4AWDA 3ME2A 3GZAA 4I2OA 3M3CA 2HWF2 1ALYA 5BNPB 4CTEA 1WUVA 4PDWA 2ZMLA 2B42B 4AFDA 4XIOA 1K5MC 4XETA 1MZEA 2WNEA 5AFBA 4PBPA 4LR4A 3ZFFC 4JTOA 4LE3A 4GULA 3BODA 2WJSA 1OMIA 2BVBA 2DVAA 3R0RA 1MEC2 2Z42A 3LWCA 1CAXB 3VL8A 2VPVA 1PVC2 4WVWA 2OUJA 2MEV3 2GC1A 3AZVA 3N7JA 3USUA 3AZWA 4WVVA 2R0HA 1PIV1 3ZSLA 4LBJA 1QNYA 5T50A 1VBC1 1S0JA 4QGLA 1A78A 4AI3A 2UWAA 5A33A 3U11A 3UKVA 4Y5Z0 1W6PB 1TNRA 4YGCA 3SHRA 3TBDA 3AKQA 3VLBB 2ZGOA 4FSJA 2R32A 1BKZA 1UX6A 5FO9B 5CFCB 4YNIA 3NVCA 5L73A 4AFMA 5A3MA 3WR0A 4MXVA 1VRH1 2QZ2A 4BE3A 1YI7A 5H9RA 5EYYA 4GA9A 3HD8B 3I59A 4MXW