4JGYC

Crystal structure of human coxsackievirus a16 uncoating intermediate (space group p4232)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
236
structure length
231
Chain Sequence
GIPTELKPGTNQFLTTDDGVSAPILPGFHPTPPIHIPGEVHNLLEICRVETILEVNNLKTNETTPMQRLCFPVSVQSKTGELCAAFRADPGRDGPWQSTILGQLCRYYTQWSGSLEVTFMFAGSFMATGKMLIAYTPPGGNVPADRITAMLGTHVIWDFGLQSSVTLVVPWISNTHYRAYFDYYTTGIITIWYQTNYVVPIGAPTTAYIVALAAAQDNFTMKLCKDTEDIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyprotein, capsid protein VP1
publication title Picornavirus uncoating intermediate captured in atomic detail.
pubmed doi rcsb
molecule tags Virus
total genus 38
structure length 231
sequence length 236
ec nomenclature
pdb deposition date 2013-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4jgyC00
1PGW2 1VBD2 1CD3G 1RHI3 1NCQA 4PDWC 2BUKA 1AR61 2FZ1A 5C8CB 5K0UA 2WZR2 1FOD1 1NCRB 4RQPB 1MQTA 1ZBA1 2HWB1 1E57A 1TME1 1D4M2 5BNNB 4FTSA 1PO13 5C8CC 2R072 4LLFA 4GB33 1NCRC 2RS53 4RQPC 1B35C 1POV0 1SMVA 1VBC3 5BNNC 3ZFFB 1RUE3 1BMV2 3VBFA 1NY71 1NY72 1RUF2 5L7OC 3JB8A 4QPGA 5DDJ3 2R042 1TMF2 1BEV3 1RUI2 1CJDA 1VBB2 4RHV3 3ZFFC 1Z7S1 2RMU2 4Q4V3 1HRI1 5BNOB 2WS91 1GFF2 5C4WA 2RM21 2RR12 4JGYB 1R1A2 5JZGA 4QPIA 2RS11 1EV11 1COV1 1FPN1 2PLV2 4AEDC 5BNOC 3JBG3 4WM8B 2MEV2 1MEC2 2WFF2 3VBOA 4JGYC 4WM7B 4N53B 1ND3B 1VRH1 1C8M1 4CEYB 3DPRB 1RUJ3 4WM8C 5C4WB 3J8F3 1AR71 4CEWA 1DDLA 2WWSA 1NA1A 1RHI2 4WM7C 1EAH1 2HWC1 1AR91 4N53C 1ND3C 1RUH1 1VBA3 3JD71 4CEYC 3DPRC 3ZFEB 1HXS2 1AR63 5D8AA 5C4WC 1V9U1 2BBVA 2FZ2A 1HRV1 1PVC1 1AYN1 3NAPA 3ZFEC 1PO12 1ASJ1 1H8TB 4N43B 3VBUB 2HWF3 2HWB3 1OOPB 1TME3 4GB32 4CEWB 2RS52 4GMP3 1F2NA 4Q4Y1 1PO23 2HWE2 4Y5Z0 1VBC2 1RUG3 1RUE2 1H8TC 4N43C 3VBUC 1RUC1 4CDQB 1OOPC 1AR83 1K5MA 5GKAC 3ZFGA 5DDJ2 5CFCA 1BEV2 4YVSB 1R091 4JGZA 1R081 2DF7A 4Y4YA 1VBE1 5C9AB 2HWD3 4Q4V2 4CDQC 3FBMA 3VBSB 5BNPC 1Z7S3 5AC91 5AC92 4Q4X1 4YVWA 1PGW1 2RM23 4YVSC 1VBD1 2X5IA 2RS33 5C9AC 1PGL2 1RVF3 3JBG2 1AL23 2RS13 1EV13 3VBSC 5A33B 1RUD3 1FPN3 2XBO3 4Q4W3 5LK7B 4JGZB 2WZR1 1AL0G 2R063 1QJY3 4NWWA 1RUJ2 4IV1A 1ND2A 3J8F2 4GH4A 1D4M1 1QQP2 4YVWB 2R071 1POV1 2X5IB 4JGZC 1VBA2 1RMU3 4CDXA 1NCQB 1ZBE3 5CFDA 1BMV1 3VBRA 4CDWA 1C8NA 1RUF1 1NG0A 5K0UB 4SBVA 2R041 1NCQC 1HRV3 1TMF1 2HWF2 1MQTB 1PVC3 4IV1B 1ND2B 1FMD3 1RUI1 1VBB1 2Y26A 2RMU1 5ABJA 1PO22 5ACA3 5K0UC 4GMP0 1IHMA 2RR11 1MQTC 1R1A1 1PIV2 2WLPA 1QJU2 1AR82 1QJX3 2BPA2 2PLV1 2XPJA 3CJIA 3TN92 3VBFB 4CDWB 2MEV1 1MEC1 3M8LA 2HWD2 3S6PA 4CDUA 1QJZA 2WFF1 4QPGB 1VBE3 1BBT2 1AYM3 5ABJB 3VBFC 4CDWC 2RS32 1RHI1 4QPGC 4RR3A 1RVF2 1AL22 1RUD2 5JZGB 4QPIB 2XBO2 4Q4W2 1HXS1 1F8VA 3CJIB 2R062 1QJY2 3VBOB 5JZGC 4QPIC 1FOD3 1PO11 3VBHA 2VQ0A 3CJIC 1ZBA3 5J96B 4GB31 1RB8G 1D4M3 2RS51 4RS5A 2R073 1NA1B 1RMU2 1VAKA 3VBOC 2BFUS 2GSYA 1ZBE2 2HWE1 1VBC1 1RUE1 5D8AB 5J98B 3VDDA 4CEWC 1OHFA 5FMOS 1NA1C 3HAGA 5DDJ1 1BEV1 1OPOA 4FTBA 1FMD2 4RHV1 4RHV2 4PDWA 2GH8A 4Q4V1 3NAPB 1VBB3 5D8AC 5ACA2 1HRI3 2WS93 5FOJB 1QJX2 3NAPC 1PGL1 3JBG1 3VDDB 1COV3 1K5MB 1VB4A 5C8CA 3ZFGB 5A32A 2MEV3 4NWVA 1NCRA 5CFCB 4BCUA 4RQPA 1AYM2 4PDWB 1B35A 1RUJ1 3J8F1 5BNNA 1VRH3 1K5MC 1C8M3 3ZFGC 1QQP1 1VB2A 5CFCC 1AR73 5L7OA 4FSJA 1VBA1 1EAH3 2HWC3 1AR93 1AR62 1RUH3 3ZFFA 3JD73 1HXS3 4YVWC 5A32B 2IZWA 2X5IC 1V9U3 1FOD2 1B35B 1HQNA 2HWF1 1ZBA2 2HWB2 1M06G 1AYN3 1TME2 4GMP1 4AEDA 4GH4B 5BNOA 2QQPA 1ASJ3 5L7OB 1PO21 1X33A 1RUG1 4JGYA 1RUG2 2BFUL 2ZAHA 4CDXB 1PIV1 2HWE3 1QJU1 4IV1C 1ND2C 4Q4Y3 1AR81 2ZTNA 4GH4C 5CFDB 1RUC3 4WM8A 4IV3A 3VBRB 3TN91 5FMOL 1X36A 2HWD1 4WM7A 2TBVA 4N53A 4CDXC 1ND3A 1WCDJ 1R093 1R083 1BBT1 4CEYA 1Z7S2 3DPRA 4AEDB 5CFDC 4FTEA 1HRI2 3VBRC 2WS92 2RM22 2RS31 5AC93 1NOVA 4Q4X3 1RVF1 1AL21 1VBD3 2RS12 1EV12 1RUD1 1COV2 2XBO1 1FPN2 4Q4W1 3ZFEA 5ABJC 4IV3B 2R061 1QJY1 4CDUB 3LOBA 2WZR3 1VRH2 1C8M2 1H8TA 4N43A 3VBUA 4EJRA 1A6CA 4IV3C 1OOPA 3IDEA 1AR72 1QQP3 1RMU1 1POV3 4CDUC 1EAH2 4RR3B 2HWC2 1AR92 3ZXAC 1RUH2 1ZBE1 3JD72 4CDQA 1AUYA 5BNPA 4RFT0 1V9U2 4RR3C 4YVSA 1HRV2 1RUF3 5C9AA 1PVC2 1FMD1 1AYN2 1ASJ2 2R043 3VBSA 1TMF3 3VBHB 1RUI3 4Z92B 5ACA1 2RMU3 4RS5B 4Q4Y2 1QJX1 1W39A 2RR13 5A33A 1RUC2 1PIV3 1QJU3 1R1A3 3VBHC 5BNPB 3JB4C 2PLV3 4RS5C 3TN93 1MEC3 1R092 1R082 1VBE2 1AYM1 1HX6A 2WFF3 1BBT3 2ZZQA 3VDDC 4Q4X2
chains in the Genus database with same CATH superfamily
2BU9A 1ULFA 1HB1A 3FHQA 2VXJA 3C7HA 1I9RA 2Y6GA 3FHIB 5IVJA 2R1DA 3RNSA 4QQHA 1HB2A 4IEVA 4PDWC 2BUKA 3WP4A 1QH6A 4LBOA 3WOGA 2BYVE 2VU9A 2YPDA 2GNBA 4KWKA 4OUSA 4XYXA 1DGRN 2JDKA 1EPZA 2FZ1A 3HBKA 1UY2A 3OOXA 2OZ6A 1IGOA 1UZZA 2UWAA 4DINB 2GMMA 3H42B 2XJSA 2WSUA 5H9PA 3GZUC 2HWB1 3GYDA 3QBQA 5F3GA 1OBNA 1O7FA 1A3KA 1AHSA 3PTRB 5FOBB 4FTSA 4GD4A 1WW7A 4AW7A 2JDHA 4FP3A 3HQUA 5FV3A 1RJ8A 3K3OA 3VHNA 2IXKA 1DYOA 1CVNA 1MACA 4RQPC 5DG1A 2WNUC 5FPZA 1POV0 1GWMA 3MPBA 5F3IA 1SMVA 3LOIA 3AJZA 3AC0A 1JYNA 1VBC3 2Q0AA 4ZKTB 2P3KA 4QX1A 2YDEA 2JDMA 4Y1UA 3VBFA 1ULPA 2IUWA 3UESA 1E5HA 5KHKA 2YBPA 4HBNA 4YW1A 1O91A 3O1PA 3P3NA 4Q0VA 5L7OC 3JB8A 3T0DA 3GZEA 2ZEZA 4YARA 1BEV3 4RHV3 3AZWA 2ZGQA 4K40A 3ZFFC 2F4LA 2YHJA 3AMPA 2RMU2 2KR2A 1HRI1 1C28A 2W94A 2WS91 2YXSA 1DYPA 5C4WA 2TUNA 2RM21 4AI8A 4BQWA 2H0BA 1WD4A 5I8SA 4M0NA 3OYWA 3PJQA 1TQ5A 1C1FA 1CAUB 2FDFA 1S2BA 1R1A2 2RS11 2P37A 4W6WA 5C8WA 4MG2A 3WY6A 4LA3A 1LGNA 2J1AA 1UZWA 4WM8B 3RZZA 1UX6A 3U14A 2MEV2 3ZXLA 1H6XA 5D21A 3CU7A 3O1UA 1UZVA 2SBAA 3E5UA 4QHOA 4IE5A 4IEOA 5BV6A 2DCZA 1DLCA 3IBMA 4JGYC 1MR5A 4WM7B 1JUHA 5F6LB 5F2WA 3QD6A 1ND3B 3G6JB 1W2AX 3MW2A 5DXDA 2ZACA 1LHWA 5CB7A 2XJTA 1OSGA 1IZ3A 2XJPA 4XMAA 4FPJA 1AJKA 4HSLA 1RUJ3 4Y22B 1AX2A 1CAXB 4P14A 2D97A 3PU8A 4NHLA 3WG2A 4CEWA 3O1MA 3PUIA 2BOIA 4PQQA 1UU4A 3SKVA 1RHI2 5A3LA 5FPBA 5FY8A 3AKTA 1EAH1 5FKCA 1YHFA 3ZKYA 3U10A 4CUBA 1OF4A 3QH6A 4D7YA 3MO4A 3V0AB 4HKOA 4QKFA 1PK6C 4CEYC 5A7OA 2ET1A 3LFMA 2D98A 5A32A 1ULEA 5FLIA 3O12A 3I2HA 1US3A 1Z78A 5L19A 5F3CA 4XFFA 3O14A 5FZDA 5FYIA 3VD5A 3GF6A 2J1SA 3KF5A 3NAPA 1W6NA 1W6MA 2FHRA 3TEXA 3ZFEC 1U5ZA 4C1WA 5B4NA 3J7HA 1QXJA 1GZ9A 3RI9A 2BP6A 4DUWA 4GB32 1TME3 5EP9A 1PM7A 3LGRA 3ZYPA 1KRIA 1W90A 1Z0HA 2AACA 4FPHA 3IPVA 4GMP3 3ILNA 1S2EA 5JSRA 1L7LA 3VB9A 2HWE2 4Y5Z0 4ZPIA 5C71A 1H8TC 3R4DB 3VBUC 2Y38A 4JQTA 3BTYA 4IW3A 2VCAA 4D7SA 2OPKA 5A7NA 1K5MA 1UKRA 3NJZA 5FFOC 1UKGA 2EXHA 1UCXA 2GP5A 1HQWA 4BQ2A 5CFCA 2Y6KA 4RSUA 1KFUL 1R091 2VD7A 1QOSA 4Y4YA 1UOFA 4ZY9A 2JEMA 4CCNA 4YG3A 4Q4V2 5LBBA 3PJYA 4HZFA 3AVSA 4WZCA 4CDQC 5I0RA 4YGDA 5KXBA 3SEPA 1XU1A 2JXAA 1Z7S3 1MS0A 3GCWA 4RD7A 2BJSA 1OPMA 1PGW1 4JTNA 4XCBA 5C9AC 3C7GA 3WCSA 3J7LA 4E8DA 2VUAA 1PMHX 3JBG2 3MUZ1 1AL23 3BN6A 3OGVA 1CESA 4XBLA 4D69A 2XBO3 3I54A 2Z5WA 2WNVA 4YRDA 4BLIA 1MS4A 1F5JA 1J1TA 2X53S 1J83A 4W4ZA 4OHXA 3PVBB 2NLRA 4JGZB 4Y1ZA 2F17A 3EB7A 3I59B 2JG8B 4LBQD 4XUQA 1JN2P 2R0HA 4IV1A 2P3JA 3J8F2 5CNAA 1N3OA 4ZXEA 1WLTA 3K4DA 4NOTA 4YYOA 1J59A 4FOVA 3I97A 3S57A 3KT1A 1POV1 5KHJA 5JXHA 3PU3A 1V6IA 3ATGA 3KGLA 2QQLA 1VBA2 3ILFA 5FZGA 1H2MA 3MZHA 3SITA 3WDYA 1KJLA 1X7NA 3MLKA 5LY1A 1NCQB 5C6CA 3KHCA 3S5AA 3WHTA 2BGOA 2Y0OA 4JKMA 1ZBE3 5CFDA 3P3PA 4E8CA 1Q56A 5HI0A 3NQHA 3TBDA 3RYRA 4ZHNA 2NZ9A 5FK7A 4AHYA 4K20A 5A6XA 3R4UA 4YZ2A 5FZEA 4AQTA 2R041 1JI6A 1TMF1 1MQTB 1ZRIA 3B69A 4K21A 2WNOA 1FMD3 1RUI1 1SLCA 4YM1A 3WDUA 1YXWA 4XHBA 5ABJA 3DF0A 1LOGA 5F5IA 3VDCA 1XBFA 1PO22 2WNEA 1Y3TA 1CAVB 1IHMA 2RR11 3OF1A 4RGGA 2EVXA 2W91A 3VKNA 2NPIA 2OIIA 1AR82 1CIWA 4H14A 2PLV1 5FZOB 3O1RA 2XPJA 2CU5A 3THTA 2FDIA 1JW6A 4KWLA 5F39A 4KI5M 3N3HA 3Q8AA 3VZKA 2OW4A 1MS3A 3OBAA 3S6PA 3BKZA 2WQ4A 4CDUA 1W0OA 1YEWA 4HN0A 4IUGA 2K9ZA 4QXHA 4BK5A 5ANNA 1WBLA 1QNYA 1DGWA 2IFWA 3WV6A 5FO8B 2IXHA 2KXLA 2RDRA 5IUQA 3FUQA 3RGBA 3VBFC 2PQQA 3K48A 3ME2A 4CDWC 1DBNA 2RS32 3V0BA 1UIKA 2WSVA 4IEZA 5FQ0B 2W08A 1RC6A 2XL9A 2ZA9A 5LATA 4CE8A 1V70A 1Y9QA 4YWAA 1S0EA 3ZYBA 1SFNA 5GZCA 1AXKA 2V72A 4B4RA 1RUD2 3M1HA 4LK7A 4UF0A 5A3NA 1ZA7A 4PI0A 5JZGB 5KXDA 1GZTA 1O5LA 1HXS1 1ENQA 2KM2A 3KD4A 2XVKA 1F8VA 3CKHA 3C8XA 4OI2A 4BQ5A 3WP3A 5CAZA 3VHRA 1YCIA 2ZGUA 1UY4A 3N7KA 3AKRA 2ZX4A 4Q0SA 1SDDB 5FIXA 3CZJA 3ZR5A 1PO11 3GCXA 1Q5OA 4QX0A 3KT7A 2FCTA 3CJIC 1G86A 3OEAA 5J96B 4M00A 5FR3A 3ZXDA 2BNOA 1JMUB 4DFSA 4CVUA 3OGSA 3L2HA 5JI9A 4Q0QA 2BWCA 2GSYA 4LITA 1QNWA 3OSDA 4FPGA 1CAWA 3HWJA 4X8PA 1QIQA 3LA3A 5D8AB 4CEWC 4YZ1A 1OHFA 4LBQA 4AFDA 2VR4A 5DDJ1 3G7DA 4FOYA 5KXEA 3I2GA 5FBJA 3LWCA 4QX8A 1X8EA 3DYPA 5ERLA 1AXYA 1W8TA 1GQHA 2P34A 4MHUA 3H8RA 4GJZA 2ENRA 2MPFA 1DU3D 2XVGA 3H1MA 5FCCA 1OA4A 2AGSA 4QGNA 1HRI3 5F5CA 4DXTA 4ZU7A 2WS93 4I0BA 3ZSEA 4JQRA 3URFA 2CY6A 3PUAA 1W9WA 1WW4A 3KLSA 5JSPA 3SISA 4QQOA 1JZ2A 1QJX2 5FPXA 4M4RA 3NAPC 5FYBA 1YYNA 4FPCA 1Q8VA 2B5HA 3LDRA 5FLJA 4ARYA 1O6UA 1QEXA 4P9JA 2ZMKA 1VB4A 5C8CA 3BGAA 4O9GA 2A75A 2WABA 3INAA 3WNLA 1YQ6A 2A6ZA 1X9PA 2MEV3 3OUIA 4ZU5A 3BIWE 1J1LA 2X29A 1YQCA 2C0ZA 1BZWA 1HIXA 3PHMA 1GYKA 4PDWB 3Q8EA 4H7LA 2WA3A 4FOQA 4O7XA 1K5MC 2AEYA 1VB2A 2PHUA 2VZOA 1LHNA 5CFCC 4F8AA 3VV1A 3RFRA 2VC9A 2WAOA 5CG9A 4ITCA 3FE5A 1TE1B 4R8HA 1EAH3 5JR7B 1JU3A 2BDRA 4H7MA 1ZRDA 3E5QA 2GN7A 5LBEA 3VLBB 1XQNA 3ZOIA 3O1SA 1UZ0A 2JENA 2XH6A 5C3OA 4EN0A 2O1QA 4MGKE 4NIGA 4M0HA 5GLZA 4XTMA 4EROA 4M3CF 1L7RA 1QY4A 5A7SA 3LDKA 2HWF1 4CP2A 3LSDA 5K9YA 4AEDA 5BNOA 4EN9B 2WNVC 3CEWA 3AVRA 3BOPA 4JHZA 5ANQA 3PIGA 5FLHA 5L7OB 4LO6B 1HW5A 2ZAHA 2VM9A 4XF1A 1PIV1 2HWE3 1QJU1 4IV1C 3AXEA 2O14A 1GQPA 4GXLA 5GLWA 3SKJE 3N9PA 3VBRB 2VNVA 2D6KA 1LGBA 4R9BA 4CYDA 5GLUA 4N53A 4ASLA 2CWSA 2D6NA 1R093 1U12A 4XJ9A 4YNIA 3ZN6A 4BISA 4BLJA 3DL3A 3T2TA 5CFDC 5A3UA 1B09A 2YY1A 1UQXA 1ZZ9A 1LENA 5IVYA 4N8MA 4C1XA 2W1WA 2ETEA 3WG3A 5FO9B 2W52A 1Y9MA 5E88A 3E6CC 5CKQA 4K6BA 5E6HA 5DQ0A 2ZGTA 1EV12 4UFKA 3RMXA 1W6OA 3AFKA 1FPN2 4J6GA 2GDFA 3T0BA 5FXZA 5ABJC 4L0PA 3VD7A 4AAXA 2Y0IA 4IV3B 2GC2A 5FZ4A 1GV9A 4DQAA 3MIFA 2VMHA 3AP9A 5F5AA 1BCXA 1UY0A 4NHKA 4J1XA 4NRQA 5FJHA 3T09A 5IAXA 2R061 2ZX2A 1ZYBA 3POEA 3USSA 1A8DA 3J7MA 4PF1A 4MXWB 3KV9A 5FK8A 5DAWA 2H6CA 3RZGA 1NLQA 1C8M2 1PK6B 4HANA 4N43A 4XFHA 3MIHA 4BQYA 1OOPA 3WUCA 3QLQA 1CN1A 1AR72 4QXBA 3KV5A 1Y4WA 4CP9A 5FZ8A 2VOTA 2H0VA 2XHKA 4JZRA 4BA6A 4E27A 1XU2A 1POV3 1YFYA 3DV8A 4JHTA 3W9AA 2HWC2 2PHFA 4A6SA 4JCKA 5AVPA 4CDUC 2OUJA 5GJ6A 1YUDA 3NMBA 2XQXA 4OUMA 3MW3A 3PMEA 3DCQA 1N3PA 2VCCA 1RINA 1VAVA 2ZHNA 4QHBA 2NQYA 1IS3A 3B94A 1YIFA 5SV8A 5BNPA 1V9U2 5G04L 2W3JA 2QQOA 1JZ8A 5BXXA 1CZSA 2D6LX 2B39A 1HRV2 3MW4A 1ZRCA 1VMHA 1BHGA 1AYN2 4XBQA 1EY2A 4G3YC 1RJ7A 2WYFA 4O61A 4OHZA 2R043 2VE1A 3HT1A 5IW0A 1TMF3 3VBSA 4EQVA 5JOYA 5K8SA 1RUI3 2XJQA 1PNGA 3CHXA 2VZPA 1K3IA 5JOZA 2BQPA 4MGTA 1HLCA 2ILMA 1GZCA 3MBWA 4Q4Y2 2XL7A 3OPWA 3WSOA 3RJ2X 2LS6A 4AI0A 2RR13 5A33A 1NE4A 5F7UA 1UMIA 4LBNA 3A23A 4XPVA 2XR4A 4XQWA 1J84A 3JB4C 2PLV3 4D6RA 1YQ5A 4Q0UA 2OS2A 3FUOA 4QWNA 2Y6JA 3ZN4A 5JR2A 1O3TA 2V09A 1DGWX 2WZPP 4Q29A 5CEHA 5A70A 2DVBA 3T1MA 2WFPA 3NV3A 1G9FA 3ZDVA 4BU2A 3RPQA 4UOJA 4Q4X2 4XF3A 3WP6A 4XETA 2LRPA 2WO7A 1CD3G 3J7NA 1JUIA 4E4DX 3KHBA 5D2AA 3SC7X 4I09A 2W9XA 5DUXA 4BPZA 4QM9A 1GP5A 2IFRA 1PZ8A 3MHZA 3B93A 1W6QA 3ACHA 4YSFA 4MXVA 1DHKB 2CYFA 4P00B 5GZFA 4AQ6A 3MYXA 5K0UA 2WZR2 1FOD1 1NCRB 1XYNA 1LOCA 2BGPA 5I0TA 4M3CB 3VN4A 3AMHA 1PGSA 1PX4A 1OLQA 4XXPA 5FP9A 5H9SA 5HCBA 1ZBA1 4IE4A 4CUCA 4I2OA 4JDOA 4BDVB 1I6XA 1TME1 1W9SA 5BNNB 1PO13 5C8CC 3KCCA 3JQWA 3RJRA 3RZMA 2V4VA 2JDZA 4PLOA 1UW8A 2UU8A 5FYCA 3WF3A 2WAAA 3DGTA 4KU7A 2G9ZA 5KBFA 1PX3A 1OD3A 2B9UA 1JHJA 4QB2A 2CSGA 2C9KA 3GZAA 4DY5A 4FPOB 2CNAA 3LB9A 2VOXA 3BOWA 1BMV2 2YFZA 1WLWA 1NY71 1NY72 4QQPA 4QPGA 5T55A 5F5QA 3TYJA 1VPHA 2VOKA 5DDJ3 1H2KA 3OBRA 2TNFA 1DQ5A 3WW1A 5FYZA 2ZMNA 2GMEA 4Y26A 1Z7S1 4CXYA 1J3QA 4MGIE 4A44A 4PBOA 4WVWA 4BMBA 3GNEA 4I3PA 5LRRA 3IIAA 4A7KA 2F4PA 4W6YA 2R16A 3C3VA 4G9SB 4BMEA 5JMCA 3M3QA 3AP5A 3KCYA 1XC6A 2JDYA 5AFEA 2DUOA 5LCWL 3FL7A 2R30A 2XUMA 4AEDC 5BNOC 4FPLA 2Y6HA 4MO3M 3H1YA 4H2AA 2VXRA 4KWUA 2ZHMA 2XLFA 2YZ4A 2Q30A 2R0FA 3PDQA 4ZONA 3HNYM 4MUVA 1BK1A 1DLLA 2WFF2 3B9IA 5T50A 4WVMA 4BQ4A 2CDOA 3LDBA 3USUA 1VRH1 1NQDA 2VH9A 3DPRB 1W2NA 1V6OA 5JVVA 2RE9A 5C4WB 1IQDC 3LIHA 5JSOA 1VMJA 1S2KA 2FBEA 3UNPA 3SH4A 4XJZA 2CHHA 3OYWB 4AR2A 5FZFA 2PHDA 5F6KA 2O0OA 4N53C 1S0CA 3MV11 3K77A 2PAEA 2HBTA 4LHSA 3VL8A 1UIJA 3M3CA 4LIVA 3POBA 2WLQA 3ECQA 1TG7A 4XUNA 1OFSA 1UU6A 5JIAA 5JI7A 2NM1A 1LCLA 2LUWA 4R52A 3LE0A 1OI6A 1ACCA 1SACA 4GWJA 1RUOA 1W8WA 1AVBA 2HWF3 2WWUA 3W21A 2WO1A 3RS6A 4CEWB 2Z69A 2RS52 4Q1PA 1OLMA 4BH9A 4UI9L 5L73A 4IE7A 1PZ7A 3ELNA 3ABZA 5KC5A 5JAXA 2V5YA 1RUE2 4PLNA 4N43C 1WD3A 1RUC1 1JOPA 4FT8A 4CU8A 1OOPC 2PXJA 2BTVC 4LBLA 4XQDA 4XJ8A 3BTXA 5IVFA 5G05L 2CGOA 4KNCA 3DECA 1LOBA 2JKXA 3I2FA 4YVSB 1XRUA 5EYXA 3WX5A 1BK0A 3HNMA 3WINE 1TZOA 2AREA 3FBMA 1GP4A 1YLLA 2VZVA 5FZ0A 4DY3A 4ASKA 5BNPC 1OKQA 4F83A 3IPVB 3LZZA 4CCLA 4XDPA 1ZNPA 1JBCA 1W2TA 2X5IA 1DCSA 3B9CA 4CSWA 1N1SA 2PYTA 3NV4A 4NROA 3ZXJA 4LT5A 1PGL2 3UKTA 4LUKA 3VBSC 1EV13 1GOHA 3I2JA 3WQ7A 1FPN3 2QDRA 4COZA 1UYPA 4FXGB 3DYMA 4L2NA 4XZUG 1H4HA 3VZLA 4BK4A 4UBHA 4DNYA 2W2IA 2VVDA 4XBNA 4AHWA 2ATFA 2RHPA 2IXIA 3N9OA 2R063 2JE8A 3O7OA 3OPZA 2HEWF 3AXDA 4M01A 3SH5A 4AGGA 3GHMA 4NWWA 3WUDA 5CA6A 1W2UA 1IPJA 1CPNA 2YB7A 2XJVA 4FQZA 1CWPA 3IN9A 2C5DA 4Q27A 2DBIA 1T2XA 1O3QA 2EAKA 5EPAA 4Z82A 3FX3A 3IDBB 2J42A 3DXUA 3IAQA 1WZXA 2R7EB 3OGGA 4GULA 4A3XA 3GDBA 4N7IA 4CXWA 5J37A 1EP0A 3CLPA 4ORFA 1JU4A 2ARXA 2E63A 4HN1A 1ULCA 4AK3A 1BYHA 1N1VA 4L11A 2WN2A 3NV2A 1HB3A 1DP0A 4CDWA 5JUVA 1C8NA 2W1UA 2UURA 4K8RB 2WWJA 4FPEA 4SBVA 2A3YA 4CU6A 1HRV3 1YQ2A 3AZVA 1H9PA 1RL3A 2JKBA 1L7QA 3I3QA 1I3HA 4IV1B 4LTAA 4OMDA 4QHZA 4TYSA 2JDNA 3OCPA 3K51A 1YFUA 5F3EA 3TEWA 2RMU1 1H4GA 5JCTA 4XVHA 3S30A 5SV5A 3I2DA 2D5FA 4XF9A 5K0UC 2FCVA 4IL7A 2SLIA 4MX3A 1R1A1 2O8QA 1O5UA 2VMGA 4JX0A 4Y20A 4L8QA 3CJIA 3VL9A 1ALYA 2MEV1 2FD8A 3GGLA 2JB4A 4AI2A 2JG9A 3M8LA 3U11A 2HWD2 4NRPA 4E2QA 5KC6A 1J58A 3QCWA 2HH9A 2F6BA 4XFIA 4AFAA 3KQRA 1BBT2 1JZ4A 4UFHA 1I1EA 4LE4A 4LO8A 2W47A 5ABJB 1YC61 2YG0A 5IK4A 3AB0A 3N7JA 1ZX5A 2BW8A 3EO6A 3CBNA 4NPRA 4YGEA 1H1IA 4P9GA 1C5IA 3EHKA 3VZMA 2PA7A 1RHI1 4QPGC 4RR3A 1RVF2 1O8PA 3PMSA 4Y1YA 5D1IA 1XNCA 1UN1A 1WMDA 1SBFA 1YO8A 4LULA 1GZWA 4XABA 1GWKA 1Q8PA 4S2FA 4QPIB 5EJ1B 4Q4W2 1VRBA 5JWPA 3HPNA 2EXIA 5T3NA 1LOAA 4PCRA 1GUIA 2A3XA 4EV0A 1EUUA 3J4UH 3NNLA 3RWNA 2ZMLA 3A0KA 3PUQA 1HDKA 3AZYA 4LO7A 4XE9A 1I5PA 1QJY2 2WO3A 4GAZA 4QPYA 3VBOB 5FREA 4CCEA 1JYVA 1FOD3 3R6SA 4SLIA 5FYVA 1OA3A 4AVSA 4MYEA 3WXPA 3I3EA 3FLPA 3VBHA 2VQ0A 3O1VA 1ZBA3 1WCKA 3HR9A 4GB31 4CPBD 5I91A 5C5TA 4PIZA 4RS5A 1WCQA 1NA1B 3POGA 1RMU2 4YG6A 3BUCA 3C7OA 1VAKA 2PTMA 5CKMA 2Z42A 2HWE1 2MNGA 1OKOA 4IETA 2YUEA 3RDIA 3WP5A 1GNZA 1VIWB 5LY2A 1M4WA 3VDDA 1XPWA 3U37A 4AAPA 2DFCA 3HAGA 1D2SA 1KDMA 1Y7BA 2DVAA 5BUVA 1W9YA 4AG4A 4Q8LA 2Q8EA 1W8UA 4TLGA 4KG0A 4CCMA 4KGGA 3FWEA 3ES1A 2XVLA 2XWBB 4Q4V1 5DZEA 4D6QA 5IK8A 4MSVA 3PUSA 4G4FA 3PUHA 5FZ1A 1W8OA 4EZHA 1ZVFA 3I59A 4P5HA 1F15A 5ACA2 4OULA 2TEPA 2QKDA 2WT2A 3RYPA 1XE0A 2GAUA 2VUJA 4OQ9A 2DFBA 2ZGKA 2VBPA 3NSTA 2W87A 2VG9A 4IDZA 3KVAA 3GJAA 1H6YA 3EMRA 3JBG1 2CGPA 1CAWB 4U36A 1OH4A 3POIA 3ZMNA 3OUHA 1V0AA 4LBQB 1CONA 1F4HA 3ZFGB 3ZXFA 2VZQA 2YV8A 2QQVA 2Q4SA 5LA2A 1W2OA 4NMIA 2ES3A 2ZABA 4NWVA 4AVCA 1DQ6A 1F9KA 1T6BX 1AYM2 4JDNA 5GLTA 3FLTA 4XJWA 2OT7A 1QU0A 3P5BA 4P9YA 5EHDA 3J8F1 2ERFA 4MV2A 4W50A 1VRH3 3UGHA 2DV9A 3AL5A 4XJUA 4META 4MGQA 4YG0A 1VBA1 3WF1A 2VY0A 5FZAA 3RZHA 3NRUA 1AR62 3MIGA 5LB6A 1DZRA 3ROUA 2YMZA 3TRSB 4XFAA 4TZDA 2G19A 2UY8A 1VE0A 2X5IC 4BB3A 4QB1A 5DUVA 2VCMA 4AZZA 2RVAA 4QQLA 5KXCA 1XSQA 1HQNA 2ARBA 4FPKA 4GWIA 2W39A 1M06G 4R4XA 1R64A 4GH4B 2QQPA 4KGQA 4AVVA 2VTFA 4UW5A 2J1EA 4UW6A 4WV8A 3VHPA 1C57A 4WVZA 1LHVA 2J1RA 5FYUA 1PO21 1RGSA 3M4FA 4NUBA 1IS5A 5CISA 1JODA 1CAUA 1RUG1 1O8SA 1UOJA 1RUG2 2V73A 4CDXB 2DUPA 4AGRA 1AR81 2IVIB 4EE2A 1RUC3 1UD1A 4WM8A 3NJYA 1ONAA 1XE7A 2DVGA 1YFXA 1QOOA 4WM7A 5LA1A 2TBVA 1SCRA 4CPBA 1IQAA 1ND3A 1WCDJ 2BNNA 2VW2A 3ASIA 5A3WA 1JXNA 5DAPA 5CBLA 3AFGA 4AXOA 2VNOA 4AEDB 4HT1T 4FTEA 1CAXA 5CIRA 5GALA 2RS31 3QACA 4A6OA 4Z2AA 1NOVA 2X09A 4HXCA 3ETPA 1XE8A 3ZYRA 3KMHA 3V0AA 1RUD1 4ARXA 5JDBA 1KGYA 1COV2 1X82A 2Q8OA 3PLQA 4NVPA 4GQ7A 5A3PA 4A42A 4M3CE 4UBGA 1KD7A 3A21A 3SLIA 3VKOA 1UMHA 5C3RA 1JZ6A 1FI2A 2EXJA 2JX9A 5CADA 4QGLA 5M0TA 3LOBA 4EYUA 2DUQA 1N1TA 2C6SA 4YGCA 1RUNA 4RA0A 4A3ZA 1NKGA 4NHYA 1S1AA 2JG9C 2D6PA 2OPWA 1AR92 1MVEA 2DCKA 5HCAA 5FY5A 1RUH2 4DZGA 3WEZA 2WQ8A 3JD72 3PVOA 1GP6A 4ZU4A 1TVGA 3D5OA 1UF2C 5A3MA 2HKXA 5FP4A 3T1LA 2ZKLA 3E6BA 5DUUA 4FI9A 1T6GC 4A7YA 2ZGMA 5BNQA 4IEUA 4PBPA 4RR3C 5IVCA 3VZNA 1V6MA 1PVC2 1UWWA 3N35A 1W28A 1VP6A 3IIIA 3NO8A 4YM2A 3ZXKA 1U5IA 1ASJ2 4KH9A 1HJGA 2HEYF 4ISRA 5JOXA 2CGNA 2GNTA 1SBEA 1REFA 4QD2A 5C3PA 2RMU3 1BXHA 4DRVA 4BOWA 1V6KA 3ZYGA 4XAEA 1L3JA 2B46X 4OYUA 1QJX1 1W39A 3ORJA 1ULDA 2D5HA 3N7MA 5L9RA 1R1A3 3VBHC 5BNPB 1H9WA 4JC1A 5DUWA 2IXJA 2KA3A 3FFQA 5A6YA 4RS5C 3AYCA 3HIFA 3PTYA 1REEA 2VAUA 1R082 1NYWA 1S55A 1VBE2 2YFUA 4IEXA 2JG8A 2NN8A 2WO2A 2VUDA 5JPMB 3JCIA 3AP7A 1BBT3 4HPKA 1Y43B 3ZMOA 2X10A 3VDDC 3ACLA 4Q26A 5A6QA 2V5DA 3GBWA 1GLHA 3JU9A 5FY7A 3UK9A 3LA7A 1V00A 1VBD2 2LROA 2A73B 2E32A 3IDCB 3OD0A 2A71A 4QKNA 1ULGA 3ZIWA 3UETA 4UW3A 4C8DA 4BXSV 1RHI3 1YJLA 1NCQA 1SLLA 4LHKA 5J36A 2JDAA 1SFYA 3BYWA 2OXBA 4J1WA 3N7LA 3CDZB 2YC0A 5BYNA 5LEKA 2PN5A 2J7MA 5EYYA 4XHXA 4AF9A 2QJVA 2VMCA 3I7DA 5BY5A 3AKQA 3KVBA 1PVXA 2LALA 1KITA 2VNGA 1MQTA 2QQKA 2VQTA 2E51A 1OT5A 2WNUB 4RQPB 1X8MA 4XIKA 5T5LA 4AFCA 1SLAA 4S2HA 4LO4B 1D4M2 1BLZA 4GJYA 2DBNA 2XQRA 3E1F1 2R072 2X8KA 4IGPA 4LLFA 2K2SA 4OHVA 4GB33 1LJ7A 2C26A 3BI3A 1CAVA 4OHWA 1GQGA 2ZBJA 2K0GA 4YW7A 3KT4A 4Q1RA 3KB5A 4XACA 4N90A 1XB9A 4LR4A 2PHRA 4FO9A 3J26N 5FZOA 1UY3A 2CAVA 3ZFFB 5KR7A 4QU1A 1RUF2 5LBCA 5LWBA 2R32A 3MIEA 5FP8A 1IKPA 3BU7A 3H3ZA 3SCGA 2DYCA 1WCSA 4CZSA 1Q8OA 1VBB2 4HKLA 5F2SA 3E97A 4BWOA 3LKJA 4Q4V3 4P5YA 3D0JA 1W8HA 3EYPA 1XNKA 2WC2A 4V2VA 1NT0A 5DAXA 3WDVA 4LBJA 3W59A 1S0DA 2D40A 1LOFA 4TN7A 2A70A 3S7EA 3RZKA 4JGYB 1HB4A 3ENRA 2FMYA 3D3AA 3E6DA 4Y1XA 5C3SA 5JZGA 1EV11 1ZZ7A 2D6OX 2VZSA 4A2UA 4HVOA 1FPN1 3T2PA 5A1AA 2XMLA 5FYHA 1O3SA 1W6PB 3B02A 3JBG3 5IJRA 3GJBA 2KD7A 3SXWA 3DEMA 3H8OA 1LKNA 1MEC2 3DKWA 1NXMA 4IESA 1W06A 1D2QA 4OUEA 4WVVA 4UAPA 3WW3A 5LZ6A 4NJ4A 3I2IA 2YPJA 5IFPA 3I2OA 5GZGA 3M3OA 1LU1A 3NNFA 2BVBA 1RYYA 3Q8CA 4X6RB 4R9CA 2BGCA 2RDSA 3K3NA 1C8M1 5TSWA 4XFBA 3C7FA 3H3UA 3PVNA 4CEYB 4AVBA 4COYA 4NIDA 1E5IA 4JRAA 4WM8C 1GMMA 1WLCA 1AR71 3J8F3 4URAA 3KCXA 2P6HA 3HQRA 4UXAA 2ZEWA 4WM7C 5F37A 4KL1A 1F4AA 2HWC1 1BJQA 1WGPA 2ADEA 1ND3C 3L2YA 1V6JA 3AYDA 1PMJX 1VBA3 4R9AA 4QDRA 2Y8KA 2VNRA 3ZFEB 1H2LA 5AFBA 1AR63 3MF9A 5D8AA 4GKYA 1V9U1 1IPSA 2YC4A 4M4PA 4Y33A 5EQUA 4OI1A 3IZOA 1JYXA 3OY8A 2BBVA 2FZ2A 1KS5A 1KFXL 4ZS2A 1HRV1 4ES8A 3H7YA 1ODMA 5B2GB 3WW2A 1AYN1 3LF7A 2WZ8A 4YZ3A 4YFZA 2R49A 5JXJA 1H8TB 3BCWA 3OGRA 4XOGA 2JIJA 3VBUB 1SLIA 2Y6FA 4XAAA 5E1RA 2Q8DA 4FVVA 3VKLA 5IATA 1SZBA 1QDCA 3BU0A 3U75A 1SPPB 1ZA4A 4FP2A 1LGCA 1QF3A 3AYAA 4LLOA 3BB6A 4QQ2A 5FZ9A 1O3RA 1F2NA 4Q4Y1 3TAYA 1PO23 2JE7A 1RITA 1RUG3 1VBC2 5FRAA 1OVSA 3MGUA 1IS4A 2OYZA 4CDQB 4PHZA 4C90A 2BNMA 3KV6A 1AR83 1S0IA 5GKAC 3ACFA 3VHOA 1XNTA 2B45X 2VL4A 5EWSA 4LBMA 1BEV2 3POWA 3M2MA 2XXZA 2LTNA 4BXFA 5C9AB 1AXZA 4XZPA 1LU2A 2QFEA 4B1LA 1C1LA 4BM8A 1ZRRA 2WT1A 4FAGA 2ZPXA 4HETA 1WKYA 3CIHA 2EXKA 4NO4A 4Q4X1 4YVWA 2NP0A 1G6NA 4XF4A 2AZ5A 2GNMA 2RS33 3ZIXA 4HVQA 5A7QA 4EN6B 2WIIB 2J22A 2DVFA 2XOMA 1RUD3 4OZOA 1FX5A 3FN9A 1AZDA 2A6WA 4AI1A 5LK7B 1Y9GA 3NW4A 2DCJA 4D3WA 3CL1A 4LA2A 2UYAA 4FOWA 2WZR1 3VUOA 4JVAA 1KS4A 1RUJ2 3ZN5A 1JS9A 5FMCA 1ND2A 2ZGNA 3ZPYA 5IVEA 4BJ0A 1QXRA 1FT9A 1R1ZA 4DXZA 1QQP2 1G9DA 1WW6A 3AL6A 2YROA 4LJHA 3WLUA 2X5IB 3UL2A 4JGZC 1A78A 3U1XA 2JG8C 2W5FA 1YJKA 4IEWA 3UJOA 2CV6A 3NKTA 4Y4RA 2Q1ZB 2EAAA 2N7GA 5FP3A 4AEKA 2VBDA 4ZXKA 4OI0A 4DOUA 4YW6A 2HYKA 1BMV1 1VR3A 3VBRA 5I93A 2FQPA 2E31A 2FMDA 3NNJA 4LKFA 4FBFA 3NNGA 1O4TA 5F8PA 3AMMA 3VDBA 1NG0A 2GMPA 4Y5SA 4XUPA 1H0BA 1YQ8A 1U5YA 1NCQC 4XCAA 1PVC3 4HFSA 1UPSA 3HBZA 5LRSA 4AOCA 2Y26A 4LEJA 2QQNA 2EIDA 2GP3A 3HOBA 4O9EA 1YI7A 5GZEA 3FHAA 3D8CA 2VUCA 2EALA 4B7KA 3D82A 1XYOA 4CCDA 1MQTC 1IPKA 2ZGSA 4XIOA 4B3NA 3BTAA 4LOTA 1QJX3 5FXWA 2WINB 5FZMA 2BPA2 1HQLA 2QQWA 2R6QA 4IEQA 5EJZB 1AF9A 3TN92 3VBFB 4CDWB 1OH3A 2UYBA 1UX7A 2VZUA 4JKKA 3WD5A 1QJZA 2WFF1 3DKQA 4NHMA 3I49A 2I2SA 1OUXA 2A3WA 4JTOA 4MXWA 1VBE3 1V6LA 1FV2A 3IB3A 3POSA 5A6ZA 1BVVA 3ZR6A 1WBFA 4XDOA 5T5PA 1W0NA 1CQ9A 2RDQA 3MF6A 3HN3A 4MOAA 4P9LA 1V6NA 1NQJA 2VVEA 1QJFA 2W1QA 4S2GA 2OVUA 4L99A 1AL22 4N7UA 1CZTA 4B7EA 5HV0A 1G9CA 1EYBA 2B7YA 2XBO2 3APBA 2WZEA 4DO0A 4ZZ8A 1FXZA 1LHUA 2D6MA 4Y20B 5L9BA 3WG4A 4Y1VA 3CJIB 4BZ4A 2YGLA 3LEGA 3RMYA 4DEQA 3WDWA 4TTGA 2JG9B 4W65A 2ZHKA 2XGXA 3CZUA 1LOFC 1IG3A 3WR0A 3ES4A 5IT6A 2I74A 2XHNA 4XFGA 5JZGC 3W58A 1NZCA 3IM0A 3N9LA 5GZDA 3ZPOA 3FMGA 3JUUA 2L9LA 4RFRB 2RDNA 3IMMA 4XF0A 1RB8G 1D4M3 2GH2A 2RS51 5J7MA 2R073 1LRHA 3I4IA 4XUOA 3M3EA 2BBAA 3K46A 2GC0A 4GWMA 3WQ1A 3HNBM 1ZBE2 3H9AA 3OD4A 3U07A 3WNXA 1QOTA 1RUE1 5FJKA 3RWKX 1UU5A 4XJAA 4CCOA 1SCSA 5J98B 5FZBA 5HXMA 1O59A 2BOJA 1WA6X 2BZDA 3WF0A 3WW4A 3AMQA 3K4ZA 1ENSA 4FTBA 1FMD2 1MS9A 5DMYA 2VGDA 3ZO0B 2ZX3A 3NAPB 1W6NB 1W6MB 2ZKNA 2ZOEB 5HPOA 4P9IA 4YFWA 1VBB3 5D8AC 4AHZA 4I30A 1E5RA 3D4KA 3LD8A 1W3VA 3QOPA 3B7MA 3LEMA 3NV1A 3MICA 4ZS3A 4ASMB 2P3YA 2ZGOA 2WYSA 1URXA 1CX4A 3K4AA 4PI2A 5T5JA 1W8FA 1PGL1 2B42B 4PIXA 3BALA 1BQPA 1DGLA 3VDDB 5CZKA 1K5MB 2WN3A 4O65A 4QT6A 3O1OA 1J3PA 2FDJA 4QPWA 1NCRA 4JRLA 4QMAA 5CFCB 3P1IA 4M3CA 4A41A 2QBXA 1K45A 1XXNA 2UWCA 4BCUA 1B35A 2ZX0A 4KMQA 4CTEA 1GR3A 3W5NA 3OB8A 2B9VA 1OFNA 2A6YA 4URTA 5E8AA 1YI9A 5BNNA 5FDBA 1C8M3 3T4HB 2I07B 4I0AA 2QQJA 5L36A 3VD9A 2EICA 1AR73 4FSJA 4NPLA 4S2DA 4JKLA 2DCYA 4LQRA 2HWC3 3T30A 3UKNA 4DMIA 4B4PA 5KHIA 1MPXA 3W5MA 3H8XA 2D43A 3HN1A 4Z07A 3VD3A 1D4VB 4LOSA 5C5UA 3N4MA 2WNVB 2G9GA 4YVWC 5A32B 3WVJA 2IZWA 3WF2A 5FZ3A 1H1MA 1V9U3 2VMEA 2Y60A 1LTEA 3B00A 3UV9A 1GSLA 1KDKA 3ZSMA 4OHYA 3WNOA 1LEMA 1SBDA 3WQBA 4IEYA 2VMDA 2HWB2 4LIUA 4L92A 3AX4A 1Q8QA 1AYN3 3RI8A 1A8MA 2P4EA 2WUHA 5KHGA 3ZYIB 1JZ7A 3MIBA 2GNDA 4WBBA 4Z1VA 1ZREA 2YU1A 4J25A 4LKSA 2ZX1A 2DCTA 3J9SA 1X33A 2DWRA 3CJXA 4H55A 1XNDA 3UYJA 4OI4A 4Q4Y3 3EJKA 2JIGA 1ND2C 5APAA 5LASA 2HBUA 4Q0PA 4BE3A 3Q9OA 1CR7A 3VZJA 2A1XA 5CFDB 4GA9A 4NAOA 4TWTA 3TEYA 2NMNA 4MADA 2HWD1 4DXSA 1LHOA 4CU7A 2P17A 2I45A 2WR9A 4NN0A 1SLBA 2Z2SB 5FYSA 4D8MA 3S5QA 1LAJA 4CP1A 2QQMA 4MH0E 3AKSA 1BBT1 2ZXQA 2XKOA 1UOGA 2YBSA 3DPRA 4MGSA 1WMXA 4PIYA 3KS7A 1CZVA 1HRI2 5GLVA 2CL2A 2WS92 3VBRC 4UW4A 2RM22 2PHXA 2VQUA 1MVQA 3EQEA 4Q4X3 1O4YA 5JXGA 1RVF1 1GNHA 4BHPA 2ZZJA 1VJ2A 2RS12 1JZ3A 4NPMA 1POQA 2AUYA 3OPTA 4Q4W1 3WT3A 4BYYA 5CG8A 2VTXA 4DPNA 2E26A 1F31A 1NLSA 5A7WA 1G9BA 1ENRA 4XILA 1G7YA 4UFJA 4NIAA 4I01A 1QJY1 4CDUB 3N9QA 2WZR3 1DQ1A 1FV3A 4KQ7A 4YM3A 1ODNA 1PNFA 3VGIA 4EJRA 1A6CA 2BRTA 2RJLA 4N9IA 3H0OA 1W0PA 1S0GA 4IV3C 5A80A 3IDEA 1G9AA 3SQOA 1CJPA 4AYUA 1LOEA 1QQP3 3V0BB 5CYYA 1RMU1 1EAH2 3NJVA 3JZVA 1ZZ8A 5IVBA 3ZXAC 3HD8B 2V4AA 1YRZA 5A1FA 4DUVA 4UF0B 5JLVA 1SQ4A 5JIUA 3ILRA 3ACIA 4E2SA 5EJ3A 1W99A 2VMFA 3FJSA 2ZCWA 3B3QE 4RFT0 4YZ4A 1KXGA 1OQ1A 4RGKA 3VD4A 4Y24A 3HMYA 2HJIA 1RXFA 4YVSA 1ZM1A 4E4HA 3I2KA 1ZZCA 1W3XA 3TEZA 2WKKA 5FZ7A 1W8ZA 2PMWB 4F7ZA 4QX3A 2GC3A 1NX9A 1JYTA 2VQAA 2P3IA 4KWJA 4FFGA 4COVA 2HLEA 5ACA1 4GALA 1DGRA 1WUVA 5FUNA 4AFMA 3RZJA 4LBKA 1LEDA 1H8VA 4Z2WA 4OFGA 3UGFA 2A7AA 4MGYE 3ZVXA 1BKZA 2E53A 3RZLA 2JJ6A 3A4UA 4L9BA 1DQ0A 2WBKA 3TN93 2XKPA 2ZAAA 1H2NA 4QB6A 5FPAA 2HEVF 3Q8BA 4AL9A 1R092 3MI8A 2K46A 1AYM1 2JDUA 3U4SA 1HKDA 4YZ5A 1HX6A 2WFF3 2JICA 4CCCA 1OQEA 1Q43A 2C24A 3WZ1A 4BQ3A 2DTYA 4D0QA 1W8NA 2RJKA 4H3WA 3PVEA 2AH2A 2ZZQA 2WQZC 1IKQA 3WHUA 1MZEA 4GWNA 3R05A 4V2WA 4B8EA 4C0BA 5J3UA 1PGW2 2WT0A 3FC0A 1D0GA 3KGZA 4COUA 4XXAA 3KSCA 1REDA 3AZXA 5CVRA 4FFFA 1WMEA 1FNYA 2GALA 3WQ0A 2JE9A 1AR61 1QMJA 2ZS6B 3O0WA 2C4XA 2YGMA 3LAGA 4TXWA 1X50A 4ZZ5A 1Q8SA 4Q5OA 4P9XA 2JB8A 4A45A 5C8CB 1ZRFA 4NE9A 2XDVA 2PAKA 4MHRA 1SLTA 1ZZ6A 3IMNA 2CTVA 2D93A 2DURA 2ZGLA 1YNAA 3OJBA 5F32A 1LECA 3WG1A 5FZCA 2RG4A 2E6VA 4K1ZA 4LHLA 1FAYA 3RYKA 2ORXA 4OQ8A 4NHXA 4HPKB 4K7JA 1E57A 1OF3A 2QQUA 2VVFA 3H3LA 3ZSLA 4PJYA 4D6SA 1CGPA 3ZKUA 3GBGA 3KWVA 1IOAA 4CA9A 4XDQA 1OVPA 1NCRC 5FZLA 2RS53 1JYIA 1ST8A 1YWKA 4X6QB 1D7PM 1PZ9A 1B35C 1HV0A 2J1UA 2AENA 2Y34A 5BNNC 1RUE3 2QUOA 4DRRA 4LXLA 4QDQA 4HSJA 3TNPB 4BIFA 1NAEA 1OMIA 1XNBA 3A0NA 2C1FA 5DN2A 4HG6B 4I02A 2OQ6A 4L97A 3IT8A 4QM8A 3OGJA 4XTPA 1VAMA 3SCFA 2R042 4UFIA 5F1RA 1TMF2 1OLME 3PURA 5JMOA 5T5OA 2VZ3A 1RUI2 1CJDA 4UYBA 2ADDA 4R9DA 2CDPA 5DABA 1MZFA 4TSVA 2VBBA 4XUTA 4Y22A 1OURA 5BNOB 1GFF2 1KQRA 1OQDA 3POYA 2QZ3A 3O5SA 4IEPA 3WNNA 4E9KA 1MZ5A 1ENXA 1N3QA 2PHLA 4DXRA 2YYOA 4KU8A 2RR12 3VKFC 1QWRA 2YC2A 3DYOA 1OC1A 3RQ0A 4QPIA 5FTTC 1COV1 2BEOA 2PLV2 3AKPA 3ITQA 3KZ4C 4N9HA 1QDOA 3GBFA 2OQ7A 4QXKA 1NLRA 4FQ4A 4AI3A 2O8OA 3VBOA 3L9JT 2B8MA 2QZ2A 5FYMA 4N53B 4DB5A 3T4VA 5I0DA 2IVJA 4IGOA 3ETQA 3ZN6B 1GU3A 2OA2A 1NXD1 3K2OA 4P9WA 4UWDA 2XLGA 4FPFA 2ARCA 3N9NA 3PIJA 2WWSA 3KQ4B 5K4LA 1DDLA 1NA1A 2QNKA 2W1SA 3ZSJA 3LIGA 2BERA 1AR91 3AZZA 5DZGA 1RUH1 2PELA 5IFTA 3DN7A 2ZGPA 3JD71 1WW5A 4QU2A 4COWA 1W6OB 1BVP1 2P1BA 1HXS2 3DPRC 5FY1A 3V64A 5FUIA 1QGLA 5C4WC 3IAPA 4E4ZA 1NUKA 3MIDA 2XWJB 4ET7A 1W05A 4LE3A 4YW4A 4KBZA 1IS6A 2PHWA 2XJUA 4AQSA 3FZ3A 5FY0A 2QVSB 5A7PA 1UL9A 3E5XA 1N47A 3GZTB 1PVC1 3FLRA 4EZ4A 4CCJA 4LMFA 1PO12 3GALA 3NWKA 1ASJ1 3H1WA 4N43B 3ZDSA 2HWB3 1OOPB 3I3DA 4LORA 4X8NA 4CP9B 4AGVA 2VZRA 2EIEA 3AM2A 3OEBA 3T08A 2VJXA 1P8JA 4FXKB 5FZHA 3BPSA 4QX2A 1G8WA 3CNAA 3HEIA 2Z4FA 1UAIA 1IG0A 4HKWA 5KWRA 5FXVA 3NVCA 3SCHA 3ZFGA 3OY8B 2YU2A 4MGZE 1W04A 5DDJ2 3AK0A 4HK8A 2AR6A 2ORZA 2EIBA 4JGZA 1R081 2DF7A 2G4IA 1VBE1 1UXZA 2A5ZA 2FCUA 2HWD3 2VW0A 4QKBA 5E89A 1LODA 5FBZA 5LA0A 4DUXA 4EN7B 4IGQA 1A34A 3OUJA 4QGMA 4RN5A 3VBSB 2PQSA 4YLZA 3O0VA 5CKNA 4UFLA 5AC91 1DQ2A 4XC9A 3ZYJB 4LHNA 5AC92 5IHRA 2G9FA 4ATFA 4AWDA 2RM23 4YVSC 1VBD1 1VLNA 1TNRA 2ARAA 4JAAA 4BQXA 1MS1A 5FPUA 3U0ZA 2EIGA 2E7QA 1RVF3 5A3OA 3WNMA 4QX7A 4GKXA 2RS13 5A33B 5KHHA 4Q4W3 3LEIA 4PLMA 4JV4A 2CAUA 2VOVA 4HMZA 2VCBA 3ZM8A 1H30A 5EV7A 4NRMA 4NIHA 2D3RA 1S0JA 1AL0G 4AI9A 1S0FA 1QJY3 1UYXA 3N9MA 1QXPA 1LULA 4IERA 5FMBA 5IVVA 3F2ZA 1SDWA 4GH4A 2EA7A 1D4M1 4BQ1A 5F9TA 1XJAA 4YVWB 2R071 1LR5A 4PT6A 4AHXA 3ACGA 5C33A 5T54A 1JH5A 3T2QA 4MZUA 4QX5A 4ISQA 1DFQA 1AJOA 5H9QA 1RMU3 4CDXA 2X05A 4KBBA 2J1VA 4D7TA 4Y5TA 2AC1A 1FYUA 3Q8FA 4EWDA 5FO7B 1W6QB 3RG0A 5IK5A 1UYYA 3MEPA 5A1LA 1RUF1 1SG3A 2RJ2A 5FMDA 2UWBA 4IE6A 1JTZX 2W0XA 3THDA 5K0UB 5FWEA 5L9VA 3V56A 1F5FA 2FDGA 2DU0A 2ZHLA 3O0XA 2HWF2 2VTXJ 3ZSKA 1ND2B 2RV9A 4XEZA 5FP7A 2D44A 1VBB1 1XYPA 1U5XA 3IDAA 5FUPA 3THCA 4YGBA 3SHRA 1K12A 4FFHA 1OXCA 2OZJA 5FQ0A 5ACA3 2P2KA 3NJXA 4GMP0 1MZ6A 3UJQA 4Z8BA 3BTZA 5FYTA 3MLLA 4LK6A 3U78A 5LA9A 4CRQA 3FFZA 1TEIA 1PIV2 2QDNA 1QJU2 2WLPA 4LNVA 5JXIA 5LEJA 5H9RA 1C3HA 3UT0A 4QXCA 4YW2A 3ST7A 2CWMA 2FDHA 1MEC1 3TB0A 5J1XA 1U0AA 4QAWA 3R0RA 4QPGB 4Q8KA 4HK9A 4AFBA 3H7JA 5CU1A 5C3QA 1AYM3 5LW9A 5I8TA 4ES9A 2QCSB 2GZWA 1QKQA 2VZTA 1O4ZA 5DZFA 2IC1A 3AP4A 1JZ5A 5FPVA 2VMIA 3LEKA 4NAMA 5T52A 1CPMA 3SEEA 2E7TA 1LB2A 5IAVA 1XNAA 2Z79A 1US2A 3RRDA 3LSEA 2A6VA 4CXXA 2P5BA 1VALA 3AJYA 3HJRA 4IXLA 2ID4A 1WMFA 1S0BA 4AEJA 2PAMA 3CMGA 2QQIA 1DF0A 2R062 1ZZBA 2W95A 4C91A 2OX0A 4AVAA 1X9TA 3OG2A 4NIIA 3FBYA 3K75B 3D6EA 3DUIA 4D94A 4QPIC 3P6BA 1VMFA 1CIYA 3OBTA 4UT5A 2LM3A 4WVMB 3USUB 1PM4A 1SFPA 2GU9A 3M3IA 4YPJA 2Q5TA 3GM8A 4IE0A 3VZOA 3S0MA 3LQCA 5HXVA 2C9AA 5FY4A 4K8FA 2A6XA 3ALQA 2XLAA 3VBOC 1RTVA 1QH7A 2BFUS 1EUTA 3SNMA 1YFWA 5HV4A 1VBC1 3KV4A 3OTFA 2D3SA 4OZXA 1GWLA 2XJRA 4HOOA 3B5LB 5FZIA 4A7ZA 4B1MA 4UFMA 2B4KA 5FMOS 3TWIA 4I0WB 1NA1C 4LPLA 4GIQA 4JDMA 3TNQA 1BEV1 3V65A 5EIYB 1OPOA 5JOWA 4RHV1 3NNMA 5AVAA 3I8TA 1HN1A 4RHV2 2W92A 4PDWA 2GH8A 4DS0A 1PMIA 5DAVA 2VULA 3I3BA 3RSJA 1F35A 3ZXGA 3IWZA 3WNKA 4CUGA 5FWJA 4IQPA 3PL0A 2R1BA 2W68A 4R4ZA 2JD4A 3HVDA 4RYDA 5EFUA 1CX1A 4WZFA 4XW3A 1GBGA 1OD5A 4RL7A 1MS8A 4YW3A 5FZKA 5FOJB 1HN0A 1DIWA 2VZ1A 4LKDA 1GANA 4DIQA 2Q8CA 3CF6E 1JYCA 1UMZA 4E4SA 1MS5A 4XQ4A 5HBAA 1COV3 4YM0A 2DVDA 2OUHA 2JDPA 4MLOA 1STMA 4RGAA 5C70A 4KG8A 4EN8B 2DU1A 1FNZA 5HCFA 4OCTA 5FXXA 3AYEA 2VPVA 4RQPA 2WNUA 1QJEA 2NMOA 4ONUA 2BVVA 3S7IA 5K7PA 1OA2A 1RUJ1 1RXGA 1NE6A 1WCUA 2Y6LA 2ZEYA 5LBFA 2MHFA 3LPFA 3ZFGC 4INDA 5GM0A 1QQP1 4U2AA 1JYWA 3X29B 4LKEA 1C4RA 3WCRA 1GOFA 1SEFA 4CP0A 5L7OA 3H50A 4K1YA 4CCKA 4LO5B 5FY9A 5BPXA 1AR93 4NR1A 5FKBA 4FCAA 5IWFA 1RUH3 3ZFFA 3JD73 2H6BA 2PFWA 3T2OA 1HXS3 1TNFA 2HYXA 1PHMA 1FATA 1HJFA 1S4CA 3MUY1 4I3GA 4B29A 5HCHA 2Y64A 1JHNA 1FOD2 1UXXX 3F95A 3T3YA 1WWYA 2IXLA 1B35B 1APNA 3EXUA 3NKGA 5DPNA 3WNPA 1ZBA2 3HQXA 1UO9A 2AEZA 1LESA 2EF6A 1TME2 3EBRA 4GMP1 5C7GA 1ASJ3 3W20A 1W03A 4PQ9A 3OBZA 3ZLIA 4HONA 2IWGB 2AYHA 3A22A 4GZ9A 5FAXA 1UPIA 1K42A 1D0HA 4JGYA 5J48A 3I3MA 2BFUL 1XSRA 2VECA 5A3TA 5I0SA 2PHTA 2Y33A 2ZTNA 4GH4C 1W6PA 5IYYA 1AX1A 4IV3A 4MVTA 2E7AA 3CO2A 3TN91 5DAQA 4CUAA 5FYYA 5FMOL 1X36A 2FDKA 4W6XA 4P08A 2JD9A 3WDTA 1E5SA 4CDXC 1KJRA 5I0UA 3D0SA 3B01A 4EWAA 1R083 1UNBA 1H1AA 1JOJA 4CEYA 1PK6A 1Z7S2 4V1PA 3JQXA 3IKWA 3VKMA 2P6CA 5B4XA 3A7QA 3UKVA 2DTWA 5AC93 1GICA 3HT2A 2QTWB 3POFA 1OLRA 2OKXA 3M7AA 3RVHA 4CU9A 1AL21 1VBD3 1C5HA 2VO5A 2YBKA 2XONA 2E9QA 3ZFEA 2GC1A 1DG6A 2XBO1 3POJA 3O1TA 5DG2A 1QHDA 3UGGA 3ZXEA 2QE3A 2W46A 1JOBA 3KM5A 4OLLA 1W9TA 3GXUA 5I8YA 1KEXA 4FPYA 4ATEA 3QH7A 2WDBA 2ZJCA 1DZTA 3MPPG 1UZYA 3SMHA 1N1YA 2ZGRA 3THPA 4F3JA 3M70A 2G1MA 1Q3EA 2XUEA 2WRAA 1DZQA 1NZIA 3GHNA 3WF4A 4A4AA 4K9SA 3MFCA 2BV4A 1VRH2 3T0AA 1H8TA 4XURA 3VBUA 1W9FA 4YW5A 3LFIA 4TLFA 4AEMA 1WLDA 2XG3A 2ZEXA 4C0HA 5ISLA 1UY1A 2Q1FA 1SPPA 1XOYA 2GN3A 2E33A 4QDSA 4K3UA 1K5JA 4RR3B 2VW1A 5EXOA 3U4XA 3LCPA 4Q2FA 3TOJA 3SH3A 1ZBE1 1GZWB 3ZX7A 3BPZA 4AQ2A 2D7FA 4CDQA 2LW8A 5E16A 1AUYA 1AX0A 3LA2A 2JWPA 3BODA 5A7WB 3C2UA 2BWAA 2VOWA 1DYKA 3C7EA 1SHWB 3R4SA 2Q1MA 5FZ6A 1UYZA 4XMIA 4HVRA 5J09A 3JXSA 3LPGA 4HLTA 3BIEA 3AMNA 4DEVA 1RUF3 4E2GA 5C9AA 1FMD1 3MFAA 3KF3A 1LNSA 3AP6A 4W8JA 3MV01 5FPLA 2J1TA 3WDXA 3ZYFA 4EWEA 1I5ZA 2IXCA 3VBHB 3VDAA 1WA4A 1YIPA 2JECA 2WL1A 4AVTA 4Z92B 2WJSA 4RS5B 1ULOA 4P02B 2ET7A 5LK5A 1EPWA 3MLJA 3MDPA 4FFIA 5IK7A 4XFCA 1RIRA 4OMCA 3ZYHA 4PF5A 1GNYA 1RUC2 3CQOA 1PIV3 1QJU3 1UOBA 3NL1A 5EZWA 4LUMA 4OVEA 4BIOA 1GKBA 3BVCA 3DXTA 2NYYA 1DQ4A 2D3PA 2XB6C 3ON7A 4QKDA 1MEC3 1HV1A 3PNAA 5JPNB 1J3RA 4HL0A 1OUSA 4Y3OA 2UY9A 4AE2A 2DDUA 4B4QA 4FAHA 1GOGA 3H8UA 2WA4A 3N36A
chains in the Genus database with same CATH topology
1ULFA 1I9RA 3FHIB 2R1DA 3RNSA 4QQHA 4IEVA 4PDWC 2BUKA 3WP4A 1QH6A 4LBOA 3WOGA 2BYVE 2VU9A 2GNBA 4KWKA 4OUSA 4XYXA 1DGRN 1EPZA 2FZ1A 2OZ6A 1IGOA 1UZZA 2UWAA 4DINB 2GMMA 2XJSA 2WSUA 5H9PA 3GZUC 2HWB1 3GYDA 3QBQA 1O7FA 1A3KA 1AHSA 5FOBB 4FTSA 1WW7A 4AW7A 4FP3A 1RJ8A 3VHNA 2IXKA 1CVNA 1MACA 4RQPC 5DG1A 2WNUC 5FPZA 1POV0 3MPBA 1SMVA 3LOIA 3AJZA 1VBC3 2Q0AA 4ZKTB 2P3KA 2YDEA 4Y1UA 3VBFA 5KHKA 4YW1A 4HBNA 1O91A 3P3NA 4Q0VA 5L7OC 3JB8A 4YARA 1BEV3 4RHV3 3AZWA 2ZGQA 4K40A 3ZFFC 2YHJA 3AMPA 2RMU2 1HRI1 1C28A 2WS91 2YXSA 1DYPA 5C4WA 2TUNA 2RM21 4AI8A 2H0BA 1WD4A 5I8SA 4M0NA 3OYWA 3PJQA 1TQ5A 1C1FA 1CAUB 1S2BA 1R1A2 2RS11 2P37A 4W6WA 5C8WA 3WY6A 4LA3A 1LGNA 4WM8B 3RZZA 1UX6A 2MEV2 3ZXLA 3CU7A 2SBAA 3E5UA 4IEOA 5BV6A 2DCZA 3IBMA 4JGYC 4WM7B 1MR5A 5F6LB 1JUHA 3QD6A 1ND3B 3G6JB 5DXDA 3MW2A 2ZACA 1LHWA 5CB7A 2XJTA 1OSGA 1IZ3A 2XJPA 4XMAA 4FPJA 1AJKA 4HSLA 1RUJ3 4Y22B 1AX2A 1CAXB 4P14A 2D97A 4NHLA 3WG2A 4CEWA 1UU4A 1RHI2 5A3LA 3AKTA 1EAH1 1YHFA 3U10A 3QH6A 4D7YA 3V0AB 4HKOA 4CEYC 1PK6C 2ET1A 2D98A 1ULEA 5FLIA 3O12A 5L19A 1Z78A 4XFFA 3O14A 3GF6A 3NAPA 1W6NA 1W6MA 2FHRA 3ZFEC 4C1WA 1U5ZA 1QXJA 1GZ9A 3RI9A 4GB32 1TME3 1PM7A 3LGRA 3ZYPA 1KRIA 4GMP3 1Z0HA 4FPHA 3IPVA 3ILNA 5JSRA 2HWE2 4Y5Z0 1H8TC 3R4DB 3VBUC 2Y38A 4D7SA 2OPKA 1K5MA 1UKRA 3NJZA 5FFOC 1UKGA 2EXHA 1UCXA 1HQWA 5CFCA 4RSUA 1KFUL 1R091 4Y4YA 1QOSA 2JEMA 4YG3A 4Q4V2 4CDQC 3PJYA 4HZFA 5I0RA 4WZCA 5KXBA 4YGDA 1XU1A 2JXAA 1Z7S3 1MS0A 4RD7A 1OPMA 1PGW1 4JTNA 5C9AC 3WCSA 2VUAA 3JBG2 1AL23 1CESA 4XBLA 4D69A 2XBO3 3I54A 2Z5WA 2WNVA 4YRDA 4BLIA 1MS4A 1F5JA 1J1TA 2X53S 4Y1ZA 4OHXA 3PVBB 2NLRA 4JGZB 3I59B 2JG8B 4LBQD 1JN2P 2R0HA 4IV1A 2P3JA 3J8F2 5CNAA 1N3OA 1WLTA 4YYOA 4NOTA 1J59A 4FOVA 3KT1A 1POV1 5KHJA 1V6IA 3ATGA 3KGLA 3ILFA 1VBA2 3MZHA 1H2MA 3SITA 3WDYA 1KJLA 1X7NA 3MLKA 1NCQB 5C6CA 3WHTA 2Y0OA 1ZBE3 5CFDA 3P3PA 1Q56A 5HI0A 3TBDA 3RYRA 2NZ9A 4AHYA 4K20A 3R4UA 4YZ2A 4AQTA 2R041 1TMF1 1MQTB 3B69A 4K21A 3WDUA 1FMD3 1RUI1 1SLCA 4YM1A 1YXWA 4XHBA 5ABJA 3DF0A 1LOGA 1PO22 2WNEA 1Y3TA 1CAVB 1IHMA 2RR11 3OF1A 4RGGA 2EVXA 3VKNA 2NPIA 2OIIA 1AR82 1CIWA 4H14A 2PLV1 2XPJA 3THTA 1JW6A 4KWLA 3N3HA 3VZKA 2OW4A 1MS3A 3S6PA 2WQ4A 4CDUA 1W0OA 4HN0A 2K9ZA 1WBLA 1QNYA 1DGWA 2IFWA 3WV6A 5FO8B 2IXHA 2KXLA 5IUQA 3FUQA 3VBFC 2PQQA 3K48A 3ME2A 4CDWC 1DBNA 2RS32 3V0BA 1UIKA 2WSVA 4IEZA 5FQ0B 2W08A 1RC6A 2XL9A 2ZA9A 1V70A 1Y9QA 1S0EA 1SFNA 5GZCA 1AXKA 4B4RA 1RUD2 3M1HA 5JZGB 5KXDA 1O5LA 1HXS1 1ENQA 2KM2A 3KD4A 2XVKA 1F8VA 4OI2A 3WP3A 5CAZA 3VHRA 1YCIA 2ZGUA 3N7KA 3AKRA 2ZX4A 4Q0SA 1PO11 1Q5OA 3KT7A 3CJIC 1G86A 5J96B 4M00A 3ZXDA 2BNOA 4DFSA 5JI9A 3L2HA 4Q0QA 2BWCA 2GSYA 1QNWA 4FPGA 1CAWA 3HWJA 4X8PA 3LA3A 5D8AB 4CEWC 4YZ1A 1OHFA 4LBQA 4AFDA 5DDJ1 3G7DA 4FOYA 5KXEA 3LWCA 1X8EA 1AXYA 1GQHA 2P34A 2ENRA 2MPFA 1DU3D 2XVGA 3H1MA 5FCCA 1OA4A 2AGSA 4QGNA 1HRI3 4ZU7A 5JLVA 2WS93 4I0BA 3ZSEA 4JQRA 3URFA 2CY6A 1WW4A 3KLSA 5JSPA 3SISA 4QQOA 1QJX2 5FPXA 3NAPC 1YYNA 4FPCA 1Q8VA 2B5HA 5FLJA 4P9JA 2ZMKA 1VB4A 5C8CA 4O9GA 2A75A 3INAA 2A6ZA 2MEV3 4ZU5A 3BIWE 1J1LA 2X29A 2C0ZA 1BZWA 1HIXA 3PHMA 1GYKA 4PDWB 4H7LA 2WA3A 4FOQA 1K5MC 1VB2A 2PHUA 1LHNA 5CFCC 4F8AA 3VV1A 5CG9A 4ITCA 3FE5A 1TE1B 4R8HA 1EAH3 5JR7B 4H7MA 1ZRDA 3E5QA 2GN7A 3VLBB 1XQNA 2JENA 2XH6A 4EN0A 2O1QA 4MGKE 4M0HA 5GLZA 4XTMA 4EROA 4M3CF 1QY4A 2HWF1 4CP2A 3LSDA 5K9YA 4AEDA 5BNOA 4EN9B 2WNVC 3CEWA 3BOPA 5FLHA 5L7OB 4LO6B 1HW5A 2ZAHA 4XF1A 1PIV1 2HWE3 1QJU1 4IV1C 3AXEA 4GXLA 5GLWA 3VBRB 2D6KA 1LGBA 4R9BA 4CYDA 5GLUA 4N53A 4ASLA 2D6NA 2CWSA 1R093 1U12A 4XJ9A 4YNIA 3ZN6A 4BLJA 3DL3A 3T2TA 5CFDC 1B09A 2YY1A 1ZZ9A 1LENA 4C1XA 5FO9B 3WG3A 2ETEA 2W52A 5E88A 3E6CC 4K6BA 2ZGTA 1EV12 3RMXA 1W6OA 3AFKA 1FPN2 4J6GA 2GDFA 5ABJC 2Y0IA 4IV3B 2GC2A 4DQAA 1GV9A 3MIFA 2VMHA 3AP9A 1BCXA 4NHKA 4J1XA 2R061 2ZX2A 1ZYBA 3USSA 1A8DA 4MXWB 2H6CA 1C8M2 1PK6B 4HANA 4N43A 4XFHA 3MIHA 1OOPA 3WUCA 3QLQA 1CN1A 1AR72 2H0VA 2XHKA 4BA6A 4E27A 1XU2A 1POV3 1YFYA 3DV8A 3W9AA 4CDUC 2HWC2 2PHFA 4JCKA 5AVPA 2OUJA 5GJ6A 1YUDA 4OUMA 3MW3A 3PMEA 1N3PA 4QHBA 1RINA 1VAVA 2ZHNA 5SV8A 2NQYA 1IS3A 3B94A 1YIFA 5BNPA 1V9U2 5BXXA 2D6LX 2B39A 1HRV2 3MW4A 1ZRCA 1AYN2 4XBQA 1EY2A 4G3YC 1RJ7A 4OHZA 2R043 3HT1A 3VBSA 5JOYA 1TMF3 5K8SA 1RUI3 2XJQA 1PNGA 5JOZA 2BQPA 1HLCA 2ILMA 1GZCA 4Q4Y2 2XL7A 3RJ2X 4AI0A 2RR13 5A33A 1NE4A 4XPVA 4LBNA 4XQWA 3JB4C 2PLV3 4Q0UA 3FUOA 3ZN4A 1O3TA 2V09A 1DGWX 2WZPP 4Q29A 2DVBA 3T1MA 2WFPA 3NV3A 1G9FA 3RPQA 4Q4X2 4XF3A 3WP6A 4XETA 1CD3G 1JUIA 4E4DX 4I09A 5DUXA 4BPZA 4QM9A 2IFRA 1PZ8A 3B93A 1W6QA 4YSFA 4MXVA 1DHKB 2CYFA 4AQ6A 3MYXA 5K0UA 2WZR2 1FOD1 1NCRB 1XYNA 1LOCA 5I0TA 4M3CB 3VN4A 3AMHA 1PGSA 4XXPA 1OLQA 5H9SA 5HCBA 1ZBA1 4I2OA 4JDOA 1I6XA 1TME1 5BNNB 1PO13 5C8CC 3KCCA 3JQWA 3RJRA 2JDZA 4PLOA 1UW8A 2UU8A 3DGTA 4KU7A 5KBFA 2B9UA 3GZAA 4DY5A 4FPOB 2CNAA 3LB9A 2VOXA 3BOWA 1BMV2 1WLWA 1NY71 1NY72 4QQPA 4QPGA 5T55A 5F5QA 3TYJA 2VOKA 5DDJ3 1H2KA 3OBRA 2TNFA 1DQ5A 3WW1A 2ZMNA 2GMEA 4Y26A 1Z7S1 1J3QA 4MGIE 4PBOA 4WVWA 4BMBA 3GNEA 4I3PA 5LRRA 3IIAA 4A7KA 2F4PA 4W6YA 2R16A 3C3VA 4G9SB 4BMEA 5JMCA 3M3QA 3AP5A 3KCYA 5AFEA 2DUOA 2R30A 2XUMA 4AEDC 5BNOC 4FPLA 3H1YA 2VXRA 2ZHMA 2XLFA 2YZ4A 2Q30A 2R0FA 4MUVA 1BK1A 1DLLA 2WFF2 3B9IA 5T50A 4WVMA 3USUA 1VRH1 1NQDA 2VH9A 3DPRB 1V6OA 5JVVA 2RE9A 5C4WB 5JSOA 1S2KA 2FBEA 3SH4A 4XJZA 3OYWB 2PHDA 5F6KA 2O0OA 4N53C 1S0CA 2PAEA 3VL8A 1UIJA 3M3CA 2WLQA 3ECQA 5JIAA 1OFSA 1UU6A 5JI7A 2NM1A 1LCLA 2LUWA 4R52A 1OI6A 1SACA 1RUOA 1AVBA 2HWF3 3RS6A 4CEWB 2Z69A 2RS52 4Q1PA 4BH9A 5L73A 1PZ7A 3ELNA 5KC5A 5JAXA 2V5YA 1RUE2 4PLNA 4N43C 1WD3A 1RUC1 4FT8A 1OOPC 2BTVC 4LBLA 4XQDA 4XJ8A 2CGOA 4KNCA 5EYXA 1LOBA 4YVSB 1XRUA 3WX5A 3WINE 2AREA 3FBMA 1YLLA 4DY3A 5BNPC 1OKQA 4F83A 3IPVB 3LZZA 1ZNPA 1JBCA 2X5IA 3B9CA 1N1SA 2PYTA 3NV4A 3ZXJA 4LT5A 1PGL2 3UKTA 4LUKA 3VBSC 1EV13 3WQ7A 1FPN3 2QDRA 4COZA 4FXGB 4L2NA 3VZLA 1H4HA 4UBHA 4DNYA 2VVDA 4XBNA 4AHWA 2ATFA 2RHPA 2IXIA 3OPZA 2R063 3O7OA 4M01A 3SH5A 2HEWF 3AXDA 4AGGA 5CA6A 3GHMA 4NWWA 3WUDA 1W2UA 1IPJA 1CPNA 2XJVA 4FQZA 3IN9A 2C5DA 4Q27A 1O3QA 2EAKA 4Z82A 3FX3A 3IDBB 3OGGA 4GULA 4A3XA 4N7IA 5J37A 1EP0A 3CLPA 4ORFA 2ARXA 2E63A 4HN1A 1ULCA 4AK3A 1BYHA 1N1VA 4L11A 3NV2A 4CDWA 1C8NA 2UURA 4FPEA 4SBVA 2A3YA 1HRV3 3AZVA 1H9PA 1RL3A 2JKBA 4IV1B 4TYSA 1I3HA 4LTAA 3OCPA 3K51A 1YFUA 2RMU1 1H4GA 5JCTA 3S30A 5SV5A 3I2DA 2D5FA 4XF9A 5K0UC 4IL7A 2SLIA 4MX3A 1R1A1 2O8QA 1O5UA 2VMGA 4Y20A 4L8QA 3CJIA 3VL9A 1ALYA 2MEV1 4E2QA 4AI2A 2JG9A 3M8LA 3U11A 2HWD2 5KC6A 1J58A 3QCWA 2F6BA 4XFIA 4AFAA 3KQRA 1BBT2 1I1EA 4LE4A 4LO8A 5ABJB 5IK4A 3AB0A 3N7JA 1ZX5A 2BW8A 3EO6A 4NPRA 4YGEA 1H1IA 4P9GA 1C5IA 3EHKA 3VZMA 2PA7A 1RHI1 4QPGC 4RR3A 1RVF2 3PMSA 4Y1YA 5D1IA 1XNCA 1UN1A 1WMDA 1SBFA 1YO8A 4LULA 1GZWA 1Q8PA 4S2FA 4QPIB 4Q4W2 5JWPA 2EXIA 5T3NA 1LOAA 4PCRA 2A3XA 4EV0A 3J4UH 3RWNA 2ZMLA 3A0KA 4LO7A 1HDKA 3AZYA 4XE9A 1QJY2 4QPYA 3VBOB 5FREA 1FOD3 3R6SA 4SLIA 4AVSA 1OA3A 4MYEA 3WXPA 3FLPA 3VBHA 2VQ0A 1ZBA3 1WCKA 3HR9A 4GB31 5I91A 4PIZA 4RS5A 1NA1B 4YG6A 1RMU2 1VAKA 2PTMA 2Z42A 2HWE1 2MNGA 4IETA 3RDIA 2YUEA 3WP5A 1GNZA 1VIWB 1M4WA 3VDDA 2DFCA 3HAGA 1D2SA 1KDMA 1Y7BA 2DVAA 5BUVA 4AG4A 4Q8LA 4KG0A 4KGGA 3FWEA 3ES1A 2XVLA 2XWBB 4Q4V1 5DZEA 5IK8A 4MSVA 4G4FA 1ZVFA 3I59A 4P5HA 5ACA2 4OULA 2TEPA 2QKDA 2WT2A 3RYPA 2VUJA 2GAUA 2DFBA 2ZGKA 3NSTA 2VG9A 3JBG1 2CGPA 1CAWB 4U36A 3ZMNA 4LBQB 1CONA 3ZXFA 3ZFGB 5A32A 2YV8A 2Q4SA 4AVCA 4NWVA 2ES3A 2ZABA 1DQ6A 1F9KA 4JDNA 1AYM2 5GLTA 3FLTA 4XJWA 1QU0A 4P9YA 3J8F1 2ERFA 4MV2A 1VRH3 2DV9A 4XJUA 4META 4YG0A 1VBA1 2VY0A 1AR62 3MIGA 1DZRA 3ROUA 2YMZA 3TRSB 4XFAA 4TZDA 2UY8A 2X5IC 5DUVA 4QQLA 5KXCA 1HQNA 2ARBA 4FPKA 2W39A 1M06G 4R4XA 4GH4B 2QQPA 4KGQA 4AVVA 4UW5A 4UW6A 4WV8A 3VHPA 1C57A 4WVZA 1LHVA 1PO21 1RGSA 3M4FA 1IS5A 1RUG1 1CAUA 1RUG2 2V73A 4CDXB 2DUPA 4AGRA 1AR81 1RUC3 1UD1A 4WM8A 1ONAA 1XE7A 2DVGA 1YFXA 1QOOA 4WM7A 2TBVA 1SCRA 1IQAA 1ND3A 1WCDJ 2BNNA 2VW2A 3ASIA 5CBLA 1JXNA 3AFGA 4AXOA 2VNOA 4AEDB 4HT1T 4FTEA 1CAXA 5CIRA 5GALA 2RS31 3QACA 1NOVA 1XE8A 3ZYRA 3KMHA 3V0AA 1RUD1 5JDBA 1COV2 1X82A 2Q8OA 3PLQA 4NVPA 4GQ7A 4M3CE 4UBGA 1KD7A 3VKOA 3SLIA 1FI2A 2EXJA 2JX9A 5CADA 4QGLA 3LOBA 1N1TA 2DUQA 4YGCA 1RUNA 4RA0A 1S1AA 2JG9C 2D6PA 1AR92 1MVEA 2DCKA 5HCAA 1RUH2 4DZGA 3JD72 4ZU4A 3PVOA 3D5OA 1UF2C 5A3MA 2HKXA 3T1LA 2ZKLA 3E6BA 5DUUA 1T6GC 4A7YA 2ZGMA 5BNQA 4IEUA 4PBPA 4RR3C 3VZNA 1V6MA 1PVC2 3N35A 1VP6A 4YM2A 3NO8A 3ZXKA 1U5IA 1ASJ2 4KH9A 2HEYF 4ISRA 5JOXA 2CGNA 2GNTA 1SBEA 1REFA 4QD2A 2RMU3 1BXHA 4DRVA 4BOWA 1V6KA 3ZYGA 1L3JA 2B46X 1QJX1 1W39A 1ULDA 2D5HA 3N7MA 1R1A3 3VBHC 5BNPB 1H9WA 4JC1A 2IXJA 2KA3A 3FFQA 4RS5C 3AYCA 3HIFA 3PTYA 1REEA 1R082 1NYWA 1S55A 1VBE2 4IEXA 2JG8A 2NN8A 5JPMB 3JCIA 3AP7A 1BBT3 4HPKA 1Y43B 3ZMOA 3VDDC 3ACLA 4Q26A 3GBWA 1GLHA 3JU9A 3UK9A 3LA7A 1V00A 1VBD2 3IDCB 2A73B 3OD0A 5DUWA 3ZIWA 2A71A 1ULGA 4UW3A 1RHI3 1YJLA 1NCQA 1SLLA 4LHKA 5J36A 1SFYA 4J1WA 3N7LA 2YC0A 5BYNA 5LEKA 2PN5A 5EYYA 4XHXA 4AF9A 2QJVA 3I7DA 5BY5A 3AKQA 1PVXA 2LALA 1KITA 2VNGA 1MQTA 2WNUB 4RQPB 2E51A 5GZFA 4XIKA 1X8MA 5T5LA 4AFCA 1SLAA 4S2HA 4LO4B 1D4M2 2R072 2X8KA 4LLFA 2K2SA 4OHVA 4GB33 1LJ7A 1CAVA 4OHWA 1GQGA 2ZBJA 2K0GA 3KT4A 4Q1RA 3KB5A 4N90A 4LR4A 2PHRA 4FO9A 3J26N 2CAVA 3ZFFB 1RUF2 2R32A 3MIEA 1IKPA 3BU7A 3H3ZA 3SCGA 2DYCA 1WCSA 4CZSA 1Q8OA 1VBB2 4HKLA 3E97A 4BWOA 3LKJA 4Q4V3 3D0JA 1XNKA 2WC2A 3WDVA 4LBJA 3W59A 1S0DA 2D40A 1LOFA 2A70A 3S7EA 4JGYB 3ENRA 2FMYA 3E6DA 5JZGA 4Y1XA 1EV11 1ZZ7A 2D6OX 4A2UA 4HVOA 1FPN1 1O3SA 1W6PB 3B02A 3JBG3 3SXWA 1LKNA 1MEC2 3DKWA 1NXMA 4IESA 3WW3A 1D2QA 4WVVA 2YPJA 5GZGA 3M3OA 1LU1A 2BVBA 4X6RB 4R9CA 2BGCA 5TSWA 1C8M1 4XFBA 4CEYB 3H3UA 3PVNA 4COYA 4AVBA 4WM8C 4JRAA 1WLCA 3J8F3 1AR71 3KCXA 4UXAA 4WM7C 4KL1A 2HWC1 1BJQA 1WGPA 1ND3C 3L2YA 1V6JA 3AYDA 1VBA3 4R9AA 3ZFEB 2VNRA 1H2LA 5AFBA 1AR63 3MF9A 5D8AA 4GKYA 1V9U1 4OI1A 2BBVA 3OY8A 2FZ2A 1KS5A 1KFXL 1HRV1 4ES8A 3H7YA 5B2GB 3WW2A 1AYN1 4YZ3A 4YFZA 2R49A 1H8TB 3BCWA 3VBUB 4XOGA 1SLIA 5E1RA 3VKLA 4FVVA 1QDCA 1ZA4A 4FP2A 1LGCA 1QF3A 3AYAA 4LLOA 3BB6A 4QQ2A 1O3RA 1F2NA 4Q4Y1 3TAYA 1PO23 2JE7A 1RITA 1RUG3 1VBC2 5FRAA 3MGUA 1IS4A 2OYZA 4CDQB 4C90A 2BNMA 1AR83 1S0IA 5GKAC 3VHOA 2B45X 5EWSA 4LBMA 1BEV2 3POWA 3M2MA 2LTNA 5C9AB 1AXZA 4XZPA 1LU2A 2QFEA 1C1LA 4BM8A 1ZRRA 2WT1A 4FAGA 2ZPXA 4HETA 4NO4A 2EXKA 4Q4X1 4YVWA 2NP0A 1G6NA 4XF4A 2AZ5A 2GNMA 2RS33 3ZIXA 4HVQA 4EN6B 2WIIB 2DVFA 1RUD3 1FX5A 1AZDA 2A6WA 4AI1A 5LK7B 3NW4A 4D3WA 2DCJA 3CL1A 4LA2A 2UYAA 4FOWA</