4JHBA

Crystal structure of relb double mutants: y300f/i335f
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
110
structure length
110
Chain Sequence
LVPRGSHMNTSELRICRINKESGPCTGGEELFLLCDKVQKEDISVVFSTASWEGRADFSQADVHRQFAIVFKTPPYEDLEISEPVTVNVFLQRLTDGVCSEPLPFTYLPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of RelB double mutants: Y300F/I335F
rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords Transcription factor RelB
total genus 17
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2013-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jhbA00
4HFUH 2NY3D 3OWEA 3HNSH 5KVDL 4G7VL 2DAVA 4WWKA 3WYRA 3TJEL 4HWEL 5ESQA 4LARL 2AXHA 5D6DC 2Q76B 4Q6IC 3Q48A 2C1PA 1KFAH 3BW9A 3OL2A 5CINL 4LCCB 3TM6A 3ZYJA 5FOJA 4JVPA 3BIBX 1P7QB 3BP7B 2YD9A 1CDHA 3UYRH 5DDHB 4YWGL 5T1KA 1JVKA 2CK0H 1EXUB 2KKQA 5JDJA 1WWWX 2V2XA 2H32A 2UVEA 4OF5A 4N8VA 5ACLA 4Z7VF 1V3LA 3BN9C 4YC2C 5D5ME 4PJXF 4H88L 4GFTB 1NFDA 3KLHD 1RMFL 3WJLC 3W2DL 4WTXA 1AD0B 5MI0C 1E0OB 4CN4A 5I75C 5GPRA 1T5XA 4S1DD 5DA4A 5C0DA 5IJKC 1MRDL 3Q3GA 4OGYH 2H45A 1CICC 1EGJL 3ARFC 2FGWL 5FYKL 3GMMB 2I07B 3WHXB 3MJ7B 5KSBB 1CI5A 1P6AB 4AIZA 3HG1B 3GSNA 1BFTA 4XBPA 3MRNA 1HHKB 1NCTA 1JHTA 4MA3A 3MLZL 3GBNL 1GH7A 4Y5YA 4CJ0A 3RWIB 4N0YL 5C07D 1PGRB 4EJ1C 4NQVA 1CE1L 1HZHH 1L4IA 2YRZA 3RVXD 3T65B 4PV8A 3QUMH 2R29L 3EYVA 2PXYA 3PP3H 4M48L 3G6DL 4KVNH 4P4RA 1FZMA 5C0CA 3FQUA 3GJFB 3F62A 5GS1A 1FORL 5FA4A 2VL5A 4GAJH 3SDCC 3VFTB 3W11D 1E6JH 4ZUVA 1CDIA 1CIUA 4YGVA 5B39B 1KELL 4YAQB 3O3AB 5IVXF 4FQ1L 4YXKH 5IBUB 2HP4A 2VABA 4KJPC 2OI9B 3C6LD 35C8H 2IAND 4X4MA 1F6AA 4JM2C 3ZE0E 5F9DC 3W9EB 3WXVL 1MFCH 4D0DB 4I48A 2Q3ZA 4R4FL 1YMHA 3N1FC 4UDUB 2VZSA 2HN7A 1KCKA 4X99A 3WE6A 4AEHH 1FNEB 1AXTL 1JI1A 1WK0A 3C60B 1RUQL 1NJ9A 1DE4A 1IGFL 1HI6A 2G75A 4H5SB 3L3KB 3BGMA 3U83A 5IVOA 1W0VB 4HD9A 4Z9KB 1A5FL 4XPFH 3HHRB 1LMKA 3M1BA 2PO6C 2DKSA 3RHWK 3GUTB 5JQHC 2VLRE 3INUH 1QFWI 4ZSOA 3FB6A 1BF8A 2XWJB 1CBVL 1XIWC 3IDIA 2W65B 3VWKA 3WJJA 2VSDA 1NBYA 3QULB 1DBAL 1QA9A 3K81A 5T3XH 4QHUB 4P5TB 1KV3A 4QNPF 1A4KB 4XAWL 3Q5YA 2W60B 3LH2H 3QDGB 2D31A 3BJ91 4R96B 2VXVL 1DCLA 1YEJL 4MJ2A 4ZS6C 5LXGL 4FP8H 3TWCH 4LSDA 5A16A 4PFEA 2F8OA 5CWSA 3RIFK 1IC7L 3OZ9H 4LCYA 3IVKB 4WNQB 3BJLA 3QG6A 1KENH 1KIQA 2D7MA 4PLKD 1TNNA 3CDGB 3RNQB 3V5DB 1U6AL 1BFSA 1G7IA 1QR1A 5GSRB 4RIRB 1IGJA 5HHOE 1NKRA 5FYLE 4PYHA 3F12A 4GRWB 4OLXH 1BFVL 4I9WD 4TTDC 3KYKL 4DZ8A 4PP1C 3B5GA 3QWRD 1S7QA 4JGMA 1ZLWK 5HI3D 1G0XA 1KACB 4X9HA 1N7MH 5I18L 3VFGH 3BP4A 3LPGA 3BYYA 2NY5C 3MLXH 4ODBD 2P24B 3S5LB 2OTUA 1ACYL 3ZKNC 3MNVB 3D39D 5ELIA 1PZUB 4WWID 4D8PA 1TETL 2BNRD 2O5YL 1JHLH 5AD0B 4OAWB 1QSZA 1UJ3B 4NQSB 2ITDA 2VMFA 3LEYH 4JQVA 3LN4B 1RJLA 2N1KA 4PJHF 3SGJC 1N3NA 3ZE1F 3D39B 5B3JF 4EZMA 5TE4L 4AT6B 3VRJB 4WWKB 1RZKC 5J1SC 1I9RH 1FFPB 5ESQB 4I77H 2WBJA 5D2NC 2Q76A 3ARFD 1C1EL 3UDWA 2C1PB 4LGRB 3BW9B 1CXFA 1D5IL 4M9OA 4PP1D 3VE0B 1XAUA 5IB2B 5K9OB 1P7QA 2E27H 4OF7A 5DDHA 4P2OD 3MJGX 2ZCLL 3B9KD 1EXUA 3U48A 2V2XB 3VGHA 5I1HL 2H32B 2KPNA 2X09A 1LEIA 3MLZH 1JMZA 1AJ7H 2YD2A 5F21B 3SBWC 3WCYA 4ELMF 2BNRB 3RVXC 1LNUA 1RZ7L 5ALBH 1AD0A 5FOBB 5C0RH 4TNWK 1ULVA 5FYKH 1EVUA 3P9LA 4HH9A 1Q0XL 4XNUH 5SX5K 1A3RL 2E8ZA 3U7WH 2IGFH 5E6IB 1S5IH 3CSGA 5I30L 5C7XH 1H3PL 5DGQA 1EPFA 3GMMA 4WI9A 3VXRB 4AG4L 4DGVH 4KQ4H 5I74C 5LAXA 3RJQB 5KSBA 1A6VL 5E08L 3NACH 4AIZB 3HG1A 4HUKB 1Z9MA 3EHBC 1OPGL 3VI4E 3QO0B 4XBPB 4Y4HA 2ZUUA 4LHJB 1HHKA 5KSUB 4OFVA 4PRBB 4XHJC 1JHTB 1NC4B 1E4XL 1D7FA 5D2NA 4U1NB 4YDLB 3WUWG 4Q6IB 1SY6H 5SWQB 4DUXA 1FH5H 3M45A 3RWIA 3BPCB 2JJVA 2NX5B 1LK2B 3T65A 3CK0L 3EYVB 4P4RB 2QADD 4JAMB 1FZMB 5C0CB 3FQUB 5EUOA 5ALBL 5DFVD 4PUBH 2VL5B 5TFSL 3ETBF 5D2LF 1EO7A 4XMPL 4YGVB 4J3WA 5B39A 1CGUA 3HNTH 3HFMH 4JHAL 4QRRD 5DMGC 3U7YL 4NZUH 1F6AB 4Z7WA 3IFOB 1YC7A 1WZMA 1IBGL 5L8JB 4AG4H 4DGVL 4PRAB 1GGBL 3RVUC 3O6MH 4YHMH 4X99B 5TE7L 1KXQE 1MI5D 4P46C 4KROC 1FNEA 2ZCKH 3ULUF 3CLEH 1CLYH 3WFZA 3ARBB 3TV3H 1NJ9B 2PNDA 5DMKB 1HI6B 5BRZA 2G75B 4H5SA 3L3KA 3LHPL 2DTSA 4R0LC 1T03L 4M7LH 1A7NH 2EDBA 1NCCL 3BGMB 2JJTA 3TZVD 3E2HC 3QFJE 4KJQC 4CW1B 1RZJL 3QJHB 1LP9E 2IANE 3P77A 1P5UA 5BV7L 3GUTA 2F58L 1FC2D 5DFWH 2D4DA 3FB6B 4JG0H 1T7WA 2XWJA 4PREA 1J88A 3CSBA 1WT5C 1A7RL 3IDIB 1MVUA 3ZDYF 1LO5A 5T5FL 3QULA 1NBYB 1NLBH 1QA9B 3UTSE 3O4LE 4QHUA 2NY7H 2HRPH 1JNLL 3L7FA 1HQ4B 3VDAA 2W60A 2M26A 1OY3B 3QG7H 2D31B 3RVUD 4R96A 3WO3B 5BS0E 3MNWB 1L0QA 5A16B 4PJAB 4GG6F 4OCRH 2RCSL 3ULVE 3IVKA 5E5UB 3S98A 3QG6B 2BVUA 3U6RB 4UT6L 1J18A 2J8HA 3V0WH 2BHZA 2V2WA 2QQKH 3R4DA 4JM4H 3MOBH 5E2TH 1V05A 5DUML 1QR1B 2BC4B 5HHQA 3GI8L 2AJZA 4KK5D 1KEML 1UYWH 4JFEE 5HGDA 1FL5B 3F12B 1U2HA 1ZWIA 4P5KB 32C2B 5IP4A 4YBHA 1RJZA 3MOQA 2KZWA 2PF6A 1J11A 4XAWH 1S7QB 3CX5K 3WD5L 3T1WA 1FNGA 2K3TA 2GY5A 2FCBA 1XGQB 5E5MB 3SGEH 4D9RD 5JW3H 3PP3K 3BP4B 5E0QA 4OM1L 3OPZL 3S5LA 1EO8L 2P24A 4YHKL 3BKCH 2VR9A 4J23A 2UYLB 4JR9L 4TVPE 1NMAL 1LP9B 2MJWA 3KLHC 2AJVL 4P5TC 3S5LG 1UJ3A 3BI9X 3ZTNH 4G8GD 4NQSA 3IDMB 2ITDB 4K94L 4OZHB 4QHKI 1CF8H 1YECH 4OF3A 3LN4A 1RJLB 1N3NB 2X4RA 2CJUL 3D39A 5D93B 1OF2A 4PLOB 3D5OF 2GTWA 4AT6A 3DUSA 3VRJA 5E7BA 1FFPA 1RUKH 4M02A 1EZVX 2WBJB 3OJDB 3ZE2E 1Q9KB 5MERB 1TLKA 3OTTA 3RWFB 4OBSA 4OZGF 1BBDL 4OCMC 2XZQL 3VE0A 3KDMA 5IB2A 1ZGLM 5K9OA 3X13B 1GOFA 5CEZE 4N8VG 2C9AA 2DLHA 2Z0BA 5LGHL 5C2UB 1A6PA 3P40A 1XT5A 1A7OH 1M7IA 4S1QH 1UEYA 4HS3A 4XH2B 1OAYL 1LEIB 2BDNL 2NY6B 4RFNB 1SEQL 2BNRA 1LNUB 2VZ3A 5CJOL 1X5JA 3GRWA 3P73B 3DURA 5FOBA 1GVIA 3S3SA 1CK0L 3P9LB 4GBXC 4HH9B 2HT3D 2J88H 4W6WB 4DN4L 1WLHA 5E6IA 4MNGB 1G9MC 4JCMA 1JNJA 3QCVL 2WBJD 3MLVL 3TESA 3PV6A 4LIQH 3VXRA 3A6CL 5LAXB 3B9DA 1MRCH 4JREB 4FQJH 4LRNH 3QO0A 4Y4HB 3ROLA 3P9WB 2FBJH 5KSUA 4PRBA 1RZ8B 3VXTA 4JPIB 1NC4A 4LASL 3MOAL 5D2NB 4U1NA 1FNSH 4MD5A 4Q6IA 4O00A 5SWQA 3JV6A 1CFQA 3KPNB 1J10A 2ZNWA 3D3VA 5ITFB 3BPCA 4JHBA 3VMOA 2NX5A 2GJ6E 1LK2A 2CKBL 4X5LA 3C9NB 4G3YH 1N7ML 4MZ2A 4JAMA 4PJFF 1OCWL 1IKNA 5EUOB 5JO5A 3X14A 4YUEH 1DP0A 1R5VA 1A9BB 1VPOL 5I1KH 1DEDA 4KZEH 4Q9QL 5I73C 1LO0H 3SJVE 1KGCD 1YPZE 1O7SA 1BJ1H 3CUPA 1PJ9A 1K6QL 4EXKA 3O4OB 4Z7WB 3IFOA 1M7XA 4LSSL 1I1YA 3VXQA 4PRAA 4Z0BL 4YQXH 5K9JH 3WO4B 3QXUA 1MI5E 4LNRB 3V52H 2EXYC 4CVZA 3SOBL 2ZUVA 3VGDA 3BQUC 1AR1C 1NGZA 2A9ML 4ZUSA 1YYLH 3ARBA 5DMKA 2HT2C 4P2QE 4R8WL 5BRZB 4YDLC 1PX3A 2XTJC 3ARWA 1BBJA 5FUZH 4RWYL 3MV11 4CW1A 4P9HH 3QJHA 1WEJH 3QDJB 5EBLA 3P77B 3B4NA 3QCUH 3ZE1E 4YDIH 4YUEL 4CNIB 1FO0L 3EDKA 3W39A 1UEMA 4PB0H 4FOMA 3S8WA 5BJTA 3UZVB 3IFNL 4PREB 5B22A 3VWKC 3ULUD 3T0VA 1CDCA 2DQGH 2CLVB 1CT8A 1MVUB 3N9GL 1IQWH 4K8RC 1LO5B 3S35H 4KU1A 1JNNH 3L7FB 1IEHA 1HQ4A 3CVHL 2NTFA 4QHNA 4BFBD 4FQHB 1N4XL 3JTSA 3MNWA 2Q3AA 4PJAA 2FX7L 4RA0C 2E9BA 2YD4A 3BPNC 3U6RA 4KKCC 4HXAH 2V2WB 1QFOA 4LCIL 1QACA 2BC4A 3BMWA 1UWGH 4JPVL 3HG1D 5EIIA 5HHQB 3KR3H 4JKMA 4OD3L 4XWGL 2AJZB 4L3ED 2EICA 5DJXB 5HGDB 1FL5A 2D0HA 2HKFL 4QRPD 1ZWIB 4P5KA 1T83C 2HLFD 32C2A 1FLTX 3KXFE 3HAEH 4UILL 1RJZB 1TTFA 1IC4L 4NZRH 4HMEA 5KSAB 1FNGB 3PGFH 1XGQA 5E5MA 3V7MA 5GS2H 2A6IA 4GRLD 1FE8L 4OLZL 1KCRH 3V5KB 5DQDH 4KTEH 4KI1A 4HQQH 2YOCA 2UYLA 3CZFB 3SJVA 4JO2H 1OWWA 2ATKA 1LP9A 4IRSC 3QNZB 1QBML 3JWNC 4GLRI 5FCSH 4WUKL 1TMCB 5E7FA 1VPOH 1WCQA 3IDMA 5I1KL 4K3DL 1LO2H 3CGTA 3RA7H 3PQYB 4OZHA 5CEZL 3ZMRA 4DTGL 1VEPA 5HI5D 4JY5L 2X4RB 3T2QA 3TV3L 1OF2B 4ENEC 4F58L 4KK8D 2GTWB 4WDIB 3DUSB 2CRYA 2UVFA 2O61A 3D9AH 2PR4L 3OJDA 3U4BH 3VRLE 3W9DA 1HKLH 1Q9KA 5E99H 3VGGA 5MERA 1FNLA 1LO4L 1QFPA 5F1IB 3RWFA 1EFXA 3W0WD 2B1AL 4XVUC 3KDMB 2H9GA 1WISA 1G9EA 3X13A 2DB8A 4MAUL 5A2LH 4GG6E 4LDLB 4DQOH 1A0QL 5ABDE 2C3XA 3QQ4A 3T8XB 1M7IB 2YPLE 1EK3A 5EO1A 4HS3B 4XH2A 1FZKB 3GI9L 2FYYB 2WNGA 2DQJH 5T3ZD 5CJXA 4DGYH 5EUOE 3GIZL 4PUBL 5FO9B 5J11C 3P73A 2DF3A 4NKIL 1TPXC 2SEBA 3DURB 4HGKC 1CU4L 1ZMYA 1I9JL 2ZJSL 2J8UA 5FHBL 2R0LH 4MNGA 4RDQG 3ZTJG 4GLRH 4PBWD 5C0AA 3DBXA 3PV6B 2QQKL 5TE6L 4HCRH 5GRUL 4F37F 3ROLB 4BSWA 5JZ7D 3WLWC 2K7QA 4PRHD 5C09E 1XGTA 1RZ8A 3VXTB 4JPIA 5KS9E 3VG0L 4MD5B 3VD9A 1CLOH 3JV6B 3KPNA 1CFQB 2IG2H 4Y8AA 3D3VB 1JGVH 3JV5A 3DV6A 3IFLL 5ITFA 4HF5L 2VE6A 5CJOH 4HMCA 4JFXB 5ALCL 1UB6A 4KV5F 3ULVC 1PLGH 3GI9H 3C9NA 3S88L 5DA0B 1JGEA 4ZNEA 1DEEB 4AEIL 2NCMA 1JV5B 5JO5B 3WIIH 3X14B 4QWWC 2F58H 3MBED 1R5VB 1YEGL 3HI6L 1A9BA 1GPOL 1BQLH 4N68A 2OI9C 4NP4L 4OCNC 1S7TA 2H2SC 1U3ZA 3CUPB 4ELKA 4ENED 1RUKL 5MP6H 1I1YB 3VXQB 4KH2A 3ZDXE 1K3IA 1ZVSB 4WUUD 4LNRA 2X42A 2XN9B 3CH8A 4CVZB 1CGWA 5CLTA 4PRID 1T1YB 3X17A 3CVIH 2WUCL 5DJYA 1NGZB 2XA8L 4HGWB 1FGVL 2ICWI 4R0LA 3GBNH 4ZUSB 1P53A 3QIUD 3BKMH 3VXSE 1R5IA 3F7RA 4M9PA 4M4PA 1KEMH 2C3WA 3BT2L 3WNPA 2AGJL 1BBJB 2Z92A 5D4QA 1EHLH 1TDQA 3QDJA 5EBLB 1HILA 4OLUH 4NJAL 4CNIA 4UNVA 3TYGH 3H7LA 3W39B 3UYOD 4LVHB 2X9XA 1JNNL 5IB1B 5BJTB 1U95B 5JIHA 2DS4A 3KPOB 2CLVA 1CT8B 3NABL 2ZUQC 3O4LA 1IVLA 3EUUA 3F7PC 1JF6A 1DUZB 1LWRA 1ZHNA 2FECL 4TQEH 4MNQE 1R3IH 3BYTA 2NTFB 4QHNB 4FQHA 3P0VL 1UXSB 3JTSB 3KPSB 5FGSA 3MV7D 4KDVA 2ZUXA 3D39E 4F2MA 4LCWA 5D1QB 4UB0L 4KQ4L 1RVFH 3U0WH 4RMSA 4GRWE 5HHVL 5GGVH 2Z93A 4JZNB 1L9MA 2OJZL 1KIRB 5HBBA 5EIIB 3PABA 4HWBA 4ZFGH 1N6QL 1J1XL 4KJQD 2YRLA 4IHOB 4HBCL 1TJIL 1TVDA 2YBRA 5DJXA 1FZOB 2DD8L 2OS7A 4LSPL 1P4IH 5L0QB 2X1XR 1V3JA 1B0RB 3NTCL 2XTJB 1QSEB 2IPTH 5K33A 4YXLH 5KSAA 3CSYB 4K07A 4KDTA 4J7RA 4RMUA 5DD6B 2A6IB 4NUJA 3RUGE 3M17B 4HMDA 3V5KA 4KHTH 4ZSOE 1JTOA 1KENL 2VXUH 2X40A 3CZFA 3SJVB 4LVEA 4DKAA 2ATKB 3H3KA 3QNZA 3LZFH 1U3HC 4JFFD 3NPSC 4HPOH 1OAQH 2FEDD 1UZ8B 3PQYA 4ODUB 1IC1A 1QKZH 3OX8A 1RUQH 3N85L 5DFTA 4XCCL 4WDIA 4C4KT 1PKOA 2C7UA 1XF2A 1BX2A 1V3KA 3RWCA 2O61B 1C5DA 5BS0D 5JOPD 4BUHA 2D7OA 3W9DB 4MXQD 5D6DA 3SDDB 5F1IA 2ATPB 2VH5H 1EFXB 4AQ1B 1OM3L 2H9GB 3BRDA 5TJWK 4XHJD 2EC9T 4HS6A 1OPGH 3QQ4B 4FFVD 3T8XA 3NZHH 1EVTC 1N8ZB 1IGFH 1Q1JH 4WI7A 1H3VA 5EO1B 3K46A 4O51A 5HGHA 4OZIF 1FZKA 1YJDL 2FYYA 1IGIH 3O6FB 1QO3A 2VDMH 1G7QA 1IGCL 2B39A 4LKXB 3ESUF 3BDYH 3RAJH 3BE1H 3B9AA 1BF2A 1CE6A 2WBWB 3CXDL 4U2YA 4M62H 5FO9A 1OGAE 5HYFA 2SEBB 2BY0A 1XF5B 2FBOJ 4HIEA 2CD0A 2J8UB 4X7FC 4RGMC 1I3VA 4FFZH 2FB4L 4N0YH 5LBSL 3T2NL 1J5OH 5C0AB 3DBXB 3LKPA 4QY8B 3V5HB 2EDRA 2R15A 6FABL 4LAQH 2LABA 4UTAH 4BSWB 1HHJA 5HVHB 1LEGA 3ULVF 3EYQD 1XGTB 3B9VA 4JVWA 2Z31B 3R1GH 1KJ2H 1WZ1H 4ZO8A 3FQXB 5M94B 4EI5C 5SWSE 3DV6B 2CH8A 4N5ED 4LKCB 2VE6B 4NKIH 4JFXA 1NC2B 1VHPA 3MA9H 4OGXH 1BPVA 1UB6B 4CMHB 3C08H 4PGZA 1JGEB 4I2XA 1GPOH 5E70A 1DEEA 1QNZL 5GGQL 3EDEA 3EYUL 2ORBH 1JV5A 3HN3A 3IU4L 4RMQA 2JTDA 3TT1L 2Y07L 1WFOA 3BX7C 5J89A 4EXPX 4O2CA 3QIBD 1BFOA 2YPLB 1KNOB 3MYZA 4JFDD 4XC3H 1S7TB 2OR9L 3MJ9L 1TPXB 4PJBF 1ZLVK 4ELKB 1GYAA 5C1MB 1J0HA 1CLOL 3HZKB 5JHLL 1ZVSA 3MC0A 3U36A 5SV3A 5IMLA 4UNTA 2XN9A 5IVNA 4NDMA 4BKLA 1T1YA 4NRZA 2J12B 5GS0C 3TJEH 5DJYB 4HGWA 2AERT 1WVZA 4R0LB 3MV8A 2B1AH 1R5IB 1HSBA 5C6WH 3QJFB 4ISVB 5I0DA 2Z92B 4MB5A 1U8LA 4L8SC 2RB8A 1HILB 4HS8L 1JPSL 4MJIA 1FDLL 3BH9A 2VIRA 4LOUC 4DGYL 5IB1A 1U95A 3WJJC 3KPOA 1UH4A 1IGTB 1M6OB 3O4LB 5FGBA 5J8OA 4PG2C 5F8RC 1DUZA 1ZHNB 4G8EB 5D7JD 3UROR 2BVTA 1UXSA 5GRUH 2V5SA 3VA6A 3KPSA 1L7TH 4LSUH 1BQHG 3S37H 1GZQA 1H9VA 2VDOH 1PKQE 4N1CA 1IFHH 4F2MB 4LCWB 5D1QA 4K7PY 4ZODA 1DQDL 2NPLX 1Q0XH 3JXAA 1RSFA 4XNUL 5CGTA 3IFLH 2Z93B 4JZNA 5HPMA 1KIRA 4LSPH 3PABB 2QHRL 1VCAA 1MCOL 1N64H 4ERSH 4IHOA 4MJID 2YBRB 3GIVA 2F74A 3MRCB 2V6HA 1FZOA 3ZKQD 5L7XH 3DI2B 1A7PH 3QIWD 3OKEB 2J8OA 5HHMB 1B0RA 4KHXL 1QSEA 1A64A 2X1WL 2MWCA 5BV7H 3MLSL 3CSYA 5DQ9A 5ICZB 5DD6A 1SY6A 4NUJB 4K9EH 3M17A 5JDSB 4LBEB 5FUCC 3IB4A 3R06B 3V6OE 1NLDH 3EO9H 4JM2D 3V4VL 5HSFA 2ZUQB 2FX9H 4NFCA 3RWEB 2D7NA 1AQKH 1I3GH 4LLMA 4Y5XA 2ARWA 4HJ0C 4JHWH 4KKCD 4WFHD 1QSFD 3VU2A 3MRKB 1UZ8A 4IJ3C 1PBYA 2VLRA 4ODUA 5FM5M 4MAYD 5EBWB 5GRYA 2YXMA 2YSSB 3OX8B 1U93A 4P3CL 4P2CG 2C7UB 1XF2B 3AUVA 1BX2B 2OQJA 1QFWL 3RWCB 3GEWB 1C5DB 3BT2H 5KANI 1HH9A 3SDDA 1ZGLA 2ATPA 2VXSH 2XPGA 4BUGA 4NQXB 4HKBB 3DGCR 4O2EB 3T1FB 4HS6B 2F54D 1N8ZA 3W81A 5HGHB 1NLBL 4MQSB 4O51B 4OKDA 2I60L 1FDLH 4OZGA 3O6FA 1QO3B 1G7QB 4LKXA 4FNLH 3SKJL 1CE6B 5CZVL 2NY1C 2FX9L 1MRDH 3MUHL 2VDNH 1SBBA 3JVGA 1XF5A 5BZWA 4HIEB 3HC4H 5KAQG 5LKNA 3AFLA 4MA8H 4JPKH 3VI3F 3I85A 3NPSB 1BM3L 3LKPB 4QY8A 4JREC 2X4QB 3V5HA 4R97C 1HHJB 1LEGB 1IARB 5TFSH 4MDIA 1JZ5A 2Z31A 4CN1A 1LE5B 1RU9L 2F54B 3FQXA 4WIQA 2QTEA 4LKCA 5IHZB 1NC2A 1HXYB 3B83A 4NWUL 3WUWA 2X1PA 1UM5H 4HWZB 4MXVF 4I2XB 2ZWLT 5ANMA 3QDMB 4LLWB 3VD5A 3I50L 4RQQA 3V0VB 1RZKL 1NCDL 1EHNA 3CFEA 4OZGE 1QG3A 4O2CB 3Q1SL 1BFOB 2YPLA 3TN0D 1VENA 4O5LH 1KNOA 1UZ6E 5J4MA 3KPRD 1KT2B 5HD8D 4J3TA 1UENA 5C08A 4LARH 1P6FA 3NIDE 1LO2L 1TVBB 3CFBA 3HZKA 4NNXB 5DZLA 1TQCB 3U36B 5C0FB 5IMLB 2DQUL 3DJ9A 4LQFH 1NKOA 4NDMB 4R7NA 3EW3B 4BKLB 3STLA 3GSQA 5CCKH 3CDFA 5JR1L 3FMGL 4NRZB 2ZSWB 4RA3A 3UEZA 3AM8A 3MV8B 1G9NH 2A0LC 1HSBB 3OJ2C 3QJFA 3BWAB 3C60C 4ISVA 5IR1B 3MA7B 2C4FT 2XNAB 2JJTC 2V9TA 1FZJA 3HE7B 1U8LB 1J0IA 4KVNL 2QLVB 4MJIB 4AZ8A 5IW6A 2V5MA 3C2AL 2X4TA 3BH9B 2VIRB 4RX4D 4XB7A 3V95A 5MEPA 1ES0B 1Z6JT 3L1OH 3EFDL 1AE6H 2HFFA 5HDQL 2M8XA 1U9KA 3NCCB 3C87A 1WT5A 1IGTA 1M6OA 3MGAA 1A7OL 1EMTH 1J5OL 5DD0L 3WS6A 1BAFH 4G8EA 1T1WA 2FB4H 3DMMD 3KXFA 4OTXL 1F4YL 4LL9A 5DD5L 3RPKA 2J6EA 4RAHA 4Y4KD 1GZQB 3CFCH 4EUPH 3O2DH 2EO9A 3RU8H 4Q58C 4Z5RB 3KLAB 5I8OH 2JF1A 5JNYB 1T04A 3WD5H 1CXKA 4M6OH 5IEKB 4G9FA 4WENB 2CXKA 3FHQA 5HPMB 3F6IA 1S78C 4Y88A 1I3GL 1FNSL 1KJ2L 5HHOD 5ISZE 5IKCA 3GHBL 5EU3B 3EJYC 1Q0YL 2RBLA 3GIVB 2F74B 3MRCA 1D5BB 5MHSE 4JPVH 4G5ZH 1FH5L 4I4WA 4FQJL 5T1MA 2ICWA 1ZK9A 3OKEA 1UM6L 2AJVH 5IVZA 4U0QB 4ONGL 2AI0H 3K4ZA 4M3JA 1S7WB 5DQ9B 4HQQL 5ICZA 1YQVH 2Y72A 2EYRB 4WI3A 4UOW1 5JDSA 5FV2A 4LBEA 4YHPA 4U6VL 4QOKE 4XCEB 3R06A 2CO7B 5B4MC 1NUGA 1GIGL 4JQIL 3WLBA 1ERNA 1X9QA 4DTGH 3RWEA 1JF1B 1WCBB 4LLMB 4Y5XB 5C6TH 3CFCL 5LXGH 2V17L 3MRKA 4EBQH 2VLRB 1CTNA 3Q1SH 4NPYA 1QSFE 4HLJA 4I0PC 3NH7H 5EBWA 2AV7B 2DQDH 5B21A 4YEFA 2YSSA 1U93B 1JMXA 4ZD3H 5KVEH 4G80A 5D7IA 4P9MH 4KKAD 2OQJB 2ICWJ 5JOFB 4PJGF 1X5YA 1HH9B 4N0RA 1ZGLB 1KLGA 2YXFA 4FRWA 2HJLB 4KRLB 4F8QA 4WHDA 2NY4C 2XPGB 4NQXA 3QXWA 4HKBA 3MYJA 4O2EA 3T1FA 3MXWH 4OGYL 1NCAL 1MCJA 3GIZH 1DBAH 5T3XL 3S35L 4OZGB 1MOEA 5AWNH 4B7IA 5KW9H 2Z9TA 4KDTC 4FQXD 1ZHLB 3W5MA 4MD0B 3VW3H 2YD7A 3I3DA 5E8DH 1BP3B 4ZQKB 1RK0A 3AXLA 5E24E 5BZWB 3G9VA 3I3BA 1U8MA 1MLBA 1WWBX 2DWDA 4GBXA 1VEMA 1KTKE 2HMID 4FHBD 3SDXF 5E6IC 1JZ3A 4ZMAT 1N64L 2X4QA 4ERSL 2R2BA 1FPTL 3LN5B 4Y2DD 4M6OL 2NXZB 3M8OL 4XVJH 3E6HB 4MDIB 3CSPA 1MWAL 2XN9E 3KYOB 4GOSA 4AM0B 5T5NF 1LE5A 2F54A 4NIKB 4LRIC 1XH3B 3OGCA 5IHZA 4M4RA 3K8LA 1HXYA 5IGXH 35C8L 5FAAA 4XP1H 3WUWB 3FMGH 4HWZA 1FG9C 5ANMB 4ZUWB 3VD7A 1EHXA 3QDMA 4LLDB 1FCGA 3H3BC 5IOPB 5I30H 4LLWA 1J1PL 2DJUA 2Q86B 3VG9B 5GRWA 4RQQB 3V0VA 5CSGA 3CFEB 1KCUH 4PRPE 3AB0B 5IQ9B 4V2BA 3HCVB 1KT2A 3AC0A 4Q7DA 3KLSA 5FYJD 3X3FH 5C08B 4I77L 2NNAB 2NY5L 1VEOA 1TVBA 3CFBB 4NNXA 4AJ0A 4P9HL 5C0FA 5DMGD 3P0YL 4R7NB 3K0WA 3STLB 1F3DH 1W0YT 3GSQB 1CWVA 2AK4E 3ARVA 2ZSWA 4P46B 2MSPA 3K2UH 3CPLA 2DIBA 5KTEH 2R0KH 1HSAB 1WZKA 4PJEE 3BWAA 5SWZA 1ITCA 3FFCE 3UAJD 3MA7A 5IR1A 1JYXA 1OAKH 4L8SA 2XNAA 1PVHA 2UZIH 1FZJB 3HE7A 3HZYA 4FQXC 5GGVL 5IW6B 4G42A 1MPAL 2X4TB 4CL7A 5JXEC 2A6DB 1TFHA 1OSZB 5MEPB 2YWZA 1ES0A 1OGAA 1RULH 3QUZD 2QQLH 3SE4A 2HFFB 3KPRA 1A0QH 2D3VA 3UTTA 1B2WL 2GW5A 4U6HB 5FO7A 2ZCLH 3DUUB 3S37X 2WUCH 3NZ8A 3OKOB 5DRXB 1T1WB 3KXFB 1WTLA 2X9WA 3KPQB 5GRXG 1E4WH 3GKWH 3UTPD 4D0CA 4Z5RA 3KLAA 1ED3A 4K8RH 5JNYA 1QSFB 1T04B 1ZV5A 3QEQB 4J4PA 4TUJB 4Y5VB 5JMOC 5IEKA 4N9OB 4G9FB 1QYGL 4NZTH 1A22B 3EJJX 3PDGA 4Y8DC 4JKPL 4ETQB 4X9FA 5IKCB 3ARDD 1B9ZA 4FQLH 5EU3A 5DJAA 5LCVL 4E42B 5L0QC 4LPUA 5INCA 4TULL 4JO2L 1D5BA 2NXYD 3TA3D 4I4WB 1JRHH 5T1MB 3PQYE 4ZAKB 2ICWB 3CMOH 5IVZB 3HAEA 4XP9H 3WNKA 5LVEA 2Z8RA 1TZIB 2WQRA 3P0VH 1S7WA 4NKDB 4G5ZL 4R26H 2VLLA 2J6EH 5F7FA 2EYRA 5F1NA 5IK3A 1HH6B 3ZKSD 2Q1EA 3WIHA 5KVFL 4YHPB 1EO5A 4XCEA 5T3ZL 1S5HB 5CILH 3WLBB 5HVFB 1OP5H 4DAGL 4FTVD 1KN2H 1JF1A 1WCBA 3KLDA 4G43B 1N6QH 3MRIA 2GSGA 3U9PL 5EB9A 1N6VA 1ZTXL 3HI6H 3LV3A 4NPYB 4YGAB 1IZKA 2AV7A 2IFGA 4IOIA 3SKNB 4JHAH 4G80B 5D7IB 3GNMH 5EOQL 4K71C 5JOFA 4OF0A 2WBJC 3UP1A 4I18C 1KLGB 4HIHB 4YFLF 1JZ7A 2OL3L 2HJLA 1NCAH 4HSQA 4UIKL 4I3RL 3UTTE 4ACPA 3JWDH 3MYJB 3WXWL 2ERJB 3LZFL 3O6KH 5FM5O 2X5PA 2L7UA 4X9IA 3TPUA 2A83B 1ADQH 2HLAB 1ZHLA 4RFNC 1CGTA 4PD4K 4ZFZA 4MD0A 3JVGC 3O11A 4WI4A 4ZQKA 3T2NH 1RK0B 3AXLB 3AVEA 4HT1H 4J1UA 1CDBA 1JZ8A 1U8MB 1MLBB 2IBGA 4P2RA 3C09B 4H0GA 2DWDB 4GBXB 1P84J 4NGHL 2AQ1A 4Y19D 5IT2H 1QKZL 3AS3A 4QRTA 5A43C 1BZQK 3C6LA 1S7SB 3OZ9L 4XMLH 3RX7A 4CVWA 5HYQA 5JHDE 2K7PA 4S2SB 2R2BB 3TF7C 3LN5A 4M7KL 2H32H 3GKWL 5FYLH 3E6HA 4M03A 2WWMD 3PHQA 4Y4HC 4ZTOH 4X6BB 5JTWA 1R3KB 3KYOA 1FO0B 4MYWB 5F7HA 2G9HA 4AM0A 1FLRH 1MFCL 3C8KB 4ONGH 3HZVA 4L8DB 2CDGA 1CD1A 1XH3A 3OGCB 4CMHC 4URTB 1ZSDB 5DF0A 1AY1L 3C60D 2OYPA 2GTZA 4Q74A 5I1AA 5ADOH 4ZUWA 4LLDA 3S96A 3OPZH 2W9EL 5IOPA 2YS4A 3L5HA 3REWA 1NAKH 4MMZC 2Q86A 4QGTA 4M8QB 1G1CA 1YA5A 3BAEL 4D3CL 2VLJE 1GIGH 2WIIA 4JQIH 2LVCA 4CDHA 1A7RH 5IQ9A 2UWEE 3HCVA 2HTLC 4FQPA 4NO0D 3N06B 1BJ1J 2CIKB 3INUL 3DIFB 4PJIB 2NY3B 3H3PH 2BNQE 2NNAA 4DUVA 3QPXL 5KOVC 5DVOA 5KVDH 2VLKD 4ZXBD 2APXA 5DC9B 4KJPD 3WO4C 1S3KL 2IJ0C 4GXUN 3ABZA 2AJXH 1X6LA 3D18A 5FYLD 1C16B 4H1LG 4WFED 3NCJH 4P46A 2B4CH 1F02I 3CPLB 1HSAA 3X12A 3IDGA 5SWZB 1E4WL 4LCWD 1E28B 1ZHBB 3RY6A 1J12A 4L8SB 1KCUL 4OF6A 2PN5A 4Z7UA 3HZYB 2FLBT 2W9EH 4XWOD 1DLHA 3NA9H 1FGNL 4G42B 2A6DA 4MMXC 3RGVB 1OSZA 1U92B 2X89D 1OGAB 4DKEL 1AH1A 2QQQA 3QQNA 3KPRB 3CLFH 3UTTB 4U6HA 3T08A 3O3EA 4P23B 4F15C 5FO7B 3UTSA 1BEYH 4XC1L 3DUUA 1U8JB 5IIEB 3NZ8B 4NNPH 3OKOA 5DRXA 3O6LH 2W0KA 1LE9A 5DT1L 4I3SL 1OT2A 1RPQA 2CUHA 3PGFL 3O8XD 1IM9B 1T0PB 3KPQA 4MGXA 4Q0XL 3CXDH 1ACZA 4XVJL 4D0CB 3L9RA 3TH2T 5KVFH 4KRMB 5DC0A 2EC8A 3TBSB 2BSSB 4M61B 5CGMA 1ED3B 5ESAB 3GBML 1QSFA 4TUJA 3QEQA 4Y5VA 3Q5TA 3THML 1B4RA 3V4VH 4NGHH 3HNSL 1KB9J 1PW3A 4ETQA 2F5BL 2H1PL 4KAQH 3KWWB 5DJAB 4XCFH 2O5ZH 4E42A 1YEIL 4MVBD 5INCB 3AM8C 3T3PF 5CUSL 4Q9BA 4ZAKA 4LRNL 5DHVA 2HYMA 3HAEB 1TZIA 4U7SA 3X3GH 2HTKD 4NKDA 1LILA 4POYA 5L7XL 3FAXA 5FUOH 2VLLB 4FFWC 5IK3B 5F1NB 1HH6A 1X5HA 4P2YA 5GRZA 4PPTA 2AJUL 1N6UA 1NAKL 1S5HA 5BO1H 4JM2F 4KKBC 1F11B 1GGCH 2CDEA 4A6YH 2WMPA 4G43A 2P8PA 4QTIH 3MRIB 4IJ3B 2GSGB 1MH5A 2C5DC 4FXGB 2A6JA 5EOQH 3LV3B 4FS0A 1NPUA 1HINH 4QXWA 3J8F7 5A40E 2DMBA 4YWGH 4IOIB 2P49B 3SKNA 4XP4H 2OMBA 4Y5VC 2WZPD 3QUXD 3P30H 2ICCA 5F7KC 3IYLW 4GSDH 4L5FL 2IGFL 4HIHA 4H0IA 4LSRL 2B7DT 5F3BA 5DURD 3BXNB 5EDXA 3TIEA 4HS8H 4GW4A 2V9QA 3BO8B 4LLAA 4ZAKC 3UPAA 1SBSH 2Q8AH 2FJFB 2XTLA 1TZGH 3TPUB 2AJSL 2A83A 2HLAA 5TDNA 1I9EA 4W70A 1WFTA 1OAXL 3IKCB 1AE6L 4ZFZB 5CSBA 5KOMC 2BHUA 3O11B 2J4WL 3MSPA 5J11B 3WNNA 4J1UB 4W4OC 5GZOD 3WNOA 4P2RB 1FYTA 4JDTH 5B8CA 4RGND 4QRTB 4Z18A 1Z9LA 3C6LB 2WUBL 1S7SA 4NNPL 4M48H 5HYQB 3P30L 1AKJA 5D72L 4S2SA 3TJHD 1CLZH 3K1KC 1TENA 1Z9SA 4LDEB 2OR7A 3VH8G 3PHQB 4OFIA 4K71B 1EH9A 3U7YH 4BK5A 4FZ8H 3QB7C 12E8H 4X6BA 1R3KA 1FO0A 2G9HB 4ZXBC 3C8KA 5C70A 2EDKA 3HZVB 4L8DA 2CDGB 4R6UA 1CD1B 1MWAA 3UTQA 3MX0A 3O0RH 4PBVC 4R4BA 1ZSDA 4YX2H 1MAML 2GTZB 5I1AB 1E4JA 2EDFA 3S96B 4NRYB 3SEPA 1X5ZA 3BSZL 3REWB 4U1JB 4NM4H 4M8QA 4MDJB 2WIIB 4M5ZL 4PJ9B 5MENE 2HMIC 1CBVH 1P2CA 3IT8D 5D2NE 3VH8B 1CDUA 5BMFH 5I1CL 1INEL 3OKYA 5C9JA 1A3LL 2CIKA 4LPXA 4XNQA 3DIFA 4PJIA 5DI8A 4GJTB 4Z0XA 1NDMA 1GGCL 3D3VE 4KTEL 1JFQL 1HCFX 1CICA 4PTTA 4CKVX 2Z4QA 4M00A 1W72L 2XZZA 5EO9A 4LLYB 5L9DH 3NIGE 1YC8A 5GJSH 2EDTA 4V1DA 3GMNB 3N85H 5HYJE 3D18B 1C16A 4UUJA 3EOTL 3B6SA 3PDDA 2VZVA 1F8TH 3DHJA 4DKDC 4RFOL 1U8OA 3X12B 3IDGB 5D1QD 1YEEL 1E28A 1ZHBA 1DBKH 2AABL 3QEGH 1T66D 1MLCB 4Z7UB 4Y16C 5BQ7A 3MOBL 1DLHB 1XGRB 2YR3A 5CP3H 4TRPL 1EV2E 2CQVA 2PXYC 1FFOB 1XCQB 1P4BH 2WINB 3WFCH 1CD8A 2PTUA 3RGVA 1TZGL 1U92A 2CR6A 2EC9U 3FO1B 4LVHC 1JNHB 1R3IL 1SBSL 4PG2A 2Y36L 2KQNA 4PJ7A 3RDTB 3SKUD 1OQOA 2DMCA 1I1FA 3O3EB 4P23A 1INEH 4DN3L 3UTSB 2PYFB 4X5XA 1U8JA 5IEHB 5IIEA 1KEGH 3GSVB 4XMLL 1LEKB 1LE9B 1MRFH 1IM9A 3GKZA 3T2PA 4P2RD 1F4HA 2IQ9H 5C0GB 5GJSL 2CRMA 3L9RB 1F58L 4J4PC 3TBSA 2BSSA 2BVPB 4M61A 1WWAX 5ESAA 2YA1A 3LKOB 3K80A 1PEZA 4X7EC 5HHMD 3EO0A 3OG4B 1UB5A 2OL3B 1AI1L 5FHAH 3A0OA 5B38G 1CVSC 3KWWA 3L3DA 1I8LA 1FG2B 1EEZA 5HYJD 3U4EA 5DHVB 5KSVA 2ZPKL 3QUXC 4OGXL 4NZDA 4JHWL 4R7DA 1NGPL 2XXMB 2AJUH 2F8VA 4ZYKA 3T0BA 4ZG1A 4XX1G 1QSEE 4JY5H 4Q0XH 4IRZL 2OP4L 4BQCA 1INDL 1J1PH 5T5FH 1A9EA 5L2KD 1B88A 1F11A 1LDPL 2CDEB 4P23C 2EE3A 2XY1A 4F15B 5I8EA 1FHGA 2P8PB 2WWKO 1MH5B 3WIIL 4FXGA 2A6JB 4H0HB 1F2QA 3HC4L 5HXMA 3SKMB 3VA2C 4OJFL 1XFPA 2BNQD 3C8DA 4M7LL 1RHHA 3MLUH 4XPBL 5SWSA 5HYJB 1TNMA 3K2UL 2GI7A 4OT1H 2FR4A 1MJUH 5F3BB 3TYGL 4HX1B 3BXNA 5C08E 3BUTA 2BDNH 2DQFA 2CKNA 3TIEB 4GW4B 2ADFH 3BO8A 4MXQC 2FJFA 3QUXA 5F9OH 5FUCE 4F7MB 3W2DH 4PJGA 5H8DA 3QDJD 4NWUH 1YY9D 2FD6H 2KUTA 2XQYK 1DBMH 5TDNB 1TITA 3RPIA 3E8UL 3IKCA 4QHMA 5DHVH 1T0NA 3FRPA 4XCCH 3VXRD 4APQB 4HG4J 1OP3H 4G6JL 4Z8FL 1FYTB 4GMSH 4HWBH 5B8CB 1GC1H 4U0RC 3RKDC 1K4DB 4BFEA 3O3DB 1AKJB 2NXZC 2EEBA 1MCEA 5DUMH 4HXAL 4O02H 3MZTA 2HFEB 1YJDC 4E41E 5HVHC 3QDMD 4LPYA 1KCVL 4DEPC 1FPTH 4PTUA 1MWAB 3UTQB 3ZDXF 4R4BB 4FG6D 2LU3A 2WK2A 2X7LB 4MJ4A 4P3DB 4N0CD 4RGOL 1WICA 4NRYA 4TYUA 3E8UH 3LQMA 1QP1A 5EU7E 2FIKB 1EBPA 4U1JA 4MDJA 3KJ6L 1EERB 5DJZA 4YC2B 3VW3L 4N90D 3SBWA 4PJ9A 5C2BH 1UWXH 4XP5L 3LPWA 1P2CB 3QUZA 3VH8A 4LOUD 1MCLA 5C9JB 1A6TA 4ONOA 4WFFD 2W0PA 4XNQB 5DI8B 2DQDL 4UTBL 4Z0XB 3UTZA 1NDMB 5IWLC 3OKKB 1CICB 5AYUH 4PTTB 3TGXA 4HBQA 2Z4QB 5EO9B 5L2KE 4LLYA 2W38A 3KAAA 3C6LC 3NOIA 4V1DB 3GMNA 1MIML 1XMWA 3PWNB 4XPTH 5KS9F 3HI1B 4G6MH 5JQ6H 3MLUL 4UUJB 3B6SB 1FYTE 1ETZA 3H8NA 4X8XA 4ZS7L 1JGDB 4YBQD 4RDQF 4TNWF 1U8OB 3WS3A 5GJTL 1EBAA 2VERN 4Q6YA 4NWTL 1UACH 2DQIH 5IQ7H 2CLZA 2EE9A 1JZ2A 2DJ4A 1MLCA 1F4YH 5CD5C 5BQ7B 2P5WD 3D85D 4GQ9L 2BP3A 1XGRA 2FLRT 2W1NA 3S3PA 4QRPA 5JW4N 1AI1H 1FFOA 1XCQA 3P11H 2WINA 3E6FB 3FO1A 4OLWL 1JNHA 4QXUL 2EH7L 3HR6A 1KTRL 2B2XH 4PJ7B 3RDTA 5JUEH 1MPAH 1I1FB 4L29B 4XXDA 5D9SA 2PYFA 4X5XB 4JO4L 4KUZL 5IEHA 3GSVA 4PJ9C 1T2QL 4QRUB 1LEKA 4C58B 9CGTA 3QFJB 3QYCA 3BZEA 3WS6C 3HLAA 5ESVB 1XEDA 4FA8A 3S97C 2P8MB 5DUBA 3FZUD 1I7ZB 5C0GA 5CEXB 4LPCA 2IFFL 1FL3B 5IFJA 2BVPA 2VLME 2O93L 1V7MH 3LKOA 1IAIL 3EO0B 4WO4C 3MJ8B 1UB5B 2OL3A 3GHEH 1ZTXH 4JKKA 5F72S 1RJYB 4U1GB 3L3DB 4NZTL 4JKWA 1FG2A 1EEZB 4KRNA 3U4EB 3ZE2F 4K23H 1FORH 5KSVB 5J56B 5ALCH 1KEGL 4R7DB 3LKQA 5I15H 4ZYKB 5I1EL 2FJGB 4PG9A 5E9DA 2PO6B 3RTQD 2X70A 5EORL 3VXNB 3QBTB 1KTLB 4P5TD 2FX8H 1AC6A 1BVKA 2YUVA 4WTZA 1A9EB 5F7EH 3BVNA 3C08L 1XIWB 2VDQL 1QRNE 1UA6L 4YHZL 5HI5C 4M7JL 5C2BL 3NCYS 3P0GB 5I8EB 2VH5L 4NN5C 3X3FL 4AENA 4ALAL 4KKNA 5AUMB 5T1LA 2RJMA 4FQLL 4QCIA 3CVHB 4JFDB 4LSQL 3SKMA 1EFXD 3W0WA 2PKDA 2HWZH 1F8TL 4QEGA 4I0PA 4U4BA 3SOBH 4DFHA 1RHHB 4NZRL 4ODTL 5SWSB 1SJXA 3ZSSA 6FABH 4K7PX 5TGBA 4V1DE 5HYJA 2P5EE 2VTFA 2E6QA 3RRQA 4WO4A 5D7LD 2KQMA 4PJAF 3RZCA 3GO1L 1JRHI 2FR4B 1JPFA 2GITA 1MIEL 1G7JB 1KIUA 4HX1A 2YD6A 2DQFB 4HGMA 2HT4C 1JTTA 5FCUH 1ADQL 1DBML 4NBYB 4HC1H 3QUXB 3SCMA 4F7MA 2R1XA 4Y19E 4PJGB 1OTTD 4U1HB 5L88L 2HH0L 1P9MC 3RPIB 3RVVC 1FVEA 4QHMB 1J05A 4GMSL 5C0AD 1T0NB 1C7TA 4APQA 3D0VA 4FZEH 4JQXA 4LHUB 2P45B 4KXZH 5JUEL 1TJHH 2H2PC 1JWUA 4XMKL 3FZUC 4YO0B 3K8MA 4K3DH 3RA7L 3G6DH 2VZOA 4U31A 2DRUA 4E9LA 1AGDA 4LLUA 3KPLA 4GMTL 1K4DA 5DQJB 3O3DA 1CCZA 4DVRH 3UTOA 4MQTB 2LU7A 2IPUG 1A7PL 2CK0L 2JJSA 3CMOL 4WWKC 2HFEA 1LO4H 2YUZA 3GO1H 5BOZG 3MRGB 4F57H 2AS5M 1KELH 3RIAK 2X4PB 4PTUB 3RWJA 1PD6A 2VLJA 2P43B 1J86A 2DD8H 1BWMA 2XKSA 3SGDI 1QOKA 2YK1L 2X7LA 4P3DA 3V6BR 2VZ1A 5AG9A 2N56A 2B4CC 4UNUA 2FIKA 2X44D 4WJ5B 3QRGH 5DJZB 3G6JF 5E1AB 1UCBH 2HVKA 3LEYL 1KXVC 5FDWB 3QUZB 3KGRA 2NY0C 5DFVC 2D9CA 3IF1B 3T0EE 5FIEA 1A6TB 5C09A 3OMZA 3QXDA 1DL7H 5AYQA 3UTZB 2FJHA 3LB6C 3FONB 3OKKA 4FP8L 3NABH 1S7UB 4TUOB 3ZO0A 3PWNA 1AQKL 2VLMD 3U79A 3HI1A 1LHZA 1FJ1B 3NMEA 4OLVL 5FM8A 4F7PB 5T3XD 1ETZB 1UH3A 1QBAA 3P4OB 1UGNA 1JGDA 1ZEAL 4PV9B 4NN7B 3WS3B 1S3KH 4TTGA 4U6TA 3GK8L 3MRHA 1JPTL 3SY0A 2CLZB 4Y16A 4EOWH 3T04D 1GXEA 1QBLL 3NFSL 1AGBA 2DQIL 4QRPB 2C1OA 5DLML 4YEEA 4M6MH 3E6FA 4FQIL 4Q9RL 3VI3E 4JRXA 1LVEA 1YMMD 3LDBC 3O2WH 5MHSD 3NVQA 3P3YA 4YH6A 1B0WA 4OGAD 3MRPA 3H6JA 4L29A 4Z7UF 4XXDB 5D9SB 5GRJH 4WHTA 1CGXA 3LB6D 3DV4B 4QRUA 3ZDZF 3QFJA 2EH7H 3BZEB 3HLAB 1CDYA 5ESVA 4AH2A 1HCVA 1YQVL 5FK9B 2P8MA 5DUBB 5CEXA 1I7ZA 3MODL 1T1XA 1OAZL 1SMOA 1EFQA 1FL3A 2VYRE 4HCRL 5IFJB 4Z95H 3BGAA 3GHEL 3ZE0F 5F96L 2YZ8A 2VAAA 5E2WH 5ADPH 5DEGB 1FVCA 4BM7A 4J2XA 1D6EB 3MJ8A 5SX5H 1Z2KA 5IHUH 3C2AH 4Y4KA 4OZFH 2IMNA 1I4FA 1RJYA 2J2ZA 5EZOH 3HE6A 2LTQC 5DEFB 5SV4A 4HHAA 1MFEH 4IM8A 1DQMH 2ED9A 3HMXA 5BW7C 2R0WH 2CR3A 3E2HB 1NC2D 4X7CC 1I3UA 3LKQB 3OG6B 5DO2D 2FJGA 4PG9B 5E9DB 1J0JA 2PO6A 4FTVA 2X70B 4OIAA 3DYPA 4NQEB 4XP6H 3FO9B 3VXNA 4HJJH 1KTLA 2DQTH 1BVKB 3KPPA 4YHNA 4H8WH 3BVNB 1XIWA 3QPXH 4CU8A 2DQCL 15C8L 1KF9B 3TFKD 4AENB 2ESVD 5I9QB 5IG7A 5AUMA 5T1LB 3GHBH 1KPUB 4QCIB 3CVHA 4JFDA 3VGAC 3V9FA 1PDKA 4E41D 5KW9L 3F5WA 4K2UH 3W0WB 2EZ0C 1SM3L 4JGJA 5AAMA 4I0PB 4V2CB 2HRLA 3QISA 2I25N 2NLJA 5DURB 5EOCJ 3WEXA 1DL7L 2UUDK 4POZC 3RVTD 5EZOL 2NZIA 5TGBB 3OKDB 4WO4B 4FQQA 5DVMA 2ZUWA 1X3DA 3QR2A 3RZCB 3UX9B 1X5KA 4H26A 1JPFB 2GITB 1G7JA 5DRZA 7FABL 5GGUA 5JR1H 2JE8A 5IBLC 2VDQH 4YHZH 4AK1A 2XA8H 5CJBA 1T83A 5FKPA 3SCMB 5LWYL 1ND0B 2R1XB 4K3JH 4KK9D 4BELD 4ZO9A 2H26B 4U1HA 4AIOA 4OCSL 4L4VD 4I0CC 4FG6C 4P23D 5CJQL 5J9PA 1FVEB 2BRRH 1J05B 4PJBE 3D0VB 4LHUA 4X6DE 3MACL 1DSFL 1JWUB 4HZLB 5DT1H 3LS5H 2H3NB 4YO0A 1T0MA 1N0XH 1J0YA 2OZ4H 5HHVH 1B4JL 3VFMA 2XZAH 4OUOA 4NCC2 4WY7H 1YN6A 1AGDB 4LLUB 2CRZA 2JCCF 3KPLB 2KBGA 3QO1B 5DQJA 3RP1A 2APVA 3SGJA 3FOLA 4ZPVB 2Y4SA 3VFVB 5GRVL 5GISL 4RRPG 3MRGA 5DMJB 2YN3A 4PRNA 1V7NL 2X4PA 4HC1A 3RWJB 2VLJB 3B9KA 2P7TB 3REVA 1PG7H 5F88A 3FRPG 5JW4Q 1G7PA 1UH2A 2ZUYA 1FIGL 5GZNC 4WJ5A 3CFDA 5BMFL 5I1CH 3GK8H 1KPVA 4GMTH 5E1AA 5E8DL 1NCCH 4P49A 2Y06L 2HVKB 4Y19B 5FDWA 3M8OH 3AB0C 3QRGL 3IF1A 5C09B 4TSCH 3JWOC 4EDWL 2PTVA 3QXDB 4PJXE 2R8SL 1NAMH 3QUKA 5IB4B 1BQUA 2FJHB 5JIIA 2VKWA 3FN0L 1C5BL 3FONA 3MBXH 4Y89A 5ECJE 1S7UA 4TUOA 4DUWA 1IKFL 1VGKA 3GNML 1FJ1A 4XPBH 4JZOA 4R90H 4F7PA 2D7TL 4XAKD 5BOPA 3P4OA 4PV9A 5DWUL 1U3YA 1Z0MA 4JCLA 3QQ9D 4BH7B 3S37L 1WITA 3MRHB 1BEYL 4XC1H 4OZHE 1HE7A 3SY0B 2YMXL 4Y16B 4WGWB 3MGOA 3O2VL 8CGTA 1AGBB 4N90E 1J9CT 2QHRH 2C1OB 1WZLA 2VDKL 4PB9L 2I60H 5EFIB 1MFBL 3G04A 3RDTC 5GXBB 2A77H 4JRXB 1JYNA 2NQCA 1J8HE 1N0LA 3MRPB 2D03H 3VXPA 1OW0A 4WHTB 4QRSA 5I73B 3DV4A 1RUPL 3VFUB 4MXVE 3UJIL 1JZ4A 3QUZC 4AH2B 1ONQB 3GZKA 4LP4A 2Q20A 5FK9A 2F53D 1MNUH 4G6AD 4Z78B 3DHMA 5IW1A 1T1XB 2W59A 4EBQL 5FHAL 2GSIA 2I9LA 2VAAB 5I76B 1T1ZB 4TVPL 5DEGA 2XZCH 1FVCB 1D6EA 3JWDC 2R56H 1IT9H 2AXJA 8FABA 4RFEA 1MHHB 3L3JA 3A6BL 4Y4KB 2FGWH 5E94A 1GAFL 5KSAD 1I4FB 3RBSA 1NGPH 4D9LL 3HE6B 1I75A 5DEFA 3EYSL 4QXGH 4HUNB 1V7NH 4HHAB 2W9LA 4GRWF 3VDBA 5L2KA 5GISH 5LQBL 1TQBB 4JRXD 2ILLA 1R3LA 4LFHG 3MOAH 3QHZL 3BZDA 5FCUL 1Q72L 3O45A 3QNXA 4H8WL 4FTVB 4HFUL 4ODHH 4NQEA 3FO9A 3KPRE 4Q97A 1O5DT 5ICXB 3KPPB 3QCTL 4YHNB 4U1KA 5C0BA 4QLRA 3UBXG 2J7LA 4P99A 4LSTL 1OW0C 1NMCC 5TF1L 4LCUA 5IG7B 2D7PA 1OTUC 2NR6D 2Y6SD 1KPUA 1IC7H 1F3JB 3F5WB 3MPCA 1MJJA 4KUCD 4NQTA 3RWGB 4TN9A 5KTEL 2GJJA 5AYUL 1DQDH 4BQ9A 3MRQA 5C8JA 1UFUA 2NLJB 2N7AA 4KV5E 3BPNB 3WEXB 1ORSA 1QZ1A 3GSWA 4OJFH 1GSMA 3OKDA 3WXVH 4X6DF 3NBNA 1FP5A 4FQQB 4Z7OE 4LDOB 5L2JA 5DK3A 3OHXA 2CMRL 3SO3B 4H26B 3ARBD 2FO4A 3QIUB 2YUXA 2OXGA 5DRZB 5GGUB 3U0TB 2D7TH 2NY2D 5DVNA 4GKSA 3VFPA 5FKPB 4E0RA 1ND0A 1J0ZA 1UCTA 3HE7D 3SQOH 3WFBH 2H26A 4OIIL 1UM4H 1FYTD 5EU6B 4ZFOL 2B0SH 2VDKH 5J9PB 4LAQL 4APQC 4HWBL 4MJ6A 5E03A 2CJUH 1F42A 3L5WA 3DX6A 4OV5B 4FABH 5BRZE 1OTSC 4HZLA 4M43L 4NJ9L 4XT1C 2H3NA 1T6WA 1T0MB 3WFDL 5B8CC 4C56E 4XVTH 1RIVH 5TE6H 2W9DL 4U0RB 3C09C 4LCIH 3MODH 2RQ8A 3VFMB 4UQ3B 1YN6B 2EIEA 1MNUL 3QO1A 3FOLB 4ZPVA 1OD7A 5F6HI 3I6LE 1F2XK 2PR4H 3U4BL 1N4XH 5J3HD 3C8HA 2XFXA 3VFVA 1CL7H 4U49A 1D6VH 2OL3H 1T7XA 2PUQT 4PRNB 1ZANH 5FKAA 3HB3D 4OFYA 2LU4A 3CAFA 2E7MA 5JA8B 3B9KB 2P7TA 3REVB 5EU6E 1EX0A 4S0SD 5DK0A 4S11A 1IRAY 3RZWA 2DOCA 5F88B 2XKUA 3I84A 4ONFL 3SCMC 1G7PB 4YHOL 3VXMD 1Q72H 4I1NB 4NQEE 1Q8MA 3CFDB 1OARL 3LD8C 5BCAA 1KPVB 5C9KA 5DR5H 5FECA 2CLRA 4Y19A 4N0CC 5BO1L 5FYLL 2A38A 4GUPB 1JWMA 2DYPD 2EDJA 3GSXA 4U05A 4XPHL 5C6TL 1A02N 3QUKB 5IB4A 3RNKA 2WLYA 3A6OA 5CKAA 4OD2B 1RV6X 3STBA 1BECA 1CGYA 1VGKB 2X4OB 1CE1H 1HZHL 4P9ML 4XCNB 4JZOB 1I9IH 4LVOB 3AMKA 4OCYL 3SDXB 4BH7A 4G6KL 2XZQH 2NTSP 3KPMA 3MGOB 4EIZC 3I2CH 4FXLA 3RUGB 3W11C 3UYRL 2ENSA 4HJGA 1TZHB 5DD3H 3NGBC 3ZZ1A 2KZ1B 3MLPA 1ZHKA 1DBJH 4JN2B 1OHQA 5EFIA 5EIQA 1GAFH 4UIKH 1JN6A 4ODWB 3G04B 5FYKU 1FSKC 1FN4A 1NCDH 4UOJA 5K59F 5CEZD 5CD5D 3IJSA 1VERA 3VXPB 1X7QA 1WSST 4QRSB 5I1HH 4OZIE 4FFWD 3VFUA 5D8JH 4CUCA 4BSVA 5KVMC 1SJEB 1ONQA 2FEEI 5CGYC 3FO0L 4TSBL 4CVXA 1IAKB 4Y2DC 4NM8H 5IW1B 4Z78A 1JUFA 1EUUA 5IBTH 3MLVH 3MV7E 2GSIB 2I9LB 3VI4F 3QFDA 4M5YH 4JO3H 5I76A 1T1ZA 2VLKE 5JW5A 1L6ZA 1E4KC 2Z91B 8FABB 3U7WL 3ZHDA 1RHFA 4RFEB 1MHHA 3L3JB 4JANB 5E94B 1LK3H 1J0KA 5I15L 5E95B 3IFNH 2AGJH 1PQZB 2Q7YA 5BW7A 1AY1H 3BH8B 1KPRA 5L2KB 4GRMA 4MAUH 1R3LB 3TYFB 1WFNA 2ADFL 3O45B 3QNXB 3T0DA 5IBLD 3KHQA 1MJ8H 3N0PB 1I7RA 5ICXA 4YDVB 3B43A 4U1KB 4FNLL 3SKJH 5C0BB 2BRRL 1VB9A 1BGXH 5FGBC 1CFSA 4LCUB 3RWDB 5DRNA 5TE7H 2XICA 4NQED 1CFVH 1T80A 1C5CL 5D7LA 3ARGD 4BQ6A 1F3JA 1MJJB 4OZHF 3VJ6B 2DI7A 3RWGA 1JPGA 4UB0H 3MRQB 5C8JB 1RZ7H 4NCC1 1MCSA 1P7QD 2CMRH 1ORSB 5D1QC 3GSWB 3ME0A 1AJ7L 5E8EA 1LO3L 3MXVL 4LEOB 3LQZA 3EJZC 3ARGB 5L2JB 4XPGL 3WIFA 4Y16D 3OHXB 4NKMA 3V8OA 2FO4B 1ORQB 3QIUA 4DCQB 4OB5L 2MFNA 3U0TA 3WL9A 4GKSB 1IGCH 4GKOA 3VFPB 3ZKMC 4Y1AD 1CLZL 4E0RB 5IJVA 1V3MA 4YDJA 4S1RH 5DGRA 1AHWB 3RL1B 4GO6B 3ULVH 1C08A 4FQ2L 3DXAE 4O58H 5EU6A 4M6ML 2OX5A 3I2CL 3S34L 3MLRL 1G7HA 4MJ6B 2GJZA 5TQ2H 3L5WB 1HHGA 4OD1H 5H2BA 3T0ED 4G8IB 1OGAD 5EOCL 3DX6B 4OV5A 3VXSB 1BQLL 5GQBA 5D71L 4WHYG 3BGFB 2AW2A 3L5JA 1TIUA 1LQSR 3GSRA 1NMCB 4UQ3A 2F5BH 3OAUL 3T77A 5GHWL 5CFHA 5MEND 2CUMA 1D6VL 1T2QH 5I17B 3MXWL 1XR8A 3QEQD 2XFXB 2AXGB 3A6BH 5EG6C 3PWVB 3ZT5A 1PG7X 4OB5H 2A9NL 5JOPE 2YUWA 1OLLA 1CFBA 5FKAB 3SDDC 4U3XA 4C83B 4JM4L 2J1KA 5D7IF 5DK0B 3AY4A 2MCPL 5K59E 5C0CE 3WN5A 1U58B 4JR9H 1P1ZA 4EI5D 3VXUB 4S1DC 5I19H 3ARYA 4DKFH 4WVRA 5TQ2L 2R9HD 5C7XL 2GAZB 5FECB 3ILPB 5E5RB 2CLRB 3DOSA 1JHKL 2G2RA 3T4AB 3HI5L 2X41A 4N8CL 4NHCH 4R4ND 3DGGA 4GUPA 1SVCP 5C0BD 1JWMB 2APFA 3GSXB 4KUZH 3R0NA 2NYYC 4ZDHB 3QDHA 5FFLA 2LE9A 5EZJA 2GY7B 3IKKA 3RNKB 3SQBA 1CD9B 2ICES 4IRSD 3B2UC 4OD2A 4OI8A 2Q7NA 2X4OA 4XCYB 1JPTH 4XCNA 4KQ3H 4NN7C 4KTYA 4GAGL 4NUGL 4K7FB 1HIML 3SDXA 2Z31C 1EMTL 5IMKA 4KK6C 1Z3GH 3KPMB 2ADJA 3MRLA 5CP3A 5D7LE 5SX4H 1IGIL 2X1QA 5AWNL 1DBJL 4I3RH 2CKBH 4EI5B 5D5MA 3RUGA 4GS7C 3DVFA 4HJGB 1TZHA 5DHYA 1MCWM 1ZHKB 3O8XB 3RU8L 4JN2A 5D7JC 4RAUB 4JJ5A 1JN6B 4ODWA 3RVWD 2YA0A 5K93A 1FN4B 4YZFF 1RUAL 4HK3N 3IJSB 2EDLA 3FN9A 4UAOC 4PP2A 4ZO7A 4YHKH 1X7QB 1WBZB 1FQ9C 2VDOL 5EU7C 1DVFA 4KAQL 3RKPA 4NC2B 5E2JA 5F7EL 2W9DH 4BSVB 2AJSH 4Y7MA 5D72H 1SJEA 1MFDL 1N0XL 2NY5H 3IJYA 4W4NA 4G8FB 4XTRC 1KYOJ 4CVXB 1IAKA 1GC1L 2IQAA 5DMIL 1JUFB 4U1IA 3NTCH 2HT3C 4JLRB 3QFDB 4JHZA 1NGQH 1SHMA 5JW5B 5FUOL 3MV01 2Z91A 4JANA 2LTQB 4KJWC 4QHLA 1OWRM 4PGBB 3LQAH 4LVOC 4PGCA 1WTGT 1IILE 1ZOXA 4XI5C 4RWYH 1JGLL 1PQZA 2N7BA 5JZ7C 3QNYA 2Q7YB 1QEWB 4AEEA 5CBAB 3BH8A 1KPRB 1RFDH 1MCKA 3AAZB 4GRMB 4TRPH 1NGYA 3TYFA 2G60L 4HLZH 2P8LB 4S1SL 1OOAA 3CIQA 5HGGS 3FB8A 2FSEB 1FIEA 4Y4FB 1I7RB 3IDXH 5D7JA 1OP5K 2YEZB 4YDVA 1OTTC 4AL8H 4Z0BH 1U2CA 5K9JL 5I9QC 4PGJA 4LLQB 3U0WL 4PLKC 2P44B 1CFSB 3RWDA 5DRNB 2MNUA 3B2UD 5D7LB 1BD2B 1DBBH 2DQCH 3VJ6A 3PDOB 3DTXB 2R0KL 1JPGB 1KCSH 4BYHA 1RMFH 4NRXB 4YBQC 2DKMA 1CICD 2ZKHH 5E8EB 2F19L 4LEOA 1S9YB 2UWEA 3LQZB 3R8QA 1OT1A 3ARGA 4TSAL 3WIFB 5EO0B 4NKMB 5GJTH 3FB7A 1ORQA 4DCQA 4LMQE 4NFBA 4UOW0 5FYKE 3I3EA 4YIQA 1K8IA 3WL9B 4OGZA 5IJVB 4NKOA 4YDJB 2DTMH 4MQXC 1AHWA 4JJHA 3RL1A 4DN3H 2R29H 1X5AA 1C08B 5GSVB 1NCWH 3ULUH 1YEHH 3O4LD 4P2RE 5IROC 2J8UE 4F9PC 1HYRC 2DIAA 1G7HB 1JE6A 1QFWM 4LSUL 2GJZB 4XNZB 1HHGB 5H2BB 3ILQC 4G8IA 3WV0A 3VXSA 4P2QB 3ZKXB 5D70L 5F97E 3QAZC 4RISH 4IRJD 3GSRB 3I02B 4U6YA 5A2JH 2P5ED 4FXKB 3T77B 1KJVB 2PYEB 4PJHB 3W5NA 3MJ6A 3SHSA 5I17A 2VLJD 4MNGE 5CZKA 2JJSC 4F80A 1D9KC 1KLUB 1XR8B 4NQDE 2DLFL 1NGQL 2NX5D 4N5EC 3BSZH 2AXGA 1ADQA 3R0MA 2FH8A 3PWVA 4TSCL 1CD0A 1Y18A 4HXBL 3DNKA 1CFTA 1B6DA 2QHLA 3E0GA 1FV1A 3SGDH 1F4XH 5F96H 4H88H 4Z7NF 1GOHA 4C83A 2APTA 1QFUL 2V9RA 1A3LH 1FE8H 4OLZH 2DQEH 3BN9D 2ED7A 5ILTL 4ZNEE 3WN5B 1U58A 1P1ZB 3QWRA 3L5XL 2MCG1 3VXUA 1AHWC 1PG7L 4HIJB 2GAZA 3ILPA 2G2RB 3EOTH 2NY1B 3T4AA 2X89A 3DARA 2R1YA 3DGGB 4P46D 1H0DA 3ZTNL 3IDUA 4ZDHA 2ADIB 4OCWL 4XBGB 5EH1A 1AO7D 5EZJB 3IXAA 1GGTA 1MCWW 4JFEA 1ZXQA 3EDFA 4L1HA 4PB0L 4NOFA 2G5BB 3VXOB 3EOAB 1BD2E 1KCSL 2O5YH 2ZZUT 4XCYA 4NWTH 1RUPH 1MCQA 1NH6A 4PY8I 3ARZA 3QA3A 2JJUA 1JK8A 4K7FA 1MJUL 4IS6A 2B8OT 4TUKL 5BS0A 5IMKB 3RY5A 1X5LA 2ADJB 3MRLB 2VC2L 3LAFA 4CN6A 2O5XL 4Y2OA 4EI5A 4WW1A 2VXVH 5D5MB 4NC0B 4NHCL 5C0CD 5DHYB 4XVUD 1UKSA 5I1JL 4OQTH 3KYKH 5C0BE 4ZOEA 3O8XA 1S7XA 1ODAA 4RAUA 4JJ5B 3B9EA 4UDTB 2VISA 3E3QE 3UJJH 1F3DJ 4IDJH 4PP2B 2IANA 1ACYH 2XZAL 1WBZA 2X05A 3CH1B 1DVFB 1VFAB 5IVXA 2EDDA 3QHZH 1LD9A 1YMME 5T1DH 1KG0B 2E9JA 1KN2L 3ARTA 1HOCA 3THMH 3IJYB 4G8FA 4J12A 1QRKA 4HKZB 2FHBA 2IQAB 5KSBF 1AR1D 4U1IB 1KB5A 3SKOB 1IC4H 5I8KL 4JLRA 1NGXA 2DICA 1E4KA 1A6AB 1PG7W 2B4CL 3BESR 4Y4KC 3DO3A 1G6RB 5IVXE 4MB3A 5DQDL 2C3GA 4QHLB 2FH6A 4PGBA 5SX4I 3TO2A 1MREH 2YD5A 4PGCB 1IC5L 4U1GC 3QNYB 3DVGA 1FIGH 1QEWA 5CBAA 4UV7L 2ZKHL 1VFMA 3AAZA 3KJ6H 5GS0H 3NA9L 1NGYB 5EUOF 3GSNL 3UJIH 3WXWH 2P8LA 2GT9B 5D2LA 3BPOC 4B7LA 1H5BC 4YFLI 1J1OH 3FB8B 5D7KE 2FSEA 1C1EH 3PXHA 1UQSA 4Y4FA 5D7JB 1FL6A 2YEZA 5D1XD 1M7DA 2R8SH 3GBMH 3HI5H 4NQCD 4POUB 3CJJA 4X98A 1U42A 5CEYA 3UPRB 4LLQA 4NBZB 4MLSA 3UCRA 4WTZG 4CDGC 5C3TA 3OF6D 3ULSA 2AJXL 4NN5B 5D71H 2BY1A 1QTYT 3PWJA 1BD2A 2CXGA 3BZ4A 3MQIA 3OAYH 4WW2C 3CMGA 2F8XC 3CNKA 3PDOA 3DTXA 3QH3B 3B5TA 4U1MB 4NRXA 4W81A 2E6PA 4WEBH 4OM0L 1DANU 4ZOBA 2DQHH 1CXHA 1SEBA 2DN7A 1CZ8L 5IQ7L 4X8JA 2QADB 1S9YA 4RMTA 2UWEB 5DC4B 4M7KH 1YYLL 1XGYH 4E41B 1MI5B 5EO0A 5I18H 3DX7B 3LS4L 2DL9A 4KY1L 3FB7B 1HXMA 2EECA 5E8NB 3H0TA 4YIQB 1K8IB 1MFBH 3EO1A 3T0EB 3X3GL 3MRDA 3N1GC 1AXSA 4NKOB 1HKFA 2Q6WB 1NC4D 3PF2A 4JFFE 5GS2D 3OR7B 5GSVA 4RAVA 3NACL 2D9QB 4NN6C 4RGNC 4ODSL 2LQRA 4Y4FC 3AU1B 1OAUL 4DW2H 1MCDA 2WQ8A 3QEUB 4P2QA 5JXAL 1YEHL 2VLRD 2QV2A 3P4NA 5MEOA 4MNHB 2XACC 1QD0A 2KDGA 2QJDA 4Y5XC 3I02A 4KXZI 4U6YB 4FXKA 2IQ9L 1OTSD 4RISL 1KJVA 2PYEA 4PJHA 4PRPD 5DRWB 4GW5B 1KLUA 4YHML 1TTUA 4JO3L 4DOHB 3Q0HA 4UV4L 4KKLD 5IHBA 1Y18B 1S7VA 4D2NA 2IBZY 1CFTB 2ITCB 5C0AE 1FV1B 2Y06H 5CUSH 3B9KC 3ARDB 4I18A 1MF2L 5DO2C 2AKRB 4OCLC 2LAGB 2NY4B 3EJYD 3JV0A 3AS0A 1CU4H 5HDBF 4CADA 3K1DA 5I1DB 4G8GE 3JZ7A 1MFNA 4JG1H 4IMKC 1QSED 2DM3A 3MMEB 4HIJA 4RGNE 4XPTL 3HPLB 4PB9H 5D6CA 25C8L 3QPQD 3GSNH 4KRPD 3QDAA 3ARED 2R23B 2R1YB 4P3WA 4B41A 3QHFH 4XNZC 2EXYD 2AQ3A 1H0DB 1KYOK 4M1CD 2ADIA 4XBGA 4KHTL 5E9DE 1Q94B 3JV4B 3IXAB 3QAZB 4JFEB 4EN3C 3UPCA 4Z6AT 2JIXD 1F4XL 3OB8A 4GW1A 3TIDB 3TPKA 3WLWD 5C07E 2G5BA 3VXOA 2E7BA 3K74B 3EOAA 4OCRL 1INQB 1S9XB 3BZFA 4LGSB 4ZFOB 2P47B 5JA9A 4ZUUB 3A67L 1I8IB 3R1GL 2Z8SA 3QA3B 3P4MA 1JK8B 4ESKA 2BXZA 5K9KA 1S8DA 4IS6B 4L4JA 1NANH 2VJXA 5BS0B 2VLKB 3LS4H 3ZDZE 43C9B 1T89C 2HJKB 5DLMH 3FL7A 4WW1B 4LF3A 3NGBB 4KJWD 4OZFG 5CP7A 4ZTPH 1M1SA 1PKQB 1WUNT 4DVBA 5L88H 5EU6D 3IGAA 3UJJL 3AY4C 1S7XB 4UDTA 2VISB 2ZCHH 4IMKA 3Q2CA 1B90A 4OLYH 3LDBB 4OKVA 5GGSY 2Q8AL 3SDAB 2IANB 3CH1A 3TBVA 4OD1L 3MZGB 3HMWL 3I6LD 1VFAA 5IVXB 4J8RA 4XMPH 1LD9B 1KG0A 5F9WB 1HOCB 4HKZA 1M05A 3LKNA 4FZEL 4IRJA 1KB5B 3SKOA 3T0XA 2BK8A 2ZP0T 1NGXB 2EDYA 1A6AA 2BCKA 4JDTL 4NM8L 1G6RA 4LSVL 4HAGA 2EZ0D 4PJIF 4PRHB 3IDYC 3TO2B 1OP9A 1YYMH 3DVGB 1C8PA 4XP6L 5LGKA 1CR9H 1RURL 3HNVL 3WDJA 4L3CA 1FAIL 1I1AD 3HRZB 2GT9A 1NUNB 5D2LB 5E00A 4KKBD 1R6VA 4X6CF 1UQSB 4ZS6D 1FL6B 3ZKMD 1M7DB 5JPMB 2AQ2A 2EXWD 5D1ZD 2B1HH 3UMTA 1A47A 4X98B 5CEYB 4PR5B 4G6FD 4EN3D 3UPRA 3SGKC 2R4SH 1W72H 2IEPA 3AREB 3ULSB 2YPLD 3U30B 5ANME 3PWJB 4JEGB 4AQOA 5KVGL 3BZ4B 4EVNB 3VGAB 4IDLA 4PJ7F 3QH3A 2XWTB 1CVRA 4U1MA 1QYGH 1U8KA 4OQTA 5C0JB 1SEBB 1UM4L 2AABH 2P42B 4X8JB 3PWUA 3ARGC 4WCYH 2MPAL 1RIHL 3ECBB 4NFDA 4E41A 2VUYA 1MI5A 1IJ9A 1JPSH 3GDBA 3DX7A 1D9KD 3DX9A 4UT7L 3GRWH 1HXMB 5E8NA 4TNVK 3H0TB 3EO1B 3T0EA 3O2VH 1IGML 3LKSB 2XG4A 3MRDB 5J1AA 1AXSB 5DD1L 5EUKB 2Q6WA 4HV8A 1NGWA 3CFIC 1OSPL 4LPTA 5DK2B 1H3TA 3OR7A 2FBJL 1MEXL 3MTRA 4RAVB 1EHAA 4NSKA 4U1LA 2P4AB 4ONHA 1CDGA 2OSLA 2WANA 3AU1A 3H9HA 1A14L 3QEUA 4LK4A 3VMNA 1YN7A 5AZ2H 1YNLH 4ODVH 3P4NB 5MEOB 3OB0H 4MNHA 4CU7A 3DSNA 4LPWA 3N9GH 1WBYB 3O2DL 3EYQC 1EAPA 2AVGA 3D69B 1D9KA 4YX2L 2Y9RT 4RZCA 5DRWA 3LMJH 4GW5A 4GXVL 3IAQA 2UY6A 3PL6A 1P84K 5JW4M 5DJ2B 2RIKA 1S7VB 4XVSH 5KG9A 2ITCA 2RAMA 2CK2A 3ARDA 4I18B 2AKRA 3EYSH 5CD3A 1T20B 2AK1L 2FGZA 1DBKL 4YZFE 4CADB 1LK3L 1QVOB 2ERJC 3S35X 5I1DA 3RX8A 3UO1L 4L4TE 2HTLD 3BRGC 4MHHG 1HWGB 4LEXH 4WEMB 3OXSB 3MMEA 3HPLA 3BDBA 5D6CB 4EDWH 4CJ1A 3HS0A 4XAKE 4UTBH 2R23A 4TPRH 4IDJL 3CXHK 3CFJA 1XIWD 3KYMA 4LQFL 1C12B 1B4JH 2FEEL 3D1MC 3TBTA 5HPOA 1Q94A 1QFWH 3JV4A 2OLDA 5GS0D 4GW1B 3TIDA 1DBBL 4R2GD 4GXVH 1GL4B 3SE9H 1QLRB 4G9DB 2EDQA 1INQA 1S9XA 3CU7A 4KY1H 3BZFB 4ZFOA 3WKNA 4ZUUA 4XTRD 3UBXI 1I8IA 3VGEA 4PJCF 3V7AE 3P4MB 1F3RB 4JDZA 5K9KB 1S8DB 1WJ3A 1ZA3B 3IRPX 1TCRB 1YUHA 5JORA 2PETA 2CUIA 1MCOH 3U46B 1IM3B 2VLKA 4ZXBA 43C9A 4UINH 3UZEA 2HJKA 1DQQA 1NSNL 3H7BA 2EDOA 4LASH 5C07B 4LF3B 5CP7B 1PKQA 4DVBB 3FO0H 2NY2B 3IGAB 1ROWA 2QSCL 4LSVH 5EOCH 4YDKL 4EQ2A 2BOCA 1KGCE 3SE8L 5DD1H 4KMQA 2E9IA 2GCYB 1I1RA 2OP4H 4OKVB 4PYGA 1XF1A 5D5MF 4FMFA 3RUGF 4HFWA 3SDAA 1ITBB 1GHFL 3TBVB 5EU4A 1FNHA 5CILL 5HHME 3E3QC 4J8RB 1MHPH 3MV9E 5J6HA 5MP6L 5FDYA 4F9LC 3KHOA 1M05B 3LKNB 5BVJB 4IRJB 5CJ8A 4Y2DA 1NBVL 3T0AA 2BCKB 2Y6SC 4GQ9H 2BFVL 3MV9D 2FNBA 4ALAH 3GM0A 4JFHE 4A6YA 5I1LA 4PRHA 2BNQA 4HXBH 1UACL 1IEAB 2HKHL 3HE6C 3SDYL 2BNUB 2R2CA 5GIRA 3NA4A 3BWUC 1YY8B 4L3CB 3J7HA 5DJ0A 3HRZA 4MJIE 5E00B 3RI5F 1SM3H 3NFPA 2AK1H 5AAWA 5TF1H 5HY9B 5JPMA 1IFHL 4I13B 4I0PD 5D7SL 3SE4C 4BQ8A 4PR5A 2GJ6B 4XC3L 1HINL 3LVEA 1SJVA 5LJYH 1UWEL 5C86A 3AREA 2E3VA 1X5XA 5B3NA 4WW2A 4X6EA 1MEXH 4OZ4A 4EVNA 1CTOA 2OCFD 2XWTA 6CGTA 5IUSA 5LQBH 1U8KB 5C0JA 1WBXA 4MCZB 3PWUB 5JMRA 1CYGA 1G9MH 3ECBA 2ZSVA 2X6MA 1GGBH 3DX9B 1Z3GL 3EDJA 5ISZD 2F19H 3SO3C 4B5EA 1A2YB 2ADGA 2ZNXA 5IBUG 3LKSA 5J1AB 4JPKL 5EUKA 4HV8B 2ZG1A 3BKML 1NGWB 1G9NL 1H3XA 1DQJA 1AP2B 5LG1A 4UINL 1RZIB 5DK2A 4LNVA 5J06A 3NIFE 2XYCA 4ZFFA 5FYJH 4NSKB 3FCTB 4U1LB 2Q8BL 4ONHB 2OSLB 4JO4H 2DKUA 4LGPB 3H9HB 4ODTH 1BJMA 1SYVB 1YN7B 3WIHH 4EDXB 1S5IL 2AEPL 3BFOA 3QWQB 2R2HA 4U6XB 5I0ZA 3BDXA 3KYNA 4K9EC 4HF5H 4TVPH 1F6LL 3AREC 1RY7B 3ZT7A 1WBYA 5H35A 1EAPB 4JY4A 1Y0LA 2XA3A 2H2PD 3D69A 1D9KB 4M1CC 4RZCB 3GSUA 1YEGH 1UCBL 3TCLB 4DQOL 3PL6B 4GAFB 3MUGA 4YR6A 4JFYB 5DJ2A 1BJ8A 3BKYL 4R2GC 5KG9B 1Q9OB 1S9KC 5A2FA 2XN9D 2DJSA 3D9AL 1BIHA 5CD3B 1I85C 1T20A 4HAFA 5FV1L 4A2MA 3MROB 5C0RL 2VL4A 1KJ3H 3K4AA 5F7YC 1QVOA 2DDQH 4R26L 3TA3C 2DLTA 1ZKAA 1W8OA 1QBBA 3Q6GL 4NQCA 3NFNB 3OXSA 1J1OL 4JY6B 1G0DA 4HPOL 3TFKC 3LD8B 3HS0B 1NCBH 1MELA 1U36A 2KL6A 1MY5A 3JWOH 3CFJB 3D87B 2J8UF 3KYMB 5DD0H 1C12A 3TBTB 5B38B 2VITA 1XF4A 4O9HH 3O41B 3F6LA 2V5YA 2Y7QA 2NY0D 2C3HA 1QLRA 3WMSA 4G9DA 4HJ0D 2EYTA 3I75B 4BA8A 1OAQL 1NANI 1D5ZA 5JOEA 2Y1VA 4JDZB 4JKLA 3MUY1 1IT9L 1ZA3A 3MRMB 4TSBH 1TCRA 2FDBP 2PXYD 4KWUA 1YUHB 3WNMA 5JORB 5IFHH 1YMMA 2VR4A 3U46A 1IM3A 4ZXBB 1WAAE 1DQQB 5M7QA 1MCCA 3H7BB 5C07A 4C56D 2QQLL 4JG0L 4UT6H 1HNGA 4M6AA 3UJTH 4UT9L 4KPHH 2NXYB 4HIXH 2BOCB 1BQHB 1WAAF 2JB5L 3ORJA 3QUMB 5IESL 1I8KA 2I24N 1CGVA 4QRQA 1FSKB 2GCYA 4HFWB 3G5ZA 4JVUA 3VWJA 5EU4B 3PGDA 3DSFL 4JFZL 3WFBL 3NCMA 5DJ8A 2CGRH 3TBWA 2VDML 1IGYA 4P0DA 1CLYL 3FFCD 5J6HB 4LSSH 4TUKH 4KROD 4L9LC 5BVJA 4Y2DB 3P0YH 3OAUH 2AI0L 5IWLA 3LKRB 2A0LD 3L3OB 4ZD3L 1UZ6F 3MCLH 5IFHL 1BMGA 1ZAGA 4A6YB 5I1LB 3MCKA 2BNQB 1IEAA 2IAMC 1NDGA 3OR6A 4XBEL 2XOTA 1FGVH 5D1XA 1FYHB 2VN7A 2BNUA 1D5IH 3RY6C 5GIRB 3SJVD 1YY8A 1HHHA 1KB5H 4ZOAA 5DJ0B 3OBAA 3C6SA 5C0NC 4UI2A 1OB1A 4XGZB 1H5BB 3WKML 1KJ3L 4PJXA 4F37K 3NFPB 3HMXH 5E4EB 2N4IA 4KI5C 3DVIA 3K7UA 1HHIA 5FF6B 5E1HB 5HY9A 4MAYC 4MA1B 4NO0A 2GJ6A 4NP4H 5HYSB 1QNZH 5GGQH 1FRGL 2OR8A 2BMKA 4X83A 3ZSTA 1ZGLP 2BX5A 5DJ6B 4HUUB 4M8VA 5EC1A 1H8OA 4LPVA 4WW2B 4FQ2H 4X6EB 2CSPA 4OZ4B 4YE4H 2DYPB 1V5JA 3STZA 1L7IH 4MQ7B 4IRJC 1YEEH 2R0WL 5KANG 5F6HJ 5ID1A 1WBXB 2HH0H 4MCZA 3IU3B 5L6YH 1HQRB 2ZSVB 3QDGE 1L0YA 1GGUA 1VFUA 1MCIA 4UTAL 4PRPB 1XZ0B 1DN2A 5LWYH 4L4VB 4S1QL 2FD6L 1A2YA 3OJVC 5E2VH 3S7GA 2IAMA 3BIKA 2ADGB 3ZKND 5F8QC 5F71A 3E1F1 4KC3B 5IGXL 3IDNA 2GK0B 2HJFA 1KJMB 4PJ8C 1FGNH 1DQJB 1AP2A 1RZIA 1Y6NR 2YD1A 4ZFF