4JGYC

Crystal structure of human coxsackievirus a16 uncoating intermediate (space group p4232)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
236
structure length
231
Chain Sequence
GIPTELKPGTNQFLTTDDGVSAPILPGFHPTPPIHIPGEVHNLLEICRVETILEVNNLKTNETTPMQRLCFPVSVQSKTGELCAAFRADPGRDGPWQSTILGQLCRYYTQWSGSLEVTFMFAGSFMATGKMLIAYTPPGGNVPADRITAMLGTHVIWDFGLQSSVTLVVPWISNTHYRAYFDYYTTGIITIWYQTNYVVPIGAPTTAYIVALAAAQDNFTMKLCKDTEDIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyprotein, capsid protein VP1
publication title Picornavirus uncoating intermediate captured in atomic detail.
pubmed doi rcsb
molecule tags Virus
total genus 38
structure length 231
sequence length 236
ec nomenclature
pdb deposition date 2013-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4jgyC00
1AL0G 1K5MB 1HRV1 1EAH2 1QQP3 5DDJ2 2HWE3 4CDXA 4Q4V3 1D4M1 2X5IB 3LOBA 4Q4X2 1VBB1 2RS52 4WM8A 1BMV1 4IV1B 1B35C 1VBB3 2RMU2 1PVC2 3VBSB 3CJIC 2RS11 1RUE2 2HWB1 1DDLA 1QQP2 1ZBA1 1AR91 5ABJA 4QPIA 1HRV2 4PDWB 4Q4Y1 2HWB3 1ZBA3 1AR93 3ZFGC 3VBRB 1D4M2 4Q4Y3 5BNNC 4BCUA 1H8TA 1R081 1PO21 4RHV1 4NWWA 1VBB2 4CDXC 4YVWB 1K5MA 4AEDC 1QJU1 1BMV2 1PO23 4Y5Z0 1VBE1 5C9AB 4RHV3 1VRH1 4WM8C 2FZ2A 1QJU3 1NCRC 1OOPC 1VBE3 2RS12 4GB32 3JB8A 2HWB2 2X5IA 3ZFEB 5AC91 1ZBA2 1RUG1 4NWVA 1AR71 5AC93 2WS93 4IV1A 5ABJC 1RB8G 4CEWB 1PIV1 3VBSA 1FOD1 1R082 4N43B 4CDWA 1VBA1 3VDDB 1H8TC 1V9U3 1VBE2 1ASJ1 4PDWA 4JGZB 5C8CC 1VRH2 4IV3B 1K5MC 2R071 1FPN3 3VBRA 1ASJ3 1OPOA 1RUG2 5CFDC 4FTEA 4Y4YA 4YVWA 1E57A 1AR72 1RHI2 5FMOS 1AL23 5BNPB 1SMVA 5C9AA 5L7OC 5A33B 1PIV2 1R093 1FOD2 2R043 4Z92B 1ND3A 1RMU2 4IV1C 4FSJA 3ZFEA 2BUKA 1RVF2 4GH4C 1VBA2 1RUF3 3VBSC 4FTBA 1QJY2 1RUJ1 1W39A 1RUD3 1HRI1 1AYM3 2R072 4QPIB 4CEWA 1POV3 1M06G 4RFT0 3DPRC 4N43A 1HRI3 4RS5B 1TME1 3VBRC 3VBFB 1FMD1 3VDDA 3JBG3 4JGZA 4YVSC 5K0UB 4IV3A 4YVWC 2HWE1 1FMD3 4Q4V1 4RR3B 5D8AB 4WM7C 1AR61 2GSYA 1RUJ2 1RUC3 4CDQA 5GKAC 5BNPA 1AR63 5A33A 5C4WC 2RM21 5JZGC 2IZWA 1VB4A 1TME2 1VB2A 4FTSA 2RM23 3VBUC 1HXS1 3ZFFB 5FOJB 1NA1C 4N43C 4CDWB 2HWE2 1HXS3 4Q4V2 3NAPB 4RQPA 1CJDA 3J8F1 4IV3C 4RS5A 1AR62 3VBFA 2WWSA 1MQTB 3J8F3 5CFCB 5FMOL 5K0UA 5LK7B 2VQ0A 4RR3A 5BNPC 4CDUB 1HX6A 5D8AA 1HXS2 1ND3B 2BBVA 4N53B 1PO11 2WS91 1AR92 1ZBE3 3JD71 4Q4Y2 1VBD1 1ND2B 1PO13 4Q4W1 3JD73 4QPIC 1VBD3 2HWC3 1V9U1 1PO22 4Q4W3 3ZFFA 4RHV2 2WZR1 1C8M1 1Z7S3 1QJU2 3VBFC 1FPN1 2XPJA 3NAPA 2WZR3 1C8M3 2RS31 1MEC1 1B35B 1AL21 1MEC3 1AR81 1MQTA 1PO12 2RS33 2WS92 3ZXAC 5AC92 3JD72 5D8AC 3CJIB 5CFCA 2PLV1 3TN93 2R061 1R091 1AR83 2X5IC 3VBHB 4CDQB 2R041 4Q4W2 2GH8A 2PLV3 4CDUA 1COV1 4EJRA 2R063 1V9U2 1RUF1 1GFF2 2WLPA 1C8M2 1COV3 1RUH1 3IDEA 4N53A 3VBOA 5BNNB 5A32B 1RUD1 2XBO1 1AYM1 1FPN2 1RUI3 1TMF1 1ASJ2 1POV1 3ZFFC 5BNOB 1AUYA 1ND2A 2RS32 1RUH3 2XBO3 4CDWC 1TMF3 4RQPB 2RR11 1AL22 4PDWC 1AR82 3NAPC 4SBVA 2QQPA 3JBG1 2PLV2 1NCRB 2HWF3 1R092 2R062 2RR13 2HWD1 3M8LA 4GMP0 2TBVA 2R042 1MQTC 2WFF3 1CD3G 1VAKA 1COV2 2HWD3 1EAH3 2FZ1A 1RUF2 4LLFA 1B35A 5C9AC 5DDJ3 1RUC1 5ACA1 2BPA2 4CDUC 5J96B 2RS51 1EV11 1RUD2 1AYM2 4GMP3 3CJIA 1TMF2 1ND3C 5ACA3 3VBHA 2RMU1 2RS53 1EV13 1HRI2 3ZFEC 2RR12 3S6PA 5C8CB 2RMU3 4CEYB 1BEV1 1PVC3 3JBG2 4CEWC 5BNNA 2HWD2 4JGYB 5A32A 1FMD2 1QJZA 1RUE3 1BEV3 5CFDB 5BNOA 1HRV3 4AEDA 3VDDC 5L7OB 1A6CA 1RUC2 5ACA2 4JGZC 1EV12 1D4M3 1NCQB 3HAGA 1NCRA 1OOPA 2DF7A 4GH4B 2RM22 1VBC1 2Y26A 2BFUS 4GB31 1F8VA 1BEV2 1AYN1 3VBHC 4CDQC 1VBC3 2RS13 4GB33 1ZBE1 1AYN3 3DPRB 3VBOB 1HQNA 1X36A 4QPGB 1QJX1 2HWC1 5BNOC 5J98B 4YVSB 5C8CA 4CEYA 3J8F2 1QJX3 1WCDJ 1R083 4JGYA 4RQPC 1Z7S1 5CFDA 3FBMA 4WM7B 4RS5C 1VBC2 1AYN2 1PGW1 1OHFA 1VRH3 5L7OA 1NOVA 5C4WB 2ZZQA 5K0UC 5JZGB 1ZBE2 1BBT1 1NCQA 1RHI1 3TN91 3JB4C 4RR3C 1RUG3 1BBT3 4GH4A 1NG0A 1AR73 1RHI3 3VBUB 1QJX2 1VBD2 2HWC2 1NA1B 1NY71 1RMU1 1PIV3 1RVF1 1FOD3 1IHMA 1Z7S2 1RMU3 1X33A 1RUI1 2MEV1 1QJY1 2ZTNA 3DPRA 3ZFGB 4CEYC 1RVF3 2WZR2 1PGL1 1VBA3 2MEV3 2ZAHA 1QJY3 4JGYC 4QPGA 1PGW2 4CDXB 1MEC2 1R1A1 2R073 1F2NA 4YVSA 1BBT2 4AEDB 3TN92 2HWF1 1R1A3 2WFF1 4WM8B 4WM7A 1NCQC 1OOPB 1NY72 1EAH1 1POV0 5DDJ1 5CFCC 5C4WA 2BFUL 4GMP1 5JZGA 1RUI2 2MEV2 1C8NA 5ABJB 4Q4X1 1PGL2 1RUH2 2XBO2 3VBUA 1RUJ3 1NA1A 4Q4X3 1R1A2 4N53C 1PVC1 3VBOC 1H8TB 4QPGC 2HWF2 1TME3 1ND2C 2WFF2 1RUE1 1QQP1 3ZFGA
chains in the Genus database with same CATH superfamily
4HVQA 5BV6A 2A5ZA 2E33A 5LEKA 2X8KA 5AFBA 2OZJA 1SFYA 4L2NA 4NUBA 1IKPA 2W9XA 4EROA 2DUPA 2AEZA 3ZYRA 3MEPA 3ILFA 4NPMA 1S0EA 3ZIWA 5GZDA 3KHCA 4XDQA 1OI6A 2J1EA 1LOGA 4LBJA 2Z42A 1YIFA 1NZCA 4WM8A 5FBJA 3VD5A 5FR3A 3H1MA 4M01A 5CIRA 3IWZA 2Q8CA 5ANNA 1JU4A 4OUSA 3LF7A 1NLSA 3CJIC 5ERLA 1LHWA 3GF6A 1BQPA 3BCWA 2ZGPA 3MHZA 2LUWA 1VE0A 5T5LA 2GDFA 5JOYA 1IG3A 1ZBA1 1GZTA 1AR91 1Q8QA 4E27A 5CEHA 4QPIA 3UGFA 1ONAA 1HRV2 2YZ4A 5IVCA 5F9TA 3ZX7A 4OZXA 1XYNA 2I2SA 4NIGA 1ZBA3 1O6UA 4YPJA 3UL2A 1AR93 2PHLA 2NN8A 2XHNA 3FN9A 1JZ2A 1J83A 1SDWA 4LR4A 5GLUA 1D4M2 5T54A 1RIRA 1CPNA 5LRRA 4LKSA 2KA3A 1DU3D 2WABA 2VJXA 2V5YA 4NE9A 1VBB2 3WP5A 1SZBA 3B3QE 2UWAA 1D2QA 4HBNA 4AEDC 5C9AB 1VBE1 4ZZ8A 4OHYA 2W1UA 3BTAA 2UY8A 1T2XA 1VRH1 1Y43B 2BTVC 4WM8C 4RN5A 4XE9A 1NCRC 1VBE3 4XJWA 5KXCA 5KHHA 4DPNA 1ZZCA 2X5IA 3NSTA 3MDPA 1LESA 1LR5A 3VZKA 4XBQA 3VHPA 1X82A 3LDKA 4XABA 1W0OA 1AR71 3TOJA 4K1ZA 2D5HA 2E32A 5C6CA 2ZS6B 5A6QA 1F5JA 3DYPA 4OLLA 4HONA 1V6OA 4C1WA 3FUOA 3LQCA 4JC1A 4RA0A 2JDMA 3AXDA 4FFFA 4UFLA 4OI0A 4GKYA 5KHGA 3O7OA 4FPHA 4IE5A 4NHYA 3VDDB 2ZX1A 3HNMA 2YHJA 2OKXA 1ASJ1 5FO7B 1UZYA 4IGQA 3POFA 1DQ2A 2BGOA 5DZEA 4YWAA 2BOIA 5GALA 2QQVA 1ASJ3 1GUIA 1W9YA 4ATFA 1Q8OA 1ZRIA 3I7DA 4YZ5A 2YBSA 3D0SA 4ISQA 3W58A 2OUHA 1MACA 3OY8B 1W8WA 4LA2A 4IEVA 4K9SA 4Q26A 5DXDA 4YVWA 3AVSA 4XCBA 2OYZA 1W8FA 2ZGKA 5BNQA 4C90A 2A6XA 2YFUA 1JTZX 2J1SA 1CAUA 1YI7A 2E7QA 3C7HA 1UY1A 1XNKA 3PLQA 1PIV2 3SCGA 2MNGA 1CESA 4PHZA 3D82A 2XQRA 1OXCA 1GLHA 1MZEA 1ND3A 2JG8C 1RMU2 4MGSA 4D6QA 2ZGNA 4OVEA 4R9DA 2TEPA 3ZFEA 4AYUA 3WNKA 4IE6A 4QQHA 4B7KA 3SEEA 3ACIA 1L7RA 4Q27A 3QD6A 3T30A 1NQJA 2PHTA 2IFRA 3ACLA 3AYAA 1IGOA 1URXA 2R7EB 1HRI1 1OLRA 2AZ5A 4XFBA 1GICA 2FCUA 1OT5A 1O59A 4GKXA 1HRI3 1NQDA 2P3KA 1RUNA 4YW4A 1YLLA 4PF5A 4LT5A 2V73A 5FYBA 1W0NA 4Y1VA 1K5JA 2LTNA 4CTEA 2ILMA 3SH4A 3JBG3 1GZWB 4YVSC 5K0UB 4YM2A 4YVWC 2VZVA 1PGSA 4F8AA 5HCHA 3H7JA 2ZEWA 1EY2A 2P2KA 4X6RB 5FZMA 5JMCA 1DQ0A 3MZHA 2QE3A 2W52A 1KDKA 3K4ZA 2X53S 4KBZA 4JRAA 4C1XA 1HIXA 5F7UA 2WA4A 2GSYA 1KEXA 1RUJ2 2J1RA 5FZEA 1LGCA 2VTXA 4ZKTB 5BNPA 5C4WC 2DDUA 2RDNA 4CPBD 2VAUA 2IZWA 1MPXA 4XPVA 2ARXA 2K0GA 3FLPA 5LWBA 3MLKA 2D93A 2VMFA 3BTZA 1HB4A 2JG9C 3RFRA 5FOJB 2DWRA 4BPZA 3T4VA 5GZFA 4YW2A 3W9AA 4CP2A 2ZGQA 3PNAA 2DFBA 2SLIA 3IPVB 4A3ZA 1Y3TA 2HWE2 4D0QA 1JZ7A 4LNVA 1E5HA 1TE1B 2BGCA 2WBKA 3POGA 1LOBA 4ONUA 4Q4V2 5A7PA 3NAPB 1OQDA 4RQPA 3THTA 4AFMA 3UT0A 2B9VA 5I8SA 5CKNA 1D4VB 3MGUA 3VZOA 3FMGA 5G05L 1AR62 4JDNA 1H8VA 1QHDA 5FFOC 5J1XA 1LU1A 3FFQA 1OLME 4IEXA 3BUCA 1X8EA 3WZ1A 4XUNA 1D7PM 4V2VA 4IEUA 1PNFA 1W2AX 2E63A 3RVHA 3AYDA 3WF0A 1YUDA 3AKTA 1US3A 4RR3A 3EYPA 5BNPC 3KT4A 3OUIA 2ZGOA 2AGSA 2FBEA 5D8AA 4QX7A 4FOVA 4JAAA 1DGLA 3JXSA 5FY7A 3TAYA 2JDZA 3L9JT 1MVEA 1W9TA 4C8DA 2OA2A 2ADDA 4FPJA 3NNMA 2QQMA 4Y26A 2Q8DA 5B4XA 3ZN6A 2WO3A 4BK4A 1ND2B 3OBAA 1UX7A 3BB6A 3AL6A 3GM8A 4IEZA 4P9WA 4Q4W1 2JDPA 5F3IA 3JQXA 5FP7A 3WXPA 2VZ3A 3C7OA 1PO22 3L2HA 4Q4W3 2XJRA 3HWJA 1WCSA 4FPLA 3PMSA 1GOFA 3LSDA 3N9QA 3UETA 1H0BA 1MVQA 4JKLA 1QDOA 3N7JA 3J7MA 1Y7BA 1S0CA 1Z0HA 5FMDA 5FO9B 2UYBA 2W0XA 4LBQD 4XCAA 2WLQA 4A7KA 2CAVA 4P5HA 4AGRA 2EA7A 2PA7A 1JZ4A 1SLIA 4IEQA 3CHXA 5JI7A 1WD4A 2AUYA 2R0HA 4E8CA 5FPUA 1AL21 1GNZA 4KGGA 3ZDVA 2WS92 4LIUA 5AC92 5IFPA 2P37A 3ASIA 3JD72 4TWTA 5D8AC 4BISA 3LD8A 2JECA 2XJQA 2PLV1 4B4RA 4J6GA 5FZGA 1DG6A 2WNVB 5FY9A 3PVOA 4AEKA 4YZ1A 2D40A 5GZEA 1F5FA 2HYXA 2W92A 3MV01 5F3EA 5IJRA 3VBHB 3BKZA 4ZXEA 3WUDA 2PLV3 1COV1 4EJRA 1KQRA 1W8UA 4W6XA 3W20A 1V9U2 1H4GA 2VZSA 4IDZA 1CIWA 1U5XA 3VZNA 2WLPA 2ZGRA 2W87A 1UNBA 2JDKA 1W8ZA 1COV3 1DBNA 3L2YA 3H3ZA 2R49A 3QH6A 4N53A 1JI6A 4XF4A 3VBOA 1AYM1 2W1QA 5FP8A 5A7WA 1FPN2 4XHBA 5T50A 2GAUA 3HBKA 1POV1 5JSPA 2IVIB 5EYXA 2KR2A 2RS32 1ZVFA 1QJFA 3ZYGA 1XXNA 5FXVA 1XE8A 4N7IA 4IETA 1W2NA 1AR82 1SLLA 4M3CB 5DAWA 2AREA 4BB3A 3KCYA 3ZSLA 1LEDA 3TEWA 4BM8A 1EPWA 2QVSB 2PYTA 4UFHA 2PMWB 5KXEA 1LODA 1R092 1UPIA 3QOPA 3T1LA 4E8DA 2TBVA 3M3OA 5FZ1A 1I9RA 4QD2A 1EUTA 3OBTA 3VL8A 3BPSA 2ATFA 3CBNA 2CWMA 1N3PA 5GZCA 1GOHA 5FYHA 2WT0A 2ZGSA 4N90A 1LJ7A 2FZ1A 5A3OA 4AVCA 4G3YC 5C9AC 1XQNA 4EE2A 2BPA2 1RUC1 3DXUA 4X6QB 2F6BA 1RUD2 4NMIA 1QWRA 1X8MA 3W5NA 1CX4A 5G04L 3AFGA 3AP7A 1LECA 5K8SA 2AYHA 2JDUA 3M1HA 4NJ4A 4S2DA 4XUPA 2C24A 3O1UA 1JMUB 2VUJA 1OKOA 3ITQA 5FPAA 5J3UA 3N4MA 1ULGA 4INDA 3ZIXA 1BCXA 3DYMA 3TEZA 1WW5A 1PVC3 4BQ2A 1O3SA 2JICA 1S2EA 5IVVA 4CVUA 2W2IA 1OVSA 3IM0A 4GALA 2HWD2 4JGYB 3ROUA 5FK8A 4ZU7A 1I1EA 1OD3A 2CDPA 1F4HA 1T6BX 5BNOA 1GWLA 4HLTA 4D3WA 3AC0A 5LW9A 4AE2A 4HXCA 1DGWX 5JI9A 1WA6X 4OMCA 4XMIA 2JDYA 4DQAA 4YGDA 3VDDC 2VQAA 4WZFA 3MYXA 5JUVA 5FYYA 5F39A 3WCRA 3BTXA 2FCTA 1NKGA 2UY9A 3Q8CA 2ZEZA 2PTMA 3FLRA 3OUHA 5F32A 5FQ0A 2C9KA 3GBFA 3INAA 3BTYA 1Q5OA 5FP3A 1S2BA 4GH4B 1A8MA 4H55A 3WNXA 1STMA 4Y22A 3ZSEA 3DEMA 5GZGA 5DUWA 3WF3A 2D44A 1BEV2 4CDQC 3BYWA 1HB1A 4TYSA 3WP6A 2RS13 3KM5A 1S0FA 3I59A 4AZZA 2CY6A 3PJQA 2ZBJA 4XILA 4MGTA 2ZHNA 1UOBA 5IVYA 1KFUL 1X36A 4XUOA 3S30A 4HG6B 4BWOA 3H8RA 2HWC1 3LKJA 4NIAA 5BNOC 3GYDA 2WNUA 5K9YA 1G9FA 5C8CA 1O3TA 1GOGA 2J7MA 4LO4B 4H7MA 3LEKA 1WCDJ 2DCZA 2ZJCA 1MS3A 3IDAA 2YU1A 4XFIA 3IDCB 3I97A 3ETPA 5CFDA 1JYCA 4SLIA 4WM7B 3U07A 2EIDA 3WEZA 5KHJA 1ZNPA 4FFIA 4TLFA 2EAAA 2WO2A 1DZRA 2XUEA 1UU6A 3E6DA 4NO4A 1BVP1 4QWNA 4XTPA 1N3OA 5FXWA 1W2TA 5FYVA 5IW0A 1UKRA 5L7OA 4ES9A 3USSA 1HDKA 2R1BA 5HBAA 1NZIA 5K0UC 5JZGB 1NCQA 1RHI1 2YB7A 4WVZA 4EN8B 4OUMA 3TN91 3WDXA 2EICA 1RUG3 3H42B 1J3PA 1VLNA 1TZOA 3WNMA 4BXFA 3B02A 2VBBA 5FRAA 3VL9A 3VZJA 1NG0A 1RHI3 1QIQA 3ZLIA 2H0VA 1VBD2 4MOAA 1NA1B 1SCSA 2P17A 1PK6A 2VG9A 3VKNA 3KLSA 3S5AA 3JUUA 1CR7A 2EAKA 4UW3A 5GLVA 1FOD3 3KT1A 4C0BA 2B45X 4DO0A 3BOPA 1Z7S2 4NPLA 4UBGA 1PMJX 1QJY1 2E7AA 4FPGA 5LASA 3O1TA 2A6VA 2EIEA 5AVAA 4E4ZA 1VBA3 3U4SA 1PGL1 1J84A 5A7NA 1QJY3 4WV8A 1NAEA 3CDZB 1PGW2 3RWNA 3T1MA 2FDGA 4W8JA 1W05A 2BBAA 1MEC2 2R073 1F2NA 1VALA 1BBT2 2BYVE 5E1RA 1T6GC 4AEDB 1N1YA 5FZDA 3OBZA 3C7GA 1NX9A 2DFCA 2VW0A 3VHOA 2BWAA 4WM8B 4E2QA 1K12A 1NCQC 1PZ7A 2UWBA 2YPJA 1US2A 4JV4A 1NY72 5EPAA 4R4ZA 1A8DA 4URAA 3TRSB 1H4HA 5IATA 2ZGUA 5DDJ1 1ZZ6A 3MV11 3UKNA 3PUQA 4BK5A 3GXUA 3O1MA 1RUI2 3FHIB 2XLGA 4BHPA 4LEJA 4CCJA 4XDPA 1RYYA 4BQ5A 2VMDA 3B9IA 4YW3A 5IK8A 5FOBB 1SFNA 2XBO2 1KJLA 4OI4A 1HQLA 5EJ3A 3PVBB 1WMFA 4NAMA 4CUCA 1C57A 1LOFA 3UGGA 1Q8SA 4XAEA 4BQ1A 2A71A 2Z5WA 3AMHA 1V70A 4XJUA 4AEJA 3AVRA 2D3RA 3R0RA 3B9CA 1TME3 1ND2C 1WMDA 1RUE1 2YXSA 3KCXA 3OGGA 1QQP1 4GWMA 2JX9A 3ZO0B 1ENQA 3FJSA 3M3IA 4LKDA 5KWRA 5K7PA 1EAH2 2W08A 4O61A 2O0OA 1AX1A 5D21A 3AJYA 1JZ5A 1QQP3 4GA9A 2YDEA 4PQQA 1H1MA 4CDXA 5C3QA 3C7EA 2WQZC 3LIHA 4EZ4A 2ZKNA 4AOCA 3FE5A 2CGOA 2VR4A 1PVXA 2WUHA 2X5IB 3AXEA 4CYDA 2ZA9A 4Q4X2 3LEMA 2QQOA 5FKCA 4B4PA 2Z2SB 1GQHA 3MFCA 4I2OA 1LHVA 5A3PA 2PHDA 3MIFA 2ZX3A 3GDBA 1Q56A 3WDVA 5C5TA 1XE0A 2WN3A 5FZAA 5IAXA 2JKXA 3OB8A 4IERA 2C6SA 2WT1A 2WNVC 1W8OA 2WL1A 3H0OA 5T52A 3W21A 3I3BA 1X9PA 4ITCA 5CBLA 3V0BA 4JTOA 5ABJA 2VMGA 4XJ9A 3VHRA 5A3MA 2VMIA 3PJYA 4YZ2A 4IE4A 2IWGB 4MG2A 3PTRB 3LPFA 4QXKA 5SV8A 1HV0A 3AZWA 2D97A 5CISA 4U36A 5J37A 5EWSA 4P5YA 1ENXA 3T08A 3RI9A 1VRBA 1R081 4NWWA 4CDXC 3ZXJA 2ZMLA 4YVWB 3UK9A 2HKXA 1YNAA 3R4DB 2ZPXA 5FZOA 2J1UA 5ISLA 1YQ8A 1LEMA 2DCJA 3GHNA 1CAUB 1QDCA 1WW7A 2G4IA 1UCXA 2VL4A 4NN0A 2Q8EA 1UAIA 4CXYA 2DVGA 2VMEA 4LO5B 1OOPC 3S0MA 4GB32 3JB8A 2FQPA 4FO9A 2FDFA 5FZKA 1SG3A 4XIOA 3ZFEB 1ZBA2 3SQOA 1B09A 3AK0A 4NWVA 1N3QA 4AFDA 3Q9OA 5C70A 3U4XA 3FWEA 2VCCA 3O12A 3O1PA 3CQOA 4Y4RA 1X50A 2E53A 4QMAA 5ABJC 2VZUA 5BYNA 3PTYA 1I6XA 3VBSA 5A3TA 3TBDA 3SCFA 1UYXA 2KXLA 4UF0A 4UI9L 3IKWA 3LA3A 1OPMA 3NV3A 4IEOA 4S2GA 2OX0A 4CDWA 1VBE2 4XF3A 5JLVA 3RDIA 2BERA 1QXJA 4H2AA 4PDWA 4V1PA 3FBYA 1VRH2 4MGKE 4ORFA 3VBRA 3WDUA 4JVAA 1YXWA 2GC1A 3UYJA 1W28A 2WINB 3CIHA 1OPOA 4ES8A 1X9TA 5C71A 4Y4YA 2WFPA 4O9GA 4NRMA 2DU0A 4QGMA 1AR72 4CUAA 2EF6A 4YG3A 4DUXA 4XQDA 2YGMA 3POYA 4ZZ5A 1SMVA 5BNPB 2WN2A 1DYPA 1S4CA 3IN9A 4I30A 4PJYA 1JOPA 3AKSA 1PZ9A 4LTAA 3HQRA 5HCAA 2Y6GA 4X8PA 2R043 4TSVA 4AAPA 3MW2A 3QACA 4FSJA 1G9AA 2PAEA 2NLRA 5A80A 4GH4C 1AX2A 5BPXA 3APBA 4LQRA 1RUF3 2VUAA 3VBSC 1ULFA 3LFMA 1Y9MA 3WD5A 1ZA7A 4META 1WCUA 3GCWA 3NJXA 3THPA 4A7YA 4DINB 2XLAA 4LIVA 3AP4A 2DVDA 2E51A 4CEWA 3MIEA 5DAQA 1JZ3A 3UGHA 4BQXA 3DKQA 2J1TA 4BQYA 4CP0A 4CXXA 4RFT0 5F6LB 3IMNA 4N43A 4JHZA 3IBMA 2ZMKA 3VBRC 1DZQA 3KVAA 4OHVA 4BIOA 1UOJA 3RQ0A 2HEWF 3HPNA 3I3MA 5F6KA 3P3NA 4JGZA 2DBIA 2K46A 3H50A 5CKQA 5FAXA 3RMXA 3FL7A 1C1FA 2ET7A 3POIA 5A6ZA 1CAWA 4RR3B 2GU9A 3K77A 3GALA 2DTWA 3CU7A 4LOTA 3T2TA 1JHNA 4XUQA 5D8AB 4WM7C 3H3UA 4QU2A 4KL1A 1DGRA 2W68A 3AYCA 2O8OA 5D2AA 2QNKA 3R6SA 3H7YA 3MF6A 1DIWA 4CCDA 4XXPA 1YIPA 3ZN6B 3LEGA 3VDAA 3AP9A 2RM21 5JZGC 3T2PA 4DXRA 4KG0A 1VB4A 3J4UH 1L3JA 3GZTB 4Q29A 5FZIA 3N9MA 2VTFA 3NO8A 2RM23 1LB2A 5I93A 3ZPYA 2YV8A 3WV6A 1HXS1 2L9LA 2D6LX 4E2SA 3ZSJA 3FHAA 3WG3A 1NA1C 4N43C 4CU6A 1BK1A 2DUOA 1BJQA 5FUPA 2BRTA 2XVKA 3SISA 4K6BA 3H8OA 2H6BA 1HXS3 4MH0E 4UFJA 4U2AA 5FY8A 4LHKA 5JOZA 1UY3A 3PU3A 1DF0A 4BLIA 3AZZA 3TNPB 5LK5A 4LPLA 4DZGA 1BVVA 3D6EA 3KCCA 4FOWA 4JQTA 3R05A 2F4PA 2HJIA 4KWJA 3VBFA 1BZWA 5EQUA 1RC6A 1FNZA 1FT9A 1S0DA 2PAMA 2VOVA 2Y33A 4PQ9A 3IIAA 2XKOA 4LK7A 4QU1A 2GC0A 1QXPA 2VQ0A 5F3GA 3WG1A 4RGAA 4D94A 4MGIE 3WW1A 1J3QA 2W39A 1HX6A 3AMNA 2I45A 2DURA 4L11A 5JWPA 2WNEA 1ACCA 4ATEA 2EXJA 1LHUA 4OI2A 4WVMA 4OQ9A 4N53B 1JBCA 3QLQA 4FAHA 4XFAA 1NT0A 1ZBE3 2IXIA 5FZ4A 4RGGA 5A7WB 5A1FA 4Y20A 1GMMA 3RZGA 4BQWA 2ZAAA 4Q4Y2 2FDIA 1WBFA 1JH5A 4QKDA 4XUTA 1UZZA 3NWKA 3ES4A 4IEWA 4XZUG 5JIAA 3GZEA 3MW3A 4JKKA 4P9YA 4XAAA 1LCLA 3OTFA 1DFQA 4ZS2A 5FUIA 3T2QA 5KC5A 5KR7A 1O4YA 4QPIC 1O4TA 4YARA 3I2HA 2ZEYA 2Y6KA 3MICA 1GBGA 3OOXA 5JCTA 3X29B 4FCAA 4RGKA 4XIKA 4XEZA 4RHV2 1W04A 4HFSA 4QM8A 3VZMA 4KWLA 3VBFC 1QJU2 4COWA 2KD7A 1U0AA 4YM1A 3ABZA 4W4ZA 5I8YA 3LDBA 3IAQA 4LULA 3QBQA 3RPQA 2V4VA 1CAVA 4D7TA 1MQTA 4GQ7A 3ZXAC 5KC6A 3RMYA 4FFGA 1YRZA 4H3WA 4Q1PA 5EZWA 2ZCWA 1AF9A 4MYEA 5CFCA 1V6LA 1YJLA 2P3YA 2R061 3VD7A 4MHUA 2X5IC 4QX3A 1UPSA 4MSVA 4UBHA 2CTVA 4Q4W2 2E7TA 3NVCA 4CDQB 1UY0A 1AJOA 2WA3A 1C3HA 4BYYA 2PHUA 2R063 3PUSA 1W8TA 4P00B 4XHXA 2DCKA 4JX0A 2W46A 1GFF2 4OHXA 1RUH1 3IDEA 1CZSA 4QKFA 4AXOA 1YC61 3ZYFA 4ASMB 3AB0A 5BNOB 5EXOA 2W95A 1RUH3 1FXZA 1V6MA 1UKGA 2D98A 3CL1A 4MZUA 4UXAA 1H2MA 5L9BA 4CSWA 4QDQA 4ISRA 3C2UA 3MI8A 4P08A 3OF1A 2ARBA 4LBOA 1AL22 2QQPA 2A6ZA 2A7AA 1MS4A 2XWBB 3JBG1 4DUWA 4QAWA 2B8MA 5FQ0B 2PLV2 2DTYA 2JE7A 2Y0IA 2QCSB 2BJSA 3ATGA 2HWF3 3M8LA 3GBGA 2BWCA 4GMP0 4R4XA 1GNYA 1JUIA 2WFF3 1MQTC 3SITA 5LZ6A 4CCEA 2PHRA 4Y22B 5DMYA 1UF2C 1COV2 3WNPA 2PHWA 2EVXA 1S2KA 3BI3A 3A23A 3MPPG 5C3RA 1L7QA 1B35A 4LLFA 5CG9A 2JB8A 5J96B 1DZTA 3I59B 2DCTA 1AYM2 2K9ZA 2QDRA 4GMP3 3EO6A 3WNLA 3HIFA 1ND3C 1W6QB 2EXIA 2UWCA 3OGVA 3SC7X 1HB2A 5H9SA 4NRQA 3ZFEC 4QGNA 4L99A 1IS6A 4AW7A 1PMHX 3FLTA 3ZYHA 3GZAA 3S6PA 2Q0AA 2WNUB 4PIZA 5C8CB 5FYTA 2IXCA 4MX3A 2AENA 2QKDA 2NMNA 1AVBA 3AYEA 3MPBA 2NZ9A 1JUHA 3C7FA 4FPCA 5BNNA 4N9HA 1BHGA 1FMD2 4ET7A 5FDBA 1QJZA 5KHIA 3FHQA 5CFDB 3J7HA 4I09A 2BDRA 4R9CA 2G9FA 3ZXEA 4EYUA 1HRV3 1UU4A 3KSCA 5EFUA 1K45A 3PVEA 1TEIA 1N1SA 4BJ0A 2JEMA 3N9LA 4AVTA 1E5RA 1IS5A 3RNSA 5L7OB 1RUC2 4YGBA 2A3XA 2EIGA 1D4M3 2QQLA 1NCQB 2QQKA 3HAGA 3RSJA 1QF3A 1FYUA 1HQWA 2VNOA 3OSDA 4AGVA 1NXMA 5F5QA 1ZREA 1UYYA 2JD4A 1HKDA 2WWUA 3ME2A 4CU7A 2D6MA 3O0VA 1RL3A 3O0WA 1VBC1 3UKTA 1U5ZA 1IKQA 1PK6B 2BFUS 2EIBA 2VNVA 1UYPA 2W94A 3HT2A 4XQ4A 5FWEA 3GHMA 3GZUC 5JXIA 4BE3A 4FQ4A 4GXLA 1R1ZA 5CG8A 1VBC3 1UZ0A 5DZFA 2PN5A 2C26A 2YC4A 2I74A 4AQSA 3KGLA 5FK7A 4CCOA 2W1SA 3PUAA 4W6YA 3D3AA 4XVHA 5CYYA 5J98B 1H1IA 4CEYA 3J8F2 5EYYA 1XNCA 4YGCA 2XOMA 5F3CA 3LA7A 3USUA 3KQ4B 1VMFA 4MXWA 2J22A 3KV4A 1ALYA 4RQPC 3P1IA 4QM9A 1MR5A 2C0ZA 3Q8AA 4UOJA 1KS5A 3FBMA 2W3JA 2RG4A 2ENRA 3DYOA 1N1TA 4B4QA 4LO6B 3WHTA 3EB7A 3VDCA 4AEMA 2BVVA 1WW4A 3PURA 1R64A 2ID4A 1C5HA 4I3GA 4XJ8A 3WVJA 1OHFA 1ULEA 5HI0A 4CPBA 1FATA 4HK9A 2ZZQA 1G6NA 1IZ3A 2YBKA 4JDOA 2F4LA 3PU8A 4CCCA 3JB4C 4RR3C 2VULA 2XJPA 4ARXA 1SBDA 1GZCA 5FXZA 2SBAA 3B5LB 1Z78A 2D6NA 1X7NA 2OUJA 3S5QA 3ZN4A 4GD4A 1CZTA 5FMCA 3MFAA 3OPTA 2HWC2 4ASKA 1XNDA 3EBRA 3GNEA 4AQ2A 1RMU1 4BQ3A 3ZYPA 1PIV3 4AI8A 3NW4A 4AQ6A 5JAXA 5KXDA 1YCIA 1VAMA 5CB7A 1IHMA 2CNAA 1RMU3 4WVVA 3O1VA 5LY2A 3DPRA 2PQQA 4CEYC 4P02B 2WZR2 2ZGMA 2OPWA 3TNQA 4AL9A 2ZZJA 1E5IA 4XC9A 1QOTA 4QPGA 4FI9A 1RTVA 1RXFA 4HL0A 2Q1ZB 1IOAA 4CDXB 1QNWA 3ORJA 3P5BA 1UWWA 1MS8A 4G9SB 4PLNA 3S7IA 1PM4A 2P6HA 4P9IA 3LWCA 4F3JA 3AJZA 1OD5A 4QX5A 5GLTA 3TN92 1UN1A 4LBKA 3H9AA 1WMXA 2WZPP 1OLMA 5LRSA 4FBFA 3RI8A 1OOPB 3WDYA 5T5JA 4D7YA 3AMPA 1ODMA 1H2LA 2ZXQA 5FO8B 3VDBA 1OQEA 1POV0 2FMYA 1QU0A 2W91A 4XF9A 5EHDA 2VW2A 1W2OA 1D0GA 1GYKA 1FI2A 1V6JA 3ON7A 3OD0A 5KHKA 3WP3A 3T3YA 4HPKA 1V6KA 4LKFA 2Y38A 5LA2A 2CL2A 2P3JA 5ABJB 1PGL2 1DGRN 1REDA 1UOGA 1LGBA 3VBUA 1CN1A 1RUJ3 5T55A 4FP3A 4XXAA 2FDHA 1LHOA 4BH9A 3V0AA 4NOTA 3J7LA 3NKTA 4N53C 1PVC1 2B9UA 4LBQA 3VBOC 1REEA 2HLEA 1W2UA 4QPGC 4YRDA 1W9SA 1MS5A 5A6XA 2NPIA 1H1AA 3ZFGA 5FZOB 2RDRA 2XGXA 3KQRA 1W6NA 4YM3A 4CRQA 1G7YA 3EQEA 3NV4A 1W0PA 2ZMNA 2HEVF 4NHMA 4QXCA 4Y1XA 3H8XA 4MGZE 5DDJ2 2HWE3 5IK5A 1N1VA 4Q4V3 1BXHA 1UOFA 5IFTA 2CGNA 2JJ6A 1G9BA 2JE8A 2IXKA 2DVFA 4A2UA 4NR1A 3GBWA 3LOBA 2RS52 1CWPA 1LULA 2BU9A 2NQYA 4XF0A 2BVBA 2Y6FA 3HNYM 1A34A 1BMV1 2WQ8A 2RMU2 3N9NA 3ZDSA 3O0XA 5FLIA 3QH7A 2IXHA 3VBSB 2ADEA 3WX5A 3U37A 1S0BA 2RS11 3WHUA 3IZOA 1RUE2 2HWB1 1OQ1A 1QQP2 2V4AA 1J1TA 4H14A 1IPJA 1YJKA 4JCKA 5FKBA 2WAAA 1O3QA 3Q8FA 3K75B 4O7XA 1H2KA 5FBZA 4AI1A 4QKNA 4YFZA 4PDWB 2HWB3 3DL3A 2LROA 4AI3A 4AFAA 5LA1A 4RYDA 2XKPA 4Z2WA 4B1LA 3ZFGC 2VBDA 2XONA 2Y60A 2GN3A 3VBRB 1CJPA 2KM2A 2VOTA 4FPOB 5A1AA 1W3VA 2VXJA 3DCQA 3E5QA 4DXZA 4FPEA 1PO21 4E4SA 2GNBA 5CZKA 3WW4A 5FTTC 4QT6A 1HN1A 1G8WA 1HJFA 1K5MA 3IB3A 1DQ6A 2WYFA 3ILRA 4PIYA 2Y0OA 1PO23 5JIUA 2A73B 3Q8BA 2PXJA 2GH2A 3BVCA 5JOWA 3BN6A 5FYUA 4S2FA 4LUKA 4AGGA 2VC9A 4XFCA 3KHBA 4MO3M 1XYPA 3RS6A 4EQVA 3B00A 3R4SA 1OA4A 5AC91 1RUG1 4Q0QA 1LAJA 5KXBA 4K8FA 1LGNA 3H3LA 5L9VA 1IQDC 2ORZA 4WBBA 3RZZA 3HVDA 5AC93 1IG0A 2WS93 4IV1A 4OI1A 1QOOA 1O4ZA 1EYBA 2VQTA 2Y6JA 3M4FA 4MGQA 4CEWB 3SNMA 3T0DA 5FY5A 5B2GB 3TEXA 2J42A 3M70A 3RZLA 2BV4A 5GJ6A 1FOD1 1R082 3OYWA 3DKWA 4N43B 2WNOA 4BIFA 2FD8A 5LEJA 4AVSA 3PUHA 3WCSA 2W47A 5LA0A 4QPWA 3NJYA 3IPVA 2OQ7A 4Z07A 3H8UA 1VBA1 1I3HA 1V9U3 4J1WA 4LBLA 4RL7A 3B01A 2K2SA 4JGZB 2WNUC 3OPWA 2ZHLA 3ZYBA 4EV0A 2AACA 2LM3A 4EWAA 3UKVA 4FVVA 5C8CC 4M3CE 3D8CA 1K5MC 2R071 1CAWB 1FPN3 1LOAA 3PUIA 2HH9A 4E4DX 2UURA 4COUA 2C4XA 5CFDC 5DUUA 4FTEA 2OXBA 4Y1UA 5FMOS 1WKYA 4IEYA 5LA9A 1KRIA 3OG2A 3VUOA 1RJ8A 4XBNA 5EP9A 3THDA 5L7OC 3H1WA 5M0TA 1SFPA 3SCHA 2TNFA 3RRDA 1SLBA 1R093 4AHZA 5JVVA 2ES3A 4D8MA 3MIBA 3HOBA 3U14A 2J1VA 3ENRA 4IV1C 1FV2A 1XB9A 1CZVA 4KU8A 1OMIA 1RVF2 3BIWE 2VCAA 4KG8A 3ZKYA 2MHFA 2VZRA 4EN6B 4FTBA 3I8TA 4EN0A 4DOUA 4QXHA 1PK6C 4XW3A 5H9RA 5FJHA 4WVWA 2NMOA 3WQ1A 4A6SA 4AQTA 3O1SA 1LHNA 2I07B 1RUD3 1YFUA 3LGRA 1VMJA 4Z8BA 4QPIB 5LB6A 1UXXX 5DPNA 5EIYB 4NROA 4CCNA 5KBFA 1KDMA 2X09A 1N47A 5CNAA 5FLHA 1FV3A 2BW8A 2NM1A 3WR0A 2RJKA 3EHKA 1TME1 1NUKA 3ETQA 4TLGA 3VBFB 1JZ6A 4LITA 3MUZ1 4Y1YA 4A45A 3K3OA 2OZ6A 3FFZA 3MLLA 5DUVA 1KJRA 3NJVA 3BU7A 3VD3A 1BYHA 4IV3A 2VW1A 3LPGA 1ZZ8A 1TVGA 2ORXA 1EPZA 2G19A 4DXTA 3RZHA 3AZVA 1RXGA 3G6JB 3M3QA 4HK8A 3SMHA 2FMDA 4WVMB 1PMIA 3RYKA 4ASLA 4LBNA 1CAXA 3O5SA 5A33A 3WW3A 4LLOA 2D6OX 2E9QA 1IPSA 4XETA 2VXRA 3GCXA 1QOSA 4URTA 3N35A 2DUQA 2OT7A 4EZHA 5HXMA 5JR2A 1ULOA 3ACGA 5JSRA 1OFNA 2NYYA 3RYPA 3THCA 4DY5A 2QTWB 1LOFC 3OCPA 5JPMB 2Q5TA 3UJOA 5HV0A 3HT1A 3OUJA 2D6PA 4PIXA 1Y9QA 2IVJA 4P9LA 3ZSMA 1CJDA 1DHKB 2IUWA 3ECQA 4Q0SA 1DGWA 5IAVA 5C7GA 4IESA 4IV3C 4RS5A 1AZDA 1XRUA 1CAVB 4BZ4A 2BQPA 3VV1A 1SPPA 1MQTB 3EJKA 3GJAA 3IT8A 4HKLA 1ULDA 2F17A 4CCLA 5CFCB 5A7OA 4CU9A 5LK7B 5I0SA 4HN0A 3S7EA 3LB9A 1SDDB 1CIYA 1JOBA 3D5OA 4ZONA 1WZXA 4OMDA 1ZA4A 3NV2A 2QQNA 4QHZA 5F2SA 1UQXA 1ZRCA 2DVBA 1HXS2 4GWJA 1G9CA 1ND3B 1LTEA 2BBVA 3IIIA 2AEYA 3GGLA 1JYWA 1O5UA 2YBPA 1PX4A 1PO11 3TB0A 2VZPA 3I2JA 1AR92 1WLWA 3WY6A 3VKFC 1S1AA 3CO2A 3J9SA 2XQXA 1J1LA 1DLCA 1MZ5A 1VBD1 1AXZA 4YYOA 5E88A 1PO13 3KV5A 1WLTA 2XVGA 2VU9A 4YG6A 5E6HA 2VOKA 5FZ0A 5FJKA 1VBD3 5FZCA 4DUVA 3SH5A 3NKGA 4LO8A 1NYWA 3ZFFA 2RV9A 1C8M1 5HV4A 4YZ4A 1HB3A 1Z7S3 3HQUA 4R9BA 5FZFA 2XPJA 1JU3A 4MGYE 4DB5A 1OA3A 3VGIA 1WUVA 1C8M3 2EXKA 1MEC1 2R0FA 1DLLA 3RWKX 2UU8A 1GSLA 3H1YA 1AXKA 3BOWA 3WNNA 1LU2A 1UW8A 1B35B 2CV6A 2FCVA 2ZHMA 4KMQA 1MEC3 4FOQA 1G9DA 3BIEA 4UW4A 1W8HA 4LXLA 1LNSA 3CF6E 2VNRA 4YW1A 4I0WB 3I2KA 1BK0A 2ZACA 4XJZA 2R041 1QGLA 5F5IA 1J59A 1RINA 4BQ4A 2PHFA 4CDUA 2WO1A 4XFGA 5LBBA 2XG3A 4I0AA 1GV9A 4NPRA 3ZPOA 1YEWA 1RUF1 1QH6A 2DV9A 1UX6A 2OPKA 2RVAA 3B7MA 4QDRA 4UFMA 4FQZA 4BXSV 4Y1ZA 5E89A 2AR6A 5CFCC 1XU2A 5BNNB 2WAOA 2XBO1 3WP4A 3ZSKA 3CZJA 1OA2A 1RUI3 2VO5A 1TMF1 4GAZA 2A3YA 3C8XA 1ASJ2 3ZFFC 1AUYA 5SV5A 1OC1A 3ALQA 3WG4A 2XBO3 1JYTA 2JD9A 2V72A 2VY0A 5FV3A 1TMF3 4CDWC 1F31A 1O8PA 4M00A 2Q1FA 4RQPB 4AF9A 2RR11 4PDWC 3ZYJB 5FZ8A 3EXUA 3I2OA 1SQ4A 3ELNA 5DAXA 3LIGA 1VPHA 2CSGA 3PIGA 2VCBA 4A41A 2R062 3N7MA 2RR13 1GKBA 4FOYA 5AVPA 4RFRB 1C28A 4BU2A 4DIQA 1CD3G 4YW7A 2QZ3A 4QB6A 1D0HA 3DV8A 4QXBA 2G9ZA 1EAH3 4AR2A 1YQ2A 2QDNA 4GIQA 5ACA1 3NNJA 4CDUC 1AHSA 2ZKLA 1EV11 2OQ6A 5FCCA 5JR7B 2OW4A 3MO4A 1ULPA 3CJIA 1ZRDA 4QHOA 2ARCA 5D1IA 5ACA3 3AKPA 3KF5A 5C4WB 2GNMA 5IK4A 3UJQA 1ZRRA 1EV13 1GQPA 1HRI2 5FPVA 3TWIA 2FDKA 4IUGA 2H0BA 2FDJA 2ZOEB 3DECA 2IXLA 4YZ3A 4CEYB 5JPNB 3JBG2 4XBLA 3G7DA 4MXWB 3LA2A 3RJRA 1NLRA 4CEWC 5FPZA 5A32A 3I49A 2YUEA 3O1OA 2PFWA 3HMYA 3VB9A 4S2HA 4D69A 2RE9A 1K42A 2YPDA 4BDVB 4PT6A 1RUOA 4HMZA 3N3HA 4QDSA 3UESA 4HVOA 4Y3OA 1UIKA 4AEDA 2E6VA 1RJ7A 5IWFA 1OF3A 4JGZC 3SHRA 2DBNA 1E5SA 5T5PA 1W90A 1NCRA 3S57A 2X10A 2ZABA 3HN3A 1G86A 3BODA 4OZOA 4Q2FA 5F2WA 2BOJA 5FY0A 4EWDA 5A3LA 1PHMA 1V0AA 2JENA 2VGDA 1WD3A 2R6QA 3N7KA 5GLZA 3URFA 4IGOA 4L97A 4AWDA 2Q4SA 4GB31 3F2ZA 3LZZA 4BMBA 1AYN1 1J3RA 4KNCA 5FZ6A 1VIWB 5GLWA 3WOGA 4QQLA 3JU9A 2ZX0A 1ZBE1 4GB33 3WDWA 3WDTA 1UO9A 1AYN3 3DPRB 4AVVA 1KFXL 2RJLA 4XDOA 4I0BA 2XR4A 2WKKA 4CP9A 4ARYA 5GM0A 3VBOB 1W6MA 1HQNA 3I2GA 5FYMA 5C3SA 5IVFA 5LBCA 4QPGB 1XBFA 2W1WA 1QJX1 4IL7A 3ZKUA 3A0KA 4HSLA 2YC2A 4L8QA 1QNYA 1XSRA 3HN1A 3O1RA 1O8SA 1RGSA 1UY4A 4HANA 3TYJA 5BY5A 1QJX3 2Y6HA 1OBNA 2LALA 3I2FA 3T09A 3LDRA 3VD9A 4JHTA 3UV9A 3PVNA 2CGPA 1VBC2 2QQJA 1S0GA 2C1FA 4PF1A 2B4KA 4YSFA 4COYA 5LATA 1DQ1A 1VRH3 1FAYA 2D5FA 1O91A 2ARAA 1JN2P 1XJAA 4IE0A 2A70A 1XNAA 4HPKB 5FZ7A 1WLCA 3E97A 2JG8A 4B1MA 2AC1A 3POSA 5FYSA 4FXGB 1SLCA 4Q1RA 3J26N 1PM7A 1UZWA 2WWJA 3A0NA 4IEPA 1AR73 3CLPA 1DP0A 2XHKA 1SCRA 3VBUB 5AFEA 1DYKA 1FX5A 4J1XA 5CA6A 3V0AB 2OS2A 2XJVA 3LFIA 4A42A 4AVAA 2D3SA 4HN1A 1LRHA 4LBQB 5A3UA 1NXD1 1TNRA 4P9JA 5FYIA 3ZXGA 1UYZA 2BEOA 2CHHA 4QQOA 3VN4A 1H9PA 3FX3A 3HQXA 4YLZA 1OUXA 2MEV1 4B8EA 2ZTNA 1MZFA 4K20A 3ZFGB 4D6RA 4RD7A 1W6NB 4K3UA 3MIGA 4AVBA 1K3IA 4D6SA 4XFFA 1OH4A 2MEV3 4R8HA 3KVBA 2GZWA 4HSJA 1J58A 1R1A1 2E31A 4YVSA 5FWJA 1U12A 1F35A 4PI2A 2XH6A 4BOWA 1EP0A 3U10A 2GC2A 3P3PA 4IE7A 1W6PA 2HWF1 3ZOIA 1R1A3 2RDQA 2VVDA 5FY1A 4AI2A 1VMHA 2PELA 2WFF1 2PAKA 1YWKA 4HKWA 4DNYA 3NQHA 4OYUA 2X29A 1NLQA 3M7AA 2A3WA 3DGTA 1LENA 1P8JA 3F95A 2D7FA 2VTXJ 3WF2A 1KGYA 2ET1A 2Q1MA 2ZX2A 1IPKA 3JCIA 4K21A 2BFUL 4L9BA 4YW6A 4GMP1 5C4WA 4BMEA 1JZ8A 3PHMA 2D43A 4R52A 1YQ5A 3DN7A 5DG2A 4ZS3A 1F4AA 4KWUA 4LMFA 1C8NA 4A7ZA 3KMHA 1CPMA 1OVPA 3MF9A 4L0PA 4P9GA 4YM0A 4GJYA 3RYRA 1ODNA 4CUBA 2JG9A 4MADA 3ES1A 5CVRA 4QQ2A 1GQGA 2GNTA 3ZMNA 1I5PA 2GMMA 5I0RA 3ZYIB 3A22A 1XC6A 2V5DA 1SLTA 2WC2A 3J7NA 1AL0G 2A1XA 2D3PA 1K5MB 4JDMA 1HRV1 2H6CA 4LUMA 4HETA 4PLMA 3KWVA 3MIDA 1KITA 3MLJA 2J1AA 4OCTA 3WLUA 2XJUA 4NHKA 1D4M1 3RZMA 1Y4WA 4R9AA 3W59A 2R1DA 2BNMA 3A7QA 3PIJA 2ZGTA 4EN9B 3PMEA 2WIIB 1VBB1 5DQ0A 3E5XA 4ZXKA 3B94A 4XJAA 1MS1A 3ZR6A 3B93A 5FZ3A 3SXWA 1GP6A 3E6BA 2QBXA 4IV1B 4OUEA 1B35C 3SKVA 1VBB3 1W6OA 1VJ2A 2MPFA 1PVC2 4QX0A 4QPYA 5T5OA 3T0AA 4DS0A 2VUCA 1JOJA 2YMZA 4Q8LA 3DUIA 2HBTA 3OYWB 4LKEA 4PI0A 3NNGA 1PX3A 3AMMA 1ULCA 3U0ZA 1DDLA 1QJEA 2NP0A 4TN7A 3CKHA 1F15A 4OULA 2B46X 2GALA 3M2MA 1W03A 5L19A 4Q4Y1 4KQ7A 1D2SA 1QH7A 3M3CA 3Q8EA 4KBBA 1OURA 3KV6A 2QQUA 2O1QA 2P5BA 4C91A 4KGQA 5C33A 2V09A 2JKBA 2ZX4A 4Q4Y3 4BCUA 5BNNC 1H8TA 2CDOA 1WCQA 4CZSA 1UL9A 1VP6A 4RHV1 1EUUA 2Z79A 5J36A 1C4RA 3WQ7A 5CAZA 2UYAA 2Z4FA 1WA4A 2WDBA 2ZEXA 1YFWA 2GNDA 1QJU1 1BMV2 4FXKB 3AP6A 1TG7A 4Y5Z0 3T0BA 4RHV3 2B7YA 3SLIA 2WQ4A 3AM2A 1OF4A 1A78A 5IK7A 3WF4A 2FZ2A 1QJU3 5H9QA 2RS12 3N9PA 2Y34A 3WQBA 2HWB2 1ENRA 4DXSA 1QEXA 2IFWA 2LW8A 5T3NA 3ZVXA 5FZHA 3N36A 5IHRA 1HN0A 2P3IA 3ZXDA 2CU5A 3MBWA 2BZDA 2Z69A 1H6YA 1YQCA 1L7LA 5I0DA 1RB8G 5FPLA 1PIV1 1IS3A 4FPYA 3WUCA 2DVAA 4QHBA 4XTMA 5I0TA 3ST7A 4KU7A 2XL9A 1GNHA 4CA9A 2RHPA 5DABA 1WBLA 3OD4A 1H8TC 5A3NA 3IDBB 4H7LA 2CWSA 1H2NA 4COVA 4IV3B 1I5ZA 3E5UA 3OEBA 3D0JA 1UMHA 3ILNA 4DRVA 2Q8OA 2IC1A 1MS9A 2WSUA 1RUG2 1UU5A 4E9KA 4XOGA 1XNTA 5A7QA 2W5FA 1V6NA 1E57A 2BNNA 1RHI2 1UY2A 1AL23 4O65A 5FZLA 4TZDA 4UYBA 1MS0A 1C1LA 2ETEA 1CAXB 5FYZA 5C9AA 4LHLA 5JXHA 4JRLA 5A33B 4Y5SA 1NE6A 5A6YA 2VNGA 3LAGA 1FOD2 1WCKA 4UT5A 4Z92B 3RJ2X 3HD8B 2DU1A 2YGLA 2VE1A 4W50A 3KT7A 2BUKA 5FPXA 1VBA2 3AKRA 1YO8A 1QJY2 3V0BB 1RUJ1 5JDBA 1OSGA 1W39A 3HNBM 1AYM3 1YYNA 2GN7A 2R072 2VQUA 3V65A 2XL7A 1FNYA 1POV3 1W06A 5F1RA 4Q0VA 1M06G 3KB5A 3DPRC 5F5CA 3HR9A 4RS5B 1V00A 2B39A 4UAPA 4QB2A 2OVUA 5HCBA 3E6CC 1JYIA 3POWA 5JSOA 3AZXA 4MXVA 4LO7A 1O5LA 1SPPB 4N8MA 5FYCA 1FMD1 3HJRA 5L9RA 3VDDA 3VKLA 4AG4A 5DUXA 1U5IA 3NV1A 4A4AA 2HWE1 1FMD3 4V2WA 2HEYF 4Q4V1 2Y8KA 4N9IA 1GP4A 5JMOA 5HCFA 2VOWA 1CX1A 3E1F1 4Z1VA 4Q0UA 1UD1A 1AR61 1JW6A 2QQIA 2VZ1A 3O14A 3OY8A 1WWYA 4MVTA 4NIDA 2VD7A 2VBPA 5BXXA 4FAGA 1RUC3 5LBFA 1ZRFA 4CDQA 5GKAC 1HLCA 4A3XA 2XJTA 1AR63 1YQ6A 3T4HB 1JXNA 1SBFA 4M4RA 1Q3EA 1OFSA 3FZ3A 4G4FA 5FPBA 4B7EA 4O9EA 5FZBA 3EMRA 3POBA 2VH9A 4DEQA 1TME2 1VB2A 5EJZB 1POQA 1OLQA 2WRAA 4YGEA 2X05A 3K51A 2WR9A 5HPOA 4FTSA 3VBUC 4XZPA 1V6IA 2EALA 3ZFFB 4UF0B 5F37A 4N7UA 4K40A 1JODA 1OUSA 4W65A 4QX1A 1A3KA 2LRPA 4JQRA 4CDWB 2GMPA 3W5MA 3AP5A 4EN7B 1JYVA 4ZPIA 5I91A 1Y9GA 3PL0A 4CE8A 4XF1A 3J8F1 4DEVA 1O7FA 4RSUA 4K7JA 4BA6A 3VD4A 4AFBA 2WWSA 4TXWA 1IS4A 3N7LA 1DQ4A 1C5IA 1O3RA 2QUOA 3J8F3 1MZ6A 3ZXKA 4LE3A 4Y5TA 3V56A 2VPVA 1GZWA 1YHFA 4LHSA 5FMOL 5K0UA 5JOXA 3CZUA 5HXVA 3LEIA 2JE9A 2XUMA 4HZFA 5IT6A 3NJZA 4CDUB 1GWMA 5FLJA 4NRPA 5FXXA 5E8AA 5APAA 3K48A 4C0HA 4XURA 2WZEA 4QQPA 1ENSA 1W6QA 2WS91 4X8NA 3U75A 3JD71 4ZU5A 2BP6A 2P6CA 4LK6A 3SEPA 2XMLA 3K46A 5IUQA 3ACHA 4XMAA 5IVJA 3JD73 3K4DA 4TTGA 1SBEA 2VMHA 2HWC3 3I2DA 4CCMA 5CADA 1JYNA 4EWEA 2XXZA 1V9U1 5H9PA 1CGPA 2E26A 2TUNA 5J7MA 3NMBA 3CEWA 2WZR1 4UFKA 2BGPA 3P6BA 1QY4A 2QZ2A 1FPN1 4NHXA 4ZY9A 3D4KA 2HBUA 3FUQA 3NAPA 3VZLA 2WZR3 1W99A 2RS31 2WJSA 1HW5A 3RZKA 4BLJA 4AAXA 1UMZA 1REFA 4LORA 5JXGA 1QMJA 1WGPA 1H6XA 1YI9A 4Q5OA 5FP9A 4E2GA 2A6YA 2RS33 2WYSA 1AR81 1PO12 3LCPA 4K8RB 4LHNA 5I8TA 4XYXA 3PDQA 4KWKA 3CJIB 3SH3A 4L92A 3TN93 1GWKA 2BNOA 2VM9A 4NVPA 3VHNA 1R091 1AR83 4Z2AA 3U1XA 3POEA 4HVRA 2GH8A 1SLAA 2XVLA 3KD4A 1W9FA 1YFXA 2A6WA 3JZVA 5FY4A 1UXZA 3JQWA 1C8M2 4F83A 1GR3A 1LKNA 1IQAA 5A32B 1RUD1 3ZXFA 5BUVA 4QB1A 5IYYA 5F8PA 1ND2A 2RJ2A 4NIIA 4LOSA 2P34A 3OJBA 4FFHA 3WNOA 4LBMA 2VZTA 2WT2A 2WSVA 3WG2A 1WMEA 4SBVA 1JYXA 3NAPC 3OBRA 4UWDA 3N9OA 4IQPA 1XSQA 1NCRB 1KXGA 5A70A 2WZ8A 1W3XA 1JS9A 3K3NA 2HWD1 2D6KA 4KI5M 2JIGA 1Q8VA 2R042 3I2IA 3LE0A 4ZU4A 5J09A 5DN2A 4ZHNA 1VAKA 1PNGA 1UIJA 2JDAA 5CU1A 4PBPA 2HWD3 3POJA 1ZYBA 4Q0PA 1RUF2 1WLDA 2XB6C 3B69A 4HOOA 2YC0A 5DG1A 5DDJ3 4XFHA 4CXWA 2GP5A 2RS51 2VZOA 4AHYA 1TMF2 3MUY1 3SKJE 2WNVA 5J48A 4CP9B 2QQWA 1LOCA 3VBHA 2GP3A 1W6MB 4OHZA 2RMU1 2RS53 5TSWA 2VECA 4WZCA 5B4NA 4Y20B 1CVNA 4AI9A 3AZYA 3NNLA 1ST8A 2YROA 2RR12 1VAVA 2RMU3 3U78A 1BEV1 3BU0A 3IAPA 1W8NA 2DYCA 4M4PA 2PHXA 4Z82A 3DF0A 5FZ9A 2Y6LA 1RUE3 1BEV3 4PBOA 5CKMA 1HV1A 3U11A 3NL1A 4PCRA 5LY1A 3T2OA 4JTNA 4MLOA 2CAUA 2GC3A 1YFYA 2Y64A 1A6CA 3RG0A 3ZXLA 4JKMA 5ACA2 1Q43A 3M3EA 4M3CA 3GJBA 3QCWA 4MUVA 5EJ1B 1EV12 1LOEA 1XYOA 3AKQA 3BALA 5F5AA 1OOPA 1PZ8A 2DF7A 2JG8B 2VCMA 4Y33A 1S0IA 3V64A 3C3VA 2G1MA 2XWJB 3I3EA 3MW4A 1ZX5A 3HEIA 3CMGA 3OGRA 1GZ9A 5A3WA 1NE4A 1AX0A 2RM22 2Y26A 3ZM8A 4HKOA 1F8VA 1GANA 3VLBB 5I0UA 4XACA 1AXYA 3VBHC 4GWNA 1SACA 4M3CF 4UW5A 5C3OA 5C8WA 1ZZ7A 2VMCA 1W9WA 4YW5A 4GULA 4DY3A 4NAOA 1HJGA 2JB4A 2JXAA 3I4IA 3KGZA 4K1YA 5IVBA 2P4EA 3I54A 5LBEA 1S0JA 3CNAA 5C5UA 2ERFA 2VVEA 5K4LA 1BKZA 3KV9A 1F9KA 3KZ4C 1KS4A 2YYOA 4QGLA 5A7SA 4B29A 4GJZA 4QX8A 5DAVA 2QFEA 4D7SA 1KD7A 4Q8KA 4YVSB 4HT1T 4AFCA 3WF1A 2VOXA 3AX4A 5EV7A 1AJKA 3AFKA 4DFSA 4I02A 1XPWA 2JDHA 4LJHA 1R083 1W6PB 4MHRA 2RDSA 4JGYA 2JIJA 4A6OA 1Z7S1 3BGAA 2XJSA 2PQSA 2G9GA 4CCKA 4CP1A 3WINE 3NRUA 3A4UA 2XLFA 4RS5C 3VKOA 4LA3A 4CUGA 3NNFA 2B42B 4OHWA 5FMBA 5FREA 4AHXA 4FT8A 4E4HA 1AYN2 1ZZ9A 1PGW1 1ZM1A 2ZHKA 4YFWA 3ZMOA 1NOVA 3LOIA 2OIIA 3I3DA 3OGSA 4GWIA 4AHWA 2ZGLA 1RITA 1ZBE2 1BBT1 3I3QA 4GZ9A 1H9WA 1XU1A 3OPZA 4IGPA 4P14A 2JDNA 3UNPA 2DCYA 1QXRA 5FIXA 4F7ZA 1SEFA 1XNBA 2HYKA 2YG0A 3OEAA 1BBT3 3HBZA 4FPFA 4GH4A 2JG9B 3IMMA 4FP2A 1XE7A 2GMEA 1QJX2 4Y24A 4LE4A 1NY71 3BPZA 3K4AA 4UFIA 1GP5A 2CYFA 2YU2A 5DAPA 1RVF1 1SHWB 3WSOA 5FP4A 2C9AA 5DZGA 1CONA 1TNFA 4KH9A 1X33A 1DCSA 4XQWA 1RUI1 3VKMA 2Q30A 4AI0A 4YNIA 4COZA 2XDVA 2N7GA 1RVF3 2QJVA 1TQ5A 5IVEA 1VR3A 1UMIA 1GU3A 3RGBA 3KS7A 3WQ0A 1QKQA 3DXTA 2ZAHA 4JGYC 3RZJA 2LS6A 2R32A 1ZZBA 1U5YA 2R30A 5L73A 2AH2A 1DQ5A 5JXJA 4B3NA 5C3PA 3ZR5A 1DYOA 1OH3A 2IXJA 1M4WA 4J25A 5FUNA 4I3PA 2WO7A 3WW2A 4JZRA 4OFGA 4DRRA 3AL5A 1S55A 1XOYA 4WM7A 5A1LA 1JHJA 3LSEA 2C5DA 4I01A 2YFZA 3OGJA 3TEYA 4IW3A 1EAH1 4M0NA 1W6OB 1H30A 3AMQA 4CU8A 2EXHA 5JZGA 3CJXA 4MV2A 2MEV2 3KF3A 4P9XA 4QKBA 4AK3A 2JWPA 4FPKA 5ANQA 3WT3A 2VVFA 4Q4X1 4A44A 1RUH2 2P1BA 2B5HA 4M0HA 2FHRA 4UW6A 2VZQA 2VUDA 2YY1A 3ACFA 5E16A 2O14A 3MIHA 4PLOA 4W6WA 3K2OA 1NA1A 4Q4X3 1R1A2 1Q8PA 4OQ8A 1OKQA 2O8QA 1UZVA 4NHLA 3FC0A 2A75A 4DMIA 4YG0A 1BLZA 1H8TB 1CQ9A 5L36A 4NIHA 1WW6A 3A21A 2HWF2 3R4UA 2R16A 4IXLA 3ZN5A 5LCWL 2WFF2 4QX2A 1APNA 3USUB
chains in the Genus database with same CATH topology
4HVQA 5BV6A 2A5ZA 5LEKA 2X8KA 5AFBA 2OZJA 1SFYA 4L2NA 4EROA 1IKPA 2DUPA 3ZYRA 3MEPA 3ILFA 1S0EA 3ZIWA 5GZDA 4XDQA 1OI6A 4LBJA 1LOGA 2Z42A 1YIFA 1NZCA 4WM8A 3H1MA 4M01A 5CIRA 3IWZA 4OUSA 1NLSA 3CJIC 1LHWA 3GF6A 1BQPA 3BCWA 2ZGPA 2LUWA 5T5LA 2GDFA 5JOYA 1ZBA1 1AR91 1Q8QA 4E27A 4QPIA 1ONAA 1HRV2 2YZ4A 5F9TA 3ZX7A 4OZXA 1XYNA 2I2SA 1ZBA3 3UL2A 1AR93 2PHLA 2NN8A 1SDWA 4LR4A 5GLUA 1D4M2 5T54A 1RIRA 1CPNA 5LRRA 2KA3A 1DU3D 2V5YA 1VBB2 3WP5A 3B3QE 2UWAA 1D2QA 4HBNA 4AEDC 5C9AB 1VBE1 4OHYA 3BTAA 2UY8A 1VRH1 1Y43B 2BTVC 4WM8C 4XE9A 1NCRC 1VBE3 4XJWA 5KXCA 5KHHA 4DPNA 1ZZCA 2X5IA 3NSTA 3MDPA 1LESA 1LR5A 3VZKA 4XBQA 3VHPA 1X82A 1W0OA 1AR71 3TOJA 4K1ZA 2D5HA 5C6CA 2ZS6B 1F5JA 4OLLA 4C1WA 1V6OA 3FUOA 4JC1A 4RA0A 3AXDA 4OI0A 4GKYA 5KHGA 3O7OA 4FPHA 3VDDB 2ZX1A 2YHJA 1ASJ1 5FO7B 1UZYA 1DQ2A 5DZEA 5GALA 1ASJ3 4ATFA 1Q8OA 4YZ5A 3I7DA 3D0SA 4ISQA 3W58A 2OUHA 1MACA 3OY8B 4LA2A 4IEVA 4K9SA 4Q26A 5DXDA 4YVWA 2OYZA 5BNQA 2ZGKA 4C90A 2A6XA 1JTZX 1CAUA 1YI7A 2E7QA 1XNKA 3PLQA 1PIV2 3SCGA 2MNGA 1CESA 3D82A 1GLHA 1MZEA 1ND3A 2JG8C 1RMU2 2ZGNA 4OVEA 4R9DA 2TEPA 3ZFEA 4AYUA 4B7KA 4QQHA 4Q27A 3QD6A 1NQJA 2PHTA 2IFRA 3ACLA 3AYAA 1IGOA 1URXA 1HRI1 1OLRA 2AZ5A 4XFBA 1GICA 4GKXA 1HRI3 1NQDA 2P3KA 1RUNA 4YW4A 1YLLA 4PF5A 4LT5A 2V73A 4Y1VA 2LTNA 4CTEA 2ILMA 3SH4A 3JBG3 1GZWB 4YVSC 5K0UB 4YM2A 4YVWC 1PGSA 4F8AA 3H7JA 1EY2A 2P2KA 4X6RB 5JMCA 1DQ0A 3MZHA 2QE3A 2W52A 1KDKA 2X53S 4JRAA 4C1XA 1HIXA 2WA4A 2GSYA 1RUJ2 1LGCA 5BNPA 4ZKTB 5C4WC 2IZWA 4XPVA 2ARXA 2K0GA 3FLPA 3MLKA 2D93A 2JG9C 5FOJB 2DWRA 4BPZA 5GZFA 4YW2A 3W9AA 4CP2A 2ZGQA 3PNAA 2DFBA 2SLIA 3IPVB 1Y3TA 2HWE2 4LNVA 4Q4V2 1TE1B 2BGCA 3THTA 1LOBA 4ONUA 3NAPB 1OQDA 4RQPA 4AFMA 5I8SA 1D4VB 3MGUA 3VZOA 3FMGA 1AR62 4JDNA 1H8VA 1QHDA 5FFOC 1LU1A 3FFQA 4IEXA 1X8EA 3WZ1A 4IEUA 1PNFA 2E63A 3AYDA 1YUDA 3AKTA 4RR3A 5BNPC 3KT4A 2ZGOA 2AGSA 2FBEA 5D8AA 4FOVA 4JAAA 1DGLA 3TAYA 2JDZA 3L9JT 1MVEA 2OA2A 4FPJA 4Y26A 3ZN6A 1ND2B 3BB6A 4IEZA 4P9WA 4Q4W1 3JQXA 3WXPA 1PO22 3L2HA 4Q4W3 2XJRA 3HWJA 1WCSA 4FPLA 3PMSA 3LSDA 1H0BA 1MVQA 1QDOA 3N7JA 1Y7BA 1S0CA 1Z0HA 5FO9B 2UYBA 2W0XA 4LBQD 2WLQA 4A7KA 2CAVA 4P5HA 4AGRA 2EA7A 2PA7A 1SLIA 4IEQA 5JI7A 1WD4A 2AUYA 2R0HA 1AL21 1GNZA 4KGGA 5AC92 2WS92 2P37A 3ASIA 3JD72 4TWTA 5D8AC 2JECA 2XJQA 2PLV1 4B4RA 4J6GA 1DG6A 2WNVB 4AEKA 3PVOA 4YZ1A 2D40A 5GZEA 1F5FA 3VBHB 3WUDA 2PLV3 1COV1 4EJRA 1KQRA 4W6XA 1V9U2 1H4GA 3VZNA 1CIWA 1U5XA 2WLPA 2ZGRA 5CG8A 1COV3 1DBNA 3L2YA 3H3ZA 2R49A 3QH6A 4N53A 4XF4A 3VBOA 1AYM1 1FPN2 4XHBA 5T50A 2GAUA 1POV1 5JSPA 5EYXA 2RS32 1ZVFA 3ZYGA 1XXNA 1XE8A 4N7IA 4IETA 1AR82 1SLLA 4M3CB 2AREA 3KCYA 3ZSLA 1LEDA 4BM8A 1EPWA 2QVSB 2PYTA 5KXEA 1LODA 1R092 1UPIA 3QOPA 3T1LA 2TBVA 3M3OA 1I9RA 4QD2A 3OBTA 3VL8A 2ATFA 2CWMA 1N3PA 5GZCA 2WT0A 2ZGSA 4N90A 1LJ7A 2FZ1A 4AVCA 4G3YC 5C9AC 1XQNA 2BPA2 1RUC1 4X6QB 2F6BA 1RUD2 1QWRA 1X8MA 1CX4A 3AFGA 3AP7A 1LECA 5K8SA 2AYHA 3M1HA 4S2DA 2VUJA 5J3UA 3N4MA 1ULGA 4INDA 3ZIXA 1BCXA 1WW5A 1PVC3 1O3SA 2JICA 4GALA 3ROUA 3IM0A 1I1EA 2HWD2 4JGYB 4ZU7A 5BNOA 4HLTA 4D3WA 4AE2A 1DGWX 5JI9A 4DQAA 4XMIA 4YGDA 3VDDC 2VQAA 4WZFA 3MYXA 3WCRA 2UY9A 5FQ0A 2PTMA 3FLRA 3GBFA 3INAA 1Q5OA 1S2BA 4GH4B 1A8MA 4H55A 3WNXA 4Y22A 3ZSEA 5GZGA 5DUWA 2D44A 1BEV2 4CDQC 4TYSA 3WP6A 2RS13 3KM5A 1S0FA 3I59A 2CY6A 3PJQA 2ZBJA 4XILA 2ZHNA 1KFUL 1X36A 3S30A 4BWOA 2HWC1 3LKJA 5BNOC 3GYDA 2WNUA 5K9YA 1G9FA 5C8CA 1O3TA 4LO4B 4H7MA 1WCDJ 2DCZA 2ZJCA 1MS3A 4XFIA 3IDCB 3U07A 5CFDA 1JYCA 4SLIA 4WM7B 5KHJA 1ZNPA 4TLFA 2EAAA 1DZRA 1UU6A 3E6DA 4NO4A 1BVP1 4XTPA 1N3OA 5L7OA 1UKRA 4ES9A 3USSA 1HDKA 2R1BA 5HBAA 5K0UC 5JZGB 1NCQA 1RHI1 4WVZA 4EN8B 4OUMA 3TN91 3WDXA 1RUG3 1J3PA 1VLNA 3B02A 5FRAA 3VL9A 3VZJA 1NG0A 1RHI3 2H0VA 1VBD2 1NA1B 1SCSA 2P17A 1PK6A 2VG9A 3VKNA 3KLSA 3JUUA 1CR7A 2EAKA 4UW3A 5GLVA 1FOD3 3KT1A 4C0BA 2B45X 3BOPA 1Z7S2 4UBGA 1QJY1 2E7AA 4FPGA 2A6VA 5AVAA 4E4ZA 1VBA3 1PGL1 1QJY3 4WV8A 3RWNA 3T1MA 1PGW2 1MEC2 2R073 1F2NA 1VALA 1BBT2 2BYVE 5E1RA 1T6GC 4AEDB 1N1YA 2DFCA 2VW0A 3VHOA 2BWAA 4WM8B 4E2QA 1NCQC 1PZ7A 2UWBA 2YPJA 4JV4A 1NY72 4R4ZA 1A8DA 3TRSB 1H4HA 2ZGUA 5DDJ1 1ZZ6A 3UKNA 1RUI2 3FHIB 2XLGA 4BHPA 4LEJA 3B9IA 4YW3A 5IK8A 5FOBB 1SFNA 2XBO2 1KJLA 4OI4A 1HQLA 5EJ3A 3PVBB 1WMFA 1C57A 1LOFA 1Q8SA 4BQ1A 2A71A 2Z5WA 3AMHA 1V70A 4XJUA 4AEJA 2D3RA 3R0RA 3B9CA 1TME3 1ND2C 1WMDA 1RUE1 2YXSA 3KCXA 3OGGA 1QQP1 4GWMA 2JX9A 3ZO0B 1ENQA 3FJSA 3M3IA 5KWRA 5K7PA 1EAH2 2W08A 2O0OA 1AX1A 3AJYA 1QQP3 4GA9A 2YDEA 1H1MA 4CDXA 2WQZC 2ZKNA 3FE5A 2CGOA 2X5IB 1PVXA 3AXEA 4CYDA 2ZA9A 4Q4X2 4B4PA 2Z2SB 1GQHA 3MFCA 4I2OA 1LHVA 2PHDA 3MIFA 2ZX3A 1Q56A 4IERA 2WT1A 2WNVC 2WL1A 3H0OA 5T52A 4ITCA 5CBLA 3V0BA 4JTOA 5ABJA 2VMGA 4XJ9A 3VHRA 5A3MA 2VMIA 3PJYA 4YZ2A 2IWGB 4QXKA 5SV8A 1HV0A 3AZWA 2D97A 4U36A 5J37A 5EWSA 1ENXA 3RI9A 1R081 4NWWA 4CDXC 3ZXJA 2ZMLA 4YVWB 3UK9A 2HKXA 1YNAA 3R4DB 2ZPXA 1LEMA 2DCJA 3GHNA 1CAUB 1QDCA 1WW7A 2G4IA 1UCXA 4NN0A 1UAIA 2DVGA 4LO5B 1OOPC 3S0MA 4GB32 3JB8A 2FQPA 4FO9A 3ZFEB 4XIOA 1ZBA2 1B09A 3AK0A 4NWVA 1N3QA 4AFDA 3Q9OA 3U4XA 3FWEA 3O12A 1X50A 2E53A 4QMAA 5ABJC 5BYNA 3PTYA 1I6XA 3VBSA 3SCFA 2KXLA 3IKWA 3LA3A 1OPMA 3NV3A 4IEOA 4S2GA 4CDWA 1VBE2 4XF3A 5JLVA 3RDIA 1QXJA 4PDWA 4V1PA 3FBYA 1VRH2 4MGKE 4ORFA 3VBRA 3WDUA 4JVAA 1YXWA 2GC1A 2WINB 1OPOA 4ES8A 4Y4YA 2WFPA 4O9GA 4QGMA 2DU0A 1AR72 2EF6A 4YG3A 4XQDA 2YGMA 3POYA 5BNPB 1SMVA 1DYPA 3IN9A 4I30A 4PJYA 3AKSA 1PZ9A 4LTAA 5HCAA 4X8PA 2R043 4TSVA 3MW2A 3QACA 4FSJA 1G9AA 2PAEA 2NLRA 4GH4C 1AX2A 5BPXA 3APBA 1RUF3 2VUAA 3VBSC 1ULFA 3WD5A 4META 3THPA 4A7YA 4DINB 2XLAA 3AP4A 2DVDA 2E51A 4CEWA 3MIEA 4CP0A 4RFT0 5F6LB 3IMNA 4N43A 3IBMA 2ZMKA 3VBRC 1DZQA 4OHVA 4BIOA 3RQ0A 2HEWF 5F6KA 3P3NA 4JGZA 3H50A 5FAXA 3RMXA 1C1FA 2ET7A 1CAWA 4RR3B 2GU9A 3GALA 2DTWA 3CU7A 3T2TA 1JHNA 5D8AB 4WM7C 3H3UA 4QU2A 4KL1A 1DGRA 2W68A 3AYCA 2O8OA 2QNKA 3R6SA 3H7YA 3MF6A 1DIWA 4XXPA 1YIPA 3ZN6B 3AP9A 2RM21 5JZGC 4KG0A 1VB4A 3J4UH 1L3JA 3GZTB 4Q29A 1LB2A 3NO8A 2RM23 5I93A 3ZPYA 2YV8A 3WV6A 1HXS1 4E2SA 2D6LX 3ZSJA 3WG3A 1NA1C 4N43C 1BK1A 2DUOA 1BJQA 2XVKA 3SISA 4K6BA 2H6BA 1HXS3 4MH0E 4U2AA 4LHKA 5JOZA 1DF0A 4BLIA 3AZZA 3TNPB 5LK5A 4DZGA 1BVVA 3D6EA 3KCCA 4FOWA 3R05A 2F4PA 2HJIA 4KWJA 3VBFA 1BZWA 1RC6A 1FNZA 1FT9A 1S0DA 2PAMA 2VOVA 4PQ9A 3IIAA 2XKOA 2GC0A 1QXPA 2VQ0A 3WG1A 4D94A 4RGAA 4MGIE 3WW1A 1J3QA 2W39A 1HX6A 3AMNA 2I45A 2DURA 4L11A 5JWPA 2WNEA 4ATEA 2EXJA 1LHUA 4OI2A 4WVMA 4N53B 1JBCA 3QLQA 4FAHA 4XFAA 1ZBE3 2IXIA 4RGGA 4Y20A 2ZAAA 4Q4Y2 1WBFA 1JH5A 1UZZA 3NWKA 3ES4A 4IEWA 5JIAA 4P9YA 3MW3A 5KC5A 1LCLA 3OTFA 1DFQA 1O4YA 4QPIC 1O4TA 4YARA 3MICA 1GBGA 5JCTA 3X29B 4FCAA 4XIKA 4XEZA 4RHV2 4HFSA 4QM8A 3VZMA 4KWLA 3VBFC 1QJU2 4COWA 1U0AA 4YM1A 5I8YA 4LULA 3QBQA 3RPQA 1CAVA 4D7TA 1MQTA 4GQ7A 3ZXAC 5KC6A 3RMYA 1YRZA 4H3WA 4Q1PA 5EZWA 2ZCWA 1AF9A 4MYEA 5CFCA 1V6LA 1YJLA 2R061 2X5IC 4CDQB 1UPSA 4MSVA 4UBHA 2CTVA 4Q4W2 2E7TA 3NVCA 1AJOA 2WA3A 1C3HA 4BYYA 2PHUA 2R063 4XHXA 2DCKA 1GFF2 4OHXA 1RUH1 3IDEA 4AXOA 4ASMB 3AB0A 5BNOB 5EXOA 1RUH3 1FXZA 1V6MA 1UKGA 2D98A 3CL1A 4MZUA 4UXAA 1H2MA 4ISRA 3C2UA 3MI8A 3OF1A 2ARBA 4LBOA 1AL22 2QQPA 2A6ZA 2A7AA 1MS4A 2XWBB 3JBG1 2B8MA 5FQ0B 2PLV2 2DTYA 2JE7A 2Y0IA 2QCSB 3ATGA 2HWF3 3M8LA 3GBGA 2BWCA 4GMP0 4R4XA 1JUIA 3SITA 2WFF3 1MQTC 2PHRA 4Y22B 1UF2C 1COV2 2PHWA 2EVXA 1S2KA 3MPPG 4LLFA 1B35A 5CG9A 5J96B 1DZTA 3I59B 2DCTA 1AYM2 2K9ZA 2QDRA 4GMP3 3EO6A 3HIFA 1ND3C 1W6QB 2EXIA 2UWCA 5H9SA 3ZFEC 4QGNA 4L99A 1IS6A 4AW7A 3FLTA 3GZAA 3S6PA 2Q0AA 2WNUB 4PIZA 5C8CB 2IXCA 4MX3A 2AENA 2QKDA 2NMNA 1AVBA 3AYEA 3MPBA 2NZ9A 1JUHA 4FPCA 5BNNA 4N9HA 1FMD2 5FDBA 1QJZA 5KHIA 5CFDB 4I09A 4R9CA 2G9FA 3ZXEA 1HRV3 1UU4A 3KSCA 5EFUA 3PVEA 1TEIA 1N1SA 2JEMA 4AVTA 5L7OB 1IS5A 3RNSA 1RUC2 4YGBA 2A3XA 2EIGA 1D4M3 1NCQB 3HAGA 3RSJA 1QF3A 1FYUA 1HQWA 2VNOA 4AGVA 1NXMA 5F5QA 1ZREA 2JD4A 1HKDA 3ME2A 2D6MA 3O0VA 1RL3A 3O0WA 1VBC1 3UKTA 1U5ZA 1IKQA 1PK6B 2BFUS 3HT2A 4XQ4A 3GHMA 3GZUC 4BE3A 4FQ4A 4GXLA 1R1ZA 1VBC3 5DZFA 2PN5A 2I74A 4AQSA 3KGLA 4W6YA 5J98B 1H1IA 4CEYA 3J8F2 5EYYA 1XNCA 4YGCA 3LA7A 3USUA 4MXWA 1ALYA 4RQPC 4QM9A 1MR5A 2C0ZA 1KS5A 3FBMA 2ENRA 4B4QA 1N1TA 4LO6B 3WHTA 4AEMA 2BVVA 1WW4A 1C5HA 4I3GA 4XJ8A 3WVJA 1OHFA 1ULEA 5HI0A 1FATA 4HK9A 2ZZQA 1G6NA 1IZ3A 4JDOA 3JB4C 4RR3C 2VULA 2XJPA 1SBDA 1GZCA 2SBAA 3B5LB 1Z78A 2D6NA 1X7NA 2OUJA 3ZN4A 3MFAA 2HWC2 1XNDA 3EBRA 3GNEA 4AQ2A 1RMU1 3ZYPA 1PIV3 4AI8A 3NW4A 4AQ6A 5JAXA 5KXDA 1YCIA 1VAMA 5CB7A 1IHMA 2CNAA 1RMU3 4WVVA 3DPRA 2PQQA 4CEYC 2WZR2 2ZGMA 3TNQA 2ZZJA 1QOTA 4QPGA 1RTVA 4HL0A 2Q1ZB 1IOAA 4CDXB 1QNWA 4G9SB 1MS8A 4PLNA 3S7IA 4F3JA 4P9IA 3LWCA 3AJZA 1OD5A 4QX5A 5GLTA 3TN92 1UN1A 4LBKA 3H9AA 2WZPP 5LRSA 4FBFA 3RI8A 1OOPB 3WDYA 5T5JA 4D7YA 3AMPA 1H2LA 5FO8B 1OQEA 1POV0 2FMYA 1QU0A 4XF9A 2VW2A 1D0GA 1GYKA 1FI2A 1V6JA 5KHKA 3OD0A 3WP3A 4HPKA 1V6KA 2Y38A 2CL2A 2P3JA 5ABJB 1PGL2 1DGRN 1REDA 1LGBA 3VBUA 1CN1A 1RUJ3 5T55A 4FP3A 4XXAA 1LHOA 4BH9A 3V0AA 4NOTA 3NKTA 4N53C 1PVC1 2B9UA 4LBQA 3VBOC 1REEA 1W2UA 4QPGC 4YRDA 1MS5A 2NPIA 1H1AA 3ZFGA 2XGXA 3KQRA 1W6NA 4YM3A 4CRQA 1G7YA 3EQEA 3NV4A 1W0PA 2ZMNA 2HEVF 4NHMA 4Y1XA 4MGZE 5DDJ2 2HWE3 5IK5A 1N1VA 4Q4V3 1BXHA 2CGNA 2JJ6A 1G9BA 2IXKA 2DVFA 4A2UA 4NR1A 3GBWA 3LOBA 2RS52 1LULA 2NQYA 4XF0A 2BVBA 1BMV1 2RMU2 3ZDSA 3O0XA 5FLIA 3QH7A 2IXHA 3VBSB 3WX5A 1S0BA 2RS11 3WHUA 1RUE2 2HWB1 1OQ1A 1QQP2 1J1TA 4H14A 1IPJA 1YJKA 4JCKA 1O3QA 4AI1A 1H2KA 5FBZA 4YFZA 4PDWB 2HWB3 3DL3A 4AI3A 4AFAA 4Z2WA 2XKPA 3ZFGC 2GN3A 3VBRB 1CJPA 2KM2A 4FPOB 3E5QA 4DXZA 4FPEA 1PO21 4E4SA 2GNBA 3WW4A 5FTTC 4QT6A 1G8WA 1K5MA 3ILRA 1DQ6A 4PIYA 2Y0OA 1PO23 5JIUA 2A73B 5JOWA 2GH2A 4S2FA 4LUKA 4AGGA 4XFCA 1XYPA 3RS6A 3B00A 3R4SA 1OA4A 5AC91 1RUG1 4Q0QA 5KXBA 4K8FA 1LGNA 4WBBA 3RZZA 5AC93 2WS93 4IV1A 4OI1A 1QOOA 1O4ZA 1EYBA 3M4FA 4CEWB 3SNMA 5B2GB 3M70A 5GJ6A 1FOD1 1R082 3OYWA 3DKWA 4N43B 4BIFA 5LEJA 4AVSA 3WCSA 3IPVA 4Z07A 3H8UA 1VBA1 1I3HA 1V9U3 4J1WA 4LBLA 4RL7A 3B01A 2K2SA 4JGZB 2WNUC 4EV0A 2ZHLA 5C8CC 4EWAA 2LM3A 3UKVA 4FVVA 4M3CE 3D8CA 1K5MC 2R071 1CAWB 1FPN3 1LOAA 4E4DX 2UURA 4COUA 5CFDC 5DUUA 4FTEA 4Y1UA 5FMOS 4IEYA 1KRIA 1RJ8A 4XBNA 5L7OC 3H1WA 3SCHA 2TNFA 3RRDA 1SLBA 1R093 4AHZA 5JVVA 2ES3A 3MIBA 4IV1C 3ENRA 1FV2A 4KU8A 1OMIA 1RVF2 3BIWE 4KG8A 2MHFA 4EN6B 4FTBA 3I8TA 4EN0A 4DOUA 5H9RA 1PK6C 4XW3A 4AQTA 3WQ1A 4WVWA 2NMOA 1LHNA 2I07B 1RUD3 1YFUA 3LGRA 4Z8BA 4QPIB 5KBFA 1KDMA 5CNAA 1N47A 5FLHA 1FV3A 2BW8A 2NM1A 3WR0A 2RJKA 3EHKA 1TME1 3ETQA 3VBFB 4Y1YA 3MLLA 2OZ6A 3FFZA</