4JGYC

Crystal structure of human coxsackievirus a16 uncoating intermediate (space group p4232)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
236
structure length
231
Chain Sequence
GIPTELKPGTNQFLTTDDGVSAPILPGFHPTPPIHIPGEVHNLLEICRVETILEVNNLKTNETTPMQRLCFPVSVQSKTGELCAAFRADPGRDGPWQSTILGQLCRYYTQWSGSLEVTFMFAGSFMATGKMLIAYTPPGGNVPADRITAMLGTHVIWDFGLQSSVTLVVPWISNTHYRAYFDYYTTGIITIWYQTNYVVPIGAPTTAYIVALAAAQDNFTMKLCKDTEDIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Picornavirus uncoating intermediate captured in atomic detail.
pubmed doi rcsb
molecule tags Virus
molecule keywords Polyprotein, capsid protein VP1
total genus 38
structure length 231
sequence length 236
ec nomenclature
pdb deposition date 2013-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4jgyC00
4GB31 5D8AC 5GKAC 1VAKA 1RUF2 4AEDC 3DPRC 4FTEA 1WCDJ 1HX6A 4N53A 1R083 1FOD3 5BNOB 4Q4X1 2RS31 4IV1C 4Y4YA 5D8AB 1HRI3 4N43B 1VBE2 3DPRB 1FMD3 4GB32 4EJRA 1VBC3 1QJX3 2MEV1 5BNOC 1RUD2 2HWF1 2RS11 4GMP1 2WZR1 1QJX2 1QQP1 2WFF2 1MEC3 4CDWC 1AYM1 1K5MB 4JGYA 4IV3A 3CJIB 3FBMA 3JB8A 3NAPB 2FZ1A 5L7OA 1ASJ2 1QQP3 1OHFA 3ZFEC 1AR91 5C8CA 2WZR3 5CFCB 4CDWB 1PGW2 3ZXAC 2HWF3 1NOVA 4YVSB 3IDEA 1K5MC 1QJY3 2WFF1 1M06G 1OOPA 3VBOA 1RUD3 1QJX1 3CJIC 4Q4W1 1E57A 2WZR2 2RS12 1F8VA 2HWF2 5A33A 5A33B 1RUD1 2MEV2 5CFCC 1PO12 4IV1A 3VBRB 4YVSC 2X5IC 1OOPB 5DDJ1 1VRH2 5ACA1 5BNNB 1R1A2 1VBE1 1V9U2 2RM23 1GFF2 3J8F3 1RUJ3 2RS32 1TMF1 3VBFA 4Q4X2 1AL23 4RHV1 1SMVA 1HQNA 1RUC1 5L7OB 2XPJA 1RUI2 1RUE2 1B35C 1NA1C 4SBVA 5FMOL 5BNNC 1RUF1 1DDLA 2HWC1 5K0UA 3VBUC 4BCUA 5K0UB 2XBO3 2RR11 4RR3C 1AL0G 1PIV3 4CDQC 1OPOA 1Z7S3 1VBE3 2RM21 1FMD2 4AEDB 5DDJ3 2RS51 1H8TC 1AR81 1NA1B 5ACA3 1NCRB 4FSJA 3VBFB 5CFDA 1COV3 2RMU2 5C4WB 1BBT2 1R082 5C9AA 4Q4V2 3TN91 1HRV2 4CDQB 5D8AA 1FOD1 1POV3 1H8TB 2QQPA 3VBRA 1QJY1 1BEV2 4Q4Y2 1NCRC 1EAH2 3VBSA 2ZTNA 1F2NA 2XBO1 1AR93 1X36A 1EV13 1BMV1 2IZWA 1VBC2 3JD73 1AR62 2HWC3 4PDWA 1PO13 1VBA1 2TBVA 4JGYC 3ZFFA 4YVSA 4JGZC 4GH4B 2WS93 1VBD2 3JD72 1AR63 2WS91 1CJDA 2HWB1 4RQPB 1ZBE1 1RUJ1 1AR72 3NAPA 1RHI2 1AL22 4CDUC 2HWE3 3NAPC 4RS5C 1K5MA 1RUI3 1FPN1 1HRV3 1RUE3 4JGYB 4JGZB 2PLV2 1AR73 1RUH1 1C8M3 4JGZA 2HWD2 5JZGC 3TN93 1ZBA3 4CDUB 1NCQB 1HRI1 5BNPA 1C8M2 4LLFA 5LK7B 1AR83 4GH4A 2HWE1 2R042 2RS53 3ZFFB 1PGL1 3DPRA 5JZGB 4Z92B 2R071 2X5IB 1ND2A 1PVC2 4WM8B 4PDWB 1NCQC 1RHI3 4QPGB 1V9U3 3VBSB 1R091 4QPGA 4GMP0 3ZFFC 1PO21 1MEC1 5L7OC 1Z7S2 4WM8A 1RVF3 2X5IA 4FTSA 2HWD3 1EV11 1NY72 4WM8C 4PDWC 2ZAHA 1NG0A 1ZBA2 2RS13 3J8F1 4N53C 1QJU1 4RR3A 1VB4A 3VBUB 5CFDB 2MEV3 5K0UC 2R062 1TME3 1NA1A 1HXS1 4Y5Z0 4AEDA 1HXS2 1RUG2 1D4M3 2R061 1VBB2 3J8F2 2BPA2 3M8LA 5AC92 1TME2 1ZBA1 5ABJA 3VBFC 1NY71 4NWVA 4Q4X3 5CFDC 4Q4W3 5C4WC 3LOBA 1D4M2 1RMU3 5A32A 1COV2 1Z7S1 4CDXC 1PO22 1PIV1 3JBG2 1QJU3 4CEWB 4RQPA 1RMU2 1RVF1 1ND3A 1PVC1 2R072 1AYN2 5BNNA 3VBOC 2GH8A 4CDXB 1PGL2 1R093 4CEWC 2Y26A 1MQTA 2HWE2 1TMF3 1RUG3 1MQTC 4GH4C 2R073 4QPIC 1HRI2 1VBD3 4RQPC 1H8TA 4GMP3 1AYN1 3VBHA 3VBOB 1X33A 4CDQA 1ASJ3 5BNPC 1RVF2 4RS5B 1POV1 5C9AB 3JBG3 1RMU1 2PLV1 5CFCA 1EAH3 5C4WA 3JB4C 1FPN2 4QPIB 5FMOS 3ZFGB 5J98B 1NCRA 2PLV3 3JBG1 1PIV2 1COV1 4QPIA 1AR71 1ZBE2 1D4M1 2HWB2 1VB2A 2RS33 4RS5A 1QJZA 1TME1 5C9AC 2WS92 5AC91 1VBD1 4YVWA 1W39A 1VBB1 3VBHB 1BBT3 1ZBE3 1VBA2 1RUG1 2HWB3 4GB33 1AR61 1R1A3 1BMV2 2GSYA 2XBO2 1QJU2 1VBA3 1BEV1 4Q4Y1 4QPGC 3VBSC 4CDXA 4FTBA 1EV12 3VBHC 2BUKA 1FOD2 1MEC2 4N43A 5ABJC 1BBT1 2RMU3 1VBB3 1R092 4IV1B 1AUYA 5AC93 2WLPA 4Q4V3 5C8CC 4N43C 4N53B 1AR82 2R043 2RS52 1FMD1 5J96B 5A32B 2RM22 5FOJB 3HAGA 2ZZQA 4RFT0 2R063 5ABJB 2R041 2RR12 4YVWB 3VDDC 2HWC2 4CDWA 5C8CB 1C8M1 2WFF3 1RUE1 1RUI1 3ZFGA 3VBUA 2HWD1 1RUC2 3CJIA 4RHV2 1TMF2 4IV3B 1RUH2 4YVWC 1ND2C 3VDDB 1V9U1 1VRH3 1R1A1 1RUC3 1VRH1 5DDJ2 5ACA2 1AL21 4RHV3 1POV0 2FZ2A 1RHI1 1ND3C 1RUJ2 3ZFEB 1PO11 4CEYC 4IV3C 3JD71 4CEYA 1ND2B 1MQTB 5JZGA 4Q4W2 1ND3B 2DF7A 3S6PA 1VBC1 1A6CA 1PGW1 2BBVA 4CEYB 1AR92 3VBRC 1EAH1 5BNPB 1NCQA 1IHMA 4CDUA 1OOPC 1QJY2 3ZFEA 5BNOA 2BFUS 1RUH3 1ASJ1 4CEWA 3ZFGC 1AYN3 1FPN3 1HRV1 1HXS3 2VQ0A 3TN92 4Q4V1 4WM7C 1R081 2WWSA 1AYM2 2BFUL 3VDDA 2RMU1 1B35B 2RR13 1QQP2 4WM7A 1AYM3 1RB8G 1CD3G 1PO23 1RUF3 1BEV3 4Q4Y3 1C8NA 4WM7B 1PVC3 4RR3B 4NWWA 1B35A
chains in the Genus database with same CATH superfamily
2VVEA 2TNFA 5FZDA 5FK8A 4AI1A 1MS0A 5FPAA 1UW8A 3HQRA 1RUF2 4AEDC 4ZY9A 5FREA 4KQ7A 4QXBA 4EQVA 1HX6A 3RZKA 4N53A 1JTZX 1STMA 3WG1A 4RSUA 4R9BA 3WNNA 4NRPA 4DMIA 1IG0A 1UWWA 1YI7A 4QX3A 5A3OA 4IE5A 4E9KA 1HRI3 3VZOA 4BISA 4GIQA 4YZ2A 4A4AA 3VHPA 4Q27A 1FMD3 1VP6A 5LEKA 4YM3A 1GANA 1NUKA 1AJOA 4OHYA 2B5HA 4GJYA 2DU1A 3BVCA 5FY4A 4JVAA 4QQHA 4YW4A 3J26N 4FCAA 2Q30A 4KNCA 3DECA 4YM2A 5JMOA 4MGSA 3UNPA 4HG6B 4XJUA 5JPMB 2K46A 3HNYM 1S0CA 3NNLA 4LBQB 3C7FA 5GLUA 3POEA 4UOJA 5FP8A 3USUA 2PFWA 4QXKA 5FYVA 2EIGA 1CIWA 2E51A 2VE1A 1UOFA 2GH2A 1OD5A 1CESA 4YG3A 1QQP1 1Y9MA 3V56A 1RUNA 2D97A 3SQOA 5FZBA 3I3DA 1OH3A 1HQLA 3ILRA 4JGYA 4TXWA 4ZZ8A 3GM8A 4GJZA 4XIKA 3MFAA 5F37A 3CJIB 3FBMA 4PBPA 5F39A 3S5QA 3AMHA 2Y6LA 2YC0A 4YGBA 5L7OA 3C7HA 3O1RA 1YIFA 2FD8A 1XRUA 3K2OA 4G3YC 5E1RA 2D43A 2P3IA 1HJGA 1BK0A 3A0NA 4J6GA 5A1LA 1YQCA 1TQ5A 4Y3OA 1GOHA 1Q8PA 1WLWA 2XGXA 4C1XA 1PGW2 1KDKA 4ASMB 4LMFA 1PVXA 2HWF3 1DQ2A 3AJYA 1ZZ8A 3IDEA 3SISA 1QHDA 4DOUA 1EY2A 5BYNA 4UFLA 1M06G 1QJX1 1TEIA 2AENA 3SEEA 2CU5A 1O4ZA 4KWUA 4XABA 3KCYA 1QXJA 1UKRA 2JDKA 3SEPA 1WCKA 4V1PA 2WA3A 1UY2A 3I7DA 1KS4A 3VLBB 1NZCA 1OQDA 2DBIA 3LSDA 3WNXA 4IV1A 2WC2A 1V6NA 1QIQA 2DTYA 2VY0A 5LA9A 3VBRB 3VL9A 5IVVA 5K8SA 2Y38A 1O3RA 1KJRA 4XAEA 5I93A 2QQJA 5DDJ1 5D1IA 3KT7A 4AAXA 5CADA 3NRUA 5KHHA 4BA6A 1NLQA 5LA2A 1CJPA 3MF6A 1TVGA 4ZU7A 2VGDA 1LEMA 2RS32 2XJPA 1HQNA 1TE1B 1JYIA 2YY1A 1O5UA 4ASLA 1RUI2 3NNFA 4KBZA 2O8QA 2Z5WA 2JDMA 3U0ZA 1JXNA 4XBNA 4IGOA 5FMOL 3IDAA 2Z79A 2YU2A 3MIFA 3VKMA 1SCSA 2ZOEB 3BN6A 4XW3A 2A71A 5K0UA 4XVHA 4OZOA 2XBO3 2RR11 3WINE 1F5FA 2WN2A 2GC0A 3VD9A 2EXJA 1AL0G 4M3CE 2ZABA 1SDDB 3SKJE 1OPOA 4ZS3A 4CCEA 4DEQA 2O1QA 4LBQA 3M3OA 1FMD2 1JUHA 1AR81 3AP6A 2VQUA 2BNOA 5DN2A 1DZQA 3P3NA 5GZEA 3VBFB 2WN3A 3KCXA 4W4ZA 5DG1A 1J3PA 1URXA 2RMU2 5ISLA 5FMBA 1ZZCA 1R082 4YFZA 4Q4V2 1QEXA 2PQSA 1XE8A 2J1AA 2BGOA 4X6QB 3CBNA 4JRLA 1HRV2 3RSJA 3TN91 5D8AA 4D8MA 4WVZA 5KXDA 3APBA 1POV3 2JDPA 5FY1A 4Z2AA 2EIBA 1W6OA 5GLVA 1S0JA 1WMDA 1V6JA 2W08A 3OJBA 3ZXJA 4BIOA 3OGVA 2XBO1 2A1XA 1X36A 1EV13 3KSCA 3UGFA 1JZ8A 4FPFA 1VBC2 3RNSA 2HWC3 4QHBA 2D7FA 1JW6A 2VVFA 3I2FA 1OLQA 4KMQA 3UGGA 1GWMA 1PO13 1K12A 1REDA 3HOBA 1PHMA 5A6XA 3SH3A 2MNGA 4COZA 4JGYC 4OHWA 4I0BA 4EWAA 3ZFFA 3QLQA 4P9WA 4DB5A 3A22A 4Y26A 1Y43B 4BQ5A 4X8NA 3QCWA 1GP4A 3LWCA 3GNEA 3E5QA 1F5JA 2HWB1 3LCPA 2VZPA 5FZOA 4C1WA 2PA7A 1UZZA 2XXZA 4C0HA 2LM3A 2IXLA 2YHJA 3BOPA 3PHMA 4OQ9A 1HLCA 1ONAA 5BY5A 3PNAA 1LOFA 2V5DA 4UW5A 1A78A 2PXJA 1HRV3 4GKYA 3K3OA 4RL7A 4YM0A 1ENSA 2XKPA 2VPVA 1YHFA 2Y0IA 4YW1A 4XJ9A 2ZAAA 3I4IA 3E6DA 4JGZA 4AFBA 2HWD2 2B9UA 3WR0A 3PVBB 4IE0A 2GN3A 3TN93 3USUB 2W91A 5GZGA 1F15A 2AC1A 3WY6A 3GGLA 1LKNA 1GUIA 2PHWA 1ZA4A 1AXKA 1Q3EA 2PYTA 3CLPA 3GZEA 3L2HA 3MUY1 4QGLA 4AEKA 5A3UA 4PJYA 2D5HA 4L2NA 3K4ZA 2BW8A 1XNCA 3ZSEA 1DGWX 1C5IA 3WP5A 2R042 4DQAA 5C3OA 5A3WA 1LJ7A 4UFJA 5KHIA 1EP0A 1PGL1 2Y64A 5JZGB 2R071 5T5JA 2C26A 4CA9A 1AX1A 3BOWA 5C6CA 3OBZA 3KQ4B 1UY1A 1NCQC 4PDWB 5LY2A 1LHNA 4DUVA 4HETA 2J1TA 2ZHKA 3U75A 1EUUA 4FT8A 1V9U3 4IDZA 1R091 3VBSB 1YFUA 2VMDA 5FYYA 4GMP0 2W47A 4LKFA 2ZGLA 2MPFA 1GMMA 2DDUA 1MEC1 2RDSA 3H42B 4DY5A 1US2A 2QNKA 5DMYA 4TTGA 3LPGA 2HWD3 2XHNA 1NY72 4LO6B 3KVBA 4K3UA 3S0MA 1SLAA 1NG0A 4YGDA 5FZ4A 5JXJA 4NAMA 4QKFA 4U36A 5CIRA 5CFDB 2BDRA 2R062 2HEYF 2DTWA 1NA1A 3OEBA 3OUIA 4MX3A 4AEDA 3NL1A 4C91A 4CUCA 1HXS2 2ZHLA 5A3LA 1XPWA 2WNUC 5LW9A 1OFNA 2Q0AA 4DUXA 3UKVA 3V0BB 4O65A 3RS6A 5AFBA 4PHZA 4B3NA 3SCFA 3M8LA 5AC92 1ZBA1 4IEYA 3KVAA 2GNTA 3S7EA 2XQXA 4NWVA 1F35A 3LA3A 2QDRA 2YBSA 2ZEYA 2C4XA 4Q4X3 4Y1UA 4BM8A 4C90A 1RMU3 2LUWA 1RTVA 3ELNA 2WO3A 4X6RB 1COV2 4QX5A 4CDXC 5AFEA 4LR4A 1PO22 3IPVB 1CGPA 4D7YA 5FXXA 3ZN6B 4IE7A 5SV8A 2UYBA 3HNMA 1H6YA 3LF7A 4PF1A 4UW3A 5H9SA 4LUKA 4ARYA 4TLGA 4XFIA 3VV1A 5FYCA 4RQPA 5E8AA 3MEPA 5DAVA 1YXWA 2VMHA 4A7ZA 1YYNA 1ND3A 3BCWA 1W6PB 2YXSA 3R4DB 4OUMA 3UYJA 2YYOA 3MIGA 4L9BA 1HB4A 1DQ0A 1VMFA 3VBOC 2JE8A 3C7EA 1OQEA 3T30A 3WQ1A 1VMJA 2BNMA 1W2NA 1N3OA 3VKFC 2XLFA 1UO9A 4FPKA 1W6QA 1Q43A 4XXPA 2PMWB 4NROA 3A23A 1MZFA 4NPMA 3OUJA 3S57A 1VBD3 3LIGA 4RD7A 4RQPC 4UFIA 1EUTA 4Q26A 3INAA 4ZONA 1WMEA 5D2AA 1ZRCA 3IMNA 1CIYA 4Q5OA 5A1AA 5EWSA 5CFCA 3D4KA 3WNOA 1W03A 3JB4C 5FK7A 3OPZA 3ITQA 4IW3A 1UXZA 4KG0A 3ZFGB 5FV3A 2DUPA 4X8PA 1Z0HA 2BTVC 4XOGA 5CU1A 4DS0A 1O3TA 4I3PA 3MV01 3MPPG 1JYXA 3ZVXA 1COV1 4PLOA 3RZHA 2NLRA 2FCTA 1W04A 2N7GA 3LKJA 2LTNA 3S7IA 3T1LA 3R6SA 3SNMA 4ZPIA 1QJZA 1TME1 4A42A 1IZ3A 2WS92 1VBD1 4BQ2A 5AC91 1N1VA 2OVUA 1IS5A 2VC9A 3BTYA 3IDBB 3W20A 1ZBE3 4E27A 1RUG1 2JIJA 4NPLA 4B4PA 4EV0A 1GZWB 4M00A 4A7YA 1UKGA 2KD7A 4CCNA 1SZBA 5FZIA 1L7RA 4LKDA 1BCXA 5FZ6A 3MBWA 2C0ZA 2GNMA 2V72A 4URTA 5JVVA 3WW2A 1VBA3 3DXUA 1KFUL 4Q4Y1 2ZACA 3ENRA 1W2AX 3NJZA 4QPWA 2XMLA 1GBGA 2P3KA 3R4SA 4QPGC 3VBSC 3OSDA 4WBBA 3VBHC 3CQOA 2I45A 4D0QA 2W95A 1W6PA 4UYBA 1MEC2 5EIYB 1CN1A 4P14A 4XXAA 4NIHA 4BMBA 3VD4A 1BXHA 2VOXA 4HK8A 1XNDA 1G8WA 4IV1B 5AC93 1LU1A 1NAEA 2YPDA 3IN9A 5HCHA 2JDHA 3KD4A 1LAJA 2J42A 4Q0QA 5C5TA 1S2KA 5A32B 2L9LA 3LEMA 1Y3TA 5DZEA 1W28A 2QJVA 3I54A 3TEXA 4N7IA 3LOIA 3WNLA 4A45A 3PUIA 1JODA 5ABJB 1G9FA 5GLWA 4YVWB 4COYA 4EE2A 4KGQA 1DQ5A 1JOPA 4AL9A 5IK4A 3ON7A 3WF3A 3DF0A 5A6ZA 3WF2A 4TZDA 3RYPA 4M3CA 3Q8CA 1SLBA 5FYTA 5CB7A 3O7OA 5EPAA 2J1SA 3UV9A 4ISQA 2W2IA 5F9TA 4LUMA 3KV4A 5FP3A 3UESA 4A7KA 4HBNA 4MSVA 2HWD1 3T4VA 2XUEA 3LQCA 4E4ZA 4NHMA 3N3HA 4HPKB 1JYWA 3H8RA 3LEKA 4KU8A 1LOFC 1DGRN 2ZGMA 1C1LA 2VOKA 4O7XA 5B4XA 1UX7A 5FY0A 4YSFA 3TAYA 4JCKA 1YRZA 5GZDA 1V9U1 3O0XA 3N9NA 1R1A1 1S0EA 5A7QA 4GKXA 4KGGA 3FFZA 1POV0 2Y6FA 1OD3A 4QMAA 1JZ4A 2AR6A 1QMJA 4GWMA 2PELA 4W6WA 2VULA 4XF4A 3W5NA 2CY6A 1W9WA 3MV11 1IGOA 4L92A 4MXVA 1DF0A 5C3QA 1GOGA 5JZGA 2ZEXA 5IHRA 2Q5TA 4CVUA 4K20A 3PL0A 4FXGB 3I3QA 4B4RA 1UNBA 1ND3B 1SPPB 4P9JA 1D7PM 4EN0A 5BV6A 4AXOA 4DXTA 4TSVA 4L11A 3CMGA 3IDCB 4CCKA 2YDEA 3WDYA 3ACFA 1UZWA 3O1PA 1CAXA 1IHMA 3FZ3A 2VUJA 5FYZA 1CR7A 2G19A 1MS4A 2BFUS 1YFXA 2JD9A 3NMBA 3ZFGC 4FI9A 1HIXA 4YW6A 1AYN3 5JOWA 4G9SB 1BVP1 1E5RA 1LTEA 1QDCA 2R0HA 3TN92 5A6QA 3NKTA 3BKZA 3IB3A 4XJWA 1UU5A 2W1QA 4JDMA 2O8OA 1AYM2 1F31A 3B69A 3T2PA 4A44A 1YQ6A 1LULA 1N47A 2JXAA 4HPKA 4QXHA 4BQWA 5FO7B 5CKQA 4FOWA 4COVA 3PIJA 2WAAA 1UQXA 2VJXA 4BQ1A 3KHCA 1KITA 2JB8A 1H9WA 4CUAA 4EN8B 1RB8G 4LXLA 1CD3G 4HONA 1RITA 1RUF3 1BEV3 4N7UA 2ET1A 3ZXDA 1C8NA 2W9XA 1QKQA 1W3VA 2VUCA 2RV9A 4RR3B 4XTPA 4NWWA 4Y1YA 5FY8A 1UZYA 3RG0A 3WDVA 4Q1PA 4R4ZA 4XUNA 4L97A 4R4XA 5EXOA 4P00B 2FMYA 2QTWB 3JUUA 5D8AC 4MHRA 1C28A 1VAKA 2J22A 3OGRA 2I2SA 1ZZ6A 1WCDJ 2AREA 2EALA 2HEWF 3OUHA 4LKSA 3QH6A 5G04L 2I07B 3QD6A 2VUDA 2AEZA 3RWKX 4GALA 2NP0A 3D6EA 2QQIA 1O7FA 2ARCA 2PHDA 3SMHA 1LOAA 3PUQA 1T6BX 4IV1C 5IATA 1XJAA 2E26A 1NKGA 2ZGOA 1LOBA 4LBQD 4N43B 1VBE2 1RJ8A 3DPRB 3VUOA 2NMOA 3KV6A 5FQ0B 3AKRA 3L9JT 3FUQA 3NV1A 4L8QA 4AF9A 1RUOA 4GB32 1I5ZA 2YPJA 2ZHNA 4DEVA 1UD1A 4F7ZA 1WW7A 3LA2A 1J3RA 4Y5TA 2BBAA 4OULA 2YC4A 1POQA 5IK8A 1OPMA 2Q1MA 3N4MA 4GMP1 2DCKA 2K2SA 4QT6A 4QB2A 1ZYBA 4LA2A 2XVKA 4LHLA 1X9TA 4QX1A 1CZVA 2WFF2 3SCGA 2ZZJA 3E5UA 2WWUA 4CCCA 3AZZA 3BPZA 5IVYA 4YYOA 2P37A 2ADDA 3LPFA 3BTAA 3N9QA 1JOBA 2D44A 5DUVA 3WT3A 1LENA 3PVEA 4JTNA 4PF5A 1W0PA 5E6HA 5F5CA 5I91A 3NV3A 5C33A 5F6KA 4ZU4A 4D6RA 1WMFA 5FKCA 2VW1A 5JSRA 2ZX1A 3JB8A 2W94A 3NSTA 5K9YA 2DFCA 1CX1A 1ASJ2 3EBRA 4C0BA 5JR2A 3B00A 4NVPA 2BGCA 3KF5A 4K8RB 4HXCA 4FOVA 2OT7A 4YG6A 3U11A 5B2GB 3POIA 3BTZA 1AR91 2ZGKA 5C8CA 1LHWA 1WW6A 3SLIA 4IEWA 2HYXA 3ZXAC 3NV4A 3WG3A 2WFF1 2BERA 1CPMA 3OY8A 3U07A 1O5LA 1ODMA 4AFAA 3OGSA 5A7SA 1KD7A 2TEPA 4I0AA 1LGNA 3M4FA 3HMYA 4XC9A 2Q8EA 2HYKA 3K4DA 1D0HA 5SV5A 1JYVA 1F8VA 2XDVA 1H30A 5LRRA 2JKXA 1OFSA 1PO12 3G6JB 5CG9A 1W6QB 5LWBA 1M4WA 1HN1A 3EXUA 3VHOA 2RJ2A 1UX6A 1VRH2 2DV9A 2X29A 3LDRA 2JX9A 4NE9A 1VBE1 2RM23 5A3TA 5K7PA 3DCQA 4S2FA 4YW2A 2YG0A 4ZXKA 3POYA 1H2NA 5FXWA 1Z78A 1XNTA 1W6MA 2VVDA 2A3WA 3VBFA 1QXRA 4RHV1 1UAIA 3TWIA 1RUC1 5L7OB 2H6BA 5IAXA 1UOGA 2V4AA 2LALA 1B35C 4I09A 1B09A 4NR1A 2HBTA 4P5YA 1WUVA 5BNNC 4NPRA 1RUF1 1CAUB 3GBGA 2A5ZA 5T50A 3BALA 3WP6A 1NE6A 5M0TA 3A0KA 1H1AA 1QOOA 4RR3C 1XOYA 5A1FA 5JUVA 3VZKA 3PJQA 4Z8BA 4QGNA 2ZEZA 1VBE3 2RM21 5FPBA 5CISA 5DDJ3 1H8TC 1RXFA 2AACA 4KG8A 5CFDA 3AZVA 3GBFA 3T2TA 4Y4RA 2RHPA 4JQTA 4YWAA 1QJEA 1UY3A 2VZVA 4IERA 4JDOA 4AGGA 2BWAA 2DVBA 2BVVA 2WO1A 1OMIA 3N9PA 2JG8A 3W58A 2E7TA 3M3CA 1NCRC 3U78A 1PK6B 3WVJA 3VBSA 4LJHA 5FUNA 4COUA 1F2NA 1AR93 1GSLA 1SLLA 3W9AA 4IETA 1BMV1 4FFFA 3Q8BA 2JIGA 4KI5M 1DBNA 2QBXA 1XXNA 2E53A 5HPOA 4YARA 2TBVA 5DPNA 2WQ4A 2Y60A 2RJLA 4CZSA 1JZ3A 3K46A 4YVSA 1NYWA 1W06A 4XZPA 1LODA 2EICA 3POWA 1OVPA 4XFGA 2JICA 1U0AA 3FFQA 1W2TA 3JCIA 1TZOA 1I3HA 4H7MA 4XF3A 3M70A 3ZXEA 1OLRA 1S2EA 1IS3A 4XTMA 4RQPB 3RWNA 5GM0A 3WHTA 1GNHA 2JDYA 1RUJ1 3H7JA 3W21A 2YMZA 4LQRA 1UMIA 3IZOA 2VW2A 2FDGA 3MLKA 4I2OA 2OUHA 2ZX3A 1JBCA 3EO6A 5I0TA 1OA2A 4HVOA 3X29B 1K5MA 1DHKB 3WUDA 3ZYPA 2XJVA 2PLV2 1UY4A 1AR73 3B7MA 2GP3A 3WNPA 1LHUA 3U37A 3UK9A 4R8HA 1K3IA 4E8CA 1PMIA 3HBKA 4QDQA 1IKPA 1CZSA 1G6NA 3FLPA 1VAMA 1YUDA 4AQ6A 3T1MA 4QQPA 5LEJA 3RZLA 2JEMA 1IG3A 1MR5A 2C6SA 2QQKA 3GHNA 3AZXA 2EIDA 1NCQB 1DGRA 5CA6A 3ZLIA 1C8M2 3JQXA 4XACA 2F4LA 3PURA 4LLFA 5H9PA 2VCCA 1GQHA 1TNRA 2BGPA 1AX2A 3I2JA 2B8MA 1J58A 4OCTA 4D69A 1AR83 2FDFA 2RS53 1IPJA 1LHOA 2YU1A 4XUPA 4Q0UA 1LEDA 3NQHA 5L9RA 4W6YA 4FPGA 4B1LA 1ND2A 1BHGA 2TUNA 5DABA 4YW7A 3A4UA 1SBEA 1ULFA 1JHNA 2DUQA 5LBEA 4E4DX 5FZMA 3TEYA 3GYDA 3H3UA 4QPGB 1SHWB 3ABZA 1PK6A 5D21A 4Q0VA 4Q8KA 2A6YA 3M3QA 4KU7A 5L7OC 3LFMA 1H2LA 2WNUB 4XJZA 1N1SA 2AGSA 1MZ5A 2HLEA 3OEAA 4WZCA 5FZ0A 5FZEA 3VHRA 4WM8C 1ZZ9A 1N1YA 3KMHA 4BMEA 1LESA 5EQUA 4QQLA 4LA3A 2RS13 3TNPB 3ZM8A 4MOAA 3FJSA 3NJYA 3ZIXA 4QU1A 4QX0A 2PTMA 2MEV3 3ACGA 2WZEA 5C3PA 2WNEA 4LBMA 4RA0A 4AVCA 3AXDA 1FYUA 4LULA 1FXZA 1RUG2 1V0AA 2RE9A 3FUOA 2WNVC 1GV9A 1U12A 3THCA 3LSEA 1OLME 3J8F2 2BPA2 1HB3A 1OT5A 1RIRA 1GWLA 1H2MA 1TME2 2P5BA 4OMDA 4PIYA 1A3KA 4QB6A 2P17A 5ABJA 4IEUA 2V09A 3WDTA 1HW5A 1EPZA 1HV1A 4FFHA 4Q4W3 5ERLA 1D4M2 3I59A 1J84A 3KV5A 4AE2A 1Z7S1 2I74A 3WEZA 2HKXA 1H9PA 5FYIA 3ZIWA 4CEWB 1AXZA 3BU7A 3TNQA 4N8MA 5FZ7A 4BE3A 2R7EB 2JDAA 2W92A 3ASIA 3GZTB 3T4HB 4QU2A 5F5QA 2ZGUA 5GZFA 3VDCA 2WUHA 5TSWA 2FDIA 1DYPA 1SPPA 3ES1A 2YGMA 4EROA 1J1LA 2OZ6A 4M0NA 4NHLA 5J37A 4ZXEA 1OLMA 3IKWA 5BNNA 1WWYA 3OF1A 1VR3A 3LDKA 4FPJA 5KBFA 4YGEA 5JOYA 3WQBA 1NX9A 1GP5A 2WA4A 1HQWA 1X82A 1TMF3 2RG4A 1XYNA 3AK0A 4LO8A 1RUG3 4OVEA 1DYKA 2P3JA 4LKEA 3M3IA 3PTRB 1C3HA 1RXGA 1ULGA 2R073 3MUZ1 4K7JA 2EIEA 4R9AA 1E5IA 1HRI2 1RL3A 4AW7A 5CBLA 2UU8A 5FYBA 2GALA 3KCCA 4QQ2A 1W8NA 5HCBA 1H8TA 3VBHA 2XHKA 4QB1A 4UWDA 1X33A 1OA3A 1ASJ3 4CCLA 3GHMA 2ET7A 4XFBA 4E2SA 3KT4A 4BQXA 1UMZA 2KXLA 1RMU1 1SLTA 2PLV1 3BGAA 5IUQA 1JZ2A 1EAH3 1NXD1 1S0FA 5C4WA 1L7LA 4DNYA 1VPHA 1FPN2 4XUTA 3LEGA 4QPIB 5IJRA 2Q8DA 4N9HA 4HT1T 5DUXA 5HBAA 1W8OA 3ILNA 5CEHA 1MS8A 1PIV2 3B01A 5H9QA 5T52A 5EP9A 5IVBA 1AR71 2WABA 4QWNA 1ZBE2 3O1UA 2XONA 3ACIA 2VZRA 1VB2A 3E6CC 1FNYA 4P08A 4DUWA 1VBB1 3VBHB 1BBT3 2QUOA 3PU8A 4K1ZA 4GZ9A 2VMFA 5KHKA 1VBA2 1W8FA 2HWB3 5F3IA 1NQDA 2O0OA 5CKNA 2X53S 4HN1A 3Q8EA 1I6XA 1SLCA 2G9FA 4H2AA 4AWDA 5A70A 1GR3A 1BMV2 3RRDA 1U5IA 1V00A 5JSPA 3WDXA 4Q2FA 5A80A 4FTBA 5FYUA 4CP2A 1GP6A 2Y34A 4QX2A 2BUKA 4WVMA 3KQRA 3DGTA 3FN9A 4I01A 5CYYA 3WF4A 2C5DA 4B8EA 3J7MA 4I3GA 5IVCA 5KR7A 5ABJC 3AP5A 3CNAA 4NO4A 4V2WA 4GWNA 3ZYIB 1DQ6A 4FFIA 4E4SA 1PX4A 1R092 3URFA 1XNKA 4H55A 3VN4A 3ZN6A 1YQ8A 1KEXA 4AK3A 4N43C 4N53B 4OHVA 1Y9QA 1U5XA 1Q8OA 5DG2A 3EQEA 3N35A 4LBKA 1RGSA 1YO8A 3OB8A 4QXCA 2C1FA 2K9ZA 3ZXKA 2P6CA 3WZ1A 2IUWA 4IGPA 4XQDA 5EJ1B 5FPZA 2R041 4IXLA 3OD4A 5DAPA 2VNOA 5C5UA 1JUIA 2Y6HA 1Y7BA 1AVBA 2DWRA 4EN6B 4HVQA 2DBNA 4OUEA 5CNAA 1QNWA 3BUCA 4MO3M 2ILMA 4NHKA 3AYCA 1WLCA 1PZ8A 3ZFGA 1MVQA 1MS5A 2VZQA 3CU7A 4A6OA 3BYWA 5DZGA 4EWDA 1TMF2 2WINB 4CCOA 1XQNA 1S4CA 3ZSKA 2DVAA 1ND2C 5FXZA 4AVSA 1YFWA 2X8KA 4BQYA 4BPZA 5JAXA 1XSQA 1PZ9A 2UWCA 1YIPA 1RUC3 4RHV3 4ZHNA 3MZHA 5FFOC 1ND3C 2P6HA 3AKQA 2IXIA 3WSOA 1PO11 4BK4A 2BOIA 3SITA 4D3WA 2D6PA 1YQ5A 1US3A 3AKTA 3B3QE 1IPSA 3EYPA 1V6IA 4YLZA 5LBBA 4TYSA 4BHPA 3VDBA 3MDPA 1CWPA 1SFYA 5CZKA 3IIIA 4MG2A 4DXSA 3KF3A 1UN1A 5KC5A 1LHVA 2H0VA 4AZZA 3QOPA 5CAZA 1BVVA 3OTFA 4ZZ5A 2FDJA 1UY0A 2F4PA 4UF0A 1AF9A 4Y1XA 4AG4A 1VBC1 4DXZA 2B45X 1OURA 2CNAA 2ID4A 3GJBA 4CEYB 4CP9A 3J7NA 4MADA 2JG8C 3LD8A 1EAH1 1MS9A 4KH9A 2QQUA 4B7EA 5CKMA 4CYDA 1JYTA 4OQ8A 3IAPA 1OSGA 5AVPA 2VZTA 1ASJ1 2BV4A 3GCXA 4AGRA 3K77A 1BKZA 3M2MA 1QNYA 2BP6A 2UWAA 1HRV1 5EZWA 3ATGA 4PBOA 3SHRA 3AXEA 2UY8A 4Q4V1 1R081 2CYFA 1GNZA 3ZPYA 1VRBA 4ZKTB 2NYYA 2BFUL 2ZGSA 3HN3A 4HKLA 2GDFA 1H2KA 1DQ1A 2RMU1 2V5YA 4META 3GCWA 4XJ8A 4Z07A 4AI8A 1UZVA 4RGKA 3O5SA 1B35B 5KXBA 1KXGA 5EYXA 2W68A 4WM7A 4YZ1A 4R9CA 4Z2WA 4WV8A 4I0WB 1U5ZA 3U14A 3DEMA 3L2YA 3DKWA 3ZYFA 3H0OA 1RINA 2IWGB 4WM7B 3WX5A 1B35A 1OUXA 5LY1A 1WBLA 2ARBA 2W3JA 2Z2SB 2B9VA 3P1IA 2BJSA 2CL2A 3HQXA 3RMYA 2E31A 4XF9A 2XJTA 4GB31 4KWLA 2LROA 3V0AB 3EHKA 3GXUA 3H1YA 4E2GA 2XLAA 4C8DA 4FTEA 2W1SA 4XYXA 4EN9B 4IL7A 5JDBA 1ULDA 1N3PA 1ZRRA 3I2DA 4NIDA 4O9EA 2PHRA 1R083 1ULCA 1ZM1A 4RGGA 1FOD3 4IE6A 1SEFA 4N90A 1XE7A 2RS31 1VAVA 2D93A 1W6OB 1VALA 1XYOA 1YJLA 2VTXJ 5FWEA 3V65A 3WHUA 2E6VA 3KHBA 2ES3A 1ULOA 4Y4YA 3EB7A 2EA7A 2P1BA 5FZAA 3ZO0B 4A3ZA 3D82A 3T3YA 2WT2A 2WJSA 2XOMA 5BXXA 2NZ9A 2JG9A 3MIHA 4EJRA 1VBC3 2IFWA 5DAXA 1W0NA 5BNOC 2R1DA 4P5HA 1RUD2 5EHDA 4BWOA 2HWF1 1DFQA 2RS11 3LA7A 4LBOA 3WLUA 4B29A 1NXMA 1UF2C 2AH2A 2GU9A 2A3YA 3THPA 2VNVA 2GP5A 3U10A 1QJX2 2GAUA 1UL9A 3LFIA 2DCTA 5FTTC 2VUAA 1QXPA 5BPXA 5T5PA 1APNA 4QQOA 3F95A 1K5JA 3O1VA 2BRTA 4W65A 3D0SA 3JZVA 1AYM1 3VZMA 3I3EA 4XQWA 4YZ5A 2OZJA 1C57A 1N1TA 4NRMA 1W9TA 1CX4A 2WQ8A 3POJA 4A41A 1GOFA 3T0AA 3VZNA 3ZOIA 3O1SA 1WLTA 3NAPB 4H14A 5IFPA 1CAVA 2BYVE 4DIQA 2ZMKA 4URAA 1OHFA 4BIFA 1JZ6A 2RDQA 3MYXA 4XDQA 4XBLA 5JLVA 3AL5A 1JI6A 4M3CB 5FP7A 3VKNA 2Q1ZB 5JWPA 4JV4A 4IUGA 3NNGA 2IXHA 4Q29A 3M1HA 1K5MC 4M4RA 4LT5A 4HZFA 5APAA 1RUD3 3C7OA 3FHQA 1H6XA 2DU0A 4MXWA 2WZ8A 4HANA 1GZ9A 4HN0A 5IW0A 2WZR2 1J59A 1SBDA 3Q9OA 5A33A 5A33B 4JKMA 5LB6A 5LK5A 3LAGA 3T09A 4BLIA 3AKPA 2DVDA 5CFCC 5EFUA 2IC1A 2JG8B 2YROA 1FAYA 4YVSC 1MZEA 3JQWA 1O59A 4QPYA 5LATA 1ZX5A 1OOPB 5J3UA 3QBQA 4MGQA 1DIWA 2QQOA 5FAXA 1R1A2 5BNNB 1V9U2 3MW3A 1CAWB 3BPSA 4GD4A 5IVFA 3DL3A 4JC1A 4AOCA 3RYRA 2JDZA 2OA2A 5FPUA 2AEYA 1RUJ3 5KXCA 3LB9A 5FO9B 4QHOA 3P5BA 2QQNA 3UT0A 1TMF1 4KWKA 5LK7B 1X8MA 4Q4X2 3VD3A 1OVSA 1SMVA 3B9CA 2QKDA 3VDAA 2XPJA 2J1RA 3WCRA 5KHJA 4HOOA 2VH9A 3U4XA 2B39A 1YNAA 4NIIA 5DUUA 3RPQA 4LOTA 4P02B 4M3CF 3VBUC 2PAEA 3PMEA 2YFUA 5A3MA 5K0UB 2JWPA 4DRRA 2WBKA 2D3RA 4GWIA 5E89A 3KB5A 5F3EA 4BOWA 3ME2A 2VECA 5FDBA 2ORZA 3ORJA 2ZBJA 4H3WA 1Z7S3 2E63A 4B7KA 2F17A 2WNVB 1CQ9A 5ACA3 2W46A 2ZXQA 1NA1B 4AHZA 4LBLA 1UCXA 1YJKA 4LE4A 2ZGRA 3DKQA 5F8PA 1NCRB 2XH6A 5FCCA 2IFRA 5FMCA 5I0UA 1GNYA 2WYFA 3AMQA 2XWBB 3WOGA 1COV3 1YQ2A 1XNBA 2XB6C 3ZX7A 2JG9B 4NN0A 5KXEA 1JZ5A 2DUOA 4UBHA 4ONUA 2JECA 4AEJA 4FVVA 4LIVA 4OHZA 2B4KA 4CDQB 1QDOA 1X7NA 4LE3A 1ST8A 5FZGA 2VZOA 3PJYA 1D4VB 4QX7A 1QJY1 3O0WA 1MACA 3LZZA 4Q4Y2 5LRSA 4CXYA 2DCJA 3HNBM 3GBWA 2VCAA 2ZTNA 4RFRB 2C9AA 2IZWA 1O3QA 2IXJA 3ILFA 3ZMNA 3HD8B 5KHGA 2ZX0A 1VBA1 4NHXA 2VAUA 2C9KA 1LGCA 4OFGA 5JOZA 3ZXFA 3A7QA 1PZ7A 2EVXA 4GH4B 2VBDA 1O4YA 2WS93 5J09A 1VBD2 1AR63 2WS91 3JD72 4XZUG 5FZ8A 3GALA 3AP7A 3NWKA 1JU4A 2ORXA 1GZTA 2OS2A 3N9LA 1ZBE1 4EZ4A 1AR72 3N9OA 1FI2A 3NAPA 4JTOA 1AL22 3ECQA 2G1MA 1ENXA 2VBPA 1LGBA 5AVAA 4CSWA 2BZDA 4HKOA 1BK1A 2ERFA 2FHRA 3NAPC 2RDNA 4JGYB 1FPN1 1RUE3 3H1WA 1J83A 2A3XA 1GKBA 4JGZB 3HN1A 4AQTA 2VNGA 2DYCA 5I8TA 1W2OA 1LOCA 1W9YA 3OD0A 4LO5B 3J7HA 2W39A 1C8M3 1GWKA 2VR4A 2LRPA 3WNKA 4E4HA 1L3JA 1XSRA 4GULA 4HK9A 3FBYA 5JZGC 3FLRA 5EJ3A 3MIBA 2D6OX 1ZBA3 1XU1A 4PCRA 2NPIA 4UFMA 4CDUB 3B94A 1HRI1 5BNPA 4XPVA 4QKDA 2WT0A 2VXJA 5A3PA 2VZUA 3NNJA 1DGLA 1W9FA 3GJAA 4EN7B 3MW2A 4UT5A 4LBJA 2R1BA 2VNRA 2W87A 3PVNA 5FZ1A 4UXAA 1G9DA 2YUEA 4YG0A 3ZN4A 4Z92B 1UPIA 1J1TA 5T54A 1U5YA 2X5IB 1IQAA 3C3VA 3CJXA 2SLIA 5FZKA 4BZ4A 4PIZA 5FP9A 3FC0A 4LTAA 3BTXA 2ARXA 3FWEA 1YCIA 1Q5OA 1XU2A 3EJKA 4QPGA 5LBFA 5LA0A 5G05L 5T55A 3ZFFC 1JHJA 1ZVFA 3EMRA 2Q4SA 1XBFA 2NM1A 1XE0A 1Z7S2 4IEXA 3E5XA 4WM8A 2X5IA 3F2ZA 3MF9A 4PI2A 1OXCA 5GZCA 4FTSA 1JN2P 2FCVA 3H7YA 4HSLA 1XC6A 2ZAHA 1ZBA2 4XMIA 1R64A 5FOBB 1Q56A 3J8F1 4N53C 1ZREA 3P6BA 1VB4A 2CDPA 3GF6A 1O8SA 1H8VA 4SLIA 1HN0A 3VBUB 2XLGA 3CDZB 5K0UC 2CAUA 1VLNA 2RJKA 4ZS2A 4RGAA 1TME3 5DZFA 5JI7A 3TEWA 4UW4A 1NLSA 4Y5Z0 1W2UA 2WNVA 5A7WA 2ADEA 1D4M3 1SLIA 1O6UA 2J7MA 2R061 3WDUA 1S0BA 2VOVA 4I30A 3VHNA 4XUQA 3AMMA 1T6GC 4WVWA 2WO7A 3FMGA 2QQVA 1YI9A 3K4AA 1CZTA 5FPLA 3LOBA 1CAUA 2JDUA 2D6KA 1F4AA 3J4UH 3I2HA 5A32A 1UOJA 3MIDA 3KT1A 5B4NA 2ZPXA 4Z82A 3JBG2 2KR2A 2GZWA 4E2QA 4WZFA 4P9IA 3WUCA 1F4HA 5F3CA 2OQ7A 3CEWA 5JIAA 3I8TA 4JAAA 4CE8A 5LZ6A 1A34A 3HR9A 5JOXA 3WNMA 1RVF1 2D98A 1UU6A 3Q8AA 3TOJA 4CCDA 3RFRA 4QKNA 4MV2A 4AQSA 1PVC3 4IESA 3AP9A 3ZDSA 2PHUA 2R072 2RVAA 1AYN2 3AZYA 3I2GA 1SFPA 1W05A 4CDXB 2FBEA 1R093 1PGL2 2IVIB 3AB0A 2GNBA 3IIAA 3PUSA 4YNIA 2OYZA 1ACCA 4AI3A 4XURA 4YM1A 4HFSA 3ETPA 4DFSA 4BYYA 3HBZA 4GH4C 2F6BA 5FJHA 4OI4A 1MVEA 1WW4A 4MHUA 4Y22B 2VMIA 4LK6A 4MXWB 4XFCA 5F32A 1E5SA 1D2QA 3VBOB 3WV6A 1WCSA 3AVRA 2ATFA 3KLSA 5DXDA 4LO7A 1W3XA 2JDNA 2ZMLA 1RVF2 4RS5B 4K40A 2XL9A 2YBPA 3JBG3 5HV4A 2QQLA 1PM7A 3HQUA 3T08A 4JX0A 4O61A 1MZ6A 5FY5A 5FMOS 3TBDA 4LBNA 1NCRA 4ORFA 4BLJA 3CIHA 3SH5A 2IXKA 4K1YA 2VMEA 2BVBA 2JB4A 1DYOA 4MGZE 5IT6A 2HWB2 3CHXA 2YB7A 3JU9A 4K8FA 4ATEA 3T0DA 2Q8OA 4RS5A 2VL4A 1DP0A 2VXRA 5C9AC 3U4SA 4FFGA 4IEQA 4XJAA 2E33A 4NUBA 4YZ3A 3SC7X 3T2OA 3UGHA 3UKNA 3BIWE 4CCJA 2WIIB 4BQ4A 2EAAA 2Y6JA 5LASA 4Q0SA 3WDWA 4RN5A 4GB33 5FZHA 1TNFA 2D3PA 4GQ7A 1R1A3 3WW3A 2QZ2A 2GSYA 3W59A 2A73B 4JRAA 4XIOA 2GC3A 5HCFA 4AGVA 1QJU2 3E97A 4UFHA 4BXFA 3E1F1 1SACA 4JHZA 4Q1RA 1EV12 4CDXA 3QACA 1GYKA 1W8ZA 2QZ3A 5C3SA 4OYUA 4CU6A 1O91A 2VBBA 4FPCA 4N43A 4FO9A 4U2AA 4FOYA 4CU7A 5J1XA 1QY4A 1H4HA 1ULEA 1GLHA 3ZYHA 3H8OA 3OBRA 1G86A 4AHXA 4F8AA 3RVHA 3WF1A 3I2OA 3FE5A 1PMHX 5F6LB 2W52A 3H3ZA 2WFPA 4QGMA 4GXLA 2R043 3DN7A 3O1OA 1GZWA 5J96B 4HKWA 1CVNA 2RM22 5FOJB 3HAGA 3OCPA 2UY9A 4PQQA 2CTVA 4FPEA 4CTEA 4XF0A 1BQPA 5BUVA 2R063 3ZYBA 3WQ0A 4D6SA 2ZJCA 4I02A 3PDQA 2QQMA 3NJVA 4JDNA 1DLLA 5FKBA 1REEA 1LU2A 1QF3A 1A8MA 3LDBA 2HBUA 1F9KA 4UI9L 4JKLA 5C8CB 2DCYA 3POBA 2WFF3 2GMEA 3OBTA 4ES8A 3DXTA 1I9RA 1S2BA 4OHXA 5IWFA 4XDOA 2J1VA 2R0FA 3D3AA 4UFKA 4XAAA 3AM2A 3MHZA 3WCSA 4AI2A 1NZIA 5A6YA 1ZNPA 1RUC2 3WF0A 1ODNA 3CJIA 3H8XA 4RHV2 2VG9A 3ZDVA 4OI0A 4QD2A 1RUH2 2VCBA 4YW3A 3VDDB 4H7LA 5KWRA 2BEOA 2X05A 4MGTA 1K45A 2ZKLA 5L9VA 4XFHA 1VRH3 2VZ1A 5A7PA 3SH4A 1VRH1 5DDJ2 1LCLA 1RHI1 3KV9A 4FPLA 2VOTA 2VO5A 1W9SA 4PLMA 4LHNA 2HJIA 4Y22A 3MI8A 3ZYGA 4CEYC 3LIHA 1VMHA 5FLIA 3ZMOA 4AAPA 5J48A 3POGA 3TB0A 1Y9GA 3NV2A 4IV3C 4K6BA 3JD71 5FPVA 4CEYA 1G9BA 4J1XA 5FPXA 1MQTB 3GZUC 1WA4A 2A75A 2FMDA 3S5AA 4V2VA 3WXPA 4LNVA 5JXGA 4BK5A 3PIGA 1WBFA 1Q8VA 2DF7A 3S6PA 1C5HA 2EXIA 3TEZA 1LRHA 1KQRA 3LGRA 3OGJA 4J25A 2DURA 3CZJA 4DO0A 5FWJA 2BBVA 1NQJA 3ETQA 1AR92 3OPWA 4S2GA 4D94A 3RDIA 3LEIA 4HVRA 3AX4A 5BNPB 2C24A 3CZUA 3U1XA 1WGPA 5FUIA 1PNFA 2ZGTA 1OOPC 3USSA 1LB2A 1GZCA 1QJY2 4MGKE 2UURA 3UL2A 3ZFEA 1RUH3 1X50A 3I3BA 5I8SA 4N9IA 3ZXLA 1OI6A 3CO2A 5IK7A 4CRQA 1ZRFA 1HXS3 1QU0A 2VQ0A 3IT8A 4FXKB 4WM7C 3BI3A 3ACHA 4LORA 3ALQA 2H0BA 4QDRA 2EAKA 2W0XA 1OC1A 1XB9A 1H1MA 3H8UA 2RR13 3TRSB 4FP3A 4BQ3A 1AZDA 1PNGA 3AYAA 1ZZBA 5C8WA 5LCWL 2GC2A 3J9SA 1HV0A 2R16A 3A21A 1PO23 2XKOA 3KS7A 3B5LB 3R0RA 4XCBA 3UJQA 4LO4B 3AL6A 3HEIA 4NJ4A 2WKKA 3B9IA 5FMDA 1ENRA 3AYDA 3POSA 4YGCA 3LE0A 3T0BA 4ITCA 4M4PA 5GKAC 4B1MA 3DPRC 4LHKA 3M3EA 3MIEA 1MS1A 2XR4A 5J36A 2RDRA 4NAOA 3ZSJA 3ZSLA 2GMMA 4CU8A 5IVEA 1N3QA 4JKKA 3K48A 5BNOB 3ACLA 3K75B 4Q4X1 1GICA 3RZZA 1WZXA 1IQDC 1DZRA 5GALA 4AR2A 4DXRA 4F83A 2ENRA 3I3MA 3OYWB 2B46X 4AI0A 4XQ4A 4XDPA 5D8AB 3IMMA 5FZ9A 1GQPA 1X9PA 3OG2A 4JHTA 4FAGA 1L7QA 2J1UA 4IE4A 5FR3A 4QAWA 3D0JA 5F3GA 4LLOA 1UU4A 4ASKA 2XWJB 1A8DA 1HB1A 1QJX3 2ARAA 2MEV1 2ZKNA 3K3NA 3AKSA 2WDBA 2VMCA 4CXXA 3E6BA 1V6MA 4IGQA 3ZN5A 3S30A 1OA4A 3ES4A 4AFMA 1UIKA 4LOSA 4XHBA 2WZR1 1ZA7A 2WRAA 3NKGA 3BODA 3MW4A 5I0SA 1WCQA 2CAVA 1MEC3 5IAVA 1SG3A 2YBKA 3RZJA 4W50A 1FX5A 1GQGA 3I97A 5HCAA 3AVSA 3D5OA 4QX8A 2EXKA 2WZPP 1EYBA 1SQ4A 1K5MB 5JR7B 4IV3A 5DAWA 1KS5A 2OPWA 5C70A 1G9AA 4LHSA 3MLLA 4QM9A 2Y8KA 2NMNA 5JI9A 2V4VA 2WT1A 2FZ1A 1W99A 1AJKA 1QQP3 2YZ4A 2FCUA 4AFDA 2QQWA 2WSUA 4IEZA 2A6XA 3VKOA 3R05A 3ZFEC 2WZR3 5CFCB 4CDWB 1CONA 2Z4FA 3HIFA 3IAQA 4YVSB 1NOVA 1ZRDA 1XNAA 1C1FA 5F2WA 1QJY3 1ZRIA 3FHIB 4IEPA 1LOGA 1OOPA 2GC1A 3NO8A 4W6XA 5FZCA 5GLZA 3CJIC 3VBOA 5FZLA 2GMPA 4Q4W1 5FLJA 2YC2A 4PI0A 1E57A 3O0VA 4LPLA 3PVOA 1C4RA 3ZR6A 2RS12 4KL1A 2HWF2 1RUD1 4YFWA 2E9QA 4INDA 2MEV2 1CPNA 3RI9A 4BJ0A 1I1EA 3O1TA 1HDKA 5FIXA 1V6KA 1S55A 5CG8A 2X5IC 4S2DA 3H50A 4AEMA 4EYUA 3N7LA 5DUWA 5ACA1 4QKBA 1QOSA 3ZKYA 3NVCA 4XFAA 1SFNA 3VZJA 1GFF2 1S0GA 3CKHA 1OH4A 3J8F3 1AX0A 3JXSA 4COWA 5HXMA 2VZ3A 5L19A 1JS9A 2XUMA 4GA9A 1AL23 1DQ4A 5JXIA 1CAVB 3MLJA 5A7NA 4A3XA 3VL8A 1RUE2 3AC0A 5ANQA 3RZMA 1NA1C 1NLRA 4SBVA 1QJFA 3HPNA 2SBAA 2CGNA 4Y20A 1DDLA 2KA3A 5JMCA 2HWC1 1W0OA 2XG3A 3RJ2X 2ZMNA 3H3LA 4BCUA 3OPTA 3KWVA 4QDSA 2JG9C 3WG2A 4PT6A 2EXHA 2GN7A 4QHZA 3QH7A 1LOEA 4ARXA 4Y20B 1PIV3 4CDQC 5GLTA 1WD3A 4CP1A 2HH9A 2OQ6A 1DU3D 1W8UA 3HVDA 4AEDB 1JYNA 2NQYA 2RS51 2W1WA 1Q8SA 3RYKA 1YEWA 4UBGA 4CCMA 3SKVA 1W8WA 1H1IA 1BYHA 1LECA 4FSJA 2PQQA 2Q1FA 4FPOB 5FYMA 3RJRA 2FDKA 3BIEA 3C8XA 1QH7A 2PHFA 4AI9A 2GNDA 1BBT2 5C4WB 2D5FA 2ZGNA 4MH0E 4Q0PA 3ZYJB 4MVTA 1CAWA 5C9AA 5FQ0A 3PMSA 4DZGA 3ST7A 4Y24A 3ROUA 4CUBA 5F7UA 1WKYA 1FOD1 2VD7A 3DUIA 1H8TB 2QQPA 3VBRA 2PHLA 2Y6KA 1BEV2 2ZX2A 5FBZA 4AVAA 2WLQA 1IS4A 1UPSA 1NE4A 4PLNA 1EAH2 2BOJA 5E88A 3AJZA 2ZA9A 1HB2A 4BDVB 2XQRA 2A7AA 1UYXA 2JD4A 1S0DA 3JD73 3B02A 4MGIE 3WW1A 5C3RA 4PDWA 2PAKA 5J7MA 1AR62 1PGSA 2VCMA 3OY8B 4L0PA 1T2XA 1J3QA 2P4EA 1PX3A 1OQ1A 4JGZC 1KJLA 1H0BA 1FATA 2DCZA 1PK6C 4YW5A 1RC6A 1AXYA 2VMGA 3Q8FA 3HT1A 1CJDA 1HJFA 2XL7A 1DGWA 2ZHMA 2MHFA 1V6OA 1QWRA 2D40A 3OGGA 1RHI2 3C7GA 1REFA 4CDUC 5C7GA 5F1RA 1XYPA 3IPVA 2HWE3 2E32A 3FL7A 4RS5C 4XCAA 1RUI3 3K51A 1DLCA 1W8HA 3I59B 4NOTA 5L9BA 1BLZA 3KZ4C 1OKQA 1RUH1 4Y1ZA 5FYHA 4DY3A 2DVFA 2Z69A 1LNSA 2VTFA 1SCRA 2VZSA 5JIUA 3PU3A 3V0BA 1DZTA 3GDBA 4FQ4A 1AHSA 2DVGA 3HT2A 5T3NA 1CAXB 4E8DA 4Y1VA 5I8YA 1JH5A 2CGPA 1DCSA 3P3PA 4DPNA 4FBFA 1FNZA 4HSJA 5KC6A 1UYPA 4CP9B 4FP2A 3UKTA 2CGOA 2VM9A 3AFGA 1YC61 4M0HA 2YV8A 4OLLA 4P9GA 2HWE1 2BNNA 4GH4A 4FPYA 3ZFFB 1PMJX 1JYCA 2CV6A 2X10A 3DPRA 3RGBA 3H9AA 1R1ZA 2WNUA 1PVC2 4WM8B 4ZU5A 2R49A 5L36A 2YGLA 1OKOA 4CPBA 1RHI3 4IEVA 2ZGQA 4XBQA 2PAMA 5IFTA 3PLQA 2Y0OA 4NIAA 4WVVA 2D6LX 5L73A 3VKLA 1KRIA 1G9CA 1PO21 5DQ0A 2X09A 1RVF3 4HL0A 1FT9A 2PHXA 5FYSA 2D6NA 3DYMA 2WO2A 2ZEWA 1EV11 2R6QA 3KGLA 4XF1A 4YZ4A 4PDWC 3NJXA 4AQ2A 2ETEA 2OX0A 3UETA 3NNMA 1QJU1 2WWJA 4RR3A 4CP0A 2G4IA 2XJUA 3PUAA 4MGYE 1HXS1 4A2UA 3W5MA 2XVLA 2XVGA 1S1AA 2AYHA 3FHAA 3BU0A 4Y33A 1UMHA 2WAOA 4J1WA 3WG4A 1KDMA 1UXXX 3N36A 4XFFA 1VBB2 4AVBA 5BNQA 4UW6A 1Y4WA 1OF3A 2OIIA 3CF6E 1TG7A 4FQZA 3VBFC 3UJOA 3R4UA 1NY71 5CFDC 2VQAA 2UWBA 4FOQA 4B4QA 1V70A 5C4WC 4FAHA 1UIJA 4PQ9A 4OZXA 2FDHA 3DYPA 1QOTA 3D8CA 4M01A 5F5IA 3WW4A 1PIV1 1QJU3 3H1MA 1W90A 3O12A 1HKDA 2JKBA 5GJ6A 2IVJA 2W5FA 3KM5A 1O3SA 5FZOB 1W6MB 2IXCA 2P2KA 1RMU2 3HWJA 1MS3A 1DG6A 2KM2A 5FXVA 2CSGA 2WNOA 3MPBA 3VD5A 1PVC1 1I5PA 4XUOA 4XEZA 4CPBD 5IVJA 3RQ0A 4YRDA 2GH8A 2CWSA 4BH9A 1V6LA 4CEWC 2Y26A 4MLOA 1MQTA 2HWE2 1JOJA 1RYYA 4OMCA 4AVTA 3FX3A 4CUGA 3RZGA 1MQTC 5FJKA 4MYEA 4GAZA 3SCHA 4QPIC 4KBBA 2WL1A 1SDWA 1O8PA 4LITA 5K4LA 5FO8B 1D2SA 2BU9A 2W1UA 2VOWA 4GMP3 1AYN1 2D3SA 1YWKA 1ALYA 2OXBA 1BZWA 2BQPA 4CDQA 3TYJA 4D7TA 3WP3A 4AVVA 3WP4A 3VD7A 5JCTA 5BNPC 5C9AB 1POV1 3ZKUA 2CDOA 2AUYA 3NW4A 3POFA 4TWTA 4D6QA 1H4GA 1VJ2A 2D6MA 1WW5A 5FBJA 1X8EA 1QGLA 1MPXA 2OPKA 5J98B 4NIGA 2G9GA 2PLV3 3JBG1 1UYZA 5I0DA 3IBMA 4QPIA 2QCSB 1QH6A 1D4M1 1YFYA 2OUJA 3N7JA 4LK7A 4XE9A 1Q8QA 2RS33 4F3JA 5I0RA 4TLFA 3BB6A 4YVWA 2EF6A 1W39A 2O14A 2A70A 4Q8LA 1IOAA 3I49A 2CWMA 2B42B 3RMXA 4JQRA 2A6WA 5E16A 3AMNA 2LW8A 3RI8A 1ULPA 5H9RA 5T5LA 4AYUA 1S0IA 4OI2A 3AMPA 3AZWA 1AR61 4S2HA 3DYOA 3N7KA 2AZ5A 1JU3A 2JENA 2XBO2 3VB9A 3AYEA 3MICA 4DRVA 3THTA 4LEJA 1PM4A 3MGUA 2ZX4A 1BEV1 1ENQA 1FV3A 2E7QA 2K0GA 4IQPA 2UYAA 5A7OA 5FUPA 1FOD2 5FZFA 3V64A 3J7LA 5F5AA 4WVMB 2H6CA 1LR5A 4XILA 4D7SA 4ES9A 1OBNA 2P3YA 3OYWA 1BBT1 3GZAA 4P9LA 2RMU3 3WQ7A 1VBB3 1WLDA 1YLLA 4XHXA 1AUYA 5LBCA 2WLPA 4Q4V3 1KFXL 5C8CC 1K42A 1O4TA 5JSOA 5LA1A 3OBAA 1AR82 2RS52 2QDNA 1FMD1 1VIWB 2VW0A 2NN8A 2R30A 5FY9A 2J1EA 1RJ7A 4BXSV 2Y6GA 5JPNB 4P9YA 3WD5A 2PHTA 2Z42A 1VE0A 2ZZQA 4RFT0 3V0AA 1GU3A 3IM0A 4JZRA 2RR12 4ET7A 5FP4A 4KWJA 1W8TA 4R9DA 5EJZB 5HXVA 3T2QA 3VDDC 2HWC2 3DV8A 4CDWA 1IKQA 4AHYA 1C8M1 3VGIA 4Z1VA 2LS6A 5FZ3A 5CVRA 2OKXA 1OUSA 4P9XA 1NT0A 2FQPA 3AFKA 1RUE1 1KGYA 1RUI1 2JE7A 2JJ6A 4AHWA 1WCUA 3HJRA 3VBUA 4CDWC 3PUHA 4NMIA 4O9GA 4K9SA 4XETA 4IEOA 4NHYA 3B93A 4L99A 4IV3B 4YVWC 4YPJA 2V73A 2ZS6B 2CHHA 2BWCA 2WYSA 5T5OA 2QE3A 4AFCA 4HLTA 4BB3A 3N7MA 5IK5A 2R32A 3ZXGA 5ACA2 1JZ7A 1AL21 2WR9A 4PIXA 2FZ2A 1UOBA 3O1MA 4W8JA 3KGZA 1W6NA 2QFEA 4ATFA 1RUJ2 2A6ZA 2JE9A 3VZLA 3ZFEB 4CXWA 4QM8A 4CU9A 3CL1A 5ANNA 3I2KA 2QVSB 5HV0A 5F2SA 1ND2B 3ZPOA 2A6VA 4A6SA 2WQZC 4TN7A 1FV2A 2HEVF 4G4FA 1SBFA 4UF0B 1WD4A 4Q4W2 2XJQA 3O14A 3ZR5A 1OF4A 4OI1A 3IWZA 4EZHA 4FPHA 3AP4A 2XJSA 1A6CA 5EV7A 1PGW1 4ISRA 4DINB 1IS6A 1WA6X 2Q8CA 4R52A 3VBRC 5C71A 3PTYA 4LIUA 1NCQA 4CDUA 3THDA 1EPWA 4MZUA 4RYDA 1UZ0A 2B7YA 5BNOA 4CEWA 1W6NB 4K21A 3SXWA 2Y33A 4EWEA 5HI0A 5DAQA 3MFCA 5FRAA 1BJQA 1D0GA 4NRQA 3I2IA 1FPN3 2G9ZA 3FLTA 1JMUB 1E5HA 3ZYRA 1UYYA 2DFBA 2E7AA 4UAPA 5FLHA 2WWSA 4MUVA 2ZCWA 2PN5A 2WSVA 3OOXA 3VDDA 2VQTA 2ZGPA 4BU2A 1ZZ7A 1IPKA 4OUSA 2YFZA 2VU9A 3MO4A 3C2UA 1WMXA 5JXHA 5IYYA 3G7DA 1QQP2 3M7AA 5EYYA 3N9MA 4Y5SA 5A7WB 4XMAA 2OW4A 5A3NA 1AYM3 4GWJA 4HMZA 5FY7A 4Q4Y3 3ZSMA 2VTXA 1G7YA 1P8JA 2P34A 2XJRA
chains in the Genus database with same CATH topology
2VVEA 2TNFA 4AI1A 1MS0A 1UW8A 1RUF2 4AEDC 5FREA 4KQ7A 1HX6A 4N53A 1JTZX 3WG1A 4RSUA 4R9BA 4DMIA 1YI7A 4E9KA 1HRI3 3VZOA 4GIQA 4YZ2A 3VHPA 4Q27A 1FMD3 1VP6A 5LEKA 4YM3A 1GANA 1AJOA 4OHYA 2B5HA 2DU1A 4JVAA 4QQHA 4YW4A 3J26N 4FCAA 2Q30A 4KNCA 4YM2A 4XJUA 5JPMB 1S0CA 4LBQB 5GLUA 3USUA 2PFWA 4QXKA 2EIGA 1CIWA 2E51A 2GH2A 1OD5A 1CESA 4YG3A 1QQP1 3V56A 1RUNA 2D97A 1HQLA 3ILRA 4JGYA 4XIKA 3MFAA 3CJIB 3FBMA 4PBPA 3AMHA 4YGBA 2YC0A 5L7OA 1YIFA 1XRUA 4G3YC 5E1RA 2D43A 2P3IA 3A0NA 4J6GA 1TQ5A 1Q8PA 1WLWA 4C1XA 2XGXA 1PGW2 1KDKA 4ASMB 1PVXA 2HWF3 1DQ2A 3AJYA 1ZZ8A 3IDEA 3SISA 1QHDA 4DOUA 1EY2A 5BYNA 1M06G 1QJX1 1TEIA 2AENA 1O4ZA 3KCYA 1QXJA 1UKRA 1WCKA 4V1PA 2WA3A 3I7DA 3VLBB 1KS4A 1NZCA 1OQDA 3LSDA 3WNXA 4IV1A 2WC2A 1V6NA 2DTYA 2VY0A 3VBRB 5K8SA 3VL9A 2Y38A 1O3RA 1KJRA 5I93A 5DDJ1 5D1IA 3KT7A 5CADA 5KHHA 4BA6A 1CJPA 3MF6A 4ZU7A 2VGDA 1LEMA 2RS32 2XJPA 1HQNA 1TE1B 1JYIA 2YY1A 1O5UA 4ASLA 1RUI2 2O8QA 2Z5WA 3U0ZA 1JXNA 4XBNA 5FMOL 2Z79A 3MIFA 3VKMA 1SCSA 2ZOEB 4XW3A 2A71A 5K0UA 2XBO3 2RR11 3WINE 1F5FA 2GC0A 2EXJA 1AL0G 4M3CE 2ZABA 1OPOA 2O1QA 4LBQA 3M3OA 1FMD2 1JUHA 1AR81 3AP6A 2BNOA 1DZQA 3P3NA 5GZEA 3VBFB 3KCXA 5DG1A 1J3PA 1URXA 2RMU2 1ZZCA 1R082 4YFZA 4Q4V2 3T2TA 4X6QB 1XE8A 3TN91 4JRLA 1HRV2 3RSJA 5D8AA 4WVZA 5KXDA 3APBA 1POV3 1W6OA 5GLVA 1S0JA 1WMDA 1V6JA 2W08A 3OJBA 3ZXJA 4BIOA 2XBO1 1X36A 1EV13 3KSCA 4FPFA 1VBC2 3RNSA 2HWC3 4QHBA 2D7FA 1JW6A 2VVFA 1OLQA 1PO13 1REDA 1PHMA 3SH3A 2MNGA 4COZA 4JGYC 4OHWA 4I0BA 4EWAA 3ZFFA 3QLQA 4P9WA 4DB5A 4Y26A 1Y43B 4X8NA 3QCWA 3LWCA 3GNEA 3E5QA 1F5JA 2HWB1 3LCPA 4C1WA 2PA7A 1UZZA 4C0HA 2LM3A 2IXLA 2YHJA 3BOPA 3PHMA 1HLCA 1ONAA 5BY5A 3PNAA 1LOFA 4UW5A 1A78A 1HRV3 4GKYA 4RL7A 4YM0A 1ENSA 2XKPA 2VPVA 1YHFA 2Y0IA 4YW1A 4XJ9A 2ZAAA 3I4IA 3E6DA 4JGZA 4AFBA 2HWD2 2B9UA 3WR0A 3PVBB 2GN3A 3TN93 3USUB 5GZGA 3WY6A 1LKNA 2PHWA 2PYTA 1ZA4A 1AXKA 1Q3EA 3CLPA 3L2HA 4QGLA 4AEKA 5LK7B 4PJYA 2D5HA 4L2NA 2BW8A 1XNCA 3ZSEA 1DGWX 1C5IA 3WP5A 2R042 4DQAA 1LJ7A 5KHIA 1PGL1 1EP0A 5JZGB 2R071 5T5JA 1AX1A 3BOWA 5C6CA 4PDWB 1NCQC 1LHNA 4HETA 2ZHKA 4FT8A 1V9U3 3VBSB 1R091 1YFUA 4GMP0 2ZGLA 2MPFA 4DY5A 1MEC1 2QNKA 2HWD3 1NY72 4LO6B 4K3UA 3S0MA 1SLAA 1NG0A 4YGDA 4U36A 5CIRA 5CFDB 2R062 2HEYF 2DTWA 1NA1A 4MX3A 4AEDA 4C91A 3NL1A 5A3LA 1HXS2 2ZHLA 2WNUC 1OFNA 2Q0AA 3UKVA 3V0BB 3RS6A 5AFBA 4B3NA 3SCFA 3M8LA 5AC92 1ZBA1 4IEYA 2GNTA 3S7EA 4NWVA 3LA3A 4Q4X3 2QDRA 4Y1UA 4BM8A 4C90A 1RMU3 2LUWA 1RTVA 3ELNA 4X6RB 1COV2 4QX5A 4CDXC 5AFEA 4LR4A 1PO22 3IPVB 1CGPA 4D7YA 3ZN6B 5SV8A 2UYBA 4UW3A 5H9SA 4LUKA 4XFIA 3VV1A 4RQPA 5E8AA 3MEPA 1YXWA 2VMHA 4A7ZA 3BCWA 1YYNA 1ND3A 1W6PB 2YXSA 3R4DB 4OUMA 2YYOA 3MIGA 4L9BA 3VBOC 1DQ0A 1OQEA 3WQ1A 2BNMA 3VKFC 1N3OA 2XLFA 4FPKA 1W6QA 1Q43A 4XXPA 1MZFA 1VBD3 4RD7A 4RQPC 4Q26A 3INAA 1WMEA 1ZRCA 3IMNA 5EWSA 5CFCA 3D4KA 3JB4C 3OPZA 4KG0A 3ZFGB 2DUPA 4X8PA 1Z0HA 2BTVC 4XOGA 5CU1A 4DS0A 1O3TA 4I3PA 3MPPG 3ZVXA 1COV1 4PLOA 2NLRA 2N7GA 3LKJA 2LTNA 3S7IA 3T1LA 3R6SA 3SNMA 1QJZA 1TME1 1IZ3A 2WS92 1VBD1 5AC91 1N1VA 2OVUA 1IS5A 3IDBB 1ZBE3 4E27A 1RUG1 4B4PA 4EV0A 1GZWB 4M00A 4A7YA 1UKGA 1BCXA 2C0ZA 2GNMA 4URTA 5JVVA 3WW2A 1VBA3 1KFUL 4Q4Y1 2ZACA 3ENRA 3NJZA 4QPGC 3VBSC 1GBGA 2P3KA 3R4SA 4WBBA 3VBHC 2I45A 1W6PA 1MEC2 1CN1A 4P14A 4XXAA 4BMBA 1BXHA 2VOXA 4HK8A 1XNDA 1G8WA 4IV1B 5AC93 1LU1A 3IN9A 3KD4A 4Q0QA 1S2KA 5A32B 5DZEA 1Y3TA 2QJVA 3I54A 4N7IA 3LOIA 5ABJB 1G9FA 5GLWA 4YVWB 4COYA 4KGQA 1DQ5A 5IK4A 3DF0A 4TZDA 3RYPA 4M3CA 1SLBA 3UV9A 5CB7A 3O7OA 4ISQA 5F9TA 4LUMA 4A7KA 4HBNA 4MSVA 2HWD1 4E4ZA 4NHMA 3N3HA 4HPKB 4KU8A 1LOFC 1DGRN 2ZGMA 1C1LA 2VOKA 4YSFA 3TAYA 4JCKA 1YRZA 5GZDA 1V9U1 3O0XA 1R1A1 1S0EA 4GKXA 4KGGA 3FFZA 1POV0 4QMAA 2AR6A 1QMJA 4GWMA 2PELA 4W6WA 2VULA 4XF4A 2CY6A 1IGOA 4L92A 4MXVA 1DF0A 5JZGA 2Q5TA 4K20A 4FXGB 4B4RA 1ND3B 4P9JA 4EN0A 5BV6A 4AXOA 4TSVA 4L11A 3IDCB 2YDEA 3WDYA 1CAXA 1IHMA 3FZ3A 2VUJA 1CR7A 1MS4A 2BFUS 1YFXA 3ZFGC 1HIXA 1AYN3 5JOWA 4G9SB 1BVP1 1QDCA 1LTEA 3TN92 2R0HA 3NKTA 4XJWA 1UU5A 4JDMA 2O8OA 1AYM2 1F31A 3B69A 1LULA 1N47A 2JXAA 4HPKA 5FO7B 4FOWA 4COVA 4BQ1A 1KITA 4EN8B 1H9WA 1RB8G 1CD3G 4N7UA 1RITA 1RUF3 1BEV3 3ZXDA 2ET1A 1C8NA 1QKQA 4RR3B 4XTPA 4Y1YA 4NWWA 3WDVA 1UZYA 3RG0A 4Q1PA 4R4ZA 5EXOA 4L97A 4R4XA 2FMYA 3JUUA 5D8AC 1C28A 1VAKA 2I2SA 1ZZ6A 1WCDJ 2AREA 2EALA 2HEWF 3QH6A 2I07B 3QD6A 4GALA 2NP0A 3D6EA 1O7FA 2PHDA 3SMHA 1LOAA 4IV1C 2ZGOA 1LOBA 4LBQD 4N43B 1VBE2 1RJ8A 3DPRB 3VUOA 2NMOA 5FQ0B 3AKRA 3L9JT 3FUQA 3NV1A 4L8QA 4AF9A 1RUOA 4GB32 1I5ZA 2YPJA 2ZHNA 1UD1A 4F7ZA 1WW7A 3LA2A 1J3RA 4OULA 5IK8A 1OPMA 2Q1MA 4GMP1 2DCKA 2K2SA 4QT6A 1ZYBA 4LA2A 2XVKA 4LHLA 2WFF2 3SCGA 2ZZJA 3E5UA 3AZZA 3BPZA 4YYOA 2P37A 5DUVA 3BTAA 3WT3A 2D44A 4CDWC 1LENA 3PVEA 4JTNA 4PF5A 1W0PA 5I91A 3NV3A 5C33A 5F6KA 4ZU4A 1WMFA 2VW1A 5JSRA 2ZX1A 3JB8A 3NSTA 5K9YA 2DFCA 1ASJ2 3EBRA 4C0BA 3B00A 4NVPA 2BGCA 4FOVA 4YG6A 3U11A 5B2GB 1AR91 2ZGKA 5C8CA 1LHWA 1WW6A 3SLIA 4IEWA 3ZXAC 3NV4A 3WG3A 2WFF1 1CPMA 3OY8A 3U07A 1O5LA 4AFAA 1KD7A 2TEPA 4I0AA 1LGNA 3M4FA 3HMYA 2HYKA 1F8VA 1D0HA 5SV5A 1H30A 5LRRA 1OFSA 1PO12 3G6JB 5CG9A 1W6QB 1M4WA 3EXUA 3VHOA 4CYDA 1UX6A 1VRH2 2DV9A 2X29A 2JX9A 1VBE1 2RM23 5K7PA 4S2FA 4YW2A 4ZXKA 3POYA 1H2NA 1Z78A 1W6MA 2VVDA 2A3WA 3VBFA 1QXRA 4RHV1 1UAIA 3TWIA 1RUC1 5L7OB 2H6BA 2LALA 1B35C 4I09A 1B09A 4NR1A 1WUVA 5BNNC 4NPRA 1RUF1 1CAUB 3GBGA 2A5ZA 5T50A 3BALA 3WP6A 1NE6A 3A0KA 1H1AA 1QOOA 4RR3C 3VZKA 3PJQA 4Z8BA 4QGNA 1VBE3 2RM21 5DDJ3 1H8TC 4KG8A 5CFDA 3AZVA 3GBFA 2RHPA 4JDOA 4IERA 4AGGA 2BWAA 2DVBA 2BVVA 1OMIA 2JG8A 3W58A 2E7TA 3M3CA 1NCRC 1PK6B 3WVJA 3VBSA 4COUA 1F2NA 1AR93 1GSLA 1SLLA 3W9AA 4IETA 1BMV1 1DBNA 1XXNA 2E53A 4YARA 2TBVA 2WQ4A 2RJLA 4CZSA 4YVSA 1NYWA 4XZPA 1LODA 3POWA 4XFGA 1U0AA 2JICA 3FFQA 3JCIA 1I3HA 4H7MA 4XF3A 3M70A 3ZXEA 1OLRA 3RWNA 1IS3A 4XTMA 4RQPB 3WHTA 5GM0A 1GNHA 1RUJ1 3H7JA 2YMZA 2VW2A 3MLKA 4I2OA 2OUHA 2ZX3A 1JBCA 3EO6A 5I0TA 1OA2A 4HVOA 3X29B 1DHKB 1K5MA 3WUDA 3ZYPA 2XJVA 2PLV2 1AR73 3B7MA 1LHUA 3UK9A 4R8HA 1PMIA 1IKPA 1G6NA 3FLPA 1VAMA 1YUDA 4AQ6A 3T1MA 4QQPA 5LEJA 2JEMA 1MR5A 5CA6A 3GHNA 3AZXA 1NCQB 1DGRA 1C8M2 3JQXA 5H9PA 4LLFA 1GQHA 1TNRA 1AX2A 2B8MA 1J58A 4D69A 1AR83 2RS53 1IPJA 1LHOA 4Q0UA 1LEDA 4W6YA 4FPGA 1ND2A 2TUNA 3A4UA 1SBEA 1ULFA 1JHNA 2DUQA 4E4DX 3GYDA 3H3UA 4QPGB 1PK6A 4Q0VA 4Q8KA 2A6YA 3M3QA 4KU7A 5L7OC 1H2LA 2WNUB 4XJZA 1N1SA 2AGSA 1MZ5A 4WZCA 3VHRA 4WM8C 1ZZ9A 1N1YA 3KMHA 4BMEA 1LESA 4QQLA 4LA3A 2RS13 3TNPB 3FJSA 3ZIXA 2PTMA 2MEV3 2WNEA 4LBMA 4RA0A 4AVCA 3AXDA 1FYUA 4LULA 1FXZA 1RUG2 2RE9A 3FUOA 2WNVC 1GV9A 1U12A 3LSEA 3J8F2 2BPA2 1RIRA 1H2MA 1TME2 4PIYA 5ABJA 3N4MA 1A3KA 2P17A 4IEUA 2V09A 3WDTA 1EPZA 1HW5A 1HV1A 4Q4W3 1D4M2 3I59A 4AE2A 1Z7S1 2I74A 2HKXA 1H9PA 3ZIWA 4CEWB 1AXZA 3BU7A 3TNQA 4BE3A 3ASIA 3GZTB 4QU2A 5F5QA 2ZGUA 5GZFA 5TSWA 1DYPA 3ES1A 2YGMA 4EROA 1J1LA 2OZ6A 4M0NA 4NHLA 5J37A 3IKWA 5BNNA 3OF1A 1VR3A 4FPJA 5KBFA 4YGEA 5JOYA 2WA4A 1HQWA 1X82A 1TMF3 1XYNA 3AK0A 4LO8A 1RUG3 4OVEA 1DYKA 2P3JA 3M3IA 1C3HA 1ULGA 2R073 4K7JA 4R9AA 1RL3A 1HRI2 4AW7A 5CBLA 2UU8A 2GALA 3KCCA 4QQ2A 5HCBA 1H8TA 3VBHA 2XHKA 1X33A 1OA3A 1ASJ3 3GHMA 2ET7A 4XFBA 4E2SA 3KT4A 1UMZA 2KXLA 1RMU1 1SLTA 2PLV1 5IUQA 1EAH3 1NXD1 1S0FA 5C4WA 4DNYA 1FPN2 4QPIB 4N9HA 4HT1T 5DUXA 5HBAA 3ILNA 1MS8A 1PIV2 3B01A 5H9QA 5T52A 1AR71 1ZBE2 1VB2A 3E6CC 1FNYA 1VBB1 3VBHB 1BBT3 2QUOA 4K1ZA 5KHKA 1VBA2 2HWB3 1NQDA 2O0OA 2X53S 4HN1A 1I6XA 1SLCA 2G9FA 4AWDA 1BMV2 1GR3A 3RRDA 1U5IA 1V00A 5JSPA 3WDXA 4Q2FA 4FTBA 4CP2A 4WVMA 2BUKA 3KQRA 3DGTA 4I01A 4B8EA 2C5DA 4I3GA 5ABJC 3AP5A 3CNAA 4NO4A 4GWNA 3ZYIB 1DQ6A 4E4SA 1R092 3URFA 1XNKA 4H55A 3VN4A 3ZN6A 4AK3A 4N43C 4N53B 4OHVA 1Y9QA 1U5XA 1Q8OA 5DG2A 3EQEA 3N35A 4LBKA 1RGSA 1YO8A 2C1FA 2K9ZA 3ZXKA 3WZ1A 4XQDA 5FPZA 2R041 4IXLA 3OD4A 2VNOA 1JUIA 1Y7BA 1AVBA 2DWRA 4EN6B 4HVQA 5CNAA 1QNWA 2ILMA 4NHKA 3AYCA 1WLCA 1PZ8A 3ZFGA 1MVQA 1MS5A 3CU7A 5DZGA 4EWDA 1TMF2 2WINB 1XQNA 3ZSKA 2DVAA 1ND2C 4AVSA 5JAXA 1YFWA 2X8KA 4BPZA 1PZ9A 2UWCA 1YIPA 1RUC3 4RHV3 3MZHA 5FFOC 1ND3C 3AKQA 2IXIA 1PO11 3SITA 4D3WA 2D6PA 3AKTA 3B3QE 1V6IA 4YLZA 4TYSA 4BHPA 3MDPA 1SFYA 5KC5A 1UN1A 1LHVA 2H0VA 3QOPA 5CAZA 1BVVA 3OTFA 2F4PA 1AF9A 4Y1XA 4AG4A 1VBC1 4DXZA 2B45X 2CNAA 4CEYB 2JG8C 1EAH1 1MS9A 4KH9A 4B7EA 1OSGA 5AVPA 1ASJ1 4AGRA 1BKZA 3M2MA 1QNYA 2UWAA 1HRV1 5EZWA 3ATGA 4PBOA 3SHRA 3AXEA 2UY8A 4Q4V1 1R081 2CYFA 1GNZA 3ZPYA 4ZKTB 2NYYA 2BFUL 2ZGSA 4HKLA 4META 2GDFA 1H2KA 1DQ1A 2RMU1 2V5YA 4XJ8A 4Z07A 4AI8A 3O5SA 1B35B 5KXBA 1KXGA 5EYXA 2W68A 4WM7A 4YZ1A 4R9CA 4Z2WA 4WV8A 4I0WB 1U5ZA 3L2YA 3DKWA 3H0OA 1RINA 2IWGB 4WM7B 3WX5A 1B35A 1WBLA 2ARBA 3RMYA 2Z2SB 2CL2A 3HQXA 4XF9A 2XJTA 4GB31 4KWLA 3V0AB 3EHKA 3H1YA 4E2GA 2XLAA 4FTEA 4XYXA 4EN9B 4IL7A 5JDBA 1ULDA 1N3PA 1ZRRA 3I2DA 4O9EA 2PHRA 1R083 1ULCA 1ZM1A 4RGGA 1FOD3 4N90A 1SEFA 1XE7A 2RS31 1VAVA 2D93A 1W6OB 1VALA 1XYOA 1YJLA 3V65A 3WHUA 2E6VA 2ES3A 4Y4YA 2EA7A 3ZO0B 3D82A 2WT2A 2WJSA 5BXXA 2NZ9A 2JG9A 3MIHA 4EJRA 1VBC3 2IFWA 5BNOC 2R1DA 4P5HA 1RUD2 4BWOA 2HWF1 1DFQA 2RS11 3LA7A 4LBOA 3WLUA 4B29A 1NXMA 1UF2C 2AH2A 2GU9A 2A3YA 3THPA 3U10A 1QJX2 2GAUA 1UL9A 2DCTA 5FTTC 2VUAA 1QXPA 5BPXA 5T5PA 1APNA 4QQOA 4W65A 3D0SA 3JZVA 1AYM1 3VZMA 4XQWA 4YZ5A 2OZJA 1C57A 1N1TA 1CX4A 3VZNA 1WLTA 3NAPB 4H14A 1CAVA 2BYVE 2ZMKA 1OHFA 4BIFA 3MYXA 4XDQA 4XBLA 5JLVA 4M3CB 3VKNA 2Q1ZB 5JWPA 4JV4A 2IXHA 4Q29A 3M1HA 1K5MC 4LT5A 4HZFA 1RUD3 2DU0A 4MXWA 4HANA 1GZ9A 4HN0A 1J59A 2WZR2 1SBDA 3Q9OA 5A33A 5A33B 5LK5A 3LAGA 4BLIA 3AKPA 2DVDA 5CFCC 5EFUA 2IC1A 2JG8B 2YROA 1FAYA 4YVSC 1MZEA 3JQWA 4QPYA 1ZX5A 1OOPB 5J3UA 3QBQA 1DIWA 5FAXA 5BNNB 1R1A2 1V9U2 3MW3A 1CAWB 3DL3A 4JC1A 3RYRA 2JDZA 2OA2A 1RUJ3 5KXCA 3LB9A 5FO9B 1TMF1 4KWKA 1X8MA 4Q4X2 1SMVA 3B9CA 2QKDA 2XPJA 3WCRA 5KHJA 2VH9A 3U4XA 2B39A 1YNAA 5DUUA 3RPQA 4M3CF 3VBUC 2PAEA 3PMEA 5A3MA 5K0UB 4DRRA 2D3RA 5E89A 3KB5A 4BOWA 3ME2A 2VECA 5FDBA 2ZBJA 4H3WA 1Z7S3 2E63A 4B7KA 2WNVB 1CQ9A 5ACA3 1NA1B 4AHZA 4LBLA 1UCXA 1YJKA 4LE4A 2ZGRA 1NCRB 2XH6A 5FCCA 2IFRA 5I0UA 3WOGA 3AMQA 2XWBB 1COV3 1XNBA 2XB6C 3ZX7A 2JG9B 4NN0A 5KXEA 2DUOA 4UBHA 4ONUA 2JECA 4AEJA 4FVVA 4CDQB 4OHZA 1QDOA 1X7NA 4LE3A 3PJYA 1D4VB 1QJY1 3O0WA 1MACA 3LZZA 4Q4Y2 5LRSA 2DCJA 3GBWA 2ZTNA 2C9AA 2IZWA 1O3QA 2IXJA 3ILFA 3ZMNA 3HD8B 5KHGA 2ZX0A 1VBA1 1LGCA 4OFGA 5JOZA 3ZXFA 4GH4B 1PZ7A 2EVXA 1O4YA 2WS93 5J09A 1VBD2 1AR63 2WS91 3JD72 3GALA 3AP7A 3NWKA 1ZBE1 1AR72 1FI2A 3NAPA 4JTOA 1AL22 3ECQA 1ENXA 1LGBA 5AVAA 4HKOA 3UJOA 1BK1A 2ERFA