4JHBA

Crystal structure of relb double mutants: y300f/i335f
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
110
structure length
110
Chain Sequence
b'LVPRGSHMNTSELRICRINKESGPCTGGEELFLLCDKVQKEDISVVFSTASWEGRADFSQADVHRQFAIVFKTPPYEDLEISEPVTVNVFLQRLTDGVCSEPLPFTYLPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription factor RelB
publication title Crystal structure of RelB double mutants: Y300F/I335F
rcsb
source organism Mus musculus
molecule tags Transcription
total genus 17
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2013-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jhbA00
4X5WA 4ZPTA 3AU1A 4OB5H 5EO1A 1ZV5A 3HZKA 2CKNA 3OX8B 2IBGA 3A67H 3ARDC 3U82B 1MPAH 3HC3H 5SWQA 3MX0A 4OFDA 2NY4C 5J6HB 4Z8FL 4YC2C 1PLGL 5KSUB 3FB8B 3GSVB 3ARVA 2J88H 3OB0H 1RAMA 1MCWW 1A7OH 4UAOB 4A6YB 4EQ2A 4F3FA 1S7SA 1XEDA 3F6IA 2VAAA 1BBDH 4PV9B 1NFIB 5E9DA 5DJ8A 4ACPA 4P4RB 4HK0A 4YXHL 4UDTB 3EZJB 2ZKHL 1NCAL 2ICWI 3KYNB 3VH8G 3SPVB 3WS3B 32C2B 5DJAA 3S5LB 2CLVA 2FZ3B 1NGZB 1EEUA 1QA9B 2FJFA 3K81A 5AYQA 5JO5B 2C7UA 3MUGB 4R0LB 2K7PA 4G8FA 2B7DT 5T3ZH 1DQML 4MZ2A 3GBNL 1MCRA 5JOFA 4AMKH 5D6DC 1J0ZA 2ILLA 3PQYA 3INUH 4R4BB 4NSKA 1EGJL 4NT6A 2CMRH 2UYLB 1BJ8A 4JZOB 3MV7A 1TCRB 5B4MD 3B2VL 5GJTH 3RDTD 1PKQB 1MIEL 4ONOA 5T3XL 1VADB 4RBPH 4OCYH 4PRHB 2AV7A 3GIZH 5C0JA 1IQDA 1GIGH 1PG7H 1VERA 4ZTOL 1EHLH 2VLMD 4WY7L 4KUCD 2R1WA 1ZGLP 4ZUUA 3T3MF 3PABB 3B9KD 2NY5H 3UTTA 2VABB 4KV5E 3IFPA 4CUCA 1DDHA 3TBYA 3O3BB 3C5ZB 3T0EC 1S8DB 1F3DJ 3BW9A 1CICA 3OKLA 3SQOL 4P5TD 4UT7H 3V2AR 1YMMB 2VDOL 2PR4L 1IE5A 3FTGA 1GOFA 5BVPL 2AJSL 3MOBL 4XPTL 2IPTL 1CQKA 2NTFA 4OF8A 3KVQA 4YHZL 1P7HL 4GRWF 1ZT1A 4F7EA 2EEBA 5HGGS 4YR6B 1IFHL 1I8IB 5F7LB 4FABL 1R3IH 1OW0C 5FM8A 1J1PL 4JY6A 3MXWL 4NQDA 3RNQA 1KYOK 1FPTH 4WI8A 5SX5H 2XNAB 2VUOA 4PY8J 3G9VA 3FRPA 1ZT4B 2AK4E 2OJZH 3N06B 4LKXB 5IF0A 1P4LB 4X4ME 4LKCA 1ERNA 3HZYB 3LSOA 3ZHDA 1WZMA 5M7QA 4D94A 4OD1L 4NO0B 5ANME 5DMJB 2Y4SA 2H8PA 3BZEB 1IGFH 5ADOH 3JV5A 3FN3A 1TVDA 1TXKA 4HX1A 4AEHH 1KENH 4JFZH 3KPOA 3PP3H 5A16A 1U3HC 4PJXF 2HWZH 3WS6A 3QJHA 2PW2A 2ZCHH 1V7MH 2AGJL 4HV8A 1EVUA 5JHDE 3U7WH 1MOEA 2DYPA 4HUKB 4OGXL 2EDHA 1LEKB 3P0VH 4G6FB 2DLIA 4HC1L 1LP9E 3EOBA 2XXCB 3OXSA 3BZFA 3STLB 1INDL 1EGJA 2Y1VA 3IXAB 4X6FA 3EO0A 1FBIH 1RFDH 2C4XA 4OZFA 4FQXA 5E24E 1BJ1J 1FO0H 4G8IA 4XWOD 4WO4D 1DE4A 1KPVB 1MLCB 3V5KA 1IGCL 3RTQD 1GHFL 3VH8B 3O6FA 1DCLA 2YUZA 4Z18A 3O4LA 4WU7B 4R7NB 1F13A 4OFPA 1CFTA 4C54A 4WU5B 4JO2H 2IAMA 3WFHA 5J8OA 4P3DA 3ZKSD 2BNRD 4OLUH 5LG1A 3M8OL 4K07A 4GQ9H 5F7YC 3QT2A 2VDMH 1NC2B 4MQSB 3UCRA 5IHZA 1PFCA 1AQDA 35C8L 5J56B 4JRWA 3VXOB 4ORGA 3DRTA 5IQ9B 3VGDA 4WUKL 4QRPB 5LQBH 3MO1B 3U79A 2Q3AA 1U8OB 1A22B 3PGCB 1QSFE 1WBYA 3TN0D 3UPRB 5KVEH 4X7TA 2BDNH 1SEQL 3ZYOA 3L3DB 1U3JA 3N85H 1A4KA 4MQXC 5EIIA 3DMMA 3OSKA 2B1AH 3BDYH 4WGVB 5IFAL 4P23C 4J6RH 1T0NA 2X4OA 4C57C 5LGJA 4IMKA 2XKNA 4ZO8A 4LHUA 3F7YB 1SJHA 2PO6B 4WWKA 3C9NB 5KZCD 1GL4B 3D39A 4ZOAA 4K3JL 1FJ1A 1OSZB 4D8PB 5FYJE 5F44A 1TQCB 2JIXB 4HLZG 5DD6A 4P2RB 4L8CB 5IB1A 2W59A 4RGND 5F1NB 4HC1A 3QWQB 1DUZB 5LXGH 1KCVH 2WQ8A 1LD9A 4DAGL 2K3TA 3CX2A 3P11L 5C09D 4ZDHA 3QRGH 4ORZC 3UDWC 2OK0H 3ESUF 3C2SA 3F65A 4XBPA 2IBBA 4O9HL 1YNLH 1AP2B 3MRMA 1GGBH 1JMZA 3PV6B 4U1HB 3SE9L 3GJFB 4WV1B 4G7VL 3VGAC 1KFAH 2FL5A 5FKAA 3L7EA 3T0DA 3QA3A 1ULVA 3MRFB 3BXNA 4HUWA 5LBSL 4Y5YA 3NMEA 4JQXC 1JGDB 5IBLC 3VXUD 2V17H 4U0QB 3WCYA 3FHQA 4LIQL 3MODH 1VFAA 2DM7A 4XP4H 2RGSA 3QQ4B 5D1XA 1T20B 4UNVA 2YEZB 3Q48A 2BVEA 4W4OA 1VSCA 1BD2B 5H35A 4E5XB 1AXTH 1AO7D 1SM3L 3BIBX 2X10A 4TVPD 4OCWH 5EN2A 2FD6H 4H1LG 1F11B 4LCWB 3ZSSA 1NBZB 3HC0B 3K8KA 4U1JB 2FEEL 3VWKB 4G3YH 5DMKA 2IFFH 2X4PB 3MMEA 4AIXA 3RY6C 5F7UA 2ZCKH 4HJ0C 2BSSB 4M8QA 1DBJH 3DX7A 3CVHB 3SKOA 1ZT7B 4UT6H 2D7QA 2P5WD 1MH5B 1WFNA 3O41B 4HUUB 3O2WH 4JFEB 3V7MA 1EEYA 2YK1L 3STBA 4ZG1A 4HIIA 4M43H 3RZWA 3TJEH 4KKBC 1A6UL 2HAZA 5D5ME 3P9WB 5CINH 2EH8H 2FGWH 3F5WA 3MRLB 4ZUSB 2AJ3A 1RIVH 5H2BB 4OFVA 2VAJA 2AJYH 4GAJH 3R1GL 3WFDH 3VFTA 3N1FC 2A6KB 1JMXA 4N9GA 2DMBA 4LFHD 1WBZB 4PRDA 5DC9B 3EHBD 5T5NG 1A7NH 2ARWA 4U3XA 2GK2A 5GGVY 5CAYB 3FL7A 4OZHB 5F21B 4LSUL 3PXJA 4KY1L 4UUJA 1FDLH 3KG5A 3U2SB 2F8VA 3U7AA 4I0PB 2GYSA 2IPUG 3GKWL 1OAXL 3D1MC 3O8XC 3DXAA 4Q9QH 1G7PA 4IMLA 3QNXA 4HWEH 1EZVX 3QO1A 4JPKL 1NFDE 3FFCA 3B9AA 1AJ7L 2WWMC 1A9BA 2P5EB 2DQIL 1FV1A 1OAYH 1J5OL 2IADA 5DD3H 5LWYL 4Y5VC 2QADB 3AM8C 1M6OB 3ORJA 5SV3A 4B53A 3ARTA 4XAKE 5HHVH 2A2QT 4JFDD 2IC2A 5CIPA 1F4AA 1ND0A 2F53E 4XTRD 5KVFH 2HMID 3CZJA 1ONQB 4HWUA 2QQKH 4LLMA 4PS4H 4C4KO 3VFOB 1TNMA 2BY2A 4NQUA 5JNYA 1IC7H 3SGJC 4DKFL 2A77L 3O3EA 1Q9LA 1Z9OA 5ICXB 3QHZH 2E7CA 1P7QD 1UEMA 1FNGA 4Y2DB 3KHQA 4OZIF 4R90H 4WFEE 2J8UB 4H0GA 2CRZA 3QNYB 3JVGA 3Q1SH 1NEZB 5C6TH 1WEJL 1HINL 1NSNL 1OM3L 3RGVA 3RA7H 2KDGA 3BUTA 1UVQB 1W72B 3D2UB 1MWAB 4IJ3B 1KEMH 3LPFA 3QIUA 5FYLL 1HXMA 4FFYH 4U0RC 3RPIB 3BO8A 5C08A 4JN2A 4OJFL 3V6OA 1PY9A 3QIBB 4XWGL 4G5ZH 2A83B 3C5SA 5ADPH 3DUUA 2R0LH 3IJSB 3SJVD 4PGCB 2FJGA 1EK3A 1IGIH 2BXZA 2FBOJ 2OJEB 2YUVA 4RMTA 5T5FH 5FOBB 2FX9H 2QQLH 3VRJB 3QULA 5SWSB 4TTDD 1ODAA 5DVNA 4OB5L 1OTUD 4U1KB 5FA3A 3OKOA 5HI4D 4AL8H 3QDAA 4GKSA 1CL7H 1AD0B 1AE6H 3A67L 1MPAL 5JLZA 3HC3L 2NW3B 4PPTA 3JTSA 3VWJA 2J88L 2VZSA 1A7OL 4KKAD 5GGRA 1MFNA 5ESVA 5J11B 1BBDL 1GGIH 4IRSA 4JE4B 5JIIA 5C86A 1YECH 3RWDB 1KCSH 3MROA 3I02A 3QEQA 1CLCA 5I1DA 4CADA 4NPYB 5F88B 1FZJB 3L3JB 4P49A 1UACH 1OHQA 2H6PB 3AXLA 4OI7A 5D9SB 3QUZD 1AC0A 5T3ZL 2VWEC 4R97C 3UZEA 5LAXB 5INDA 4AMKL 1LEIA 4R4ND 1MCHA 2AV1A 4PJIB 3INUL 2A0LD 1FL6B 4MDJA 2CMRL 1A6ZA 4ZXBC 5GJTL 3NIFE 2A9NH 2HRPH 4N8VA 3QDHA 4OCYL 4QXWA 2ADJA 3GIZL 1IM9B 4LLVB 2XZZA 1GIGL 4CMHC 4F8TA 1PG7L 3DTXB 2APVA 1EHLL 2BK8A 2UUDH 2WV3A 3VG0H 2AW2A 1AXIB 2NY5L 4NRYA 2IQ9H 3U30B 3JBG7 3V0AC 2HG5B 3DX8A 3MRNA 1R3LA 3DVIA 3MR9B 1HSAA 2IALB 4NHUB 4UT7L 1P2CA 3CDYA 2IH3A 5DD0H 5HHNA 1ZSDB 1WAAF 1XR9B 1ZA6B 4WJ5A 1U8HB 3RVXC 3FO9B 1VKXA 3CPLB 1C5DB 2VXVH 1D6VH 3GMMB 4DUXA 1FYHB 3DYMA 4PJEA 4PR5B 4LLYA 5HPMB 1CFSA 5I76A 2IWGA 4NWUH 5E8EB 3FRPG 4FQJH 1R3IL 4LGPB 4HWNA 3ARGB 1A6TB 3NIDE 1NGWA 3OKNA 4XPBH 1H8NA 4RMRA 4G9FA 2OJZL 1Y6NR 2LU4A 3WL9A 5T1LA 5C0AE 4DZBB 3OAYH 5E6ZA 1I1AC 3VFNB 3SKNA 4FN0A 1JGVH 1DQJB 3RVWD 1FL5B 2AKRB 5HVHC 1IGFL 5ADOL 4H8WC 3FOMB 3MRHB 4PJFA 4AEHL 1KENL 4JFZL 3KLDA 4BH8B 5DSCB 5E6ID 5TH2A 2HWZL 4X5WB 4ZPTB 3AU1B 2ZCHL 1T7XA 1V7ML 5EO1B 3HZKB 5ISZB 1UWXH 3U7WL 2RIKA 1ZLVH 2GTWB 4XVSH 4YAQA 1L0YA 3MRPA 2WZPD 5SWQB 3VFRA 3P0VL 2BZDA 4DEPC 4J1UA 4F3FB 4OGAD 1S7SB 4LVHB 3L7FA 2VAAB 5TQ2H 5E9DB 5DJ8B 2DICA 1HQ4A 4HK0B 2CXGA 1ZHNB 1RFDL 4JM2A 3KJ4C 1QR4A 5IWLC 1KLFA 4NC1C 4I0CC 4OM0H 5DJAB 1FO0L 2CLVB 2FJFB 1E4KC 5JPMA 2C7UB 4LPYA 3E8UH 1BVLB 4MZ3A 2KH2B 4G8FB 2FYYA 5JOFB 1AI1H 1MFCH 3PQYB 1PX3A 5L88H 4NSKB 3LKOA 3RVUC 4JO2L 4UTAH 1Y6KR 4NT6B 2YXFA 1GRWA 3U4AA 4TNVK 3WN5C 4G80A 3EGSA 3MV7B 4OLUL 1NAKH 4GQ9L 2P1YA 4POYA 1JHTA 2VDML 5DMGD 4NZDA 5FXCH 3EYVA 5C0JB 1IQDB 3Q5YA 1N5YH 4EUPH 1W8OA 2R1WB 4ZUUB 2FATH 5LQBL 3UTTB 1X5JA 3C8KA 5JUEH 4JFHE 1DDHB 3TBYB 1P6FA 3SGKA 1H3PH 3BW9B 4Z7OF 5KVEL 1CICB 3E2HC 3GO1H 3OKLB 4MXVE 2BDNL 3FQTB 4GUPA 2CPCA 1NMCC 3N85L 4LGRB 4NOFA 4EI5A 2B1AL 3BDYL 2QQNH 4J6RL 2VZ3A 4MSWA 2NTFB 4DKDC 3KPLA 1GGCH 1ZT1B 3UJTH 4F7EB 2Z8RA 1KEGH 4KKNA 2NXYD 3NH7H 2DRUA 2VDQH 2D4FA 4WUUE 1F3DH 4JY6B 4NQDB 4R2GB 3RNQB 3NCEB 3V52H 5ICZA 5LXGL 1KCVL 2YMXH 2JJUA 3AS1A 3EYQC 3GJEA 2DF3A 1T83A 5IF0B 3QRGL 2OK0L 2YBRA 1MI5A 1QEWA 4LKCB 2WSKA 4G8GE 3LSOB 3FN0H 4IIQC 4I0PD 1YNLL 1GGBL 2H8PB 3D69A 1FO0A 2G75A 4J4PA 3SCMD 4HX1B 2OBGA 1KFAL 3KPOB 2FHCA 5A16B 1NUNB 1UM5H 3QJHB 2PW2B 5I6XC 4HV8B 1B3JA 1QSEE 1IC5H 2H2PC 2DQTH 3ZE1F 4Z7WE 2DYPB 1KTRL 4N0UA 2V17L 1W0WA 5GRUH 3OXSB 3BZFB 3MODL 4QRRA 2AK4D 4XP4L 5A2JH 2HFTA 4X6FB 5DF0A 3EO0B 4HEME 4OZFB 3UTQA 3CFIC 4FQXB 2BVYA 4QHMA 1C08A 1E6OH 5HYFA 2OLDA 1AXTL 4G8IB 2EDOA 3GSUA 1J87A 4OCWL 1CE6A 4PJ9A 1DE4B 2FD6L 3V5KB 2W92A 4TNWF 1B4JH 3HE7C 5D96C 3O6FB 5JHDD 3FRUA 5J1TC 4G3YL 4U2ZA 5DGQA 3O4LB 4U33A 2VQTA 2GJ6A 2ZCKL 3BDBA 4XWOC 4DK3A 4QCIB 1DBJL 1CFTB 1BJ1H 4XPHH 4MNQE 5CHNB 1KCKA 1VENA 2EDLA 4UT6L 4KKCD 2IAMB 3GB7A 3WFHB 2R23A 2E7LA 1PEZA 2EE3A 3VD7A 4P3DB 3O2WL 1U8IA 1P4IH 3MJ7A 3JZ7A 4M43L 3TJEL 3HCVB 1CE1H 1O0VA 4JCMA 2OR7A 3D2UD 1K8IA 4NYLA 3HI6H 5CINL 4YEEA 5IHZB 2EH8L 1AQDB 2FGWL 3TZVD 2JJSA 5ESAA 4Q6IC 4YX2H 1AHWC 1RIVL 4ORGB 3DRTB 3Q5TA 3QBTB 2AJYL 5F9AC 1ZGLA 1UM6H 4GAJL 2YD2A 3NPZB 4TYUA 3MGOB 3O11B 3WFDL 3D3VE 3G6JF 2EKJA 4NZUH 4AZ8A 3T77A 2D7TH 1WBYB 1OGAE 4Z7UA 5GSRB 4X7TB 1KOAA 3EUUA 4NN7B 2FIRT 5D7JA 1A7NL 3BN3B 1A4KB 3QYCA 1JNJA 5IJKC 5EIIB 1K3IA 2P45B 2XN9B 4JO3H 2K7QA 1FDLL 1T0NB 1JJUA 2XKNB 4LHUB 1BLNA 1SJHB 4KDVA 4WWKB 3BD4A 2WLYA 4FP8H 3D39B 5D7KE 5T5NF 1FJ1B 4Q9QL 4X9GA 5ELIA 5I16B 5DD6B 4HWEL 5IB1B 4OQTH 4RGOH 1NDGA 4NQSA 1QSFD 4ZDHB 1OAYL 5E2JA 5D6CA 1DSFH 3LEXA 4O5LH 4CJ1A 5DD3L 4NFDA 2CUMA 1TJHH 3MRMB 2R56H 5TF1H 3V6FA 1JTPA 5HHVL 4CN6A 1IL1A 4RGNC 4JJHA 5B3JF 4P4KC 5FKAB 5KVFL 3L7EB 3QA3B 2DQFA 2X44D 3BXNB 4HUWB 4PJ7F 2QQKL 4LAJH 4PS4L 2EDDA 4X6DF 4Y5YB 3T4YA 1Q94A 5FYJD 5AG8A 1IC7L 1RVFH 1UQSB 5D1QD 4KJPD 3QFDA 1JNHA 2FX7H 3NTCH 1VFAB 1F00I 4HG4K 3QHZL 4FFZH 5D1XB 1KYOJ 2CRIA 3WJLA 1F4YH 2BVTA 2V2TA 3KYKH 3LRSA 5FUZH 4R90L 2COQA 2HVKA 3ZE0E 5H35B 4JPWH 2DLGA 4TNVF 5EUOF 3Q1SL 5C6TL 4LFHG 5EN2B 4DN3H 4F9LC 4Z0XA 5DURD 4WTXA 3RA7L 1QFWH 2MPAH 3AB0C 3MLWL 5E7BA 3AREA 5DMKB 5ACLA 1KEML 2P47B 3MMEB 4FFYL 4OLYH 4PJBF 2VO5A 5CD3A 1DBKH 4CL7A 4KK9D 4M8QB 4MJ4A 3DX7B 3SKOB 1SEBA 5C2BH 3ILQD 4I2XA 5JIKA 5HYEA 4CVXA 5DDHA 4G5ZL 4XAWH 1EEYB 3QP3A 4Y16A 2AQ1A 1A7RH 4HIIB 1MJ7H 4NCC1 2QHLA 5ADPL 2YC1A 1AR1C 2R0LL 4LBEB 1W2KT 4FXLA 1RMFH 4X6CE 4F9PC 3PUCA 1IGIL 2RR3A 3F5WB 5T5FL 2AJ3B 2FX9L 2QQLL 3SOBH 3WNMA 3BPLB 3VFTB 1REIA 4XCYB 4AL8L 3BJLA 4L3CA 4LL9A 2V7HA 3R4DA 1CL7L 1AE6L 4N9GB 4XMKH 1DN2A 3HZVA 3WFEH 3FO2A 4YXKH 4I0KA 4PRDB 2ZUTA 1EBPA 1DQDH 3DARA 2UWEF 1BPVA 2NQCA 4UUJB 1GGIL 2Z92A 4QHKI 1WTLA 5ISZD 1W0VA 3HG1A 1YECL 4WDIA 5J6GA 4UZGA 5I15H 1KCSL 4PV8A 1E28A 3DXAB 1G7PB 3KPMA 4IMLB 3QNXB 3U9PH 1UACL 3QO1B 4RAHA 1N0XH 3FFCB 1A9BB 5E7FA 3MLTA 1KN2H 2NY2B 1M7XA 1FV1B 1N4XH 2IADB 3V5DA 3EJZD 4P2CG 5DJCA 2RB8A 2H1PH 3KXFE 5EBMB 1JE6A 1FFPA 1FVCA 4P57A 4UAOC 4M61A 5HYJE 4C55A 1JI2A 3TIDB 1PEWA 5CIPB 1ND0B 2A9NL 2HRPL 1NGPH 3ULSA 1WUNT 1XGYH 4LLMB 5E1HB 2BMKA 4IOIA 2WBJA 1CCZA 4TULH 3KPNA 5JNYB 3VG0L 5DJ2A 3O3EB 4UQ2B 1EO5A 3X3FH 1Q9LB 4A2LA 4PJGA 4XTRC 4EBQH 2HMIC 2IQ9L 3WDIA 1EHAA 2X1WL 1H9VA 1RUKH 1FNGB 1ORSB 2JCCE 2FWOA 1VEPA 2GKIA 4PG9A 4S0SD 4Z7WB 4P5MA 3HE6A 3QDME 3GMPA 4AK1A 1MFAH 1UB5A 4XAKD 5DD0L 4PFEA 3WIHH 4V1DE 4ODVH 5I75B 3RGVB 1TETH 2F53D 4QT5A 3FQUA 2VXVL 5GRZA 1D6VL 4O2CA 5JXEC 2BVOA 2BXYA 5FUCE 3QIUB 1JGEA 4OIBA 4NWUL 1FCGA 4FQJL 4HKJA 1OL0A 3HB3C 5C08B 4JN2B 5IHLB 4KVNH 4XPBL 1WVZA 2KQMA 3C5SB 4JKLA 2HFEA 3DUUB 1JGVL 3N1QC 3GBLA 4WGWB 4WFED 3K8MA 5DRNA 2FJGB 5DUBB 1DVFA 2Y25A 3QIWA 5CJ5A 5JA9A 3QULB 2R8SH 5L0QC 4GW1A 4L29A 3B5HA 4F7MA 4FTVA 5FA3B 3ZE2F 5TQ0H 5CD5D 2KZ1B 4GKSB 5E2TH 4XVSL 5JLZB 1CFNA 1TPXB 3JTSB 3VWJB 3MBEA 2KZWA 4ZAKD 5A2LH 5E56A 3LB6D 5GGRB 1OTUC 2NW2B 2ZP0T 4E41E 5TQ2L 5HI4C 3W11C 1T5XA 4MAYA 4IRSB 4ZD3H 4GG6F 5M94B 2YR3A 4HMCA 5EZIH 5M95B 1BECA 2DQCH 4OM0L 3MROB 4IEFB 3I02B 3QEQB 5I1DB 4CADB 1FZOA 3SDCA 4KUCF 3AXLB 3E8UL 1YNTA 3KYMA 5FAAA 4GOSA 1GC1H 2CIIA 1OLZA 4MJ2A 4JZJA 4L4VA 1S7WA 3VFVA 1ZA3A 5F6IB 4HKXA 4S11A 1LEIB 5INDB 5EUKA 3DNKA 1AI1L 1MFCL 2AV1B 2D9CA 5IB5A 3R0MA 5L88L 4CDGC 2EYRA 4UTAL 2FLRT 2LFGA 2GFBA 2VQ1A 1KGCE 3B5TA 1A6ZB 2GSIA 2JJTA 1NAKL 3QUZC 4LPXA 3WIFA 1I8LA 2H3NA 3V4VH 4N8VB 2N56A 2VZVA 2W65B 4B7IA 2WUCH 3B83A 2ADJB 2Z31A 1N5YL 1YEIH 4D9RE 4PGEA 1AGDA 4U1NB 3WXWH 2A0LC 2V7NA 1I75A 2YRPA 4JG1H 2GAZA 1G9MC 2FATL 2WBWB 3ARFD 4R4FH 5JUEL 4NRYB 1EEQA 4D9QE 1D5BA 1H3PL 1QBLH 3NZ8A 5EC1A 3MRNB 3GO1L 1RY7B 1R3LB 1UFUA 1HSAB 3ULUH 3L5WA 1HWGB 2IH3B 5MEQA 5HHNB 3W5MA 4M7JH 4WJ5B 1SY6H 1VKXB 4NBXB 1PSKH 1HH9B 2X6MA 1GGCL 5JMRA 2DQGH 3UJTL 1KEGL 1CD1A 3NH7L 2VDQL 4PJEB 3GHBH 4LLYB 5IVXF 5I76B 1JI1A 1BVZA 3WLBB 1OQOA 4NNXA 1R3JA 2G5RA 1NGWB 3OKNB 3V52L 1Q1JH 2YMXL 4G9FB 3WL9B 2XN9D 5T1LB 2DDQH 4XNMA 3UAJC 2O5XH 3GK8H 1U58A 2JJWA 5AAMA 4FNLH 1OQXA 3FN0L 3BEVA 3SKNB 4XCFH 2NZ9C 5CFHA 1CDIA 1Z2KA 4LLWA 1L6XA 3HUJF 1JPFB 5JTWA 2VLJE 1VEMA 4K3EH 1CGTA 3MJ8A 4PJFB 1KTKE 1AD9A 4E9LA 5HDBF 4KK8D 5TH2B 1H3WM 1UM5L 4YH6A 4YZFF 3ZDYE 1Q0XH 3L3IA 1QD0A 1IC5L 2NYYD 5IMKA 5CEYA 4M48H 4X6CB 2DQTL 3RVWC 5A2KH 4YAQB 3MRPB 1BM3H 1TQCC 5H37H 3VFRB 1JTTA 3D5OF 3TA3D 1WISA 1YQVH 5GRUL 3CH8A 3IF1A 5E6IC 4J1UB 5KSAD 4RZCA 1OTTC 3TBVA 3FB6A 3L7FB 1YEJH 5C0AD 4U1MA 3MJGX 1FLTX 4LVNB 1HQ4B 1YPZE 2A74A 2EZ0C 4JM2B 4PLJD 1E6OL 1ZHKA 1A21A 1J12A 3JUZA 4Y88A 2R2BA 1CS6A 4EUPA 4OGAC 4WV1C 5JPMB 4Q9BA 3L95A 3DVGA 1B4JL 1FAIH 4CN1A 5JHLH 4U31A 2E8ZA 4Y4FA 2FYYB 4XP6H 4XNZC 2Z35A 5CJXA 4P99A 4HCRH 3LKOB 2EIEA 4XPHL 4O00A 5KAQG 4GRWH 4G80B 4KMLB 3EGSB 1BGXH 1P4IL 1HH6B 4MVBC 1OB1A 1CL7I 1YDPA 1CE1L 1JHTB 3MUJA 1E4XH 4FRWA 3VXSE 3HI6L 5DJYA 3QWRA 2W91A 4YX2L 5DFTA 4CVWA 5F9JA 4YDVA 4QOKA 5I1LA 1UM6L 5GS1C 5L8LB 2BY0A 3QH3A 3KDMA 3UYOD 1T3FA 3C8KB 3VWKC 1S9YA 4NZUL 1UKTA 2D7TL 4ZFZA 4L5FH 5I74B 4I1NB 3FN9A 2ICWJ 4GUPB 1ZHLA 2XG4A 4P2OD 1HILA 3GZKA 4NWTH 4U05A 1MFBH 1UA6H 3OV6A 4JDTH 3EJYD 3WKMH 4EI5B 4JO3L 2NX5B 4MSWB 5DR5H 3KPLB 4OM1H 1U91A 3MCKA 2YN5A 4PTTA 4FP8L 4N5EC 3QI9D 1NBYA 3W39A 1I1RA 2ZCLH 2P8LA 2E8YA 3LQAC 4JFHD 4K8RH 4OQTL 4RGOL 5ICZB 1CXEA 3GJEB 4BYHA 2YBRB 1MI5B 1NANI 1DSFL 1QEWB 4O5LL 4PJCE 5C7XL 4RFOH 1HXYA 4I3SH 3OHXB 1TJHL 3H7BA 2R56L 5TF1L 5HVFB 3D69B 1IC1A 4M03A 1FO0B 2G75B 3PWPE 1WTGT 3C60A 3FO1A 2H26A 1HQRA 2Y6SD 1MAMH 3GMNA 2IMNA 1AKJA 3BDXA 2VL4A 4I0PC 1MQKH 4WUUD 1CYGA 1RVFL 4N0UB 1WCQA 2AJXH 1W0WB 2FX7L 2E9JA 3NTCL 4QRRB 2YHGA 4FFZL 4YEFA 1OSPH 1F4YL 4G8GD 3O6MH 3KYKL 5EOCJ 5FUZL 3BKCH 3LQMA 4EXPX 4JPWL 4M6MH 3LRHA 4U4BA 2W0LA 3GSUB 4IRJA 5ETUA 1CE6B 4PJ9B 4DN3L 4E41B 4ELME 4PRPE 1QFWL 2MPAL 5EOQH 2FHFA 4TTGA 1QSED 3FRUB 2I5YH 3GIVA 5F1IB 2NNAA 1SBSH 4OLYL 3QEUA 2GJ6B 1DBKL 3QJFB 4K94H 3OKKA 1EV2E 1ZAGA 5DQJA 5C2BL 2X40A 3GB7B 4NRXA 2R23B 1TVBA 1HE7A 1HI6B 1U8IB 4XAWL 3MJ7B 3ALPA 1A7RL 1G7LB 1MJ7L 3MV8E 4Y2DC 4NYLB 1K8IB 1RZJH 1RMFL 4KMTH 1P5UA 5ESAB 3UTPE 5C71A 3SOBL 1ZGLB 1RZ8A 4UQ3A 4ALAH 2FB4H 5K9QI 3RVTD 4KROD 3V9FA 5HJ3A 4OQTA 3T77B 4APQD 4IJ3C 2XTJB 4XMKL 4Z7UB 1CD0A 3TZVC 3WFEL 2WLZA 3H3BC 4MNQD 4PP1C 4WCYH 4YXKL 5KW9H 4PJHE 5D7JB 4JFFA 2VH5H 2R29H 3MZTA 3QIBC 4GMSH 1OARH 5C0FA 1PQZA 1BLNB 4P2YA 1T7VA 4Z7VF 5I15L 1OTSD 3DV6A 3A6CH 3U9PL 4XI5D 3TVMA 2BX5A 2HRLA 1N0XL 3D3VD 5GGUA 2NTSP 2DQHH 1NDGB 1CQYA 5SWZE 1KN2L 4KKLC 1OGAD 2VIRA 1AQKH 5D6CB 3ZKMC 5B8CA 4ODTH 2H1PL 3L9RA 3V6FB 4OKVA 1A2YA 4W6XB 1IL1B 5AYUH 1ZLUK 1FZKA 1FZMA 4HIJA 2GSGA 3KPTA 1NGPL 3U6RA 4XXCA 2DQFB 4OIAA 1MFDH 5EOTA 1XGYL 5D7KD 3T4YB 2OQJA 3VXRE 4F7TA 2AEQH 4TULL 1Q94B 2DL9A 3GSWB 3JWOH 3BP6A 3KNBA 3ULVC 4GRLA 1EO8H 3X3FL 3QFDB 1JNHB 3WDJA 1TZIB 5D2LA 5JW5A 4EBQL 4Z0BH 1K85A 1H3GA 5K93A 43CAB 1RUKL 5HYSA 1OP3K 4TSBH 1V3MA 3UPAA 1NDMB 2V2TB 3LRSB 2JB5H 1ED3A 2X1OA 2HVKB 1UXWB 3T0EE 1MFAL 3WIHL 5AAWA 4JQVA 4KJPC 4L4TA 4ODVL 1TETL 4YDKH 4Z0XB 2X4RA 1YPZB 3RX8A 4U3CA 1S78C 3VI4F 4Y4KA 3AREB 3B6SA 3EDEA 1XF3A 4BSJA 4Y19E 4ZFGH 4MQTB 5CD3B 2IQAA 1UGNA 4KK6C 5IBUG 4KVNL 4I2XB 3RHWF 4CNIA 1WJ3A 1T2XA 5F3BA 1WT5A 5DDHB 4Y16B 1SQ2N 2P49B 2IANE 4NN5C 5I8KH 5HVWA 2R8SL 3SDDA 2CRYA 3GKZA 4YPGA 3VXSB 3T3PE 2BHYA 4L3CB 5TQ0L 1CXLA 2V5SA 3RL1A 5E2TL 3IT8D 3I84A 3HZVB 1MCCA 3C6LB 1BQUA 1IC4H 1L0QA 3FO2B 3EYUH 3ARGC 3BPCA 1M7DA 1R5WA 3RZCA 5J7CC 4ZD3L 1D9KD 4LPUA 2J12B 2Z92B 2B2XH 5EZIL 1RPQA 2B20A 3OKDA 2DQCL 3HG1B 4WDIB 5J6GB 1K3ZA 4PV8B 4DCQA 2VXSH 3W9DA 2LAAA 3KPMB 2CJUH 7CGTA 4QY8A 3T65B 3H8NA 2OZ4H 3DBXA 2OXGA 2WP3T 3RBSA 2WIIA 4HGWB 1GC1L 2HKHH 4PJ5E 3MLTB 4NQVA 3QCTH 2VZUA 4JKKA 4R3SA 4GXVH 4HUXA 4X0KA 5GHWH 3V5DB 4NKOA 1MCDA 1L7TH 4Z9KB 4J3SA 5BRZE 1A6AA 3CX5J 5DJCB 1FFPB 1FVCB 3CDGA 3SGEH 4M4PA 3WFZA 4M61B 5JQ6H 3EYSH 3S4SA 3WIHA 1U0QA 3VFSA 4LVHC 2AAVA 1JPGA 3V4VL 3ULSB 2WUCL 2BMKB 4IOIB 1YEIL 2WBJB 3WXWL 2Z8WC 3DETC 3KPNB 2CK0H 3RWCA 4JG1L 1HHIA 2DI9A 4KHTH 3MRKB 5DJ2B 4I5BA 5A43C 1ES0A 1XIWA 3Q6GH 1BMGA 4PJGB 4R4FL 5INCA 1QBLL 8FABA 3QEGH 1NCWL 3RWIA 2FWOB 4PG9B 5C6PB 4JKMA 4P5MB 3HE6B 3GMPB 3KXFD 1BQHB 5J13B 3ULUL 4N68A 1UB5B 1KLUA 5HYJD 1QRNA 4DGVH 4M7JL 2GT9B 1SY6L 4QT5B 3FQUB 1PSKL 1VFMA 4O2CB 3ARYA 1Q72H 3WBDA 2DQGL 2I24N 2BVOB 2NR6D 1EAPA 3GHBL 4MA7H 4J3WA 2BJMH 1JGEB 4Q0XH 3QXUA 3I6LE 4HKJB 3M1BA 1H15A 3K7UA 5K9QG 4KPHH 2PTUA 3C09B 1Q1JL 5GIRB 2DDQL 5CSGA 2NX5D 2O5XL 2O5YH 3GK8L 4HG4J 4FNLL 1CICC 3BRGC 4F15B 1F45A 4XCFL 3QDMD 5C0EA 5EPMB 5DRNB 1F6LL 4V1DD 5I19H 1DVFB 2Y36H 4K3EL 3QIWB 1XGUA 4EOWH 4GW1B 4L29B 3TBWA 3P3YA 4F7MB 3IDXH 4FTVB 4DN4H 1Q0XL 1JWUA 4M48L 3RQ3A 3ARBD 3CDFA 3ZDXE 5ID1A 1BM3L 5CP7B 3MBEB 1YQVL 1TVHA 4I18A 3GNMH 3ZKNC 1YEJL 1T5XB 4MAYB 1PD6A 3U4BH 5FYKH 1QO3B 4UDUA 1TITA 3RRQA 1U2CA 4GKZA 3IKKA 3PP4H 3SGDI 1FZOB 1IEHA 1IT9H 4FG6D 3TO4D 3SDCB 3MZGB 2NY3B 3WS6C 1FAIL 1YNTB 1IGJA 3KYMB 3LKRA 3OWEA 5JHLL 2CIIB 4JR9H 4JZJB 4L4VB 1S7WB 4XP6L 1ZA3B 1UC6A 4HKXB 5DJ6A 1MY5A 3VFVB 4CU6A 1RJYA 5EUKB 1LQSR 4N9OB 4YHLH 5IB5B 3IKCA 4HCRL 3BEWA 1FYTA 2EYRB 4WFHD 4DZ8A 4JRXE 4YIQA 2DWEA 2ENSA 2GFBB 2VQ1B 5I1KH 1BGXL 4E41D 3UTZA 2GSIB 3CD4A 3WIFB 1S9KC 1SY6A 2H3NB 1E4XL 2D9QB 3VD4A 4FQXC 1YEDA 2Z31B 4K2UH 4W4NA 1U3ZA 5HI3D 5KAQF 5DYOA 5JW4N 4HJGA 2DTMH 2GAZB 3R8QA 3LZFH 5FKPA 2VR9A 4KV5F 1D5BB 1XGQB 3FMGH 3NZ8B 5EC1B 4L5FL 1JYWA 1XGPA 5C70A 4U1SA 4PRIE 3L5WB 3MSPA 1KGCD 4NWTL 5MEQB 2IAMC 1MFBL 1UA6L 2DJUA 4JDTL 3A6OA 3WKML 2HLFD 5DR5L 4OM1L 2VB5A 3I2CH 1CD1B 4D9RD 1R5IA 5CS7A 5FO7A 2JELH 4F80A 4QXUH 2ZCLL 2AVGA 4NNXB 5GGQH 4XP5H 1R3JB 4K8RL 4Q6YA 4D9QD 3QDGE 4Y1AA 1JF6A 6CGTA 2OXHA 4XNMB 3TEUA 5FGSA 4JFOA 1JUFA 3DHJA 4MQ7A 2L7JA 1U58B 2A6DB 4RFOL 5C0BA 3BEVB 3N1PC 4I3SL 4NN7C 4LLWB 3B5GA 1VFBA 1I3VA 2F5AH 3MJ8B 1MCBA 2OI9C 1IM3B 1AD9B 1SYVA 3T0AA 1MAML 4LCCA 4UOJA 4IMKC 3L3IB 4WWKC 5CEYB 1WITA 5IMKB 1MQKL 4RGMB 1CGVA 2V2WA 2XICA 1YY9C 1B4RA 4PJ8D 4HCRA 1LP9F 2AJXL 1F6AA 4KK8C 3IF1B 1EMTH 4RZCB 3TBVB 5JR1H 3FB6B 4L9LC 4U1MB 1OSPL 3O6ML 1AH1A 2A74B 5BOZG 3BKCL 5IFJA 2I07A 5EU3A 4MAUH 1PYWA 1ZHKB 4M6ML 1I3GH 2Z4QA 2R2BB 1XCTA 4LEOA 4QLRA 5EBWA 3NGBB 4EUPB 4K7PX 5F8QC 5KSAC 4YHNA 5FF6A 3L95B 3DVGB 5EOQL 3ARXA 2I5YL 4Y4FB 2VE6A 4Y5YC 2K1MA 2Z35B 1SBSL 1H5BA 5AD0A 4K94L 3ZYZA 5DC0A 2NXZD 2OMBA 1F42A 1CU4H 4EJ1C 4PJXA 3SO3B 3UYRH 1HWHB 1OB1B 1QVOB 4IBLT 4MB3A 4MGXA 1YDPB 2R0ZH 4BFIA 3VG9B 4LVOB 1RZJL 5DJYB 2HT4D 2GI7A 4KMTL 5BRZB 1U8NA 1KB9J 4W6YB 2VKXA 3CC5A 5F9JB 4YDVB 3RAJH 4QOKB 5I1LB 2NY0B 1T89C 1NLDH 2FB4L 3PDOA 4ALAL 2X89D 3QH3B 3KDMB 5C07A 1CDJA 5IW1B 3QO0A 1S9YB 4MXQC 3REWA 4QRSB 4ZFZB 1V3JA 4MLSA 3RBGA 3NZHH 5ERWA 1X5ZA 4MNGE 1NJ9A 4WCYL 5KW9L 1ZHLB 2Z8SA 4ZS6D 2VH5L 1HILB 3BQUA 2Q20A 5FB8A 3SO5A 4Y4HD 2R29L 5E2UH 4GMSL 1LO4H 1R5VA 3SDXE 1OARL 3WLWD 3KPRA 3VXSD 3K1DA 1U91B 3MCKB 4PTTB 3OF6A 2GTZA 3C6LD 4P2OC 3W39B 1JRHH 3A6CL 2DI8A 3IB4A 4F33A 3KLHD 1SHMA 3B9VA 2P8LB 1DBBH 2FBJH 3BYYA 3BPLC 2DQHL 2QSCH 3NVQA 5T1MA 3IAQA 2FDBP 3QUXA 1AQKL 2ICEA 3H3PH 3SDAA 3G08A 1HXYB 3RIAF 1F3JA 5JORA 1ZTXH 2VLJA 4HJJH 3T1WA 4ODTL 4NUJA 3H7BB 4YWGH 5DRXA 3ZYJA 5AYUL 1ADQA 2WWKT 3C60B 4YHKH 3QAZB 3FO1B 2H26B 3VFMB 1HQRB 4HBCH 4J3OC 3U1SH 5KVMC 3GMNB 1MFDL 1AKJB 5BS0E 4H1LH 4OF0A 1EZVY 2AEQL 3H9SB 4ENEC 3JWOL 43C9A 1A7PH 2QR0B 3TNMA 4JHAH 1EO8L 3HAEH 5ITFA 1CFQA 3CFKA 1G7QB 2WWKO 4Z0BL 3OR7A 2Y6SC 4NJAH 1JZ2A 4ESKA 4L4JA 4TSBL 1DTUA 2JB5L 1MCKA 1MHPH 5MENE 3BSZH 5C92A 1AY1L 4UBDC 5ETUB 3PWPD 1O5DT 1D5XA 4YDKL 3CFDA 3QXAA 5B39A 4XVUD 1JTOA 3GIVB 3THMH 4P46D 2NNAB 4OLXH 4ZFGL 1JPST 3QEUB 3S37X 5EOCH 2EECA 3OKKB 3W5NA 5DQJB 5FGBC 4NRXB 2WUBH 2P43B 3RUGE 1ZHBA 2MOVA 1D5MA 1QLEH 5D5MF 5IESH 4PREA 5I8KL 5EBLA 3O81A 4PRPD 1RZ8B 4MJ6A 4UQ3B 3RGVC 3BESR 2BVQA 5D7LB 1XR8A 3W2DH 2G60H 2PYFB 5HDQH 1RHHA 4E0RA 2VRAA 3QIUC 4RMQA 4FFVD 1IC4L 3EYUL 1JPSH 4JFFB 5D1ZA 5C3LD 1C1EH 1UEYA 4HUMB 4NQEA 4G7YH 3MV8D 2GIYA 5LVEA 2B2XL 4G6KH 4DOHB 5C0FB 1PQZB 4C56A 3QFJE 3UTPD 2DM3A 2VXSL 1FCCA 3DV6B 3U9UA 2CJUL 2OZ4L 3VD5A 4FQPA 3TVMB 5C6WH 5GGUB 1NFDF 1P5VA 3VGHA 4WIQA 3UEZA 2HKHL 3C6SB 2DI7A 3G9AB 3TNNA 1NBVH 1RIUH 3QCTL 3ZL4H 1RK0A 4GXVL 4YJZL 1II4E 5GHWL 1TPXC 4KQ3H 1OTSC 1L7TL 3UTSE 5B8CB 2N7AA 3ARDD 5F7WC 3ET9F 3L9RB 4OKVB 1TNNA 3O45B 1A2YB 4XI5C 5JQ6L 1A02N 2X4QA 1SJXA 3EYSL 1YNKH 3GEWB 1FZKB 1IJ9A 2C1OA 2BNQE 4HIJB 5D7IE 4NBZB 1G0DA 1IARB 3P0GB 5JDSA 3U6RB 3MV11 5EOTB 2EDWA 1XMWA 2OQJB 4F7TB 3TWCH 2CK0L 3BP6B 4KHTL 3KNBB 5D8JH 5E2WH 4GRLB 5F96H 5GS3A 3BMWA 2J5LB 2XY2A 3Q6GL 4OBSA 5D2LB 5JW5B 5SWZD 4AT6A 1QFWM 3OZ9H 3QEGL 5HYSB 3PF2A 1ED3B 2CKBB 4ZOBA 4K3HA 1WV7T 3VXMA 2WQRA 4NP4H 4L4TB 4HZLA 3ZKXC 2LU7A 4DGVL 1KPRA 2J6EH 2X4RB 2AXJA 5EORH 1Q72L 1B0RA 3VXRD 4MA7L 4Y4KB 3B6SB 1MHEA 1XF3B 2BJML 4Q0XL 5HDLA 4XB8A 1KN4H 5H94A 2FHBA 3GMOA 5CGYC 4KPHL 5F72S 4CNIB 5F3BB 2DWDA 2H32H 4HPOH 4OCSH 3Q6FA 4RISH 4MD4B 2O5YL 1VB9A 4BUHA 3VMNA 5JW3H 1O7SA 2UZXB 3BGMA 3T0ED 4HLJA 4LPWA 4WEUD 3QQ3A 4QWWD 3AC0A 5I19L 2Y36L 3QDJA 4EOWL 1K2DB 3SDDB 3HHRB 1T80A 1YUHA 2OZ4A 3IDXL 1JL8A 4DN4L 4KRPB 4YPGB 4I4WA 5A3ID 3DGGA 3RL1B 4OZIA 4Y19D 1WICA 2X42A 4PGJA 3VGGA 3QUYA 3ARZA 5DRWA 3BPCB 4BJLA 3GNML 1M7DB 2YRLA 1AIFA 2FEDC 4TRPH 1R5WB 3RZCB 2E9IA 4X7SH 5J1AA 1T4KA 4OCRH 5J3HC 4TVSa 3U4BL 2W38A 3P0YH 4N0YH 5FYKL 2C3HA 3OKDB 3AS0A 3E0GA 4M8VA 4QF1A 4DCQB 4WHYG 3PP4L 3W9DB 1IT9L 4K7PH 3STZA 4QY8B 1LK2A 3UO1H 3CSGA 3I6KA 3DBXB 5KS9E 4TPRH 1IQWH 2WIIB 5L2KA 5KSBB 4JR9L 2A38A 4NQVB 4PJDE 4R3SB 4HUXB 5K59E 4X0KB 4TSCH 4YHLL 4NKOB 5I0DA 1MRDH 2VXUH 1A6AB 3CDGB 5I1KL 4H0IA 1XF5A 3S4SB 3VFSB 3VFPA 3TV3H 4S1QH 1JPGB 3MA7A 4HKBA 3NIFF 3QR2A 4TQEH 3HPLA 4JM2C 2IJ0C 4OF7A 2E9BA 3VMPA 5MHSE 3SY0A 4K2UL 3RWCB 5GSVA 3K80A 3W0WA 1RSFA 2DTML 4OUUA 4UIKH 4I5BB 1ES0B 3LZFL 1XIWB 3VD3A 5C0CA 3L5IA 3P9LA 5HGHA 4PJ5D 5INCB 2NY5C 3ARSA 2A9MH 3FMGL 1BZQK 5BS0B 1H3TA 8FABB 3RWIB 4QHKJ 2E27H 1WF5A 5BRZD 1RZ7H 1SVZA 3OMZA 1KLUB 1TTGA 2NY0D 2VITA 4NC0B 3MV9E 4KHXH 1U8QA 1AR2A 3I2CL 5C9KA 3BP7A 1EAPB 3RPKA 5CJ8A 2Y9RT 3C08H 3CGTA 3TIEA 5D93B 4JHZA 2JELL 3M1BB 1HHKA 1H15B 4QXUL 1EHXA 5GGQL 1G9NC 4XP5L 1S9XA 3NIDF 4IM8A 4MB5A 5DWUH 3IFNH 3BHBA 3SGKC 5EIQA 3BAEH 2NR6C 3PL6A 1G7JA 1S7VA 2IANA 5C0EB 1FGVH 4Q9RH 2XOTA 1MVUA 4IOFC 4UIMA 3RX7A 2VLKA 2F5AL 4NZJA 1XGUB 4X8JA 4EI5C 4QXGH 1HOCA 3TBWB 3TFKC 1SVCP 2PXYA 4MQXD 1U3HA 3K2UH 4EN3A 2ADFH 1JWUB 1DJSA 5C09E 4Y7MA 3FKUS 3I6LD 5ID1B 1WAAA 1TVHB 4LLDA 1J8HA 2PYEE 1EMTL 4JDVA 5JR1L 3SKJH 1T83C 5FUCC 4XZUA 4EZMA 3ARBC 2VSDA 4MAUL 5L8KB 1YEFH 3H9SD 1CDYA 4M5YH 3QZWG 5GZNC 1I3GL 1TJGH 4GKZB 1RZGA 1VFUA 4MJIB 4J4PC 4JGMA 4KI1A 3HRPA 5K33A 3ZT6A 1W0YT 4HW6A 1IGJB 3LKRB 1IAKA 1IKNA 3MGAA 4OF3A 3CNKA 1CDUA 5DJ6B 1JGLH 5GISH 1RJYB 3U0WH 4G6MH 2ADGA 2CDGA 2JTDA 3S37H 4BFEA 5EU6E 2QL1A 3IKCB 3BEWB 1FYTB 5IMOA 4XRCA 4DZ8B 5IBLD 2XQYK 4GJTB 1CU4L 4X99A 3UYRL 3QCUH 3UTZB 2OP4H 4ZTPH 2R0ZL 3BZDA 4YE4H 2YPVH 4I8DA 2VDNH 1YEDB 3UX9B 5T1KB 4BSWA 2VR5A 5DYOB 1JZ3A 4L3EE 4HJGB 3RAJL 3TYFA 4OUOA 1NLDL 1WSST 4PJ9C 4OBRA 4J23A 3TC9A 3J7HA 4HKZB 2NCMA 3NZHL 1XGPB 5DJ0A 4HT1H 4MXVF 5HI3C 2EXYD 4JRXD 4U1SB 1VESA 3MV01 4HJ0D 2E7LC 5CEZE 5E2UL 4DKAA 1LO4L 5D7LD 1XZ0A 2WK2A 2DQJH 4NQCA 4P23A 1F2XK 4RIRB 5HI5C 4YHMH 4QNPE 4LDOB 4X9HA 2XI9A 1R5IB 2HT3D 5FO7B 5TJWK 3SGEI 4OZGE 4M7LH 2DLTA 1JRHL 2ARJA 4G8EA 3MFFA 4ZSOA 4RAUA 3Q2CA 1DBBL 2FBJL 1GZQA 1FIGH 1D7FA 2QSCL 4PGZA 4Y1AB 1HNGA 4JFOB 1JUFB 4MQ7B 2XTJC 3H3PL 3CAFA 3UDWA 5C0BB 3HRZA 2MQ0A 1ZTXL 3F7PC 4FXGA 4HJJL 2VERN 3GI8H 4PRID 5EG6C 4YWGL 2R69H 5D7JC 1RU9H 4DUVA 5IROC 1VFBB 3BIAX 4M7ZB 1CXIA 5DEFA 4YHKL 4X7CC 3W81A 1SYVB 3G04A 4HBCL 4U2YA 3U1SL 3HZMA 3CFBA 3LN4A 4LCCB 4HAGA 4RX4D 2V2WB 1Z9MA 4JQXA 1A7PL 4JHAL 3VA2C 1BBJA 1F6AB 4JKWA 3QDGD 4NJAL 4U7MA 4GRWB 3FJTA 2YKLH 3MNWA 1IGMH 2C4FU 5HHXH 1LO3H 5IFJB 2I07B 3BPNB 5EU3B 1MHPL 1PYWB 1B9ZA 3BSZL 2HJLA 3LY6A 4N8CH 2Z4QB 1XCTB 5EBWB 1XT5A 1WFUA 5FF6B 4D0DA 4YHNB 1QKZH 3TP4A 1EIBA 3TH2T 3KPQA 1Z3GH 2EIDA 2Q1EA 4J7RA 1B2WH 2VE6B 1PKQE 2V6HA 4OLXL 1H5BB 3MRQA 3DRQA 5EOCL 5AD0B 1MY7A 5KSVA 4PRHE 3UPCA 5JQHC 2WUBL 4PJXB 1Z5LA 3MA9H 4U49A 2ESVA 1QLEL 2EO1A 1JWMA 2W0KA 4BFIB 1T2QH 1OP5K 1U8NB 1A1OA 5IESL 3JTTA 3CC5B 2KL6A 4J3TA 1EH9A 1JPTH 3PDOB 1YMME 3AY4C 2C4FT 4LOUC 1NKOA 2ICWA 5C07B 3W2DL 3QO0B 2G60L 3REWB 5HDQL 3U0PA 3AREC 5MEOA 3DI2B 2HT4C 5ERWB 1S9VA 1NJ9B 1AXSA 3UROR 1JFQH 5CZXD 1JPSL 4KVCH 3ZTNH 1DQLH 3BQUB 5FB8B 2JE8A 1C1EL 3KPSA 1TQBC 1EJOH 4G7YL 1R5VB 5DFWH 4Y16C 1H8OA 2M26A 5DLMH 3KPRB 1PG7W 4G6KL 2AJUH 4BH7A 1QOKA 2GTZB 4H1LA 2EO9A 5I2IA 3O8XA 2ADIA 2NY1D 4O58H 4F33B 3I3DA 1ZXQA 2EXWD 3VFWA 1JYNA 3TH3T 3WLWC 5D7SH 1NBVL 1RIUL 2HP4A 5T1MB 3QEHA 3QUXB 3ZL4L 2ICEB 4HIEA 3SDAB 4KQ3L 3LN5B 1F3JB 5JORB 3C6LC 4NFCA 2ZOLA 3WKNA 4NUJB 5DRXB 4Y5VA 3AM8A 2DKMA 5CJQH 1YNKL 3G6JA 2DJSA 3MGTA 3QRFM 2VMFA 3LV3A 1TCMA 3V7AE 5EFIA 3HKFA 3TWCL 2Q76A 5D8JL 5E2WL 4HEPG 3C5JA 43C9B 5F96L 2XTLA 3SGJA 1CFQB 3CFKB 1K4CA 4QHLA 3OR7B 5E4IA 1INEH 1ZMYA 3OZ9L 3VE0A 2AJZA 1E0OB 3QUMH 4NNYB 3ZE0F 4BA8A 4NP4L 4P2QA 2MCPH 3RWFB 1V8HA 3X14A 5DRZA 3KYOA 3QHTC 1D5XB 4LPCA 1C5CH 2J6EL 2DJ4A 3CFDB 4U6TA 3MXVH 1A7BA 5EORL 3LEVH 4ZXBD 5B39B 5BS0D 1TIUA 5C9JB 4Y8DC 4MS8D 2WBJC 3D0LA 3VXPA 1KN4L 3BH9A 2O93L 5CSZA 3QQ9C 3LHPH 4KUZH 4GQPH 5E4EC 2OCFD 1MCSA 4HPOL 1X6NA 4OCSL 4EVNA 4RISL 4K23H 4PJ7A 1D5MB 4QRPE 4NDMA 1PKOA 5JW3L 3CXHJ 4FQLH 2YUWA 1LMKA 5IG7A 5CKGA 4N1HB 5MEND 3HE6C 5J13C 4X6CF 2ZUYA 5EBLB 4DGYH 3L5HA 4MJ6B 4OFYA 4JRYA 2BVQB 1XR8B 1FSKB 3HNVH 3F12A 1Z6JT 3HMXH 1SMAA 2XACC 4PBXA 3U0TA 3GMLA 1RHHB 4E0RB 3DYPA 5E8OA 2R4RH 3HI5H 3D85A 5EUOA 2F54A 1JZ8A 5GJSH 5D1ZB 4TRPL 3C09C 4X7SL 4P2RE 4NQEB 4OCRL 3K4AA 1URLA 1JZ4A 3P0YL 3FQWB 4N0YL 4O4YH 4QRUA 4F15C 2UY6A 5E03A 4I77H 2VL5A 1I7RA 1YN6A 4PJBA 4C56B 3LKNA 1NUGA 3OTTA 1DVFC 3U9UB 4K7PL 3QIWC 1RHFA 3UO1L 4TPRL 1IQWL 4IOSD 1K8DA 2P8PA 2VLRA 5F8RC 3TNNB 2EDRA 1MF2H 1RK0B 1VFOA 3DX6A 2EDTA 4TSCL 1T04A 3OJ2C 1RJLB 1MRDL 2VXUL 1A4JA 5GXBB 3MBEC 5B22A 1KBGH 2F15A 5E6YA 2EC9U 3RU8H 1UADC 2X4QB 4MJID 2EICA 4ZUVA 4LCIH 2C1OB 3N1MC 3SE3C 3TV3L 4S1QL 3IFOA 5EDXA 4MAYC 4TQEL 2J6EA 5JDSB 3P4LA 2LABA 5KJRH 3QFJD 5D2NA 4MD0A 3O2VH 1QACA 2O26U 1KLGA 2MKWA 5DC4B 5EO0B 4UIKL 2BFVH 3SDCC 1S3KH 1BD2E 3RWHB 4NBYB 2UWEA 2NY3C 4U1GC 3GGWA 4ZNEE 4AT6B 3ZZ1A 1DL7H 2A9ML 4JZJC 4LCWE 1DN0A 4RWYH 2JCCF 4IRZH 3LOWA 5J57B 2E27L 5I1CH 3UTSD 1JRHI 3VXMB 5T1KD 1BIHA 1RZ7L 3ZHKA 2BY3A 1BREA 3CSYA 3AAZB 4EQ3A 4HZLB 3SHSA 3RVUD 2BNQD 2GJZA 2VDKH 1KPRB 1WFTA 4KHXL 2D0FA 1I8LC 1EFXA 3OXRA 4HIHA 1B0RB 3IDIA 4JFEE 1MHEB 2Z31C 3C08L 2EC9T 2YPLA 1WIUA 4ZUTA 1UJ3C 1P1ZA 1LE9A 1G9MH 3GMOB 5GRJH 2DWDB 1Y18A 5B38A 5DWUL 3Q6FB 2IEPA 3IFNL 1I85A 3BAEL 3WSQH 3HI1A 3L6FA 3BGMB 1FGVL 1I1AA 1M1SA 4Q9RL 2ENYA 3S35X 3QQ3B 1WQVT 5F93C 3QDJB 4HS6A 2H2SC 1JCKA 4P3CH 5DVKA 2IGFH 4QXGL 5IHBA 4GBXD 3K2UL 2AQ3A 5AUMA 2GCYA 2ADFL 4I4WB 4OZHE 1HYSD 3DGGB 1V7NH 4OZIB 5HD8C 4K71B 4QWWC 3QUYB 3QQNA 2NY4B 5DRWB 4XPFH 1ORQA 1AIFB 3RIFK 4P9HC 4WI2A 3SKJL 2Q86A 4Q74A 5A3IC 2CLZA 2X9YA 5IOPB 5J1AB 1T4KB 1LO0H 3EYQD 4WTZG 2P5EE 1YEFL 4M5YL 1TJGL 3HNSH 5F1OB 4DVBA 4QRQB 1UCBH 3IJYA 3K74B 3I6KB 2XRAH 3MLVH 4PGBA 4OV6F 5L2KB 2Q8BH 1N26A 1YMHA 3B2UC 3U0WL 1JGLL 2B39A 1N3NA 4LSTH 4PLOB 5GISL 4G6ML 4JO4H 3S37L 2EC8A 2EDYA 5FOJA 1R0AH 5CILH 1FRGH 3DJ9A 2H2PD 1NGQH 1NCCH 2XPGA 3QWOA 1UZ8B 1XF5B 2R4SH 3QCUL 5BXFA 3WN5A 3VFPB 2OP4L 3MA7B 4HKBB 4ZTPL 3HPLB 1U8KA 5CGTA 1I3RA 2R2CA 3FFDA 2YPVL 4YE4L 5IM7A 1T22B 4NO2A 4PG2A 2VDNL 3PIQB 3SY0B 4X4XA 1CGSH 5GSVB 3W0WB 3NGBC 4OUUB 4X98A 5TE7H 2J8UE 5DD1H 4NHCH 5C0CB 3P9LB 5HGHB 1ZWIA 3RDTA 4GG6A 5IHUH 5I1AA 1Q0YH 3GBMH 3HE7D 5F97E 3S3SA 4YFEA 5GS2D 3UBXI 3FT4B 5CJXC 4NZRH 3S97C 1NC4D 4HT1L 2BSRA 5H8DA 2CLRA 2ZZUT 4WI9A 5HHOB 3ILPA 4Q7DA 3SO3C 2VITB 3B9KA 1DR9A 3O9WD 2D2OA 1U8QB 2DQJL 4M1DH 4HUNB 5FO9A 5C07D 5DJXA 3RKPA 4YHML 4LVOC 5MHSD 3BP7B 2ED8A 1A3RH 3W82A 5IKCB 3TIEB 1D5ZA 4Z7QE 2E3VA 4M7LL 5KANG 1HHKB 3O4OB 3HN3A 4P5TA 4ZNCD 1BOGA 2NY0C 1S9XB 5F3HA 4Y2OA 1FIGL 1X4XA 1UKQA 3BHBB 5SWSE 3FB5A 2E7HA 3PL6B 3DSFH 1G7JB 1S7VB 1ZLUH 4X4YA 3GI8L 4IIQA 4UIMB 1MVUB 2R69L 1RU9L 3KYAA 1G6VK 4PTUA 4YHOH 2VLKB 1CGUA 4X8JB 3MV9D 5CJOH 3X13A 1HOCB 3D18A 2PXYB 4EIGB 1U3HB 3E6HA 5IJVA 4EN3B 2ZUUA 4NIKB 2BVPA 3LH2H 5DMYA 3GSOA 2KBGA 3V8CA 1OP3H 4LLDB 1J8HB 4LQFH 4J2XA 1UJTA 4JDVB 4O51A 3ULVE 3WNNA 2QJDA 2YKLL 5GRXG 1IGML 2JF1A 4XZUB 5HHXL 5IVXA 1LO3L 2FCBA 5HGAA 1I4FA 4W68A 4M6OH 5DZOA 3O2DH 4N8CL 1D3CA 3S3PA 4PJIE 1RZGB 2C5DC 3IVKA 3KLSA 3QAZC 2HA1A 5B3JE 1QKZL 2IFGA 1IAKB 4P4KD 4WHTA 1Z3GL 4LK4A 1B2WL 2ATKA 3PHSA 4X6DE 4XMLL 1OPGH 2CDGB 3HUJA 2AABH 3MLRL 5IMOB 3L1OH 4XRCB 2PYED 1BX2A 5AG9A 4NC2B 4WO4A 1G6RH 1J10A 1UWXK 4X99B 1ZLVK 3RTQA 1EAJA 3TT1H 3MA9L 1N5AA 2VN7A 2L4OA 1IGYA 5HHQA 1T2QL 4HD9A 5DFVC 4M9PA 1Y6MR 4BSWB 3EFDH 2D0GA 4DQOH 1FL3A 3MRDA 4Q6IA 1AHWA 4W6WB 5EU4A 3TYFB 1JPTL 4XVTH 5BO1H 1N2RA 1Q9OA 3F58H 5JOPE 3QG6B 2BNRA 5JW4R 1J1XH 1VA9A 1I1CA 2XA3A 3DIFA 5EU6D 5DJ0B 4TVPL 2YPKA 2DKSA 3WO4B 4RAVA 4OD3H 1J88A 1JFQL 3EDDA 4HULB 4KVCL 3ZTNL 1DQLL 3MRBA 2FO1A 1KIQA 4CW1A 3GDBA 1N0LA 2CK2A 5GRVL 3ZT5A 1EJOL 4F57H 5HGBA 1XZ0B 5BVJA 5DLML 3G5VA 4IDJH 4NQCB 4P23B 3IAPA 2JB6A 5HVGB 2Y07H 3TN0A 5DO2C 1B88A 3T1FA 1ZVHA 2EXYC 5FYJU 3HAEG 2AJUL 3GSXB 1AR1D 4L3ED 1KULA 1QFUH 2ARJB 4O58L 5EO9A 4G8EB 4ZSOB 4RAUB 4M1CD 1GZQB 3B9DA 5D7SL 1DZBA 3CDCA 4WW2F 2ZUXA 4RMVA 1X7QA 4IHOA 3DX9A 4PJCF 1LWRA 2HT3C 4LP5A 4RMSA 4U6YA 4FXGB 5EZJA 1T1WA 4PJAA 4JDZA 5ISZE 1H3XA 5IBTH 5CEZD 5CJQL 3RIFF 2APFA 4MCZA 5DEFB 5DI8A 1KTDA 3G04B 5C09A 2NY6B 3HZMB 3CFBB 4MX7A 3LN4B 4OCNC 5E8DH 2QLVB 5E9DE 4RNRA 4CVZA 5DJDA 3BRDA 4PRNA 1RULH 2GY5A 1FLRH 1BBJB 1FGNH 3TVMC 5HYIA 3N0PB 1INEL 3MNWB 1T7ZA 1NBQA 3B8YA 3QUML 1CGXA 5FA4A 2HJLB 1CVRA 2MCPL 4CU7A 3VXUA 3PQYE 1C5CL 3O3AA 4ELMF 2YD5A 4D0DB 3MXVL 2BSTA 3LEVL 5FV1L 3KPQB 3MV7E 2HT2C 1ZLWK 1RZKC 3HNTH 4JREB 4GG8A 2J7LA 3BGAA 4LAQH 3MRQB 3GHEH 3DRQB 4FQIH 3VD9A 4AQOA 3EOAA 2BC4A 3MNZA 5KSVB 1AO7A 4GRLC 4JY4A 3LHPL 2J5LC 3G5XA 1NFKA 4KUZL 4M02A 1CIDA 5J9PA 3BWAA 1Z5LB 3NCFB 4YPJA 3AMKA 4K23L 3BPOB 1CT8A 2ESVB 3BVNA 3UBXG 3UTTE 5A1AA 4FQLL 1JWMB 5FYJH 5DGRA 3WHE1 3S35H 1BFVH 4F9PA 4JQVC 5IVZA 4RCAA 3JTTB 3FQXA 3AS2A 4DGYL 2P5WA 1T66C 4NQXA 3S36X 2ICWB 3HNVL 3HMXL 3RNKA 3U0PB 5MEOB 4HXAH 2R4RL 4QRTA 5JXED 3HI5L 1S9VB 4PRHD 4PY7B 4LU5H 1AXSB 4PJHF 5GJSL 1OAQH 3OKEA 4WFGE 1X5GA 3HB3D 4MA3A 1T0MA 1WT5C 2F9BT 2BSED 3KPSB 4NQDE 3AFLA 3ARPA 4O4YL 4JG0H 4I77L 3C5ZD 4PBWD 1MQ8A 2W9DH 4BH7B 3QUYD 4H1LB 1L7IH 5CZXC 5TDNB 1Q8MA 1U42A 5I2IB 2ADIB 5ILTH 1YMMD 2RAMA 3IDNA 4IS6B 4U6XA 3VFWB 4HF5H 3RFZC 4OZ4A 1IAII 1HSBA 1MF2L 3H42H 4H25A 5BJTB 3BFOA 2MCG1 4HIEB 1G9EA 1A5FH 5GZOD 2HH0H 3MPCA 3LN9A 5EIVA 5JPNA 1MRCH 2ZOLB 1KBGL 2NY1C 3PNWA 4Y5VB 2CIKA 3QUMA 3I50H 3RU8L 3HMWH 1FVEA 2EXWC 4LCIL 3RZCC 3G6JB 4AM0B 3MGTB 1X5LA 1QR1A 4AEFA 5IEKA 3W11D 5KJRL 4UDTA 4LRNH 3LV3B 3O2VL 5BOPA 2Q76B 2Z91A 3C5JB 4NFBA 4NO0D 2BFVL 1QA9A 1S3KL 1QYGH 1OWRM 4JFDA 4KDTA 1K4CB 5DTFB 5F7FA 4QHLB 1RV6X 1DL7L 3KS0J 4RWYL 3V4PH 4IRZL 3VE0B 4Z7VA 2AJZB 1F2QA 5I1CL 5FHAH 4QHNA 3VDAA 5LGKA 4R4BA 3O4LE 3VGEA 4P2QB 4EIZC 3X14B 5DRZB 4G6FD 1XGRA 3KYOB 2VDKL 5T33H 3VU2A 5EZLB 4JZOA 4ONHA 2X4NA 4O02H 1P7QA 1PZUB 1MJUH 4ZUWA 2MKLC 3HMXA 2DBJA 1G1CA 4KWUA 2WAHA 3QPQC 3D0LB 3OAZK 3VXPB 5B38G 3BH9B 5CSZB 4L9DA 1G9ML 2X1XR 5GRJL 2P44B 5HHOD 5EU5A 3WHE0 2YD6A 4EVNB 2W60A 5DMIH 3VXNA 4PJ7B 3WSQL 4X6DB 4NDMB 4MS8C 3QXVA 1S8DA 5IG7B 1YJDC 4KMQA 4BM7A 1NANH 3NA4A 4WVRA 3B9EA 2CO6B 4X80H 4P3CL 2IGFL 2E6JA 4JRYB 3EBAA 1TLKA 3F7QA 1YYLH 2VDPH 3V6ZA 3TPUA 3F12B 5FGRA 3T3PF 5KBNC 1OAUH 3U0TB 1V7NL 2XN9E 2EE9A 3EW3B 3GMLB 5I8EA 5IIEB 5E8OB 1X5AA 5D93C 4YR6A 1NC2D 2MNUA 3SJVA 3G6AA 5I73C 2X9WA 3D85B 5EUOB 3D39E 3OR6B 3N9GH 4XPFL 5C3TA 3WNPA 1YC8A 5IB3A 4KRMB 4QRPD 5B21A 2DBLH 1U8PA 1LO0L 4UINH 4QRUB 3UAJD 1S7UA 5I1GH 2VL5B 1I7RB 1YN6B 4PJBB 2DMCA 3HNSL 3LKNB 3HC4H 1KXTB 2NZ9D 1JGUH 3JV0A 1UCBL 2WANA 5J12C 1FPTL 1SYSA 3MLVL 4XPAH 1J0JA 2Q8BL 4J8RB 4M6NH 2VLRB 4KZDH 4FQ2H 2YA0A 4LSTL 2PKDA 1YA5A 3DX6B 4JO4L 1R0AL 5CILL 1T04B 1FRGL 2PO6D 3UP1A 1A4JB 4U6HA 1NGQL 1NCCL 2C1PA 2EDJA 2R4SL 4ZUVB 3D0VA 2JIXD 4P2RD 4F8QA 4U3HA 5IP4A 1OTTD 3QUZA 1MCPH 4FQQA 4YGVA 1LHZA 1X5KA 3CLFH 5D2NB 5HHMB 2EZ0D 4MD0B 1IBGH 1KLGB 1CGSL 1EPFA 2AQ2A 2MSPA 3DUSA 1JP5A 4OT1H 4CMHB 2C9AA 5TE7L 1T5WA 5DD1L 4NHCL 2UWEB 1WIPA 3GGWB 2GHWB 3SE4A 5IHUL 4KQ4H 1DLFH 1Q0YL 3GBML 5I71B 2JJVA 1DN0B 2VYRE 4NZRL 1FBIL 1ZVSA 3GSRA 4GW4A 1LO5A 1RI8A 4F7PA 3CSYB 2XWTA 3ULUC 3TO2A 3DPBA 2GJZB 4M1DL 4ODBD 1M71A 3MACH 1EFXB 3OXRB 4OZFH 4POUB 5C0IA 5KN5A 3LKPA 2HVJA 4HIHB 3IDIB 4MVBD 2O5ZH 5FDWA 4CBPA 2LQRA 3LAFA 4S10A 1A3RL 4GMTH 5CP3H 3UC0H 2YPLB 4ZUTB 4G6JH 1LE9B 3EYOA 4UOW1 1BD2D 2G2RA 4BQBA 4EDXA 1Y18B 4ZO6A 4LCWD 4TUJA 3HI1B 3VWKD 3L6FB 3DSFL 1IZJA 1I1AB 2AV7B 2EDEA 1AGCA 4YHOL 4HS6B 3AMLA 4E42A 1WWAX 3L3DA 4OQ1A 5CJOL 1AGEA 3JV6A 5FO8A 5BV7B 5AUMB 4JFED 2GCYB 4URTB 3IFPB 4FHBD 3JWDC 3LH2L 2DLEA 3ZDXF 1S5IH 1OSZA 2P46B 4N5ED 4OCLC 3RL2A 4JGJA 4LQFL 5TDPA 3ZDZE 1ORQB 3DXAE 3FTGB 5E6IA 4GBXC 4OLWH 1RJCA 2Q86B 1HYSC 2CLZB 1J0YA 2J4WH 2EDFA 2R0KH 3FFCE 2P4AB 5F9OH 4LIQE 1RUAH 2HFFA 4M6OL 1YEEH 3EOTH 3NAAH 3O2DL 3A6BH 3B3IA 3DWTA 3T2NH 1CI5A 4RFNB 4DVBB 4JCLA 4M7ZC 4U1HA 3IJYB 4WV1A 1BAFH 3LDBC 4PGBB 2SEBA 2H9GA 4LCCC 2WW8A 3MRFA 2MJWA 3NABH 1N3NB 1OPGL 1CBVH 2AABL 3KJ6H 5DA0B 2Y5TA 3FONA 4OGXH 5DHYA 3L1OL 4LEXH 2ICCA 2XPGB 1G6RL 3QWOB 3TT1L 5BXFB 3OG4B 2VXTH 1MAJA 2E5EA 1U8KB 4W70A 1I3RB 2P5ED 3FFDB 4K7PY 3BPNC 3ALXA 5IM7B 4CAGA 4NO2B 2C3GA 4OTXH 3EFDL 4X4XB 4DQOL 1U92A 2QADD 4X98B 4AY0A 4XVTL 5BO1L 3F58L 3S36H 3EOBB 4HFWA 5GS1A 3QPXH 5JXAH 1OOAA 1ZWIB 4OSUH 3RDTB 4GG6B 1J1XL 5I1AB 1OAZH 5C0NC 4O2FA 4RWHA 6FABH 4K55A 4YNYA 2BSRB 4YLQT 4OD3L 1FP5A 3BKJH 4JM4H 3DO3A 4MD5A 4HQQH 1MHHA 3NBNA 3T4AA 5C08E 3B9KB 4F57L 3EFFA 9CGTA 4POZD 2IF7A 4PLKD 3V6OE 5FO9B 4IDJL 4XH2A 5DJXB 5EC2A 4UOW0 1F4HA 1UT9A 1EX0A 2Y07L 2YD8A 2Z8VC 2IFFL 3CCHA 4Y2DD 1D5ZB 1QFUL 4P5TB 1KXVC 3ES6A 1BOGB 4KTYA 3O9WC 5F3HB 5FEBA 2JK5A 4XX1E 5E8NA 2R9HD 4K8RC 2MTPA 3EYFA 1ZANH 4YDJA 3FB5B 4NM4H 4YFLI 4X4YB 4YDLB 1U2HA 3TCLA 4IIQB 3JV4A 2XKUA 4HGMA 5IBTL 1WZ1H 4LCUA 4PTUB 3EDKA 5IQ7H 4PP1D 1CLYH 3O2DA 2XWBA 3X13B 3D18B 4N90E 2Y72A 5DZNA 3E6HB 5E8DL 5IJVB 3QIBD 3R06A 2P7TA 4XNXH 2BVPB 4I0PA 2XWJA 3GSOB 1KJ3H 2OR9H 3IETA 1RULL 1FORH 1FLRL 1FN4A 2ERJB 1FGNL 3HLAA 3SCMA 3QEQE 1RUQH 4O51B 1G6RA 3DMMB 5SWSD 1DQTA 1UM4H 3QUXC 4QYOA 2DM2A 5IVXB 2X4OB 4M62H 3SDAC 5HGAB 1F5WA 1I4FB 4KKLD 5LGJB 3ETBF 1IAMA 3WHXA 2AI0H 3ZKMD 3S8WA 3PHOA 3MRIA 4CDHA 3IVKB 3CU1A 3FB7A 1F4WH 2AK4A 4XP9H 4WHTB 4X4MA 1LD9B 1A3QA 3HNTL 1M4KA 2ATKB 4LAQL 3QCVH 3GHEL 1IAIM 3MLSH 3HUJB 3JXAA 4FQIL 4XBPB 5ANMA 4KDWA 4HS3A 1BX2B 1EBAA 2I60H 4WO4B 4DK6A 3ULVD 4NJ9H 5FYLE 3RTQB 2FL5B 4PD4K 4B5EA 4G43A 5JHDA 1N5AB 2D0HA 1IGYB 5FYJL 5HHQB 2QSQA 4J3VA 1I7ZA 4KJWC 3S35L 1BFVL 2EYTA 1FL3B 1LP9A 2EH7H 3MRDB 4Q6IB 1AHWB 5EU4B 5TE4H 5CIPH 1C7TA 3PWLA 1N2RB 1Q9OB 5DT1H 4WFFE 2BNRB 1IVLA 1X3DA 3DIFB 3D2UA 1S78D 4HXAL 3NCBB 4LU5L 2OS7A 2YPKB 3ALWA 4GKNA 1IM9D 4RAVB 3TZVA 1M7IA 4PJEE 1OAQL 3VJ6A 1P9MC 4J3UA 1KNOA 3MRBB 3D87B 1KIQB 4KK6D 1NKRA 1VEOA 4CW1B 5E8PA 4EI6A 5HGBB 5BVJB 3SDXF 2QHRH 3G5VB 1CZ8H 1PBYA 5CZVH 2O61A 5GRWA 2JB6B 4G9FE 4H20H 4JG0L 3TN0B 1FFRA 1Q9KA 2JKXA 2W9DL 1L7IL 4MA1B 4ZMAT 5ILTL 3CXDH 3WEXA 5JOPD 3QXTA 4HF5L 5DJZA 1FSKC 3JSSA 1V05A 3PWUA 4KTEH 4WENB 3SGDH 4PJFE 1OP9A 3H42L 4R26H 1X7QB 4HPYH 4IHOB 3DX9B 3AGVA 1A5FL 2HH0L 5KZCB 4ODSH 1MRCL 5EZJB 1T1WB 4JDZB 4GKOA 5A2IH 5T3ZE 3B8SA 3I50L 3HMWL 3CU7A 5D1ZC 1QPPA 4M93B 4M1CC 3ARGD 4MCZB 4RGNB 5I8CA 1GYAA 4GH7B 5DI8B 1KTDB 3S5LG 1QSFA 4MX7B 4LRNL 1IAOA 2RCSH 1KTLA 3U4EA 5DJDB 4CVZB 4PRNB 5F9DC 1N7MH 3V5HA 4LPTA 1QYGL 1QP1A 3BUYA 3P2TA 4N8PA 3V4PL 1VCAA 2B8OT 3OG6B 3ISWA 1CFBA 1MVFA 5FHAL 3T0BA 3QNZA 4AJ0A 5AZ2H 3FZUC 5FA4B 3ZLQC 4GT7A 3VXUB 4JANA 5D1QA 5J1SC 5FK9A 5T33L 3O3AB 2NZIA 3BGFB 3BIKA 1QZ1A 2BSTB 5L7XH 5I8OH 2B0SH 4XMPH 4O02L 5E9DD 1MJUL 3V95A 3Q0HA 3U7YH 4GG8B 1N59A 2KQNA 5KVDH 3EOAB 1RJZA 2BC4B 3MNZB 1AO7B 4JY4B 3DETD 3G5XB 1WZLA 4PB0H 3VFUA 4XT1C 5J9PB 3BWAB 3RUGF 5DMIL 1EFXD 2ITDA 1CT8B 4KZEH 3BVNB 3D48R 3V6BR 2IG2H 3ARRA 3PQYD 3BKYH 5IUSA 3FQXB 4X80L 2P5WB 4OGZA 1IEAA 1CFVH 4NQXB 4MWFA 1YYLL 2VDPL 3HR6A 4NGHH 4R0LC 3MV7D 3EJJX 1OAUL 4PP2A 2NX5E 4XBGA 1A9EA 4QRTB 4HDIA 5BQ7A 2G9HA 1FFOA 2ZG1A 3N9GL 3OKEB 4JQIH 1EUUA 1I3UA 4MA3B 1T0MB 3LD8B 4KJYA 5ALBH 2DBLL 2IBZY 3UTTD 2V5RA 4KI5E 4UINL 4HK3N 4CVUA 2F8OA 5DVOA 1BFTA 1TENA 5HYQA 5I1GL 1GZPA 1R3KA 1CICD 1HXMB 1DQJA 1MI5E 3B43A 3HC4L 3S9DB 2EIBA 1JGUL 3VFGH 2CSPA 1NUDA 2R2EA 3BO8B 5TE6H 3IDNB 4U6XB 5DSCA 4XPAL 2YD7A 4NRZA 4M6NL 1I9RH 1JF5A 4KZDL 4OZ4B 4FQ2L 1HSBB 3C5ZC 4H25B 5D5MA 4P48A 4K71C 5ISZA 2K9UA 3IRPX 3QUYC 2GTWA 5JPNB 4XHQA 5I1EH 3K1KC 3PNWB 3JUYA 4WFGD 5HY9A 3V7AG 2CIKB 3QUMB 1FVEB 3JWNC 5ECJE 3MUY1 4KAQH 4N0UE 4NQDD 4R2GD 3V4UH 1WWBX 1QR1B 5D7IF 1MCPL 5IEKB 1QRKA 4QRRE 3ZKND 1ZHNA 1MRFH 1RURH 3GM8A 2FECL 3OKOB 5GZOC 3CLFL 1EVTC 2L7UA 3DSNA 1IBGL 2IPKA 5FGCB 1YEHH 4OT1L 2Z91B 3CFEA 4B50A 5IVOA 1N6QH 4WFHE 2F19H 4JFDB 2BHUA 5ESVB 3DECA 1AGBA 4KQ4L 1DLFL 1BVLA 1KC5H 1JHLH 2L0DA 1GSMA 2YUXA 4PUBH 4Z7VB 5E5MA 4X7EC 1I8MA 5JIHA 4QHNB 1H0DA 3OJDA 2DYPD 5MEPA 1BFOA 2GJ6E 1XGRB 1NFDA 4JZNA 4DWHA 5MERA 4ONHB 4S1DC 3MACL 4OKDA 5CKAA 2X4NB 2ZWLT 4ONGH 1P7QB 4ZODA 2O5ZL 1NMAH 4YK4B 4ZUWB 1RUPH 3KS0H 4GMTL 3UC0L 4FQXD 4G6JL 1Z0NA 1KJMA 4LRIC 5T3XD 3UJJH 2B4CH 1ROWA 1WC7A 3P30H 4MDJB 5EU5B 2F53A 2W60B 3I6GA 4RSVA 3VXNB 4YHIA 4FQHA 2J8OA 3O6FD 4ELKA 3TBTA 1KF9B 3QG7H 4L3AA 3O4LD 2GK0A 2XTJE 3FQTA 4Z7UE 5ICYA 2CRMA 2EIZA 2IAMD 5L0QB 1OWWA 4WHYH 2D7OA 3I3BA 2J2ZA 3V6ZB 3TPUB 3NCJH 5KVGH 4HMEA 1NGXA 3HFMH 5IK3A 5TPWH 3F7VA 5I8EB 3DX8B 4EKXA 2LTQB 2XFXA 4L8SA 1S5IL 3SJVB 3O4OC 5F7DA 3G6AB 1G9NH 2YRZA 5SX4I 1P2CB 1T1YA 5F71A 5E5RB 4OLWL 3OBAA 3GMRA 3MLXH 4XC3H 5IB3B 4YO0A 2Q8AH 4HWZA 2QQNL 3WYRA 3RKDD 1U8PB 2J4WL 2R0KL 3S88H 3PL6C 5F9OL 5J89A 2Q7YA 1RUAL 1S7UB 1YEEL 3EOTL 3L3GA 1CFSB 3NAAL 4H5SA 3OGOE 2X05A 3A6BL 4X9IA 4QTHA 4ZAKA 3T2NL 5CUSH 5J4MA 4NM8H 5DS8A 3F8UB 1BAFL 5KS9F 1SYSB 2PXYC 3DMMD 4I48A 4EN3C 1I8KA 3UTOA 4PJDF 3NABL 1CXKA 5K59F 5JW4M 1CBVL 1A6VH 4LHUD 3DHMA 3KJ6L 4WWKD 1T2JA 3D39D 4LEXL 1L9NA 4HWBH 4U6HB 2C1PB 1YY9D 4XCEA 5EU7E 1MUJA 3D0VB 4NKMA 3CFJA 1OP5H 2VXTL 1E6JH 3QUZB 4MYWB 4Z95H 5F7NC 4FQQB 4ZS7H 4YGVB 1X5HA 2OTUA 4LF3A 4OTXL 2PO6C 5FM5M 5CP3A 3DUSB 1T5WB 3S36L 4OCMC 2ZNWA 3QPXL 5JXAL 3ABZA 3ZHLA 4OSUL 3IDMA 1IKNC 1OAZL 1KXQE 4GFTB 5CBAA 6FABL 3S7GA 4WRLA 1ZVSB 4CN4A 3GSRB 4GW4B 3BKJL 1LO5B 1JV5A 4F7PB 4JM4L 2KKQA 4QCIA 5CHNA 1NUFA 2VKWA 2XWTB 3TO2B 3LS5H 4HQQL 4HH8A 2PNDA 3MLYH 2KPNA 3IGAA 3ARFA 5C8JA 5IFHH 5MP6H 1BVKA 1IRAY 4I2XE 1M71B 5C0IB 2ORBH 5KN5B 3LKPB 2VDRH 2HVJB 2P8MA 1LNUA 5D1XD 3HCVA 5FDWB 1OGTA 4LSVH 2X9XA 3EYOB 2ATPA 5DUMH 2DM4A 4X7FC 4YQXH 2D3VA 2G2RB 5BW7A 2D03H 1GGUA 2QV2A 3KPPA 4EDXB 3WIIH 1K5NA 3MGOA 3O11A 1UWGH 3MYJA 1MCFA 4TUJB 1ZANL 5I0ZA 1L9MA 4NM4L 4CU8A 4MXQD 4R96A 5GSRA 3WO4C 1WZ1L 3EYVB 1AGCB 5IQ7L 2ITCA 1CLYL 4PJAF 4E42B 5TGBA 4KU1A 1GVIA 3PWJA 1AGEB 3JV6B 1V5JA 3GI9H 5CBEA 2XN9A 5FO8B 2WINA 4XNXL 1KJ3L 3RWGA 2OR9L 1FORL 3RL2B 3HG1E 3LPWA 5I16A 5TDPB 4Z6AT 1RUQL 2F58H 4DJMA 5E6IB 1F90H 1JWSA 1MCOH 1YZZA 1UM4L 4L9LA 1GAFH 4M62L 2AXHA 4RDQG 1H8SA 2HFFB 2AI0L 1NGYA 2VLLA 5ENWA 3B3IB 3OJMB 3T8XA 1GCFA 3TA3A 2BOBA 3IXTA 4WTWA 3UZQA 4HIXH 5KSAA 4M3KB 1F4WL 1P7KA 4XP9L 1CXHA 2J8HA 2SEBB 5C0AA 2NY6C 4KXZI 2H9GB 5BZDA 4Y0GA 3QCVL 5EA0H 2MQ3A 4XNZB 3MLSL 2DAVA 5ABDE 2Y5TB 3FONB 3NIGE 5DHYB 4ENED 4UMGA 2Y23A 4U7KA 2H45A 1A8JH 1UQSA 3DXAD 2I60L 4NJ9L 1SBBA 5DEGA 2LVEA 2MHAA 3FFCD 4PJGE 1MREH 1NEZG 2NY2D 4Z5RA 4JFXA 2VXQH 1QLRA 2EH7L 4Q9CA 4HK3J 4ETYA 1U92B 5TE4L 4JLRA 1T89A 3GMQA 4HFWB 4UBDD 5DT1L 5GS1B 4G9DA 1A6WH 2XQBH 1YEKH 5FECA 4U6VH 1XH3A 4JREC 4K9EC 4O2FB 3T2PA 4YNYB 3UTQB 2HTKD 1A64A 4QHMB 3VI3E 1C08B 2QADC 4MD5B 4L8BA 5EWIH 1GGYA 1MHHB 3T4AB 2CGRH 3EFFB 3BPOC 2QHRL 3EIFA 1CZ8L 4XH2B 5EC2B 5CZVL 4QNPF 4H20L 1MCJA 4PRBA 1KSRA 4LBEA 5D4QA 3CCHB 4OZGF 5D71H 5IV2A 3CXDL 4P2OA 3ES6B 2VN4A 2Q6WA 1LILA 1DANU 2AEIT 1O7VA 4POZC 4PLKC 4PYHA 4KTEL 1VPOH 1ZS8A 3C2AH 2JK5B 3I75A 2I9TA 3RGVD 2FECI 5E8NB 4XCYA 1QNZH 3EYFB 4R26L 4YDJB 4HPYL 2NXYB 4U1LA 4FTVE 4ODSL 1MJ8H 3NFNA 3QI9A 3TCLB 3QIUD 1JZ5A 3JV4B 2DIJA 4FFWC 4LCUB 4MJ5A 3FT3A 4LNRA 5C08D 3FCTA 2XWBB 1NQBA 2R9HC 1KG0A 5C2UB 3R06B 3GJFK 3CFCH 3QXDA 2P7TB 2RCSL 4V2CB 2XWJB 1N7ML 3IETB 2VDLH 2EDQA 3PHQA 1W8NA 1FN4B 3X17A 1DQDL 2ARJQ 4BQ8A 3HLAB 3SCMB 2ZUSA 1NCTA 2X09A 1G6RB 1I1FA 4QYOB 5I9QB 2GUOA 4ZO7A 4C4KT 3RP1A 4WUUA 1DANT