4JGYC

Crystal structure of human coxsackievirus a16 uncoating intermediate (space group p4232)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
236
structure length
231
Chain Sequence
GIPTELKPGTNQFLTTDDGVSAPILPGFHPTPPIHIPGEVHNLLEICRVETILEVNNLKTNETTPMQRLCFPVSVQSKTGELCAAFRADPGRDGPWQSTILGQLCRYYTQWSGSLEVTFMFAGSFMATGKMLIAYTPPGGNVPADRITAMLGTHVIWDFGLQSSVTLVVPWISNTHYRAYFDYYTTGIITIWYQTNYVVPIGAPTTAYIVALAAAQDNFTMKLCKDTEDIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Picornavirus uncoating intermediate captured in atomic detail.
pubmed doi rcsb
molecule tags Virus
molecule keywords Polyprotein, capsid protein VP1
total genus 38
structure length 231
sequence length 236
ec nomenclature
pdb deposition date 2013-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4jgyC00
2PLV2 3VDDA 1MQTB 4CDQA 1OPOA 3VBUC 1F8VA 1R082 1K5MB 2HWD1 1PIV1 4JGYC 4WM8B 5DDJ1 5D8AB 1R093 1Z7S3 2RS13 4CDWA 4YVWC 1C8M2 1OOPC 4Q4X3 4SBVA 1QJY3 1ND2A 4N53C 5CFDA 5BNPB 4YVSC 1ZBE1 1RUF1 1RUC1 1COV2 5JZGA 3J8F3 5GKAC 5C4WB 2VQ0A 1RVF1 1AR83 4CDUC 5BNPA 2X5IC 2R073 1AL23 1RHI3 3VBFB 3VBOC 2GSYA 4RHV2 4RQPB 1RVF2 1E57A 1H8TA 1AL22 4NWWA 1VBE3 1NCQB 3J8F2 2RM21 1COV3 1PIV2 5A32A 1R1A3 4RS5A 4PDWC 2GH8A 4IV1C 5BNNA 3DPRA 1QQP2 4Q4V3 1AR91 1PO21 4AEDB 1D4M2 4GMP0 1RUJ2 1R092 1FOD2 3ZFGB 1C8M3 1HRV1 1QJX2 3NAPB 2RS12 2HWB1 1RUD2 5L7OB 1AYN3 1NOVA 3LOBA 1POV3 1PO22 1QQP1 4WM7A 2HWD2 1TME3 1C8M1 2BFUL 4LLFA 1HXS2 1EAH3 2HWF3 3VBSA 4FTSA 1AR92 1BBT3 2WS91 1POV0 1QJY1 2R042 5CFCC 1ASJ1 3JBG3 4Q4Y3 5DDJ3 5ACA3 5K0UB 1TMF2 1BBT2 1VBB2 4RHV1 2HWB2 2R043 1RUG1 2RS53 2RS51 2ZAHA 1NCRA 4RS5B 1ZBA1 1ZBA3 3VBRC 3JD72 1K5MA 4WM8A 1AYM3 5BNOB 1VBD3 4N53B 1AYN2 1MQTA 1RUF2 2XBO3 3FBMA 1NY71 2BFUS 4GH4A 1RUG3 1QJX3 4FSJA 4IV3C 1VBC2 1FOD3 1W39A 1QJU3 3DPRB 1PO23 1D4M3 3ZFFA 4N43A 1RUD3 1BEV3 1BEV1 4N43B 4IV3A 1MEC3 1MQTC 3ZFEC 1ND2B 5CFDB 2XBO1 3ZFGC 2RS31 1K5MC 1VBE2 4JGYB 4WM8C 1QQP3 2HWE2 2WFF3 1FPN3 1RHI2 2RR11 4YVWB 1HRV3 1V9U1 3JB8A 3ZFFB 1FPN2 1RVF3 4RHV3 4Q4W2 4Q4V1 1X36A 5CFCA 1PO12 2MEV2 1AR82 1BMV2 2TBVA 1M06G 2RMU1 1COV1 3VBSC 1OOPB 1R1A1 1NG0A 1Z7S2 2BUKA 4YVSB 1MEC2 2DF7A 2WLPA 1VBC3 1HX6A 1RHI1 4WM7C 2R061 4IV1B 2RMU3 3VBRB 1RUE3 1VRH2 1WCDJ 5AC92 1PGL2 1R083 2R071 2XPJA 4Q4X1 1AR71 2WWSA 1A6CA 1VBB3 3S6PA 5JZGB 3DPRC 3ZXAC 2R063 3TN91 5BNNC 4IV1A 5ACA2 1VAKA 1V9U3 4RS5C 4Q4Y2 1H8TC 1NY72 2HWB3 1VBA3 5LK7B 1AR62 3ZFGA 3ZFEA 5J96B 1PVC2 1HRI1 3M8LA 1PGL1 4GB32 4N43C 3ZFFC 2RMU2 1HXS3 1B35B 1ND2C 1TME2 4N53A 1EV11 1ZBE3 5CFDC 2BBVA 1OOPA 3J8F1 1RB8G 4YVWA 2BPA2 4GH4C 1RUH3 5ACA1 4FTBA 2WS92 1RMU2 1PVC1 1FMD2 1PGW1 4CDWB 4JGYA 3VBRA 3VBUA 1ND3B 1NCRC 1RUJ3 1SMVA 2ZZQA 1RUC3 5ABJB 1PIV3 5K0UA 4EJRA 4WM7B 4GB31 4Q4W3 3VDDB 1RUI1 3CJIC 5C8CC 1QJU1 1FOD1 3VBSB 4CDXA 1D4M1 5C9AA 4RR3B 1VBE1 1R081 4CDQB 1POV1 1AYN1 3TN92 1VBA1 1FMD3 2WZR1 1RMU3 2WFF1 4CDXB 4JGZB 3ZFEB 1VB4A 3IDEA 1MEC1 2RR12 2WS93 2WZR2 1DDLA 5C4WA 3VBHB 1RUH2 1NA1C 4RFT0 2HWC1 2XBO2 1TME1 4PDWA 4GMP3 4CEYA 1ND3A 1EAH1 2HWF1 3VBUB 1AR63 1AYM2 3VBFA 4GB33 4Q4W1 1HRI2 1PVC3 1VBA2 3VBOA 5DDJ2 4BCUA 1VBC1 3NAPA 4CEWB 1RUH1 2X5IA 5BNPC 4CDUA 1RUE1 4CEYB 1VRH1 5ABJC 1HRI3 3JBG2 5JZGC 2RS11 5BNNB 1V9U2 4YVSA 5C8CB 3JBG1 1PGW2 1RUI2 2HWD3 4CDWC 1VBB1 1RUE2 1VRH3 4RR3A 1EAH2 2HWF2 4QPIC 1GFF2 2RM23 1B35A 1PO11 2MEV1 1EV12 2FZ1A 4NWVA 5AC91 4CDQC 1AUYA 5FMOL 4PDWB 1RUJ1 1AL21 3VDDC 1FMD1 2WZR3 1X33A 2RR13 1AR72 1FPN1 3TN93 1CJDA 4AEDC 1H8TB 1B35C 1CD3G 1PO13 2MEV3 3VBOB 1AR61 5C9AB 1R1A2 4QPIA 4Z92B 2RS33 2Y26A 4RQPC 4RR3C 4Y4YA 2QQPA 4Q4V2 1RUD1 1HRV2 1Z7S1 1NCRB 2ZTNA 4QPGC 2WFF2 5ABJA 4JGZC 5J98B 5L7OA 1NCQA 3JB4C 1BMV1 1VB2A 1QJZA 3NAPC 2RS32 3HAGA 4FTEA 1RUC2 4GH4B 2R072 3CJIB 5A33A 5D8AC 1QJY2 5A33B 2HWE3 5BNOA 4CEWC 3VBHC 1BEV2 2PLV1 1HQNA 1NA1B 3VBFC 1ND3C 4CEYC 1AL0G 1QJU2 1HXS1 1QJX1 4Q4X2 1EV13 1RUG2 1NA1A 1AR73 1RUF3 5C4WC 2HWE1 4GMP1 2PLV3 4CDUB 2X5IB 2IZWA 2FZ2A 1RUI3 3VBHA 4CEWA 5BNOC 5CFCB 4QPIB 5FOJB 1ZBE2 5D8AA 2RS52 2RM22 4Y5Z0 1VBD2 1RMU1 3JD71 3JD73 1NCQC 1AYM1 5L7OC 1ZBA2 4JGZA 1IHMA 4QPGA 1AR81 1ASJ2 1F2NA 2HWC2 2R041 1OHFA 5FMOS 1BBT1 5C9AC 4CDXC 2R062 1TMF1 1TMF3 5A32B 1AR93 2HWC3 4IV3B 1VBD1 4RQPA 1ASJ3 4Q4Y1 5C8CA 3CJIA 1R091 4AEDA 1C8NA 5AC93 4QPGB 5K0UC
chains in the Genus database with same CATH superfamily
3WDVA 2YROA 4YYOA 1IGOA 2OVUA 1Q5OA 4I3GA 4NRMA 4CUGA 1FV2A 2Y8KA 4J25A 1W8UA 4HZFA 3VBUC 1S4CA 4A6OA 3FFZA 1PNFA 1K5MB 1PIV1 1W6MB 1ZRIA 5DDJ1 3AVSA 4KBBA 2B45X 4YRDA 3DXUA 4Q0SA 1NUKA 1FNZA 2ILMA 3TOJA 4J1WA 1LEDA 4YVWC 1W9YA 2WT1A 4LIUA 5FYTA 1QY4A 2A6VA 4OFGA 1W9TA 3IWZA 1Q8PA 4SBVA 5CFDA 3L9JT 4FXKB 4P14A 4AAPA 5CB7A 1COV2 4CCDA 3PVBB 4K20A 3UNPA 1E5IA 3I2OA 3ZSJA 5C3PA 1ZYBA 2YBSA 2P17A 1QH7A 2W39A 4M00A 5FZFA 1DGRA 2XVKA 3KWVA 1LOGA 1F4AA 2QCSB 3MI8A 3N9OA 1WBFA 4OZXA 4ASKA 4ZZ8A 2VXRA 4BQ2A 1MS3A 5I8TA 1IOAA 4QXBA 4FPKA 1RHI3 4ZXEA 5EXOA 1FYUA 2CNAA 3POJA 4RHV2 4KU7A 4OQ9A 3T4VA 3FUQA 4GWJA 1RVF2 5CNAA 3TEWA 1H8TA 1AL22 3VZKA 1VBE3 5F3GA 1UU5A 1COV3 1PIV2 3AP7A 3VL8A 2BZDA 4RS5A 3B94A 4PDWC 4OULA 1ZREA 3CLPA 3H42B 4XTMA 5BNNA 3UK9A 5FZLA 1SEFA 4AFBA 3DYMA 3LIHA 5I91A 3LDBA 4Q4V3 3T0BA 5J37A 4P9WA 5FO7B 1OVSA 5KWRA 4TYSA 5FTTC 4AEDB 4OHVA 4X8NA 2IXJA 1Q3EA 1JYNA 4N90A 5J3UA 3VGIA 2HWB1 4F83A 2VZUA 5L7OB 5A1FA 1C3HA 5FRAA 5BXXA 4NO4A 1POV3 4AEJA 1PO22 4C1XA 3CDZB 1BK1A 2QUOA 4O9EA 1QQP1 4CU6A 4QXCA 5LZ6A 3ZDSA 1JZ7A 1J84A 1UOJA 4MUVA 1JZ8A 1WMFA 1J1LA 2Q4SA 4NMIA 4YWAA 4WVVA 3OGRA 4XFAA 3T0DA 1S55A 1O5UA 1OFSA 5HCFA 3JU9A 2PTMA 2HWF3 5C3OA 5IFTA 3LKJA 4KG8A 3NNMA 4QM9A 4R9BA 4M0NA 3JQXA 4XUPA 4BA6A 1W6QA 4MGQA 2Z69A 1ST8A 4YZ5A 4CRQA 1GR3A 2KA3A 3MW2A 3A22A 2JIJA 1NXMA 2OX0A 2WSVA 4MGZE 3THPA 5HI0A 3DN7A 2ATFA 1EUTA 2ZGRA 1OA2A 4XOGA 3M3QA 1LOEA 4HVQA 2ENRA 2WZPP 2SBAA 3RYKA 2IFWA 4CSWA 2FDFA 5F1RA 3JZVA 1OLMA 2W47A 2KR2A 3AC0A 3WT3A 1GUIA 2IXCA 2R0FA 1PZ8A 4HBNA 1PK6B 1ZBA1 2AEYA 5LA2A 4A7ZA 3ZYJB 1GOHA 1EYBA 1W04A 2ZGOA 3FLRA 4UOJA 3H1WA 3UGGA 4LE4A 2HBUA 2Q8EA 5BNOB 3KCXA 2CDOA 2WNUA 1AYN2 4GH4A 2UU8A 3RGBA 1CIWA 5FZOA 4DEQA 1CAUB 2ZMNA 1FOD3 1W39A 2WUHA 5C3RA 4X6RB 3SH4A 1QJFA 1PO23 2RG4A 3IBMA 4C0BA 4COWA 3BTZA 4RYDA 3T1LA 4ZPIA 3VHRA 1AX1A 4B4RA 4IV3A 1WD4A 1MEC3 3VZOA 1MQTC 2G4IA 4G4FA 3ZFEC 1UKRA 2EA7A 2QKDA 1TNFA 3NRUA 4TZDA 2RS31 4PI2A 3IAPA 1PZ9A 3LFIA 3WG2A 4ASLA 3R6SA 4QQ2A 1RINA 5BY5A 5FZ8A 2B42B 2EXKA 2Y6KA 1RJ7A 2ZHMA 3H3LA 2WFF3 1FPN3 2G9ZA 4XACA 1QH6A 3PTRB 1VJ2A 2Y64A 2R7EB 3OCPA 3GALA 4YW7A 1ULDA 2K46A 5F39A 1HLCA 1RVF3 2B7YA 2WJSA 1US3A 2YYOA 1GLHA 4RHV3 3ZKUA 4Q4W2 4AQ2A 4AGVA 5J36A 1TE1B 2VXJA 2D40A 4EWDA 5CFCA 1BYHA 4LULA 4XBNA 5IT6A 4YGBA 5SV8A 5DMYA 4YGCA 3CBNA 4ZS3A 1F9KA 3G7DA 2AH2A 1MZEA 2RMU1 3DKQA 4JKLA 1ZZBA 4IE7A 5GLVA 3RFRA 1W8TA 5FXVA 4CUCA 3VBSC 1IS5A 2OIIA 3RPQA 1R1A1 3O1MA 3S5AA 4L11A 5FYYA 5G05L 1NE4A 2BUKA 2XL7A 2NZ9A 4YVSB 1UOBA 1BJQA 5IK4A 1HX6A 3HPNA 2GN7A 4MSVA 2IXLA 3VDCA 1YHFA 5JAXA 2VY0A 4IV1B 5AFEA 1I5PA 2RMU3 1VRH2 2E26A 5AC92 4TWTA 3V56A 4ZHNA 4AEKA 3V0BB 1N1YA 3UT0A 2CAUA 4KG0A 5A6QA 5DUVA 1W8NA 4LBQB 1DZTA 1JI6A 1AR71 1SHWB 2HEYF 2X10A 1JW6A 5FZ0A 3SC7X 3NMBA 2DTYA 5FKBA 1AX2A 5K9YA 1YO8A 1SLBA 4E2GA 1KFXL 2QFEA 3THCA 3TNPB 3IIAA 2YBPA 4CXYA 5ACA2 3O7OA 4LLOA 4BZ4A 4Q4Y2 1E5HA 5FYUA 4FPJA 3VZNA 1NY72 4CCEA 4LJHA 2BGPA 2BERA 4KWKA 4Y22A 4XUOA 1CGPA 5C70A 2GNMA 4AVSA 5B4NA 1UPSA 3FUOA 2XB6C 4LOTA 1UU6A 1LJ7A 3HIFA 3PMEA 4ITCA 1W6PB 3FN9A 2JDPA 4JQTA 1MR5A 4BLIA 2YXSA 2RMU2 3HEIA 5KXCA 1LR5A 1HXS3 2PAKA 1K3IA 4MO3M 5E1RA 5A6XA 2LS6A 2WAAA 2DU1A 3J8F1 5FWEA 4MX3A 3TBDA 3CF6E 3D0JA 2BPA2 4FVVA 3AZWA 5G04L 4DNYA 2FMDA 2Q0AA 1M4WA 2LROA 1FMD2 1PGW1 3O1SA 4K21A 2PHWA 4I3PA 2YDEA 2E6VA 2ES3A 1K5JA 2WYFA 3QH6A 3VBUA 1WMXA 4QU1A 5E16A 4C90A 2ZEZA 1NXD1 4MVTA 4H2AA 4QGLA 1RUC3 4XURA 4RGGA 5FPLA 3C2UA 5EJ1B 1XU2A 1JZ5A 4QXKA 1XE0A 1YQCA 5A70A 4Q4W3 5ISLA 3PIGA 4CE8A 5C8WA 1U5YA 1RUI1 5CZKA 2BJSA 2ZPXA 1C4RA 1W6QB 1BQPA 3BIEA 1SBEA 5DN2A 5A7QA 2ZA9A 3A23A 3VBSB 1OSGA 2J1VA 4NHYA 3C7EA 5C9AA 1G9AA 3BGAA 2BW8A 2G9FA 1VBE1 3FC0A 1AXKA 1ENXA 4G9SB 4KWUA 4GKXA 1RYYA 3ZXJA 1BZWA 4BQXA 1ZRRA 4FPHA 4H7MA 4P9IA 4GJYA 1CR7A 3SITA 2EXJA 3WP4A 3LFMA 4QDQA 1G9CA 2K2SA 2HLEA 1UD1A 1YIPA 2E33A 1LOAA 4UW3A 1UMIA 1VB4A 3S7IA 5A3PA 5IYYA 5GZGA 4KWLA 5FXZA 5F7UA 4FOQA 3AZXA 4CXXA 3LA3A 4E4SA 2BV4A 3C7HA 4EE2A 4XFHA 1UY1A 4H14A 5DAXA 4EWAA 4IEVA 1DDLA 3U14A 5I8YA 2BNNA 2V5YA 3H1YA 3C8XA 4LBOA 5F6KA 2MNGA 2A3XA 3B02A 4QB1A 1CJPA 2XBO2 1CWPA 1IPJA 5DUWA 4CCOA 3I3DA 2FDHA 4C1WA 2HWF1 3DL3A 4FXGB 5FBJA 2JB4A 5LATA 4E4ZA 5GLTA 2JIGA 4HN0A 5HCAA 2H6CA 4XBLA 4IEYA 3ZYIB 4A2UA 3PUHA 4BB3A 4W65A 4Q0QA 1N47A 2E63A 2A1XA 2HBTA 1V00A 5D1IA 2D44A 1UOFA 3UKVA 2VOXA 2VVEA 1OT5A 2QQUA 2XQRA 4V2VA 2QVSB 3J7LA 1DZRA 2X5IA 4AI1A 2EIBA 5JSOA 4UFJA 2TEPA 1OQDA 4LK6A 5FO9B 5EQUA 3VL9A 4B7KA 3NJYA 3JBG2 4Q2FA 2CL2A 5KC5A 2VUJA 5EV7A 5JCTA 1PGSA 1QJEA 2XL9A 3DYOA 5T55A 4K40A 1V0AA 2LW8A 1G8WA 4JDOA 1HJFA 1PGW2 1WLCA 2Z42A 2JX9A 3WDTA 4ZU4A 2BYVE 2EIDA 3AX4A 1EAH2 3J7HA 4N9IA 1B35A 3WCRA 3I59B 4A41A 1O8PA 5A3NA 2R30A 4OMDA 3NVCA 2QJVA 3WV6A 5FMOL 5J1XA 3MF9A 2NQYA 2YC2A 5HV4A 4K7JA 4EN0A 4GZ9A 1O91A 4QD2A 3FFQA 4E4HA 3D0SA 3TN93 1W0NA 1CJDA 1XSRA 3VUOA 4AEMA 1H8TB 1TNRA 1CD3G 4NPMA 3VBOB 5KXBA 2P3JA 1XXNA 5FZ3A 4QPIA 3AP9A 2Y26A 3ILFA 4XABA 5GALA 5JPMB 3N9QA 1MZ6A 4IEPA 4MGKE 4TLFA 4YW4A 5I0UA 1J83A 1JOBA 1OD5A 2XKOA 3U78A 2D3SA 4A4AA 3UJQA 4EYUA 1SLLA 3SH5A 3D5OA 3ASIA 5LASA 2NN8A 1NCRB 1Y9GA 5A1LA 5F3EA 1ODNA 1SFYA 2W91A 1DQ1A 4YM2A 1GZWA 4AFDA 5J98B 5L7OA 2FDGA 3JB4C 3GZUC 2HKXA 1XBFA 3NNLA 2JB8A 2PXJA 4I0WB 1OA3A 1QOOA 5JVVA 3NAPC 4K9SA 5A3LA 2A70A 1YJLA 4LHNA 4BOWA 1IPSA 2ZGLA 5D8AC 3ZSLA 1GICA 1G7YA 1LRHA 5A33B 3ME2A 3WD5A 5JIAA 5FLHA 3LDKA 2PLV1 3WSOA 5IK8A 4HANA 1GP6A 1ULEA 4XC9A 4FOYA 4EZHA 2C4XA 5CBLA 1IS3A 2RDRA 1LNSA 3CZJA 1ND3C 4YW3A 2CHHA 1HXS1 5JSPA 5L73A 3ZSKA 4BXSV 4OLLA 3HJRA 3PLQA 2V4VA 3GDBA 3N4MA 4RSUA 5C4WC 2C1FA 3SKVA 4A42A 3G6JB 1X50A 4BM8A 4CDUB 3RMXA 4GWMA 2X5IB 4FPCA 4NIHA 2Y6FA 3J9SA 1C28A 2BVVA 3CL1A 3LPGA 5CFCB 3BPZA 4D7TA 1MS8A 4D3WA 4AHZA 4CP9A 4IESA 4S2HA 1YFXA 2JG8C 2UYAA 2ZS6B 1RMU1 1AYM1 4Z2WA 3MO4A 1OUSA 5GZFA 1JHNA 4XJ8A 3SLIA 3I2FA 1YFUA 4BIOA 4OUSA 3WF2A 3BTYA 1F2NA 2D6NA 2PHTA 3IDAA 3MIGA 5FZ7A 2R041 2VVFA 1OHFA 5CA6A 3RQ0A 4HK9A 1UF2C 1L3JA 3I3MA 4BK5A 3IAQA 2ZHLA 1WGPA 4GXLA 1TMF1 4EN8B 5J48A 3KT1A 3VLBB 3CJXA 4ET7A 1DYKA 2D5HA 2ETEA 4K6BA 3ECQA 4AWDA 2HWC3 4IV3B 4QMAA 1MS9A 4RQPA 1NLRA 5FP8A 5HXVA 3DYPA 2QQKA 3WDUA 2WAOA 3AYDA 4P5HA 1Q43A 1C8NA 2H6BA 1W8WA 3JUUA 3D4KA 3PVOA 5CKQA 1H1IA 3I4IA 2PLV2 3AFGA 4BH9A 4H7LA 5F8PA 3VDDA 2V4AA 5A3MA 3ITQA 2FCVA 5DUXA 5AVPA 1F8VA 3J26N 5A3WA 4IEXA 4JGYC 3MF6A 3MHZA 4BXFA 2WINB 1EY2A 4WVWA 5D8AB 3MV11 1DLLA 1CPMA 3J7NA 4RGKA 4Y1XA 3T3YA 5IAVA 1SQ4A 1YI9A 2JXAA 3WVJA 5CADA 4UYBA 4D6QA 2QE3A 4XYXA 4JTOA 1OBNA 1QJY3 2J1AA 3AMPA 3D3AA 3NV2A 4ISRA 3ZN6A 1ZBE1 1RUF1 4DXSA 1RUC1 1W3XA 2YMZA 5JZGA 4UFIA 3WOGA 4RA0A 1VRBA 5GKAC 3S30A 5C4WB 4N7IA 4OZOA 2VQ0A 4YFZA 4LBMA 4CVUA 1AR83 1UX6A 4CDUC 1WLDA 4Y4RA 2X5IC 2R32A 3ZN6B 2P1BA 4NR1A 5CU1A 3ZXFA 1HKDA 3ES4A 4E9KA 5JOWA 3E1F1 1AL23 1PZ7A 2JE9A 1QHDA 4IXLA 4ORFA 2VOKA 3WUDA 1VIWB 4QWNA 3ZXDA 3O1TA 2PQSA 3OUHA 2VVDA 3TWIA 4NWWA 4BDVB 1KD7A 3WUCA 4LHKA 3J8F2 4FPEA 1YQ5A 4S2DA 5A32A 5LEJA 1F35A 1EP0A 3Q8AA 3ACFA 4Q29A 5JXIA 3BKZA 2GH8A 2GC0A 3N7LA 3PDQA 5FPVA 4KI5M 2JG9C 1QQP2 2BNMA 5FYMA 1AR91 3M1HA 5JI9A 1O8SA 3MZHA 1H2MA 2HYXA 2E53A 1D4M2 3HMYA 3ZIWA 1D2SA 1RUJ2 1R092 3POSA 1LULA 5KHIA 2R16A 2RDNA 5FYCA 1HRV1 2YG0A 2NM1A 5CIRA 1URXA 4URTA 3W5MA 1G9FA 1YJKA 4UBGA 1UYPA 5CG9A 1NOVA 1U5IA 4IE4A 3LA2A 4Y22B 5HV0A 4JC1A 3WHTA 4J6GA 4GQ7A 3B7MA 2IFRA 1BKZA 1JUIA 1L7LA 2OPKA 2HWD2 2ZHNA 3AMQA 2E32A 2RHPA 4NIIA 1FV3A 4I09A 2GDFA 5CVRA 3GZAA 2DCTA 1XJAA 1Y9MA 2Y6JA 4HLTA 1PX4A 1X82A 4WZFA 1GWLA 4AXOA 1OVPA 1QNWA 4FPFA 5EJ3A 1H0BA 2ZGPA 5EP9A 3ABZA 2VD7A 1O3RA 2OQ6A 4BQ1A 5T5OA 3OG2A 1POV0 3LGRA 1QOSA 1Q8SA 4BHPA 2R042 5DXDA 2VMEA 2D5FA 4HPKA 1ASJ1 4Q4Y3 5DDJ3 1W05A 3P5BA 5FY9A 5ACA3 3TEXA 5FZEA 1W28A 4DXZA 4YZ4A 1LESA 3A0NA 4OUMA 4L97A 3KVAA 1UZZA 5FZ4A 5DG2A 2I74A 3E5QA 1JTZX 2VZRA 2IXIA 2ZHKA 2RS53 3RNSA 4XDQA 4ARXA 3INAA 4AI9A 5E88A 3RYRA 3NKTA 3VBRC 1V6JA 2DUPA 2QQOA 3JD72 3KV9A 3LE0A 1K5MA 4BQ5A 3T30A 3POWA 1VBD3 3U10A 1MS5A 5FMBA 3WF0A 4FPLA 3D8CA 4BJ0A 1RUF2 2BFUS 1AJKA 3GNEA 3GZEA 4QX0A 2VM9A 5DAWA 5IWFA 5JWPA 3H3UA 2CDPA 1G9DA 4OQ8A 1QJU3 1R1ZA 2XR4A 3DPRB 3RJ2X 2WL1A 4L2NA 1D4M3 4ATEA 1ULOA 2JG9B 3C3VA 4XETA 2PHXA 1FI2A 1S0JA 5I8SA 3MLKA 3R4SA 1ND2B 1PMHX 4NUBA 1YRZA 1N3PA 1ONAA 4AVAA 2BQPA 2DCZA 4HK8A 1JOJA 1XU1A 4Y1YA 3ZXEA 4WM8C 2WC2A 3LD8A 4NHKA 3TEYA 4YLZA 2HWE2 4LBLA 1F31A 4GWNA 1XNDA 4PJYA 4XPVA 2E51A 3WNKA 2RR11 2DWRA 1BLZA 1UNBA 1V9U1 1QDCA 4FPGA 1GYKA 4OHXA 5HBAA 2DCKA 3JB8A 4PBPA 5FK8A 3ZFFB 1FPN2 4X8PA 2VL4A 2WWUA 3DUIA 4CCJA 2PHLA 4RD7A 5L36A 1EPWA 4L9BA 5GLUA 1FXZA 4B29A 2RE9A 1Y7BA 4COZA 5B2GB 4LT5A 2JD9A 2O1QA 1GSLA 4A6SA 1ALYA 3I59A 2VTFA 2ZACA 2W87A 1NAEA 1PO12 2MEV2 3E5XA 4WZCA 2P5BA 4AQSA 4D7YA 5C5UA 1VE0A 5IUQA 4LO5B 2YC4A 3KM5A 2JICA 4OCTA 2VCCA 3KGZA 2A3YA 4A7KA 2OUJA 1OQ1A 1A8MA 1NG0A 1NYWA 2VZPA 4FFGA 5LK5A 4AOCA 2VH9A 2YBKA 5D2AA 3W58A 5EJZB 3K3OA 3NO8A 4LR4A 1C1FA 4MXWA 5H9QA 5J09A 4XF4A 2J1EA 4IEUA 3RWNA 4XUTA 4YARA 2R061 1QIQA 2PHUA 1WD3A 3VBRB 1RUE3 4O65A 1W2UA 4B3NA 1PGL2 1R083 3IM0A 2C5DA 3GBWA 1UY0A 4EZ4A 1LGBA 2Y38A 3O14A 2JKBA 4HOOA 1UZYA 1I3HA 1PM7A 2VZQA 2X8KA 4FOVA 4E4DX 3AKRA 3KD4A 2CV6A 3DPRC 1GQPA 5JZGB 3CNAA 1D4VB 4IV1A 4LMFA 3KF3A 2AUYA 4D0QA 1JXNA 3AFKA 3MIHA 3K4AA 1LOFA 1VLNA 1XOYA 3FHIB 2HWB3 1SLTA 1D0HA 3LF7A 3OOXA 4OVEA 3ZYRA 1CAXA 5KC6A 4PIZA 1VBA3 2F4PA 2QQMA 2X29A 4XIOA 2JECA 2VMCA 3ZN4A 4WV8A 3GF6A 1AR62 2QQLA 1T6GC 2UYBA 2VZOA 2JDYA 3HVDA 3O0VA 3WQ7A 3ZFGA 3ZFEA 4LITA 1SLCA 3SCFA 2QZ3A 4QHZA 3HQRA 5JR2A 1GV9A 4XFGA 5J96B 4Y20B 2ADEA 2W1WA 3VHOA 4P02B 1PGL1 2BOIA 4MADA 4PT6A 3ZFFC 4LK7A 4OUEA 1W03A 3GBGA 2WIIB 1B35B 1VALA 1ND2C 1TME2 2AENA 3NNFA 1ZBE3 2ZJCA 1LOCA 4N53A 3QACA 1OOPA 4XAAA 1IKQA 4E27A 2NYYA 1RGSA 4AE2A 4QQPA 4XFBA 4GH4C 4DINB 3AYCA 4QQOA 5FYIA 3RI8A 1F5JA 4FTBA 2VQUA 2WS92 4O61A 3H9AA 4FPOB 4IGPA 4R9DA 4Y5SA 5F5IA 5LY1A 3BODA 1JS9A 2ADDA 3E6DA 2QDRA 1JN2P 4KBZA 4UFKA 3VHPA 1LB2A 3U07A 1PIV3 4FP3A 3AB0A 1H1AA 2LM3A 4MH0E 2IC1A 2F17A 2XJSA 5K0UA 4OI0A 3BI3A 3IN9A 1NKGA 4BE3A 4GB31 2B4KA 2R49A 3CJIC 1S2BA 3T2PA 5C8CC 4AF9A 4MZUA 5IK7A 4XF0A 1CAUA 4FQZA 5I0SA 2OZ6A 3VKOA 3UYJA 3AZZA 3BVCA 3LA7A 2XHNA 3VN4A 1QJU1 3QH7A 1QF3A 3I54A 2G9GA 4RN5A 4QKFA 3ST7A 4CDXA 4E2QA 4AGRA 4RR3B 1UMHA 1DLCA 3WZ1A 4QGMA 1R081 4PQQA 1EPZA 1WUVA 1O3TA 2ZGSA 2FCTA 5IW0A 4Q0VA 5T54A 2DFCA 4TXWA 5FP7A 4EN9B 1POV1 4P9YA 3GYDA 1AYN1 4Z2AA 4O9GA 2RDQA 5FYVA 3TN92 1TQ5A 3BTAA 5GZDA 5H9SA 1CESA 1O59A 5LRRA 1JYCA 3ACLA 2DDUA 3KV5A 4HKWA 1RMU3 4IE0A 4Y20A 4Y24A 4CDXB 1JYXA 3HT1A 3IPVA 1QXJA 3ZFEB 3POEA 4EN7B 4I0AA 4HKLA 3IDEA 1OH4A 2WFPA 1G6NA 1OF3A 4QHOA 2RR12 3R4UA 2VZVA 1PMIA 4XHBA 4D94A 2WZR2 4S2GA 4YSFA 4UW4A 3S7EA 1IPKA 1FNYA 1NA1C 4RFT0 1DYOA 2OT7A 3SMHA 3H7JA 1PX3A 4ZKTB 1TME1 3UKTA 1Q8QA 4GMP3 2VNOA 1U5XA 4PDWA 5GJ6A 2WO3A 2O0OA 3VBFA 3VKFC 4Q4W1 3URFA 1PVC3 3BIWE 1LHNA 3OEBA 1NQDA 2JDMA 2OQ7A 4XHXA 5FIXA 1ZX5A 4UXAA 5FZGA 3VBOA 3LWCA 2ZXQA 1DG6A 4HG6B 3X29B 4A44A 5CG8A 4BCUA 4OHYA 1VBC1 3K48A 3MIEA 2H0BA 5DG1A 1CAWB 1YYNA 2V5DA 3UJOA 4CEWB 4FAHA 5JOZA 1CIYA 2BOJA 3LPFA 1JHJA 4RGAA 4JKKA 5EHDA 1RUE1 1ULGA 1S0GA 4M3CF 5BNPC 4CEYB 1IG3A 3ETQA 1SDDB 3LAGA 5DZFA 3K4DA 3RZLA 5LWBA 5EIYB 5LRSA 2HYKA 1C1LA 2RS11 1XYNA 3AKTA 5BNNB 4MXWB 1V9U2 1AZDA 2JE7A 4MYEA 4YVSA 5C8CB 4JDNA 2J42A 3IMNA 1G86A 1STMA 2G19A 1Q8OA 2GMMA 1LTEA 1RUI2 2PHRA 3RVHA 4AHYA 1LODA 2OZJA 5LA0A 3J7MA 5ERLA 3W5NA 1XYOA 4RR3A 1LHUA 1SPPA 2X09A 3WNOA 3JXSA 5JMOA 3WQBA 2J22A 2N7GA 3WW4A 4I02A 1WW7A 3OUIA 4FI9A 4AHXA 4ZONA 1WLTA 2R1DA 3GJBA 3PJYA 1AUYA 3NKGA 1RUJ1 1AL21 2VPVA 4META 2WT2A 2EIEA 5FPAA 3SEPA 3OB8A 3ZIXA 2AC1A 2XMLA 3LCPA 5FYHA 2VOTA 2IXKA 4TLGA 1N1VA 2FHRA 4RR3C 4HVRA 3LEKA 3V65A 2YHJA 4AFMA 3WR0A 2GMEA 1ZZ8A 1GZCA 5DZGA 5EFUA 1ZZ9A 2B8MA 3MIDA 4HSJA 4AGGA 4PLNA 3T2TA 2XJRA 1RUD1 2ZBJA 1W6MA 2DUOA 3BPSA 5EYYA 2P6CA 5IVVA 1HRV2 2ZX1A 4W50A 1UYZA 1D2QA 1Z7S1 2XJPA 4YW6A 4QPGC 1PNGA 1UY2A 4XIKA 4JDMA 2CTVA 3N9MA 5FZMA 4P9JA 2HJIA 2A6XA 3D82A 5FUNA 4NIDA 3MDPA 1XE7A 2QZ2A 1MZFA 3H3ZA 1DCSA 3KV4A 1BMV1 1QJZA 2RS32 2ZX3A 4I0BA 2GC2A 1RUC2 1ULCA 2QQJA 3AP5A 5FREA 4NRQA 4IQPA 2FD8A 3R0RA 1YNAA 4IDZA 2DBNA 4YGDA 5KXEA 5BNOA 4UI9L 4CEWC 4LIVA 1BEV2 1NA1B 1CN1A 3VBFC 5E8AA 5B4XA 4CEYC 1GQGA 1MS0A 1JYVA 2W95A 1I6XA 4D6SA 3H8RA 2IVJA 3LEGA 1XNBA 4LO7A 1WZXA 3HBZA 3THTA 5FZHA 1RUG2 1NA1A 3BUCA 1HJGA 1E5SA 4BWOA 4ZU7A 1DYPA 1I1EA 1BVP1 5DAQA 4DOUA 3AK0A 4L92A 3ZM8A 4W8JA 4LHSA 4Y33A 1JZ2A 2YV8A 1MS4A 4QX5A 3VBHA 2DFBA 4OI1A 4COYA 2PFWA 1ZZ6A 3I2JA 4CP9B 3OD0A 3S0MA 2Z2SB 2XXZA 1X9TA 1MVEA 3PUQA 1C5IA 4IEOA 2YFZA 4LOSA 1XNCA 2CGNA 1F5FA 4CU7A 1QMJA 3JD71 1NCQC 2P4EA 3OGJA 4JGZA 4XJ9A 2ZMLA 1LGNA 3AL5A 4PI0A 4FAGA 3TEZA 4FFHA 1YQ2A 1POQA 1ULPA 1PK6C 3WDYA 1GKBA 3MUY1 3EBRA 2HWC2 5A7PA 1WCQA 1IKPA 5CYYA 1V6NA 1H2KA 5IJRA 3LB9A 3OBZA 3VHNA 3GGLA 1TMF3 1UZVA 1AR93 2VCMA 1ENQA 1H30A 2QQNA 3I97A 5FMCA 3ZN5A 4Q27A 4XDPA 3C7OA 1VBD1 3O0WA 3BYWA 5L9VA 4Z07A 4TTGA 3T1MA 2YB7A 5C8CA 5F5CA 2WZ8A 3EXUA 1KQRA 2GAUA 4AEDA 3VKLA 4LO8A 3Q8EA 1OLME 5AC93 4C91A 2D6OX 4IL7A 5C3QA 4QPGB 2BWCA 1DQ2A 2WNVB 1WW5A 4R8HA 2NPIA 1O6UA 1KFUL 1MQTB 2A73B 2ZGNA 2VZ3A 1NT0A 4FFIA 4CDQA 3NSTA 3POGA 4QU2A 4HPKB 1S0EA 3OF1A 3SCHA 4UAPA 2HWD1 5FZ9A 4LTAA 1IS4A 2YU1A 3SQOA 4I30A 5IFPA 2WWJA 4XILA 2RS13 4Q8LA 2VULA 5DUUA 1C8M2 1OOPC 4KNCA 4L8QA 2J1RA 1OKOA 1ND2A 4N53C 2IXHA 4OHWA 2DVFA 1IQAA 1WMDA 2P6HA 5FJKA 3E5UA 3WX5A 1UQXA 3M2MA 3ETPA 4IERA 1RVF1 5A1AA 3HN1A 4XBQA 4DXRA 5FY0A 1T6BX 5BYNA 1WA6X 1J1TA 1SBFA 2ZOEB 2ZX4A 1HQWA 4WVZA 3VBFB 1I9RA 2GN3A 2HEWF 2ZGTA 4TSVA 3DGTA 3THDA 2VBDA 5HXMA 1RC6A 1UYXA 1UOGA 3MBWA 4RQPB 5LY2A 2ZGKA 2XJUA 1NCQB 1ZA4A 3ES1A 3CKHA 1R1A3 5FZKA 3K3NA 3SXWA 5EPAA 2W9XA 5K4LA 4IV1C 3BB6A 4QKNA 3H1MA 1LOBA 2VUDA 2WQZC 2D6PA 3N35A 4HL0A 2F4LA 1PO21 2GALA 1ZA7A 2JDZA 3O0XA 5T5LA 3U1XA 4GMP0 1OI6A 1O4ZA 3L2HA 2K9ZA 1ACCA 3IPVB 1FOD2 1NQJA 2YPJA 3ALQA 4ZY9A 4CP2A 5K7PA 3MPBA 1GWMA 4LKFA 1NLQA 3N9PA 1RUD2 1V6OA 3FX3A 1Z78A 3AKQA 1AYN3 3MYXA 3RZJA 3L2YA 1LENA 3LOBA 5M0TA 4DY3A 3K46A 3KHBA 3Q8CA 4UF0A 4WM7A 3S57A 3MW3A 5LA9A 1OXCA 3KQRA 2WNVC 3WQ0A 2ARXA 3A7QA 1RUOA 2D97A 1TME3 1NX9A 1C8M1 1UW8A 4LLFA 3U11A 4XFCA 1EAH3 2A6YA 2JWPA 1J3RA 2EAAA 3KT4A 2Y60A 4FTSA 4LBKA 2VGDA 1C5HA 1DP0A 2Q8CA 3WG4A 1AR92 1V6LA 2VECA 4FT8A 5BNQA 2WS91 5A3TA 4GULA 3ZLIA 2XVLA 1EUUA 3CEWA 3N36A 5DAPA 2Q8DA 2WLQA 1GQHA 4R52A 5FY1A 3JBG3 5JXHA 5IVBA 5AVAA 4B8EA 1YQ8A 4A7YA 2VCAA 1J3QA 1Y3TA 4P9LA 1A3KA 2WA3A 4COUA 4RHV1 2HWB2 1W3VA 3M3EA 5E6HA 3V0BA 4AVVA 4CYDA 1ODMA 3ZMNA 2DCJA 4LO6B 1JODA 3AVRA 5A7NA 2O8QA 2RS51 4N9HA 3KSCA 2ZAHA 2XVGA 3V0AA 3QCWA 2W1SA 1ZBA3 1H6YA 2CWMA 4WM8A 1JZ3A 5FAXA 4NHMA 1LU2A 4NHLA 4XFIA 3ZPYA 2R0HA 1A8DA 1UMZA 4N53B 3IZOA 3ZYFA 4DPNA 3POBA 2ZEYA 2XBO3 3FBMA 5GLZA 3H7YA 1RUG3 4XQWA 4FSJA 1VBC2 4YNIA 3GCXA 2GP5A 2VU9A 3FWEA 1GZ9A 4R9AA 4D7SA 5FO8B 2P3KA 1RUD3 1O4TA 3BOWA 1BEV3 2Q1MA 4N43B 4JVAA 4IEZA 1CPNA 2A5ZA 3OY8A 1XNAA 4WBBA 3U4SA 2GZWA 3UV9A 3WG3A 2XBO1 3ZX7A 2GC3A 3NV4A 4XJZA 2PHFA 2EXHA 1K5MC 1VBE2 4YZ2A 1G9BA 1KJRA 3LOIA 1REEA 4KGQA 4UBHA 4NAMA 1GZTA 1N3OA 1S0IA 3WLUA 2JEMA 3JQWA 3K77A 1RHI2 5FYBA 3I3EA 1T2XA 1UL9A 1V6IA 1X8EA 2W94A 4M4PA 3LEMA 4YVWB 1HRV3 1BHGA 2FCUA 2PA7A 2CWSA 3GCWA 3BCWA 3OPZA 3USUB 5T5PA 1GNZA 4UFLA 5A6ZA 5IAXA 2ZCWA 3WDWA 3AKPA 2Y6HA 3B5LB 4NOTA 4BQ3A 4AQTA 1SFNA 2V09A 5IVYA 3WP6A 4CXWA 5FY5A 3IMMA 3NNJA 3B3QE 1BCXA 3T2QA 3HD8B 3F2ZA 1UIKA 1M06G 1KS4A 2VAUA 1JH5A 4W6YA 1N1TA 3KGLA 1COV1 4P00B 1GZWB 3M3IA 2XG3A 1JUHA 5A7WA 4CPBA 4OHZA 5KBFA 3WNLA 4LO4B 4QX1A 1VP6A 2OUHA 3LZZA 1HDKA 1RHI1 4WM7C 3M3OA 5BPXA 4AFAA 5JSRA 3J4UH 3N9NA 3I2KA 3GXUA 3H0OA 3APBA 2DBIA 1PMJX 4Y1ZA 5FZ6A 5GLWA 1PM4A 4ONUA 1YUDA 3IIIA 4XCBA 3VKMA 2OS2A 4MGTA 4YGEA 3W9AA 2R071 2Y0IA 4AAXA 1AF9A 4Q4X1 2A6ZA 1WW6A 1WCKA 1VMHA 2WWSA 1KDKA 2C9KA 3PMSA 1VBB3 3S6PA 3O1PA 3ZXAC 2A75A 2F6BA 2R063 4IGQA 4NPRA 3TN91 4GALA 4X6QB 3RI9A 1F15A 1OD3A 5A7OA 3KS7A 1XYPA 3VDBA 3POFA 2DUQA 4PHZA 1GBGA 4G3YC 4JV4A 4XJWA 1MACA 3GZTB 5GZCA 1HB4A 2ZKLA 3CIHA 2H0VA 3FE5A 1XB9A 3N7MA 1YQ6A 5FYZA 3WW3A 5LK7B 3ZO0B 2VNRA 2B9UA 1GNHA 2WA4A 1CX4A 1XNTA 4O7XA 3B93A 2C9AA 4UFMA 5H9PA 1JU3A 4JTNA 4UW6A 3I49A 3U4XA 1IS6A 4GB32 4N43C 3KVBA 4YZ3A 3SKJE 4XE9A 1MS1A 3NJZA 1MVQA 2MPFA 3AYAA 4KQ7A 2CU5A 1WKYA 1NZIA 3OPTA 1RB8G 5JMCA 4XF9A 1RUH3 4XUQA 5ACA1 4LE3A 1GNYA 4FQ4A 3FL7A 5K8SA 1BXHA 2FMYA 1SACA 1RMU2 4LKDA 1PVC1 5LBEA 3PURA 1U5ZA 1W8HA 4CDWB 2JE8A 4LNVA 4JGYA 2OW4A 2DVDA 3MEPA 5FLIA 1SCRA 2DCYA 4B7EA 1NCRC 4CCCA 1RUJ3 1S0CA 1X7NA 1SMVA 1UAIA 2ZZQA 3D6EA 3ZVXA 2AGSA 5I93A 2FDKA 1O4YA 5APAA 4URAA 3ZYHA 5T52A 2VOVA 4AVCA 1LGCA 4WM7B 2NP0A 5I0TA 4H3WA 2BGOA 2DVBA 4NE9A 1RUNA 3DEMA 3OGSA 4XTPA 2A6WA 2GU9A 2LTNA 4U36A 3NJXA 2WRAA 3FMGA 4AVTA 3VD9A 2NLRA 1FOD1 3AP4A 3PIJA 1YC61 2EXIA 2WNOA 1W2TA 1D4M1 1DFQA 2BEOA 2XGXA 2XWBB 3C7FA 3BALA 1UPIA 3RZHA 3B01A 3ZXKA 5KXDA 3U75A 3SHRA 1DQ4A 4Y5TA 3NQHA 4NHXA 3I2IA 4WVMB 3FHAA 3WF3A 3U0ZA 3LSDA 1W6NA 2JDAA 3B9CA 2VMGA 3PHMA 1XSQA 3KZ4C 2QQWA 4LUMA 3HOBA 1S0FA 1CZSA 4M3CE 1W6PA 4Y3OA 3TYJA 3P3NA 5LBCA 4JGZB 1QXPA 2E7AA 5BUVA 3O1UA 3LIGA 1UO9A 3MPPG 4P9GA 1MEC1 3SEEA 2DVGA 3WQ1A 5T5JA 5FUIA 5F6LB 4AYUA 5F5QA 4CPBD 5C4WA 1UZWA 1GOGA 1RUH2 1LCLA 1RXGA 4WVMA 3ZYBA 3USSA 1Y43B 2FBEA 4QDSA 3B00A 5FZCA 5LEKA 4XMIA 4QX3A 5C33A 2DU0A 3P1IA 4UW5A 4CEYA 5IATA 1ND3A 5LCWL 1EAH1 3N7JA 2VOWA 3VBUB 4A3XA 1AR63 2W1QA 2UY8A 4GB33 2YU2A 1JZ6A 1HQLA 3POIA 1W0OA 1VBA2 4XFFA 2WQ4A 3RJRA 3TNQA 2RJ2A 3PVNA 3KLSA 4XXPA 1DF0A 2ZMKA 1REFA 4UWDA 1J59A 2WDBA 2E7QA 3PJQA 1XNKA 2L9LA 1CONA 5FZAA 1HV0A 4QM8A 2W3JA 3OGGA 3ZPOA 1RUH1 1WLWA 3PVEA 5IVJA 4JKMA 4MHUA 5DAVA 3VD3A 4MG2A 3HWJA 3PUAA 3ACHA 4HT1T 3GBFA 4KU8A 1HRI3 3WHUA 4QB2A 2GNDA 4Q26A 1V6MA 3FBYA 3GJAA 2VG9A 1W2OA 4FPYA 4P5YA 4CUBA 2ARAA 4K8RB 3RG0A 4B1MA 4GKYA 3AMMA 3HQUA 4JHZA 4PF1A 5FFOC 1W2AX 5DQ0A 3V64A 3Q8FA 2DURA 3R05A 4CDWC 4UT5A 4AG4A 1RUE2 4Z1VA 1FATA 2HWF2 2QQIA 1L7RA 1GFF2 5T3NA 2YUEA 4W4ZA 4DUWA 4DO0A 4Q0UA 1SFPA 2LALA 4V2WA 2OYZA 1EV12 4ATFA 1WMEA 4NWVA 4BQ4A 5A6YA 4PDWB 1DGWA 4MGSA 2P3YA 4GA9A 1FMD1 2WZR3 4BK4A 3QBQA 1OKQA 2GNTA 2RR13 2WKKA 5FZDA 4AL9A 4YG3A 5IK5A 3N7KA 4AEDC 4CP1A 4XJAA 1W99A 3DECA 2I2SA 3B69A 1PO13 2MEV3 1RXFA 3WNNA 5C9AB 1SZBA 2D6MA 1R1A2 1SLAA 1GWKA 3IDCB 3Q8BA 2Y34A 4KMQA 5EWSA 1JU4A 4HKOA 4NVPA 3I2GA 4Y4YA 5FP4A 3O1VA 1NZCA 2QQPA 4Q4V2 2VBBA 3E97A 3ILNA 1IQDC 3AKSA 3KT7A 4YG0A 1K42A 1FAYA 2P37A 1H4HA 2IVIB 3SNMA 2ERFA 2PAEA 5L9BA 4DIQA 3SH3A 5CEHA 2Q1FA 2VTXJ 3I3BA 1H9PA 2DTWA 1PK6A 2ZX0A 2ZTNA 5T50A 2A3WA 4E8DA 3RZMA 5A80A 5FXXA 3WF4A 1GMMA 5FQ0B 4CCNA 4JGZC 2VMFA 4QHBA 4QAWA 4IW3A 3VB9A 5IVEA 3WP3A 4BYYA 4LORA 1OUXA 3ELNA 3WNPA 4FTEA 5JXJA 1XPWA 4GH4B 1OPMA 1H6XA 3BU7A 4LBJA 4JCKA 5KHHA 3F95A 4XF1A 2Q30A 4QDRA 2BTVC 1SPPB 3M4FA 4YG6A 3VDAA 1VMFA 2KM2A 3H8OA 4W6WA 1HQNA 4YM0A 2I07B 1UX7A 3IB3A 3UGHA 4N7UA 2NMOA 2D3PA 1AL0G 1QJU2 2I45A 2XLAA 3ENRA 3K2OA 4IEQA 5FCCA 3SCGA 4M3CB 1EV13 2ZEXA 5JI7A 5GM0A 3POYA 1RUF3 2XDVA 3HN3A 1WBLA 1UCXA 4QB6A 1SLIA 5LW9A 2P34A 2CYFA 5J7MA 5IHRA 2JDHA 2IZWA 3WY6A 2RJKA 1N1SA 5BNOC 2EIGA 1ZBE2 3AL6A 2WO2A 2CGPA 2RS52 2TUNA 5IVCA 1QOTA 2Q5TA 3ACIA 3ZR6A 4RL7A 5FR3A 3AXEA 2ET1A 5SV5A 3S5QA 3U37A 3ZOIA 3MW4A 1ZBA2 2Z4FA 5E89A 1V70A 3MLLA 4XJUA 4DFSA 1L7QA 1WW4A 3HNMA 2BDRA 5CISA 1JYWA 2IWGB 2WBKA 5FMOS 3WNMA 5FZIA 1NLSA 2VW2A 3NW4A 5C9AC 1ZRFA 4CDXC 1HB2A 1W8OA 4P08A 5A32B 1YI7A 4ES9A 3RSJA 5FP9A 4BQWA 3LEIA 2ZEWA 1S1AA 1UY3A 1UY4A 5C3SA 1AVBA 1JMUB 1BVVA 3I2DA 1ASJ3 4Q4Y1 3PUIA 5F32A 2GNBA 1W8ZA 3I3QA 1W8FA 1ENSA 5EYXA 3T4HB 3CJIA 2WZEA 4BPZA 5L9RA 4Z8BA 4YZ1A 1QXRA 4MOAA 2WQ8A 5K0UC 4U2AA 2EVXA 3WW1A 3PU8A 5IVFA 3PNAA 2ARBA 4XUNA 2W1UA 1OPOA 4CP0A 2PYTA 3MFAA 1R082 5ANQA 2W0XA 4WM8B 5JUVA 3KV6A 4B4PA 3AJZA 1SDWA 4YW1A 1R093 4HXCA 1Z7S3 2YY1A 2Y33A 4HONA 3ILRA 4JRLA 5F37A 3EQEA 1J58A 4K8FA 2ZGUA 4LUKA 3UGFA 1DQ0A 3SISA 5FXWA 3WG1A 3WNXA 2D93A 4CDWA 4D6RA 3RZZA 3BU0A 4MLOA 3PL0A 3LQCA 4Q4X3 2V73A 4QX2A 1X8MA 3BN6A 2OXBA 4YVSC 1DGRN 1SCSA 3NV3A 2XLGA 3WINE 5BNPB 4RFRB 4E8CA 3J8F3 3H8UA 3I7DA 2J1SA 4AQ6A 2HH9A 1KEXA 1ULFA 3MICA 4DUVA 3MGUA 1V6KA 5BNPA 1DQ5A 1GU3A 1O5LA 3VD4A 2R073 4DZGA 1O3QA 5KR7A 2XHKA 2G1MA 1D7PM 3TAYA 5AFBA 4IEWA 3OGVA 3DXTA 4YW5A 5FUPA 2P2KA 2GSYA 1YFWA 2FQPA 3VBOC 1OFNA 3PU3A 4HN1A 5FMDA 1E57A 3WW2A 3AMHA 4QQHA 1UN1A 4XQDA 2RM21 2BU9A 3GHNA 2D6KA 3RMYA 3BOPA 3KHCA 1JOPA 1REDA 2VCBA 3ZYGA 2PAMA 2WT0A 3N9LA 2DVAA 1H2LA 3DPRA 4IGOA 5FZ1A 4XAEA 4BMEA 4ZZ5A 3MLJA 1XE8A 4NROA 5FWJA 2B5HA 3DF0A 4CU9A 4QPYA 2VQTA 1W90A 4XEZA 2C26A 3TB0A 3TRSB 3VKNA 4QKDA 3ZFGB 1LECA 4HMZA 4OMCA 1C8M3 4PQ9A 1QJX2 3NAPB 4Q5OA 2O8OA 1JYTA 1KS5A 2RS12 2C0ZA 1WA4A 1DGLA 3MFCA 2YC0A 3EHKA 2VMIA 4MGYE 5FYSA 4YW2A 3WCSA 4B4QA 1AX0A 1HIXA 1ZZ7A 4W6XA 3OBRA 2C6SA 5A3OA 2VE1A 3QOPA 2BFUL 2ZZJA 2WO7A 1HXS2 1AJOA 2X53S 3IKWA 3NL1A 1VAMA 2WR9A 3O12A 1PVXA 2FDJA 4HVOA 3VBSA 4JQRA 2SLIA 3W59A 1XC6A 1LKNA 1OA4A 3CMGA 5FP3A 1YIFA 1KDMA 1BBT3 1DBNA 2CSGA 4Q0PA 1UKGA 1HV1A 1UXXX 1QJY1 2YFUA 3T0AA 5CFCC 4OI4A 4BQYA 1KJLA 3HT2A 1JZ4A 3AP6A 4LXLA 3T09A 5K0UB 1TMF2 3CZUA 3RRDA 2ZKNA 3VZJA 1BBT2 2VJXA 2VO5A 1LU1A 1PHMA 1VBB2 2JG8B 5EZWA 4D69A 4DRRA 3DV8A 1U0AA 2QNKA 5FZOB 4PLMA 2VTXA 3FHQA 2R043 2CGOA 1RUG1 4MHRA 4A45A 4AI0A 3K75B 1B09A 4L0PA 1MZ5A 1NCRA 1P8JA 4L99A 1RITA 4OI2A 1CAWA 4RS5B 2QBXA 4R9CA 2UWCA 3HQXA 4TN7A 1ZZCA 3UETA 2VMDA 1VMJA 3FLPA 4XZUG 3WF1A 1S0DA 1AYM3 5C71A 2CY6A 3ZR5A 2WN2A 4XMAA 1CVNA 3MIBA 1SBDA 1MQTA 2V72A 1NY71 1D0GA 4CTEA 1QJX3 2XONA 3KMHA 4IV3C 5GZEA 2YPDA 4PCRA 4I2OA 4CA9A 5JLVA 5FKCA 1LEMA 5FQ0A 3USUA 3ZFFA 4N43A 1W2NA 2XH6A 3NWKA 1BEV1 4XZPA 4EROA 3ZYPA 3GM8A 2AYHA 4IE6A 4C8DA 1E5RA 2XJVA 1KGYA 2WNUC 5CFDB 3ZFGC 4AK3A 1CAXB 1Q8VA 1RJ8A 1QKQA 2JJ6A 2NMNA 2LRPA 4JGYB 3W20A 4IUGA 3QD6A 1QQP3 4ARYA 1QGLA 2VQAA 4LQRA 4R4XA 1LOFC 1WCSA 3PUSA 4NRPA 1OURA 1YCIA 1VPHA 1W9SA 4KGGA 4M3CA 3OPWA 3RDIA 3R4DB 2GH2A 1O7FA 2QQVA 5F2SA 4F8AA 1CQ9A 1DGWX 1OMIA 2W5FA 1K45A 2VMHA 1CAVA 2BVBA 1US2A 1F4HA 4KL1A 4HETA 4Q4V1 4UFHA 3ZKYA 2UURA 4YPJA 1O3SA 1X36A 2WABA 3DKWA 1XRUA 3HR9A 4GJZA 1AR82 3HNBM 3IDBB 4PF5A 5LB6A 1BMV2 2TBVA 3RS6A 4CZSA 1C57A 3B9IA 2JENA 4IE5A 2W68A 1OOPB 3VZMA 3OEAA 1Z7S2 1W6NB 2YZ4A 5CKMA 2VZTA 1MEC2 2DF7A 1H9WA 2WLPA 4DUXA 1CZVA 2J7MA 1VBC3 4XXAA 5I0DA 2ID4A 5HCBA 2HEVF 5KHJA 1QWRA 3OBAA 4BMBA 1WCDJ 2CAVA 3VZLA 4LBNA 3ORJA 1KITA 1UYYA 2XWJB 4INDA 1W0PA 3OD4A 4LKSA 5H9RA 5A7SA 4QGNA 2XPJA 1ZRDA 4PIXA 1IZ3A 5KHKA 4K1YA 3RWKX 1A6CA 3O1RA 3AM2A 2D3RA 4R4ZA 4MXVA 2GP3A 3E6CC 2B9VA 2JKXA 4FCAA 2VUAA 5BNNC 1UZ0A 5FBZA 1VAKA 1V9U3 5FDBA 2FDIA 4RS5C 2TNFA 2EAKA 2XLFA 4DMIA 3EB7A 3AZVA 1H8TC 2R1BA 4UF0B 4AFCA 3H8XA 1YEWA 2AACA 2D7FA 2J1UA 3ZMOA 5FPZA 2R6QA 2UWBA 3FZ3A 4DRVA 3MV01 4JZRA 3RZKA 2Q8OA 1RL3A 3AMNA 4NIGA 5D21A 4QXHA 2W08A 1JBCA 2K0GA 4KH9A 2ZABA 4XDOA 2QDNA 2BNOA 1TVGA 4B1LA 2E31A 3BTXA 2IUWA 1PVC2 1HRI1 3KB5A 3M8LA 4PBOA 3OSDA 2W2IA 3HBKA 5F5AA 3T2OA 2WNEA 3LSEA 2LUWA 1TG7A 4FP2A 4MV2A 2WNUB 5CFDC 1EV11 3M70A 3WP5A 2BBVA 2E7TA 4JHTA 2JDKA 4YFWA 2RDSA 2VNGA 1AHSA 3ATGA 4J1XA 4NAOA 2ZX2A 1MPXA 4HSLA 4YVWA 4Q8KA 2YGLA 1YFYA 4QT6A 1IG0A 2X05A 3RZGA 1YXWA 3A0KA 2WYSA 1A34A 4DEVA 4A3ZA 1KXGA 4Y1VA 4DXTA 3VV1A 3NV1A 3I2HA 1TZOA 3VBRA 3GHMA 4QPWA 4EWEA 1ND3B 3LDRA 5ANNA 2W46A 4EQVA 3RYPA 5I0RA 4BIFA 5ABJB 1OH3A 2XKPA 1APNA 4YM3A 4EJRA 3ZXLA 4AI2A 4NPLA 3W21A 3O1OA 3VDDB 2KXLA 2B39A 4GWIA 4JRAA 3OTFA 3E6BA 1DU3D 1OLQA 3EMRA 2AEZA 3KCCA 5FV3A 1GOFA 1W6OA 4OYUA 1LAJA 4LBQD 5C6CA 3IT8A 1DHKB 2RJLA 3OBTA 2JDUA 4Z82A 3C7GA 3OY8B 2BWAA 2ET7A 2Y6GA 5FY8A 4FO9A 1CZTA 5JDBA 1RTVA 2PQQA 4CDQB 1ZNPA 3A4UA 2VNVA 1QU0A 2VZSA 4XCAA 1QDOA 2AR6A 4GIQA 3MUZ1 4BU2A 2WNVA 4HFSA 4JX0A 5CAZA 1KRIA 1VBA1 1FMD3 2WZR1 2JG8A 2OA2A 2Z79A 2EICA 2WFF1 3CU7A 2AZ5A 1HW5A 2EF6A 2AREA 1S2KA 4IETA 2GMPA 4AR2A 2BBAA 5LBFA 2WO1A 3OJBA 2ARCA 4NJ4A 1H4GA 1ZM1A 4LPLA 2GC1A 4H55A 3KQ4B 4GAZA 4AZZA 5JOXA 1ENRA 2WS93 2A7AA 1OC1A 1OLRA 5FPUA 3VBHB 1FT9A 3NJVA 3ZSMA 1GP4A 3NNGA 2HWC1 1UIJA 2JG9A 3CQOA 4I01A 3OUJA 2OPWA 4FFFA 3ACGA 5FK7A 1WCUA 4KWJA 4N8MA 5F3IA 1AYM2 1I5ZA 4GD4A 4QQLA 2VR4A 1HRI2 2PHDA 2Y6LA 3KCYA 4FOWA 5DPNA 2BGCA 4D8MA 5FOBB 5L19A 1QNYA 2J1TA 4Q1RA 2P3IA 5DDJ2 2ZAAA 4FBFA 3NAPA 4DS0A 1FX5A 1H8VA 1LHOA 5DABA 3ZSEA 1UU4A 1S0BA 3DCQA 5DZEA 4CDUA 5F3CA 4AI8A 1VRH1 5ABJC 3WDXA 4E2SA 4ES8A 1S2EA 4XF3A 1UXZA 3UL2A 4CUAA 2VW0A 1CAVB 5JZGC 1Y9QA 3K51A 5JOYA 3OYWA 5A7WB 4BLJA 3QLQA 4XW3A 5FY7A 5HPOA 4DY5A 3JBG1 2W92A 5FY4A 2UY9A 2PELA 3EJKA 2HWD3 1HN0A 4YM1A 1VBB1 2D6LX 1VRH3 4XQ4A 3VD5A 1H2NA 4QPIC 3O5SA 1GP5A 4LHLA 2RM23 4M4RA 5FZBA 4AVBA 4C0HA 4F7ZA 3CO2A 1U12A 1PO11 2MEV1 5JIUA 3AJYA 1ZVFA 2FZ1A 5AC91 2E9QA 4CDQC 1LHVA 1Z0HA 2DV9A 4Q1PA 1AXZA 4QX7A 1VAVA 2JDNA 3VDDC 2Q1ZB 2DYCA 4F3JA 1X33A 3A21A 4JAAA 4ZS2A 2D98A 4ZU5A 1AR72 1SG3A 1FPN1 4Y1UA 2XJQA 2RVAA 3WEZA 2XOMA 5FJHA 4ISQA 3UESA 1B35C 5C7GA 1AR61 1UWWA 4ASMB 4Z92B 2RS33 4RQPC 2RV9A 1JYIA 3FLTA 3UKNA 4SLIA 1W06A 4NIAA 3K4ZA 3MIFA 2WSUA 2EALA 4PIYA 2VW1A 4MGIE 2PMWB 3Q9OA 1HB3A 2WN3A 1HB1A 5F2WA 1QEXA 2UWAA 3ZDVA 4LA2A 1XQNA 2WFF2 3ROUA 5ABJA 4S2FA 3CHXA 3I8TA 3EYPA 3VD7A 1NCQA 1AXYA 2O14A 2A71A 1BK0A 3P6BA 1VB2A 2JD4A 4XVHA 5JR7B 4DQAA 3HAGA 1W9FA 3KF5A 4LKEA 2R072 3CJIB 5A33A 1N3QA 1ZRCA 2QTWB 2D43A 1QJY2 2VBPA 1A78A 4NN0A 2HWE3 1K12A 2XUEA 1OF4A 3H50A 4M0HA 3VBHC 2YGMA 2XJTA 1DZQA 4EV0A 4QKBA 2W52A 4CCKA 1OQEA 2VC9A 3P3PA 1QJX1 1J3PA 4Q4X2 2OKXA 5LA1A 5JPNB 2PN5A 1AR73 1VR3A 2HWE1 4GMP1 5FPBA 3AYEA 2PLV3 3FJSA 2FZ2A 4P9XA 1RIRA 5LBBA 3T08A 4BISA 1RUI3 4CEWA 3M7AA 3AXDA 3N3HA 1X9PA 2VZ1A 1H1MA 3M3CA 4QPIB 4AW7A 1W6OB 2MHFA 5FOJB 1TEIA 4LBQA 1Y4WA 5D8AA 5BV6A 2RM22 1R64A 4Y5Z0 4EN6B 5JXGA 4COVA 1VBD2 4CCLA 5HCHA 4Y26A 1LHWA 1YWKA 2BRTA 2ZGQA 3JD73 3ZXGA 4CCMA 5A3UA 5L7OC 4K1ZA 2ZGMA 1IHMA 1DIWA 4AHWA 4QPGA 1AR81 4V1PA 5C5TA 2Z5WA 3EO6A 1ASJ2 1HN1A 1NE6A 1W9WA 5F9TA 1WWYA 4K3UA 5KHGA 2KD7A 2ORXA 3JCIA 1BBT1 5CKNA 4QX8A 1YLLA 4CU8A 4LEJA 2R062 1GANA 1DQ6A 1CX1A 4DB5A 2BP6A 2C24A 5FLJA 2VUCA 5FPXA 2XQXA 3ON7A 4M01A 5TSWA 3V0AB 3OYWB 3PTYA 2B46X 2XUMA 2ORZA 1R091 3HNYM 4PLOA 3WXPA 1Q56A 4LA3A 3AZYA 2Y0OA 4ZXKA 4AI3A
chains in the Genus database with same CATH topology
3WDVA 2YROA 4YYOA 1IGOA 2OVUA 1Q5OA 4I3GA 1FV2A 3VBUC 4HZFA 3FFZA 1PNFA 1K5MB 1PIV1 1W6MB 5DDJ1 4KBBA 2B45X 4YRDA 4Q0SA 1FNZA 2ILMA 3TOJA 4J1WA 1LEDA 4YVWC 2WT1A 1QY4A 2A6VA 4OFGA 4SBVA 3IWZA 1Q8PA 5CFDA 3L9JT 4FXKB 4P14A 5CB7A 1COV2 3PVBB 4K20A 3ZSJA 1ZYBA 2P17A 1QH7A 2W39A 4M00A 1DGRA 2XVKA 1LOGA 2QCSB 3MI8A 1WBFA 4OZXA 2VXRA 1MS3A 5I8TA 1IOAA 4FPKA 1RHI3 5EXOA 1FYUA 2CNAA 4RHV2 4KU7A 3FUQA 5CNAA 1RVF2 1H8TA 1AL22 3VZKA 1VBE3 1UU5A 1COV3 1PIV2 3AP7A 4RS5A 3B94A 4PDWC 4OULA 1ZREA 3CLPA 4XTMA 5BNNA 3UK9A 1SEFA 4AFBA 5I91A 4Q4V3 5J37A 4P9WA 5FO7B 5KWRA 4TYSA 5FTTC 4AEDB 4OHVA 4X8NA 2IXJA 1Q3EA 4N90A 5J3UA 3VGIA 2HWB1 4F83A 5L7OB 1C3HA 5FRAA 5BXXA 4NO4A 1POV3 4AEJA 1PO22 4C1XA 1BK1A 2QUOA 4O9EA 1QQP1 3ZDSA 4MUVA 1WMFA 1J1LA 2Q4SA 4WVVA 4XFAA 1S55A 1O5UA 1OFSA 5HCFA 3JU9A 2PTMA 2HWF3 3LKJA 4KG8A 4QM9A 4R9BA 4M0NA 3JQXA 4BA6A 1W6QA 4YZ5A 2Z69A 4CRQA 1GR3A 2KA3A 3MW2A 5HI0A 1NXMA 4MGZE 2WSVA 3THPA 3DN7A 2ATFA 2ZGRA 1OA2A 4XOGA 3M3QA 1LOEA 4HVQA 2ENRA 2WZPP 2SBAA 3RYKA 2IFWA 5F1RA 3JZVA 3WT3A 2IXCA 2R0FA 1PZ8A 4HBNA 1PK6B 1ZBA1 4A7ZA 3ZYJB 1EYBA 2ZGOA 3FLRA 3H1WA 5BNOB 4LE4A 3KCXA 2WNUA 1AYN2 4GH4A 2UU8A 1CIWA 1CAUB 2ZMNA 1FOD3 1W39A 4X6RB 3SH4A 1PO23 4C0BA 3IBMA 4COWA 3T1LA 3VHRA 1AX1A 4B4RA 4IV3A 1WD4A 1MEC3 3VZOA 1MQTC 2G4IA 4G4FA 3ZFEC 1UKRA 2EA7A 2QKDA 1TNFA 4TZDA 2RS31 1PZ9A 3WG2A 4ASLA 3R6SA 4QQ2A 1RINA 5BY5A 2B42B 2EXKA 1RJ7A 2ZHMA 2WFF3 1FPN3 1QH6A 1VJ2A 3OCPA 3GALA 1ULDA 1HLCA 1RVF3 2B7YA 2WJSA 2YYOA 1GLHA 4RHV3 4Q4W2 4AQ2A 4AGVA 5J36A 1TE1B 4EWDA 2D40A 5CFCA 1BYHA 4LULA 4XBNA 5IT6A 4YGBA 5SV8A 4YGCA 1F9KA 3G7DA 2AH2A 1MZEA 2RMU1 5GLVA 1ZZBA 3VBSC 1IS5A 2OIIA 3RPQA 1R1A1 4L11A 1NE4A 2BUKA 2XL7A 2NZ9A 4YVSB 1BJQA 5IK4A 1HX6A 2GN7A 4MSVA 2IXLA 1YHFA 5JAXA 2VY0A 4IV1B 5AFEA 2RMU3 1VRH2 5AC92 4TWTA 3V56A 4AEKA 3V0BB 1N1YA 2CAUA 4KG0A 5DUVA 4LBQB 1DZTA 1AR71 2HEYF 1JW6A 2DTYA 5K9YA 1AX2A 1YO8A 1SLBA 4E2GA 1KFXL 2QFEA 3TNPB 3IIAA 5ACA2 3O7OA 4LLOA 4BZ4A 4Q4Y2 4FPJA 3VZNA 1NY72 4KWKA 4Y22A 1CGPA 2GNMA 4AVSA 1UPSA 3FUOA 2XB6C 1UU6A 1LJ7A 3HIFA 3PMEA 4ITCA 1W6PB 1MR5A 4BLIA 2YXSA 2RMU2 5KXCA 1LR5A 1HXS3 2PAKA 5E1RA 2DU1A 3J8F1 3TBDA 4MX3A 2BPA2 3CF6E 3D0JA 4FVVA 3AZWA 4DNYA 2FMDA 2Q0AA 1M4WA 1FMD2 1PGW1 4K21A 2PHWA 4I3PA 2YDEA 2E6VA 2ES3A 3QH6A 3VBUA 5E16A 4C90A 1NXD1 4MVTA 4QGLA 1RUC3 4RGGA 3C2UA 1XU2A 4QXKA 4Q4W3 5C8WA 1U5YA 1RUI1 2ZPXA 1C4RA 1W6QB 1BQPA 1SBEA 2ZA9A 3VBSB 1OSGA 5C9AA 1G9AA 2BW8A 2G9FA 1VBE1 3FC0A 1AXKA 1ENXA 4G9SB 4GKXA 3ZXJA 1BZWA 1ZRRA 4FPHA 4H7MA 4P9IA 1CR7A 3SITA 2EXJA 3WP4A 1G9CA 2K2SA 1UD1A 1YIPA 1LOAA 4UW3A 1VB4A 3S7IA 5GZGA 4KWLA 4FOQA 3AZXA 4E4SA 3LA3A 4XFHA 4H14A 4EWAA 4IEVA 1DDLA 5I8YA 2BNNA 2V5YA 3H1YA 4LBOA 5F6KA 2MNGA 2A3XA 3B02A 1CJPA 2XBO2 1IPJA 5DUWA 4C1WA 2HWF1 3DL3A 4FXGB 4E4ZA 5GLTA 4HN0A 5HCAA 2H6CA 4XBLA 4IEYA 4A2UA 4W65A 4Q0QA 1N47A 2E63A 1V00A 5D1IA 2D44A 3UKVA 2VOXA 2VVEA 2QVSB 1DZRA 2X5IA 4AI1A 5JSOA 2TEPA 1OQDA 5FO9B 3VL9A 4B7KA 4Q2FA 3JBG2 2CL2A 5KC5A 2VUJA 5EV7A 5JCTA 1PGSA 2XL9A 5T55A 4K40A 1G8WA 4JDOA 1PGW2 1WLCA 2Z42A 2JX9A 3WDTA 4ZU4A 2BYVE 3AX4A 1EAH2 4N9IA 1B35A 3WCRA 3I59B 2R30A 3NVCA 2QJVA 3WV6A 5FMOL 3MF9A 2NQYA 4K7JA 4EN0A 4QD2A 1O91A 3FFQA 3D0SA 3TN93 1CJDA 3VUOA 4AEMA 1H8TB 1TNRA 1CD3G 3VBOB 5KXBA 2P3JA 1XXNA 4QPIA 3AP9A 2Y26A 3ILFA 5GALA 5JPMB 1MZ6A 4IEPA 4MGKE 4TLFA 4YW4A 5I0UA 1OD5A 2XKOA 2D3SA 3UJQA 1SLLA 3SH5A 3D5OA 3ASIA 2NN8A 1NCRB 1SFYA 1DQ1A 4YM2A 1GZWA 4AFDA 5J98B 5L7OA 3JB4C 3GZUC 2HKXA 4I0WB 5JVVA 1OA3A 1QOOA 3NAPC 4K9SA 5A3LA 2A70A 1YJLA 4LHNA 4BOWA 5D8AC 2ZGLA 3ZSLA 1GICA 1G7YA 1LRHA 5A33B 3ME2A 3WD5A 5JIAA 5FLHA 2PLV1 5IK8A 4HANA 1ULEA 4FOYA 5CBLA 1IS3A 1ND3C 4YW3A 1HXS1 5JSPA 5L73A 3ZSKA 4OLLA 3N4MA 3PLQA 4RSUA 5C4WC 2C1FA 3G6JB 1X50A 4BM8A 4CDUB 3RMXA 4GWMA 2X5IB 4FPCA 3J9SA 1C28A 3CL1A 2BVVA 5CFCB 3BPZA 4D7TA 1MS8A 4D3WA 4AHZA 4IESA 4S2HA 1YFXA 2JG8C 2UYAA 2ZS6B 1RMU1 1AYM1 4Z2WA 5GZFA 1JHNA 4XJ8A 3SLIA 1YFUA 4BIOA 4OUSA 1F2NA 2D6NA 2PHTA 3MIGA 2R041 2VVFA 1OHFA 3RQ0A 4HK9A 1UF2C 1L3JA 2ZHLA 1WGPA 4GXLA 1TMF1 4EN8B 5J48A 3KT1A 3VLBB 3CJXA 1DYKA 2D5HA 2ETEA 4K6BA 3ECQA 4AWDA 2HWC3 4IV3B 4QMAA 1MS9A 4RQPA 1NLRA 5HXVA 3WDUA 3AYDA 4P5HA 1Q43A 1C8NA 2H6BA 3JUUA 3D4KA 3PVOA 1H1IA 3I4IA 2PLV2 3AFGA 4BH9A 4H7LA 3VDDA 5A3MA 5DUXA 1F8VA 5AVPA 3J26N 4IEXA 4JGYC 3MF6A 2WINB 1EY2A 4WVWA 5D8AB 1DLLA 1CPMA 4Y1XA 1SQ4A 1YI9A 2JXAA 3WVJA 5CADA 2QE3A 4XYXA 4JTOA 1QJY3 3AMPA 3NV2A 4ISRA 3ZN6A 1ZBE1 1RUF1 1RUC1 2YMZA 5JZGA 3WOGA 4RA0A 5GKAC 3S30A 5C4WB 4N7IA 4YFZA 2VQ0A 4LBMA 1AR83 1UX6A 4CDUC 1WLDA 3ZN6B 2X5IC 2R32A 4NR1A 5CU1A 3ZXFA 1HKDA 3ES4A 4E9KA 5JOWA 1AL23 1PZ7A 2JE9A 1QHDA 4IXLA 4ORFA 2VOKA 3WUDA 1VIWB 3ZXDA 3TWIA 2VVDA 4NWWA 1KD7A 3WUCA 4LHKA 3J8F2 4FPEA 4S2DA 5A32A 5LEJA 1EP0A 4Q29A 2GH8A 2GC0A 3N7LA 2JG9C 1QQP2 2BNMA 1AR91 3M1HA 5JI9A 3MZHA 1H2MA 2E53A 1D4M2 3HMYA 3ZIWA 1D2SA 1RUJ2 1R092 3POSA 1LULA 5KHIA 2R16A 1HRV1 2NM1A 5CIRA 1URXA 4URTA 1G9FA 1YJKA 4UBGA 5CG9A 1NOVA 1U5IA 3LA2A 4Y22B 4JC1A 3WHTA 4J6GA 4GQ7A 3B7MA 1BKZA 1JUIA 2HWD2 2IFRA 2OPKA 3AMQA 2ZHNA 2RHPA 1FV3A 4I09A 2GDFA 5CVRA 3GZAA 2DCTA 4HLTA 4AXOA 1X82A 4WZFA 1QNWA 4FPFA 5EJ3A 1H0BA 2ZGPA 1O3RA 4BQ1A 5T5OA 1POV0 3LGRA 1QOSA 1Q8SA 4BHPA 2R042 5DXDA 2D5FA 4HPKA 1ASJ1 4Q4Y3 5DDJ3 5ACA3 4DXZA 4YZ4A 1LESA 3A0NA 4OUMA 4L97A 1UZZA 5DG2A 2I74A 3E5QA 1JTZX 2ZHKA 2IXIA 2RS53 3RNSA 4XDQA 3INAA 5E88A 3RYRA 3NKTA 3VBRC 1V6JA 2DUPA 3JD72 1K5MA 3POWA 1VBD3 3U10A 1MS5A 4FPLA 3D8CA 1RUF2 2BFUS 1AJKA 3GNEA 5JWPA 3H3UA 1G9DA 1QJU3 1R1ZA 3DPRB 3RJ2X 2WL1A 4L2NA 1D4M3 4ATEA 2JG9B 3C3VA 4XETA 2PHXA 1FI2A 1S0JA 5I8SA 3MLKA 3R4SA 1ND2B 1YRZA 1N3PA 1ONAA 4AVAA 2BQPA 2DCZA 4HK8A 1JOJA 1XU1A 4Y1YA 3ZXEA 4WM8C 2WC2A 4NHKA 4YLZA 2HWE2 4LBLA 1F31A 4GWNA 1XNDA 4PJYA 4XPVA 2E51A 2RR11 2DWRA 1V9U1 4FPGA 1QDCA 5HBAA 1GYKA 4OHXA 2DCKA 3JB8A 4PBPA 3ZFFB 1FPN2 4X8PA 3DUIA 2PHLA 4RD7A 5L36A 1EPWA 4L9BA 5GLUA 1FXZA 4B29A 2RE9A 1Y7BA 4COZA 5B2GB 4LT5A 2O1QA 1GSLA 1ALYA 3I59A 2ZACA 1PO12 2MEV2 3E5XA 4WZCA 4AQSA 4D7YA 5IUQA 4LO5B 3KM5A 2JICA 4A7KA 3KGZA 2A3YA 2OUJA 1OQ1A 1A8MA 1NG0A 1NYWA 5LK5A 2VH9A 3W58A 3NO8A 4LR4A 4MXWA 1C1FA 5H9QA 5J09A 4XF4A 4IEUA 3RWNA 4YARA 2R061 2PHUA 1WD3A 3VBRB 1RUE3 1W2UA 4B3NA 1PGL2 1R083 3IM0A 2C5DA 3GBWA 1LGBA 2Y38A 3O14A 2JKBA 1UZYA 1I3HA 1PM7A 2X8KA 4FOVA 4E4DX 3AKRA 3KD4A 2CV6A 3DPRC 5JZGB 3CNAA 1D4VB 4IV1A 2AUYA 1JXNA 3AFKA 3MIHA 1LOFA 1VLNA 3FHIB 4OVEA 2HWB3 1SLTA 1D0HA 3ZYRA 5CA6A 5KC6A 1CAXA 4PIZA 1VBA3 2F4PA 2X29A 4XIOA 2JECA 3ZN4A 4WV8A 3GF6A 1AR62 1T6GC 2UYBA 3ZFGA 3O0VA 3WQ7A 3ZFEA 1SLCA 3SCFA 2QZ3A 1GV9A 4XFGA 5J96B 4Y20B 3VHOA 1PGL1 3ZFFC 3GBGA 2WIIB 1B35B 1VALA 1ND2C 1TME2 2AENA 4N53A 1ZBE3 2ZJCA 1LOCA 3QACA 1OOPA 1IKQA 4E27A 2NYYA 1RGSA 4AE2A 4QQPA 4XFBA 4GH4C 4DINB 3AYCA 4QQOA 3RI8A 1F5JA 4FTBA 2WS92 3H9AA 4FPOB 4R9DA 3BODA 3E6DA 2QDRA 1JN2P 3VHPA 1LB2A 3U07A 1PIV3 4FP3A 3AB0A 1H1AA 2LM3A 4MH0E 2IC1A 5K0UA 2XJSA 4OI0A 3IN9A 4BE3A 4GB31 2R49A 3CJIC 1S2BA 5C8CC 4AF9A 4MZUA 5IK7A 4XF0A 1CAUA 4FQZA 5I0SA 2OZ6A 3VKOA 3AZZA 3LA7A 3VN4A 1QJU1 3QH7A 1QF3A 3I54A 2G9GA 3ST7A 4CDXA 4E2QA 4AGRA 4RR3B 3WZ1A 4QGMA 1R081 1EPZA 1WUVA 1O3TA 2ZGSA 4Q0VA 5T54A 2DFCA 4EN9B 1POV1 4P9YA 3GYDA 1AYN1 4O9GA 3TN92 1TQ5A 3BTAA 5GZDA 5H9SA 1CESA 5LRRA 1JYCA 3ACLA 4HKWA 4Y20A 1RMU3 4Y24A 4CDXB 3HT1A 3IPVA 1QXJA 3ZFEB 4EN7B 4I0AA 4HKLA 3IDEA 2WFPA 1G6NA 2RR12 3R4UA 1PMIA 4XHBA 4D94A 2WZR2 4S2GA 4YSFA 4UW4A 3S7EA 1IPKA 1FNYA 1NA1C 4RFT0 3SMHA 3H7JA 4ZKTB 1TME1 3UKTA 1Q8QA 4GMP3 2VNOA 1U5XA 4PDWA 5GJ6A 2O0OA 3VBFA 3VKFC 4Q4W1 3URFA 1PVC3 3BIWE 1LHNA 1NQDA 4XHXA 1ZX5A 4UXAA 3VBOA 3LWCA 3X29B 1DG6A 5CG8A 4BCUA 4OHYA 1VBC1 3K48A 3MIEA 2H0BA 5DG1A 1CAWB 1YYNA 3UJOA 4CEWB 4FAHA 5JOZA 4RGAA 5BNPC 1RUE1 1ULGA 1S0GA 4M3CF 4CEYB 3ETQA 3LAGA 5DZFA 5LRSA 2HYKA 1C1LA 2RS11 1XYNA 3AKTA 5BNNB 4MXWB 1V9U2 1AZDA 2JE7A 4MYEA 4YVSA 5C8CB 4JDNA 3IMNA 1G86A 2GMMA 1Q8OA 1LTEA 1RUI2 2PHRA 4AHYA 1LODA 2OZJA 1XYOA 4RR3A 1LHUA 2N7GA 3WW4A 4I02A 1WW7A 4AHXA 1WLTA 2R1DA 3PJYA 1AUYA 3NKGA 1RUJ1 1AL21 2VPVA 4META 2WT2A 3ZIXA 3LCPA 2IXKA 1N1VA 2FHRA 4RR3C 4HVRA 3V65A 2YHJA 4AFMA 3WR0A 2GMEA 1ZZ8A 1GZCA 5DZGA 1ZZ9A 2B8MA 3MIDA 4HSJA 4AGGA 4PLNA 3T2TA 2XJRA 1RUD1 2ZBJA 1W6MA 2DUOA 5EYYA 1HRV2 2ZX1A 1D2QA 1Z7S1 2XJPA 4QPGC 1PNGA 4XIKA 4JDMA 2CTVA 4P9JA 2HJIA 2A6XA 3D82A 3MDPA 1XE7A 2QZ2A 1MZFA 3H3ZA 1BMV1 1QJZA 2RS32 2ZX3A 4I0BA 2GC2A 1RUC2 1ULCA 3AP5A 5FREA 4IQPA 3R0RA 1YNAA 4YGDA 5KXEA 5BNOA 4CEWC 1BEV2 1NA1B 1CN1A 3VBFC 5E8AA 4CEYC 1GQGA 1MS0A 1I6XA 4LO7A 1XNBA 3THTA 3HBZA 1RUG2 1NA1A 4BWOA 4ZU7A 1DYPA 1I1EA 1BVP1 4DOUA 3AK0A 4L92A 2YV8A 1MS4A 4QX5A 3VBHA 2DFBA 4OI1A 4COYA 2PFWA 1ZZ6A 3OD0A 3S0MA 2Z2SB 1MVEA 1C5IA 4IEOA 1XNCA 2CGNA 1F5FA 1QMJA 3JD71 1NCQC 3OGJA 4JGZA 4XJ9A 2ZMLA 1LGNA 4FAGA 3WDYA 1PK6C 1GKBA 3EBRA 2HWC2 1IKPA 1V6NA 1H2KA 3LB9A 3VHNA 1TMF3 1AR93 1ENQA 1H30A 3ZN5A 4Q27A 1VBD1 3O0WA 4Z07A 3T1MA 5C8CA 3EXUA 1KQRA 2GAUA 4AEDA 3VKLA 4LO8A 5AC93 4C91A 2D6OX 4IL7A 4QPGB 2BWCA 1DQ2A 2WNVB 1WW5A 4R8HA 2NPIA 1KFUL 1MQTB 2A73B 2ZGNA 4CDQA 3NSTA 4QU2A 4HPKB 1S0EA 3OF1A 3SCHA 2HWD1 4LTAA 1IS4A 4I30A 4XILA 2RS13 4Q8LA 2VULA 5DUUA 1C8M2 1OOPC 4KNCA 4L8QA 1ND2A 4N53C 2IXHA 4OHWA 2DVFA 1IQAA 1WMDA 3WX5A 3E5UA 3M2MA 4IERA 1RVF1 3HN1A 4XBQA 5BYNA 1J1TA 1SBFA 2ZOEB 2ZX4A 1HQWA 4WVZA 3VBFB 1I9RA 2GN3A 2HEWF 2ZGTA 4TSVA 3DGTA 1RC6A 4RQPB 2ZGKA 2XJUA 1NCQB 1ZA4A 3ES1A 1R1A3 3SXWA 4IV1C 3BB6A 3H1MA 1LOBA 2WQZC 2D6PA 3N35A 4HL0A 1PO21 2GALA 2JDZA 3O0XA 5T5LA 4GMP0 1OI6A 1O4ZA 3L2HA 2K9ZA 3IPVB 1FOD2 1NQJA 2YPJA 3ALQA 4CP2A 5K7PA 3MPBA 1RUD2 1V6OA 3FX3A 3AKQA 1Z78A 1AYN3 3MYXA 3L2YA 1LENA 3LOBA 4DY3A 4WM7A 3MW3A 3KQRA 2WNVC 3WQ0A 2ARXA 1RUOA 2D97A 1TME3 1C8M1 1UW8A 4LLFA 3U11A 4XFCA 1EAH3 2A6YA 1J3RA 2EAAA 3KT4A 4FTSA 4LBKA 2VGDA 1C5HA 3WG4A 1AR92 1V6LA 2VECA 4FT8A 5BNQA 2WS91 4GULA 2XVLA 3CEWA 3N36A 2WLQA 1GQHA 4R52A 3JBG3 5AVAA 4B8EA 4A7YA 1J3QA 1Y3TA 4P9LA 1A3KA 2WA3A 4COUA 4RHV1 2HWB2 3M3EA 4AVVA 4CYDA 3ZMNA 2DCJA 4LO6B 2O8QA 2RS51 4N9HA 3KSCA 2ZAHA 2XVGA 3V0AA 3QCWA 1ZBA3 2CWMA 4WM8A 5FAXA 4NHMA 1LU2A 4NHLA 4XFIA 3ZPYA 2R0HA 1A8DA 1UMZA 4N53B 4DPNA 5GLZA 2XBO3 3FBMA 3H7YA 1RUG3 4XQWA 4FSJA 1VBC2 4YNIA 2VU9A 3FWEA 1GZ9A 4R9AA 4D7SA 5FO8B 2P3KA 1RUD3 1O4TA 3BOWA 1BEV3 2Q1MA 4N43B 4JVAA 4IEZA 1CPNA 2A5ZA 3OY8A 4WBBA 3UV9A 2GZWA 3WG3A 2XBO1 3ZX7A 2GC3A 3NV4A 4XJZA 2PHFA 2EXHA 1K5MC 1VBE2 4YZ2A 1G9BA 1KJRA 3LOIA 1REEA 4KGQA