4JHBA

Crystal structure of relb double mutants: y300f/i335f
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
110
structure length
110
Chain Sequence
LVPRGSHMNTSELRICRINKESGPCTGGEELFLLCDKVQKEDISVVFSTASWEGRADFSQADVHRQFAIVFKTPPYEDLEISEPVTVNVFLQRLTDGVCSEPLPFTYLPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of RelB double mutants: Y300F/I335F
rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords Transcription factor RelB
total genus 17
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2013-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jhbA00
3MUY1 4NN7C 3MJ9A 1AJ7L 1A7OH 5TFSH 1QLEH 2FBJH 1PDKA 5IF0A 4UOW0 3ZTJG 1OTSD 4CU7A 2P7TB 5B39A 4MXQD 4HGKC 1NEZB 5FA3B 3RUGE 2F58H 3OHXB 3T0EC 5K93A 4PGBA 4R3SA 1DDHB 3KPRD 3QEHB 4NO0D 1CGSH 3TIDA 4YXHH 4PRPA 1HHHA 5GGVY 1H3XA 5A3ID 4GG6F 4GW5A 1FSKB 2PTUA 1G7LB 4RQQA 4M61A 3PWJA 1U3HC 1E4WL 3LRHA 4H25A 4JFFD 2NX5B 1I75A 1INEL 3CFCL 4KDTC 3AS3A 4RX4A 2OL3B 4F57L 4ONHA 4NO5A 3V9FA 4P5TB 1JMZA 4OBRA 3RHWK 1ERNA 1NMAH 3FO0H 5E5RB 2X4TB 3ALXA 3BKJL 4NKDB 1K4CB 3VFVA 5C2UB 3OV6A 3BP7B 4DZBB 5INDB 5F3BA 1OF2B 3GGWB 3CVIH 2G60L 1D3CA 4TOYH 3V7MA 3C5ZB 3WIIH 3O41B 1KIQB 3UZEA 1KNOA 1T0MB 4U1HB 4GG6E 1QBML 3GJFA 3IDJA 2OXHA 3FZUD 1OW0C 4PJHF 1MVUA 2IPKB 4PP1D 3TT3H 4HUUA 5CLTA 2BC4B 1YNLL 2UY6A 5HYQA 1OHQA 3OX8B 3LKRB 3TLRA 4K3GA 1EBAA 2Q6WB 2EE6A 4BYHA 1OGTB 4P4KC 1H3TA 1RZFL 5B8CA 5JHLH 4JO4L 1MUJA 1N6UA 1XCTB 4HKJA 1FIGL 2DWDB 4KMQA 5IWLC 3DXAE 5LCVL 5DHYB 1UACL 4LVHC 5EH1A 1I7UA 1AGEA 1MUJB 1XCTA 3MRLA 4E5XA 2QEJA 3QEUA 2QR0B 4OSUH 3PL6B 2O5YH 3KLAA 4NT6A 4HKBA 3NIFE 3T3ME 1J0YA 3O4LE 2Z31D 4UDUA 3HAEH 1JWUA 4JPVL 4YNYB 1MCWW 4M43H 5DT1L 3MRMB 4WTZA 3X12A 4E5XB 2VIRA 3FQUA 2UWEA 2IEPA 4GW5B 4P3CH 4R7DB 1GOGA 5F1SA 1I7RA 1FLRL 1I1YB 4ODWA 1YUHB 2OZ4H 1U8MB 2IH1A 4R96B 3U4AA 2YSSB 4F33B 5E4IA 3TVMA 35C8H 2AK4B 3DX8B 5IFHH 1JHKH 4HF5H 3O2WL 4BFEA 3V52H 3NABL 5BMFH 1K4CA 4IRJA 3QDJA 3R0MA 3GMMB 2AK1L 2DTMH 3GDBA 4JQXC 1G7MB 1EPFA 1UWGH 5JXEC 4EBQL 1CXFA 5KBNC 1AKJA 2I9LB 1T2JA 5TE6L 1R3KA 1JI1A 5C9JA 4PRID 4N9OB 3HNTL 1AGCB 4GW4A 4OD2B 2H1PL 3RVUC 1ZLWK 5JR1L 3LN4B 1M7DA 5J12B 5HXMA 1BECA 2RCSL 5FUOL 3QEQB 2CIKA 1T0PB 3SKUD 4FQCL 3ZKMD 4PB0L 5SWSE 4C4KT 2A6DA 2AJVH 5CJBA 4N8CH 1HXYB 2CRMA 3SE8H 4NQCD 1TVHA 5JIPA 2LTQC 2VL5B 1T7ZA 2AV1B 3QFJB 4RX4D 4ZS7L 3CSYA 1CFQB 3GMLA 2MFNA 4LRIC 1VHPA 2PNDA 4Z77A 2BSSA 1ZT7A 1UYWL 2PO6A 4GJTB 1KEGL 5EIIA 5AD0B 3FFCA 2GSGB 5FA3A 4KU1A 43CAB 4LLDA 3EOBA 3RY4A 4QTIH 4FQ1H 2Y7QA 4NJAH 5EUKB 5IHUL 3RNKA 3E6FA 1MREL 3EJJX 1MF2L 4FZ8H 1UCBH 3TA3A 4LGRB 2P5WD 4IEFB 2R1XB 3OPZH 2DTML 1S9VA 2Y7QB 5EUKA 2QADB 5H94B 1IVLA 3TBWA 1OTUC 3QJHA 3V6FA 4G9FE 3BDYH 1MCHA 2QQKL 2C5DC 1BFSA 2VZVA 2V9RA 3BAEH 1GXEA 2A77L 4UIMA 4M62H 2PETA 3EGSA 1JF1A 4PJ5A 3UDWC 5B39G 1I9RL 4L4VA 4WFHE 2E7MA 5A2KH 5BQ7B 3L7FB 5L7XL 5TF0A 4X6CF 4GRWB 2IWGA 5DRWB 3FB7B 2WBWB 1MH5A 5TH2B 2CRIA 4X9IA 3WMSA 1H5BA 1E27A 3RWFB 5E6IB 5I8KH 1A3RL 3NMEA 3NFPA 4MJ6A 4LL9A 5A1AA 1LP9B 1IE5A 3TZVB 2EYRB 4O2CA 3GSOB 4M00A 5IKCA 1H5BB 2EYTA 4MDIB 4AG4H 1TJHL 5D71L 3ZDYF 2P8LB 5F7LB 3IKCB 5KVFL 1AC6A 5L2KD 1EVUA 3TM6A 4YFLI 1HKFA 2AJ3A 3OGOE 5D72L 3CAFA 3ULUE 1LO0L 4UTBL 3V8OA 3ZYZA 3B3IB 1CD0A 4LLQA 3EO0B 4MD0B 3KPQA 1P84J 5D1ZA 5BJTA 4YHPA 3CFKB 2WLYA 3FT2A 1DBKL 3MJ6A 3DLQR 3VG0L 3QUMH 1MCRA 3H8NA 2BDNH 3BP5B 3QULB 2R23A 4J3WA 2Y6SC 1AD9B 5E2TH 2X7LA 1T1ZA 1VFBB 2PO6C 3NVQA 1WLHA 2VDKH 3FO2B 5H35B 1AGDB 5TE7L 1QBBA 5EIIB 4CVUA 1I7TB 2YN5A 4ZUWB 4QRPE 1AD0B 5E8OB 4JRYE 2ICWJ 1HYSD 3D2UD 4LVEA 5C7XH 1CBVL 3HZMA 1ZAGA 1ZK9A 1L7IH 5C09B 3NZHL 2OTUB 1J12A 4PLKD 5FGSA 5BO1L 2VXTH 5CEYA 3SO5A 4WU5A 4PJ7E 1H8NA 3BRDA 3O6MH 1JYVA 3QHFH 4HT1L 1YPZF 3P73B 3NIDF 4PJEA 4Q9BA 1NSNH 2CIIB 2Q8AH 4A6YB 4M7LT 3QXDB 4AG4L 5D93B 3MRRB 4NQED 3QUZD 2UYLB 2W1NA 1AQKL 1D5ZA 1ZGLA 3AAZB 3PV7A 5J9PA 1XZ0B 4OGXL 3U1SL 4C83A 4L3EB 5LWYL 4GQ9H 1F3JB 3L3HB 4FP8H 1JWMB 3BWUC 4ZUSB 4YGVA 5DJ2B 4PTUB 4U1HA 3SN6N 2M1KA 3A67L 2WQRA 4G9FA 1ZA6B 2A1WL 4GKZB 2DN7A 5C0RL 2GIYA 2OS7A 4JHAL 4ZXBA 3FMGL 5CSGA 3MCKB 4LSRL 2CGRL 4MA7L 1L0XA 4JPIA 4TQEL 3VDAA 3UPRA 4KXZI 3FTGA 5TGBB 2R0LL 1F5WA 1KG0A 5C0BA 3UTTD 1MAML 4WEBH 3CSGA 2C1OB 4Z7QE 5J1AB 4JRWA 3OKMB 1DQJB 1YC8A 4HDIA 1N6VA 3ARBC 4OBSA 4TSBL 3UJIH 4PRAA 3WXWL 4HX1A 4P4RB 2CK2A 2A83B 3MRBA 5LAXB 3B9VA 3UTTE 1PEZA 2XWBB 3QQ3A 4WHYH 3TBYB 1IGCH 1U91B 4ZXBD 5CCKH 2AXFB 1TTUA 1D5XB 4HKXB 4X7TA 5DD3H 1QTYT 2ZOKA 1JYWA 2BVQA 4O9HL 3QIUC 3WS3B 3OKDA 5DI8B 8FABB 4K8RD 4GBXA 1H3PH 3RWDA 2ZZUT 1IAIM 1T21B 2FO4A 4MD5A 5D4QA 2PW1A 4PJDF 4M48L 4OCRH 3L3GA 4E42A 2PTTA 1X5ZA 5FFLA 2IMMA 1VACA 5CEXB 1R3HB 1YECL 3WFHA 4LRNL 2V2TB 2JF1A 1NC2B 4KQ3L 3QUKA 1AHWB 1X6LA 5KVMC 2BY0A 1NC4A 4MQTB 3RAJL 4X0KB 2ENSA 1OSZA 1BQUA 5DZLA 4D9QE 3O2VH 2VUOA 3KPSB 4X6FB 5EU6E 2YPKA 3ULSA 3SE3A 2PR4L 4LMQE 2HTLD 2NTFB 1MCCA 3VXSB 3D1MC 5F9AC 4KRPD 1PAMA 2WUCH 4U6XB 5C6TL 3OWEA 1F90L 2ATPB 1KN2H 3HUJA 4XNUH 3ECBB 2CLVA 5I1LB 4DN3L 2MSPA 4WJ5B 2VDNH 5I1GL 5FYLD 3JV5A 4QOKA 2VLRA 3HC0A 5ALCH 4P23A 2B39A 4MCZB 1KULA 4NGHH 1YEHH 5EB9A 1ZA6A 4G9FB 4ZXBC 3VXRE 4X98A 2G75B 5HVFB 1ONQA 3N1MC 4OGAC 4NPYA 4G5ZH 1JNLH 1NGQL 4LCIL 3PWJB 1UH4A 4D0BA 4ZO9A 1Z0NA 2CJUL 4M1GL 3ARBD 3HS0A 3DV6A 4PJ7B 4R4FH 3IRZA 1O7SA 2ARJB 3ULVC 1VA9A 3HZVB 5DJYB 1Q1JL 5ISZD 1U8JA 4J8RA 4JB9H 3U4EA 2FHFA 1ULVA 4KTYA 4U31A 4KJWD 4G6JH 5SWZE 5F1OB 2JCCA 1NLBH 3P0YH 3M8OH 3F7YB 4P23D 5HBBA 5CBEB 3K1DA 1JF6A 1DVFB 1KTDB 4WNQB 1ZHKB 5JOPD 1ND0A 1NBQA 1UENA 3PUCA 3VRIA 5DMGC 3CGTA 4LLUB 5JHLL 1F11B 4ODVH 2OQJA 1CLZH 5DRNA 3G6AA 3LIZL 4FXKA 2Z8VC 3MNZA 2A6JB 4W70A 3G5VB 5CSZA 4CADB 1QO3B 3V6ZA 4YDJA 3JTSA 3E6HB 2Z4QB 3FQRB 3JV6A 1Z9MA 4G8FB 1FZKA 4X6DE 1I9JL 4JFDA 3LMJH 3HLAB 4Y5YB 1Q72H 3QPXH 3FKUS 5DYOA 1U8OB 4RDQF 3RUGF 4Y19E 3T3PF 2VZ1A 4LFHD 3U83A 2AK4E 5FHAL 1YDPA 1INQA 4LASL 4YZFE 1MJ7H 2IANB 3BZEB 5K9OA 2AXGB 1U2HA 3T65B 4FXGA 4RA0C 1FRGH 5IV2A 3BAEL 4JZJC 5C09E 3ETBF 4RAUA 1Q0XL 1A6WH 5D71H 2EDNA 4F37K 5FM5M 5J4MA 1IEAA 1YA5A 3HFMH 4QHKI 1KJ2A 3IF1A 5CS7A 4WI4A 6FABL 4OQTH 2AXGA 2ZG3A 1DQML 1H3GA 5HHMD 1A9BB 1XFPA 4KK5C 4Y4FB 3VGFA 2D7QA 5JW4Q 5TDOA 4G42A 1YMHB 5IJKC 3QWOA 5ESQA 5HDQL 1LO4H 3BUTA 5FYJU 4PJ5D 2CQVA 4PRBB 3RTQD 3VH8G 3CZFA 1B4JH 5D7LE 2IFGA 4NRYA 5IESH 5DD6A 3OJVC 5DUPH 2FEDC 4J6RH 1FH5L 1HH9A 5I71B 3ZDXF 1D6VL 1MLCB 1P7KB 1MRDL 3P4LA 4TPRH 1IAKA 3R8BB 1YEHL 3SDCD 5IG7A 3C5JB 2CDFB 4W6WB 4FRWA 4UU9A 1YC7A 2VZUA 4OZIA 2IG2H 4YR6B 3L3KA 5T33H 3E6FB 3N85H 1DBAL 3W0WE 5IJVA 2CDEB 2VLKD 5KSUB 1N59B 3IFNL 3QAZC 3DXAB 5JW5B 2ZOLA 3OAUL 4PGZA 1QKZH 1ZT1B 4U6YA 4WEUD 5HGAA 1W8OA 4JN1H 1D9KA 1MWAB 3TN0B 3INUH 4ZO8A 4PRIB 1HQRB 1M71A 2RGSA 2FEEL 3HNVL 3IDUA 1G9MC 4NJ9H 1C16B 5IEHA 2H1PH 5E5UB 2VR5A 5FB8A 3DWTA 1CL7L 4Y5YA 4UV4L 2JKXA 1OWRM 4S2SA 2F5AH 1H3WM 4NKMB 5IFJA 5GZNC 4PJDA 5JDJA 4P48A 3SDAC 4U6TA 1S9KC 4Z7VF 3T0XA 4KMLB 3IDNB 1DBJH 1W0YT 3F12B 4KJWC 2HRLA 5I9QC 4NUJB 5GHWH 4HG4J 1RSFA 2YPLE 3IDXL 1E28B 1TZIA 3ROOA 1CL7I 4PJFA 5IMKA 4AK1A 4JDZA 4PREA 1NDMB 2ZUQB 1S7QB 3W0WA 1A0QH 4P3DB 4XCYB 2DQTL 2JJUA 4M5YH 4WV1B 5GSVB 5IB1A 3WJLA 3UP1A 4TYUA 3FT3B 1NCTA 5F9JA 4ZNEE 3OQ3B 4J1UA 5BRZE 3MPCA 1CTOA 1JZ8A 2C26A 4XB7A 4WEBL 4LHUD 3DUHA 3V52L 4NCC2 3PP4L 1KIPA 2JELH 5IFAH 2F54E 2UWEB 3E3QE 1TNMA 4FFVD 4LLDB 2ZUTA 3VFGH 1I3RB 4XP5H 4MJID 2IPTH 4C83B 4HIXL 1AY1H 3WFCL 3WIFB 3VGAC 1PZ5A 3VFMB 2Y36H 2A73A 3W9DB 2GCYA 1NANI 4Q9RL 2OQJB 1I1AA 1FBIL 1WISA 2Z35A 1NC4D 1U8KB 3MA7A 4BFGA 1GRWA 4QRPB 1JPSL 3I75B 4L9LA 1BBDL 2XZQH 1HCFX 1OP9A 4JREB 1MNUL 4HIEB 2A6IA 1X5IA 1ZVYA 5C09A 3DV4B 4W4OA 3SDYL 4S1QH 3BIBX 5I66B 2VXQH 4OM1H 3HPJB 2BVPA 1D9KB 1MWAA 5ESAA 1C12B 3RGVC 1UACH 1FE8H 3GIVB 2ZOLB 1KTRL 3QI9A 4R26L 3C6LB 2ZP0T 3PJSA 4KTDH 1EO5A 1EAPB 3MR9B 1UG9A 4POYA 3QDGB 3QWRD 5F1IB 4AZ8A 1XGTA 4IOFD 4HK3N 3P40A 4Y1AB 3PGDB 5F97E 1QSED 1X9QA 4JFFE 1J87A 2ICEB 4NSKA 4PD4K 2IQAA 4NKMA 4HIIA 4M6OL 3QHZH 2A9ML 5E6IC 5HHQA 1AR2A 2E27L 4NBYB 2PW2B 3H7LA 2D7OA 1UKSA 3U7AA 1RAMA 4XHQA 3PXHA 3QUMA 5A2LH 2JJTC 3KPRE 2NXYB 4GOSA 1U8NB 4MSWB 3IJHB 1SBSL 3ULUC 4IDLA 1PLGL 3ET9F 4XWGL 1FQ9C 5TE4L 3NCYP 1QLRA 3P4MA 4APQD 5HYEA 4LCWB 1I3GL 3B9KB 1KLGB 3VCLA 4MMZC 4XP9L 5AWNL 5I8CB 5HGDB 1A1NB 2B1HL 3NGBC 5J1AA 3ZO0A 1XZ0A 4XCCL 3H3PH 3O9WD 2HLAB 1OLLA 4RGND 3CZJA 4B7IA 3FZUC 4MA1B 3EO9L 4JZJA 4P2QE 5EZIL 3DETD 2I07A 4XZUA 5ID1B 3ZLQC 4XXCC 5C0GB 3DNKA 5I1JL 2OMBA 2HFFB 3KLDA 4LVOB 4XBEL 1QRNA 2E7LA 3D85A 1DANU 1I1AC 2APVA 3OKDB 1NFIA 3X11B 1TVDA 5ITBH 1E4XI 1E4XH 2YK1H 4CNIA 4MX7A 3C8HA 3O6FD 2I24N 4UV7H 5HGHA 2JB6A 5EO1A 5IB4A 4AMKL 4NJAL 2R1YB 4PLJD 1A4KA 5CGYD 5C07E 4NZTL 3IAPA 2DF3A 4GAGH 5GRYA 2R39A 2D31B 4Z95H 5SWZA 1DSFH 3EYOB 4ZYKB 3IDMB 3BX7C 3GSVB 1YEEH 4GG6B 2GI7A 5DA4A 1FC1A 3QO0B 2YA1A 4I3RH 4POZD 2Q7NA 2ZKHH 1MRCL 3LHPL 5DVLA 4ELMA 3OKKB 4LSSH 1TETH 4MAUH 2N4IA 1ZLUK 3D5OF 4ZAKC 4JFHE 1UVQB 3JVGA 3EFFB 4UIKH 3CFDA 3ZL4H 3SE4C 3GMPA 4JG1H 1FZMA 5CFHA 4MHHI 4FQ1L 3TP4A 1OTSC 2VO5A 1G0DA 3WHE1 1WZKA 1DN2A 4WU7A 3SDDC 3UEZA 1AQDB 3RVXC 4G6FD 3LN4A 5E2VL 3FB5A 3MRGA 4OCSH 4M4PA 4U1NA 4RAVA 4XCEA 3LH2H 4Q9QH 4JO3H 5KG9A 4L5FL 3VFWB 1A6TA 4ZFFA 5E2UH 1IZKA 5BRZA 3EGSB 2P5WA 5C0FB 4Q9RH 1HHGA 3QUZA 4Y16B 1KIRB 4P59H 2MWCA 3OR7A 1A1OA 4ZAKD 1MCFA 4PJEB 1MELA 3RVVC 5EC2A 3C09C 3OGCA 5E9DB 4DVRL 2CDEA 5F7WC 4POZC 3T3PE 3MRNB 4GAJL 4JZJB 5GRVK 2AJUL 3F5WB 5GGVH 2EKSA 1A5FH 3K1KC 3GJEB 1FL5B 4JFQB 5E9DA 4H20H 3TZVA 5T3XL 4MWFA 3FO1A 5ERWA 4NKIL 4F2MB 3MNZB 1OTUD 3MSPA 3UX9B 4KK8D 1NBZA 3BQUA 3O4LA 5H2BA 1G6VK 4U0RC 2AEPH 4NO2B 4XMLL 3ZE0F 1BQHB 4Y4HC 4JHWH 2DJ4A 1WWCA 1XIWA 3TPUB 4ZQKA 4L5FH 3PV6A 3QG6A 3RJDA 3S98A 1YEDB 3QRFM 2OLDA 3NA9H 4X7SH 3QNYB 1UWEL 4JKKA 1YZZA 5C0BE 4YHOL 1DQDH 2FCBA 3P77B 4HJ0C 5BW7A 3LKRA 4G6MH 4GRMB 1K2DA 1R3KB 3LKSA 3MZTA 4KRNA 3QQ9D 4NQVB 3W5NA 5GJTH 2ATKB 4HX1B 2IQ9H 1KEML 3OZ9L 4R8WH 2IANA 3NCBB 1HE7A 4UNVA 4P23B 2C3XA 4JG1L 3QUYB 4D0BB 1L9NA 2I27N 4N0FA 1GGIH 2NXZD 3VMOA 1BHGA 3SDDA 3RY5A 4DAGL 4UT6H 4G6KL 5BS0B 1FYTD 1N7MH 3FFDB 5BCAA 4OI7A 3WJJC 4ODVL 2DIBA 4OKDA 5ADPH 3WE6B 3PL6A 1JCKA 1FCGA 2YPLD 1Q9WB 2EDFA 5BQ7A 1YNLH 2AV1A 4LIQE 1XF2B 3BVNB 1MJ8H 1ORSA 1JWUB 1CG9A 4FQIH 2P45B 3OB0K 1U8KA 2V2TA 3VJ6B 4OZFA 4TSAH 1NLBL 3PGFH 1HCVA 3D85B 2QR0A 4WGWB 4X5XA 4WI6A 5JW4N 2X40A 4TUJA 5EWIH 4PJGB 2BVOB 1M1SA 3O8XB 3HR5A 4KVNH 3QO1B 1R24A 1IM9B 1MFEH 3WFDH 2UUDK 4KHTL 4N8VB 2ICWB 1I9IL 4TSAL 3PJSB 4PJGA 4JFYA 2FD6L 1IC7L 2F74B 2ADJA 4HBCH 4XAWH 1A6WL 4WJ5A 5B22A 3DI2B 4ONOA 3GJFB 3BKYL 4WU5B 3LD8C 3ZHLA 1GZQA 4QY8A 1DLHA 3W0WD 1LWRA 2CSPA 2J6EA 1S78D 4MVBD 3SCMD 3V5KA 1I9IH 3N1PC 3TBSB 4WRLA 5JO5B 5EZOH 4UT6L 3NTCL 4X5WB 5DDHB 5E2WH 4P2QB 3NFNB 3EOAB 5DMKB 1P7QB 1OQOA 5TE4H 1F97A 3GMQB 3UCRA 4P4RA 1JGVH 3BT2L 4JCMA 1TJGH 3FO2A 1UFUA 5D7LD 1U8PA 3KYKL 3SO3C 1PZ5B 3BMWA 4I0PA 3BEVA 2ZCHL 2XYCA 3KS0H 4X5WA 1QUNA 4K8RC 5DDHA 3SDYH 5GJTL 2ENYA 3GGWA 1OP5H 5GRZA 3OL2A 3VFUB 3WN5C 5J3HD 4NUGL 4YBQC 1KCVL 2ATKA 1F58L 4M7ZB 3RIFK 4MD5B 5FKAA 3IAQA 5HHXL 4LMQI 3G5YA 4IRSB 4PGEA 1RIUL 1N7ML 4NZDA 2NY4B 4P2YA 1XF4A 2BY1A 4OCRL 3IFPB 4HWBH 2XN9D 1UC6A 3PABA 4K9EL 4JM2C 4FQCH 1FVCB 5JW4R 1IL1B 3IDYB 1NC2A 4EI5D 4CUCA 5CJ5A 3MLSH 4OZGF 4YO0A 1II4E 5HYQB 4HUWA 5I19H 2K9UA 2IQ9L 5DUMH 4S11A 1F3JA 4DKDC 2AK4D 1YEFH 1FNAA 4IDJH 4JM4H 1Q1JH 5LBSH 4RIRB 1GL4B 4JKPH 3FO1B 3QUXA 2QQLL 3J8F7 1LVEA 4LPXA 2X89D 4PRPB 3RIAK 5DRXB 1KB5A 3DVNB 4HJ0D 1IQWL 2O26U 3GMRB 3GKZA 4NN7B 3WFCH 4XPTH 1SJEA 5B21A 4QHLA 1BZ7B 1OAKL 3RVWC 4U7MA 1MVFA 5ALCL 2QQLH 3I9GL 5SX5K 3T0BA 2C1OA 1KJ2B 1T4KB 3T0ED 5F9DC 5MEOB 1SEQL 3A67H 2DQIL 4OLZL 5KVEL 2BX5A 4OCXH 1KCSH 2NY7H 4KK8C 4OLXH 1JZ2A 4WGVB 1ZOXA 2A74A 3BE1L 3JZ7A 1KOAA 3EYUL 1RZKL 1ZLWH 4WU7B 4YDIL 2P8LA 5I17A 4JN1L 3SKNB 5ISZE 1O7VA 3GM0A 3OXSB 4GBXB 2HVKB 1R3LB 2V5TA 3I2CH 4JQVA 4LAQH 2EDLA 4HCRL 4H26A 2VLKA 4KH2A 1JE6A 4P46D 1RURL 4C56A 5L0QC 4PB9L 2P7TA 4WFED 2H8PB 1EAJA 2GW5A 4NZJA 5EUOF 2EIDA 1VGEL 1ZTXL 4N0CC 1I7ZA 3VXRD 3LCYA 1L7IL 3S8WA 5I30L 1DTUA 4IRJC 4LSVH 1F2XK 4JHBA 1NGZB 3C60D 4KGJA 5FYLE 1P9MC 3QUXC 5HGAB 3RBSA 1JGDA 3SCMA 4K3DH 5IVNA 3S7GA 4JFED 3SHSA 1TMCB 1F4WH 4UIKL 4LCYB 4LSTH 1QLFA 5ITBL 1HEZA 3JWDC 3BIKA 1C1EH 5CILH 3P0VH 4L4JA 4WTXA 3NPZB 5F1KC 3GSQA 1KXQE 5FV2A 2VDOL 3C8KB 3WKML 5DJCB 2W9EH 5JW4M 3RQ3A 1CXEA 3GZKA 2W60B 1RJYA 4XRCB 1CGTA 1A8JH 1RK0A 1WJ3A 1G9EA 4I48B 3IVKA 5DUPL 2M8XA 1RZGB 5DJ2A 5F93C 3WNNA 3ZT7A 3VXUE 4XVUD 3FB5B 5D6DA 1JGEA 1QQDB 5D7JD 3QQ4B 5DT1H 4DUWA 5C6WH 2BY3A 3X14B 4KZDL 2HRPL 3WS6A 5HGDA 1CFQA 3GMLB 3IJYA 3RY6C 4YHIB 5DR5L 5GRXG 1JHTA 2VAAB 1BJ1H 4JDTL 4P49A 4GQ9L 3MLXL 4NQCB 1IKNC 4OZGB 3DGCR 4NWUH 4U1JB 3C5ZD 3IFLH 4LPCA 4OLWH 5IHZB 4BUGA 5C0CD 3RIAF 1RVFH 1QBAA 3T0WA 5TDPA 2ZUUA 4MCZA 5GS1C 4YDLC 1OCWL 2W9DH 4FMKA 3U0WL 1I1AD 5KANI 4Y7MA 4X4YA 1A7BA 3EDEA 4NNPH 1ZVSA 3PE9A 4HT1H 2BVYA 3QHFL 4Y4HB 5AYQA 3GHEH 2VWEC 2XQYG 3W9EB 4JQVC 4H1LH 5FO8A 2VE6A 2JJVA 3DIFA 4Z7UB 3TH4T 2J8UF 1QO3A 2VDOH 1PYWA 1GGIL 2CR6A 1YEKH 4LSUL 5T5NF 3UC0L 3U9PH 4LIQH 4EOWL 5J06A 4OFVA 1CD8A 1GC1L 5ACZA 3CIQA 1WCBA 4KUZL 3MQIA 2AEWA 3EUUA 4E42B 2X4PA 3K2UL 2Q8BH 1SYSB 4Z7VA 4LBEA 3I50H 2BMKB 4I5BB 2UYLA 4EIGB 5MENB 2E27H 2VABA 3KLSA 4K94H 4FQXA 4RZCA 4GS7B 4NO3A 5T1LB 1ZLSL 4F37F 4WNQA 4I5BA 2YD6A 3VFVB 3ARFB 1VEPA 1WEJH 4K2UH 1U41A 4G6KH 3WS6C 3VW3H 1QEWA 5JXED 2IPUG 3JV4B 3ULVE 3IAGC 5CJXA 4ZUVA 5LGHL 3BMVA 5CINL 5EBWB 3WLBB 3ARUA 1T0MA 5DQDH 2W65A 2HH0H 4M7ZC 1NLDL 1Y6KR 1QVOA 1ZA3B 5DHXB 1KELH 1I8IB 3C9NA 5DMKA 2VDRL 3QIBB 1CFVH 4WWKC 4FTVD 4R4BB 3L7FA 4M1CC 4Y5XC 1NMBH 2VQ1B 4TTDD 4ZTOH 5EZLA 2YUZA 2O93L 5BVJB 3P3YA 2F58L 1FNSL 3DX6B 4QXTA 2XWBA 3QQ3B 3DGGA 1VFAA 3HG1D 3OB0H 5FKAB 4ZG1A 3MRBB 4JJ5A 2Y36L 2NY2B 2B0SH 4K71C 2P46B 5B3NA 3MBXL 2X4OA 4Y4KD 1QSFA 3GSOA 2JB5H 4FTVE 2IJ0C 4X6BB 1U58B 4S1DD 3MYZA 3QEQE 3MV11 3QZWG 4XCFH 5LBSL 3QR2A 2DKUA 1WFNA 4Z7UA 3MREA 3OMZA 5HI4D 5D96B 2DQEH 3HKFA 4EQ2A 2PW1B 4H25B 3RP1A 2HT2D 1IGCL 5CCKL 1GGTA 4UT9L 4DTGL 1HI6B 4AEIH 4EVNA 3ZE1E 2V5SA 2R0ZL 5I1CL 5C1MB 2P47B 2WQ8A 8CGTA 3V5KB 1MFDL 2MKLC 2NNAB 2VIRB 3J7HA 1V7NL 1CDHA 5EOCH 1BFVL 3O3UN 3T4AB 2AKRA 2V2WA 4NDMA 1FIGH 2DYPD 4UIMB 3QIWD 3MRHB 1QSFD 5DK2B 2R0LH 5H35A 2LAAA 3DMMB 2ILLA 1PSKH 4X5XB 4HV8B 3D0LB 5MHSD 3B8YA 1D5XA 3C5ZC 3Q6GH 5DFWH 2J88L 2EKSB 2NY3C 2X1XR 5HYJB 2KQNA 4MZ3A 1WQVT 1BBJB 3QUYA 4JKMA 3NACH 1CICA 3TT3L 4HG4K 3LQZB 4EDWH 4WO4A 1ZEAH 3QCUL 1KENL 3NPSC 4G9FD 4X83A 3TO2A 1G6RA 2ICWI 1N5YL 1D5BA 2P5WE 1DVFD 4FMFA 4HUNB 1KG0B 3W2DH 1ED3A 1ZSDA 3BSZL 2HJLB 1FO0H 3S97C 1TETL 5H37G 3KXFE 2L7UA 3BVNA 3QXVA 4XCFL 2Q87A 3SQBA 4YLQT 1BIIA 5BS0D 4G80A 4JR9H 1QSVA 1FDLL 1A9BA 4DOHB 1MFAL 35C8L 4I0KA 5ACMA 5BRZB 1JPTL 5C0CE 2H3NB 1U92A 2VTFA 1BEYL 5A3IC 3MCG1 4X4MA 2B1HH 4MQ7A 5FYJL 4AJ0A 5EA0L 3ILQD 3QULA 1MJ7L 2WBKA 4U1GB 2Q1EA 4L8CB 4GXUM 1SYVB 5C0RH 3EZ8A 1MCPH 2YD5A 3S6CA 4HZAA 3S36X 1I8LA 5IR1A 1RHFA 4LDLB 3E3QC 3QUXD 2IMNA 2FNBA 1ORQA 3B6SB 3HE7B 2NQCA 3WNOA 2ZSWB 4TRPH 1DQMH 2PXYB 3GSNB 1BJ1J 4O5LH 4EJ1C 3U1SH 5KSUA 1PEWA 4YHYC 1MQKL 5MENA 1HNFA 2WBJD 5JLZA 2AK4A 1NPUA 2VKWA 1GPOL 5T3XD 4ACPA 1YMMB 2XIDA 4R96A 2V5RA 1ZANL 1FNLA 3T2PA 4GW1B 2MNUA 4JFDB 3RX8A 4GG6A 3GBLA 4CN6A 5BXFA 5F6IB 1QFWM 4KV5E 1OPGH 2PYFB 3H9SD 4OQ1A 3K4DA 4RMVA 1LK2B 4UTBH 1MHPH 4CVZB 2ORBH 2WWMC 4PV8A 1J1OH 5FYKE 5D7IF 3BP6B 3D9AH 3S5LB 5D7LB 3SE9L 1ND0B 2I26N 5C0NC 3IXAA 4MS8C 2X4QB 2IAMC 3KG5A 5L6YL 5E2TL 4LCUA 5F3BB 5EUOE 5IMLA 1HKLL 1DLHB 3LEVH 2LFGA 1S7UA 4XP4H 2J3SA 3PHOB 2FGWH 4ODHL 1RIVL 4N0UE 1FYTA 3I85A 2B20A 2DBLH 1UM5H 4OB5H 4XCEB 3CSYB 4Z77B 4XC1H 5HHMB 2WMPA 5BVPH 2A0LC 4IRSD 4AIXA 5I1AA 3KPRB 4XVJH 4HUWB 1HHGB 2UV3A 5CHNA 5SWZB 3MV9A 1W0VB 4QF1B 1E6JL 1QPXA 3IETA 3SOBL 3FN0L 4FNLL 4HUUB 1GHFH 3V5HA 3EOTH 1XR9B 4OF6A 3FOMB 1EO7A 1AGBA 5TQ0L 5DMGD 3KJ6H 1AKJB 1F90H 1FYHB 4XPGH 1U92B 1LO2H 3V6OE 2VLRB 2YUWA 3CVHH 3OPZL 2CD0A 4S1RH 3FAXA 3PP3H 4K8RL 4XNMA 5I1KL 2FL5A 4H26B 5INCB 4AT6B 3LRGA 5L2KA 3RWGB 4IRSA 4NCDA 4X4ZA 3QJHB 3VWJD 2XT1B 3IDYC 4YHZL 3H7BA 5MEPB 4AH2B 1NAMB 4L8DA 3QDMB 3UC0H 3QEGL 1G7PB 2R1YA 3LEXA 4LCIH 4U3XA 5ELIA 5F71A 2AJXL 4HJJH 4FHBD 2CJUH 2O5XL 1U95A 4F7MB 1NBVL 4HWEL 2P1YA 3VD4A 1FCCA 3U7WL 5I1DA 2Q7YA 2R9HC 1QFWI 5D2NC 5I75B 3KXFB 3VGGA 5DXWA 2WP3T 3MRMA 4C54A 5J11B 3IDIA 3WFHB 3PP4H 3QIUA 4XMPL 4PJCA 5ICZB 3ARGD 5DEFB 3G08A 4HFUL 1T6VN 5F9OH 4B41A 2AXHA 4PB0H 1K4DB 2R2EA 4RBPH 4YHLL 1E6OL 4I77H 4HXAL 2NYYC 2ITDB 2DL2A 1QACA 3NCEB 5F6HJ 3T1FB 1HIMH 3VXOA 4O2FB 1F4WL 1GZQB 4J4PC 3L1OH 3A0OA 3Q1SL 3T8XB 1B6DA 5F6IC 2XN9E 4U1NB 5JDSB 3G5ZA 3CC5B 1OAZL 2J8UE 1ZHBA 4XMKL 2AW2A 2P43B 5F96L 3VFSA 1FZOA 2PYEB 1U6AL 1V7ML 4X6EA 3VXRB 1RMFH 3S35L 4JRXE 4P4KB 5SWQA 4QOKD 4RRPG 2DQCH 5ICYB 3G6JE 2FH6A 5D7IE 2H45A 1F6LL 3LS5H 3OKNB 3LPWA 1BFVH 2JE8A 4JPWL 1AO7A 4G43B 4YDIH 3RWHA 1MFDH 4FOMA 5HDQH 3EYUH 4NHUA 1BGXH 2BRRL 4GRMA 3WD5L 4PJAB 4J3SA 1KTLA 1FZJB 3FCTA 4EBQH 4NQSA 5HPMA 2JIXA 4OZFH 2GFBA 1HILA 3O6KL 4JEGB 1IEHA 4UTAH 1OAYH 3G6DL 5DO2D 5C08B 5ACLA 4POUB 3RWEB 1EJ6A 2VQTA 2I60H 4I77L 5I1IL 1DBAH 2WIIA 1X4YA 5EBWA 1AH1A 1A9EB 5FAAA 3ZDZE 2IG2L 3L3GB 1FFNA 5IFHL 3OJDA 2R2CA 3DURB 3BDBA 3VA2C 1T1YB 2J1KA 3VXMA 4H1LG 4XCCH 1EAPA 2IF7A 3V0WL 1LEIB 1ZGLB 4LASH 4N5ED 4XP9H 1S7XA 5INDA 4JHAH 1WVZA 2XA3A 1KB5H 1BX2B 3AB0B 3NN8A 1DZBA 3L5IA 1TJIH 4XRCA 1A3LL 1NMCB 1SJEB 1MJUH 2B2XL 3QO0A 4N90E 3CUPA 1U3JA 1A7QL 2C1PB 5L2JA 3HR5B 4ERSH 3SGDI 1IAOA 2B5IC 3QFJD 3PHQA 1IGYA 4LAJH 4ZOEA 1OGAE 2GJZA 6FABH 4D9LL 2C7UA 3C2AL 4DQOH 3JUYA 4FFWD 1U3HD 1F42A 2NY1D 3R0NA 2HVJA 1TZGH 3GKWL 4U0RB 4OFKA 1BLNB 3UDWA 3VFPA 5GXBB 5KSBF 3DMMC 2M26A 1F4YH 3VXNB 2EIZA 4DGIH 1YN6A 1Q9WA 2B4CC 3STBA 1UH3A 5I9QB 4LQFH 4S1SH 3LKNB 3LN9A 5DSCB 4PJIB 1ZT4A 1GIGH 1NMAL 1FNEB 1C5DB 3NZHH 2APBA 4MXWL 1T5WA 2IAND 5D96C 4ENEC 4F7EB 1JRHL 1I1RA 4LLQB 3IS1X 3P77A 4NOFA 1LDSA 2G5RA 3KYAA 2VDRH 4QRRA 2HJKA 4YBLB 1A3RH 2ED7A 5GGTL 3MV8E 4LEOB 3VFUA 3D9AL 4X6DF 2PO6D 4G5ZL 4N9GA 1EEYB 2Y72A 1JV5A 1JVKA 4O4YH 3QFDB 2CMRL 3IJHA 4N0YL 5DLMH 1QLEL 1LO0H 3HZMB 5DEGB 4HLZG 5DRZA 1GPOH 4Y16C 3ZTNL 5KW9H 4GSDH 5HGHB 1ZT1A 1SBBA 1H9VA 1S9WB 4JLRA 4GMSL 2VLME 3GSQB 1NBZB 2VOTA 3KPPB 4K94L 4QRRD 2EXWD 4Y1AE 5GGSY 1J8KA 3AMLA 4Y2DA 3X3GL 4QRUA 1T22B 1IZJA 3KPOA 2D3VA 5EUOB 3GSWA 3MRKB 4WTZG 2H26B 3K7UA 2FWOB 3D39B 4E41A 4LIQL 4EOWH 3UTSE 4LARL 1IC4H 4I2XE 2QJDA 4NFDA 3WYRA 2JCCE 5K9OB 3LV3A 4PJAF 3LKPA 5KAQG 4MSWA 1IAOB 3FO9A 4NN5B 3B2VH 3B5HA 3MRGB 5IQ9A 2KH2B 3WUZA 2BVEA 5JUEH 3S35X 4JGJA 2A6KA 4RGNE 3GB7B 1H0DA 1N0XL 1CFTA 1NJ9A 4PJ9D 1MCDA 3AVEA 4RMRA 1MWAL 4X80L 1A3LH 1XR8B 1IFHL 5T3ZD 3SKOB 1LEKB 4XNYH 1CIDA 1QR4A 1KB5L 1XEDA 5DF0A 1F6AA 4HFWB 2A9NH 3S34L 2O61A 5K9JH 1J0JA 4GRWF 4P5KB 4KQ3H 5HHQB 1SY6H 4LNVA 4ELKB 3L6FA 1TFHA 5BW7C 1P4BH 3QIWC 1UVQA 5E94B 3MX0A 1SMOA 4FABL 4YDLB 4JFQA 2DQCL 5FGCE 3RU8L 1NCAL 3F5WA 3WL9A 5E08L 4ODSL 2Y5TB 1H3PL 3D3VD 4M93B 3VDCA 3C6SB 4TUOA 4WW2F 4XMLH 1XF4B 2YR3A 5GS1B 1J1XH 3KLHD 1CLOH 1JZ5A 2B5IB 5D7IA 3CJJA 1U8OA 4C59B 2NY0D 2I9TA 2FB4L 2D0GA 2DM3A 3BPLC 1RK1B 3QUZB 2Y06H 4OIBA 4Y16A 5HHNB 3QG6B 2R1WA 5D5ME 4QHKJ 3TA3C 4DJMA 4NKOB 3PHSA 3QJFB 3QNZA 1T03L 5KZCD 1R24B 3VWKA 3RZCB 2W0LA 2AK1H 5GRJH 4XP6H 5DK2A 4PRHD 3CUPB 3I6LE 5ID1A 3TGXA 4CU8A 1HWGB 1BVKB 2VQUA 3RKDD 3RPIA 4X9BA 1HH6A 3WIHH 2BNRD 4UQ2A 2BNQE 3D3VA 3T2OA 1YEJH 4XHJC 1IEBB 2CUMA 3EIFA 5LJYH 5MEQB 2AJYH 4HS3A 3QCVL 2YOCA 3Q3GA 3CPLB 3TO4B 1S5HA 4ZFGH 1HHKB 4PP2B 2EDEA 4ZOBA 3L7EB 5EBMB 1UB5A 2Y5EA 3MV8D 4HJJL 1OP3H 1NCDL 4P9MH 4MNGB 3BXNA 3V5DA 2A2QT 1QSZA 4L4VD 1JNNH 3CPLA 1H5BC 2V2XA 3GSXA 4KI1A 5IEKA 5ICYA 1U58A 2FSEA 4HEME 1IM9D 1JPGA 4LP4A 4NPYB 4OSUL 3IDMA 1AGFB 5D7SH 4ZFOL 5IVXF 4LBEB 2HG5A 1IKNA 3HC4L 5AZ2L 4PJ7A 3R1GH 5B38A 4H8WH 5AG8A 4IJ3C 2UVEA 2BDNL 1PX3A 2P8MB 3LN5A 1H3UA 3MZGB 1DBKH 1VPOL 1ZHLA 2VZSA 1OARH 3GIZL 2WBJA 2HKHH 2HJFB 4K3HA 1JMXA 1T7XA 1FL3B 5FUZL 4BFIA 1E6JH 4MQXD 3SOBH 4M7JL 1FNSH 4Y4HA 2VB5A 3K0WA 1HQRA 2BVQB 4XI5D 2QSCL 3O3AB 4PG2A 1QRNE 2NY0C 3L3IB 1FAIH 1G84A 2VLJE 1WBXB 3SGDH 3QRGH 1QVOB 3KLHC 1OL0A 3CNKA 1Q94A 2X2YA 3K3QA 4LGPB 3I50L 4PD4J 1RHHA 3WFEL 5DQDL 4GQPH 3K2UH 4IS6B 4KTEL 4QF1A 1RZJH 5DUML 5I16A 1TJGL 4D8PA 1BF2A 5E8PA 5F88A 1FAIL 1NL0H 3U9UA 4TOYL 3VJ6A 4J12A 1BFOB 3JWOC 1QHOA 4O2EA 1NFKA 1CR9L 4MJIE 5D2NB 3VWKB 1B0GB 3MO1B 4TUJB 2DAVA 2WW8A 4M5ZL 2OZ4A 3S5LA 4O02H 3LV3B 3GJEA 2UVFA 1HOCA 1WTLA 4GO6B 3T1FA 2IGFH 4WDIB 5KVFH 5KS9E 1JHLH 3NZ8A 1G0XA 1W72L 1HHKA 4PP2A 3TBVA 4X99B 43C9B 2VXUL 4U6YB 3TJHC 3DX9B 1YYLL 5DK0A 3WSQH 3AM8C 5GS0D 5C9KA 3BQUB 5GZND 1NEUA 2X09A 2BRQA 3I3BA 4DZ8A 3F7QA 3OXRA 4AIOA 3S36L 3FQTB 3UTTB 1W0VA 1AD9A 4FFYH 1WK0A 4PJ5E 3QAZB 5CHNB 3L3JB 3QDMD 1KPRA 1A1NA 5IFJB 3ULVF 4WFFD 3GSNH 5HDBF 5HHME 4GXUN 1HINL 5JPNA 3DO7A 3VD3A 2OTUA 4N9GB 1KPVB 3Q2CA 3AREC 2HKFL 1KCRH 4BQ8A 4Z78A 5HJ3A 2EXWC 3PQYE 1AI1H 4OUOA 1ACYL 4YJZL 1K5NB 3KPMB 1R3HA 4UNTA 4BK4A 4X4XA 5J6HB 3MRRA 1A4JA 4IRJD 4OZ4B 1LE5A 1B6UA 4LDEB 5DRNB 5K9QG 1T0NB 3MRDB 5CZVH 5EU4A 1IC5H 2N56A 1EEQA 5DD1L 4HMDA 4GMTL 4JO2H 3F62A 3IDGB 5E03A 5MERA 3CFKA 4Z7UF 1J1PH 4KK5D 1UYWH 3LS4L 3REWA 5DRWA 5HYSB 5C6PB 2DQDL 3WN5A 1LO5B 5I8EB 3D2UB 4M7JH 1V7MH 5DYOB 4K23L 3RRQA 1R0AL 3VG9B 4YH6A 3SDXA 3BW9B 4OAWB 1FJ1A 4MNHA 1FL6A 3D18A 4LSQH 5I1HL 5I76A 2BOCA 2VDQL 3F12A 2E6QA 3BW9A 4XP1H 1IGJA 1MI5B 2FR4B 3QZWA 1CDUA 2KL6A 4M6NL 4M4RA 3VXSD 4HPOH 3ROLB 2H2PC 3DX9A 1F6AB 3LDBC 2FL5B 2OBGA 2FJGB 1A6VL 5EIVA 1NUGA 3B9KA 5D1XB 1BBDH 2XZQL 2UY7A 2YA0A 2XN9B 1A7NL 2BSSB 2YHGA 5DJ8B 2RFXA 3FB8B 1XGQB 1IBGH 2HFFA 4DKFL 4HQQL 3ARGA 3MUJA 4K3EL 4TQEH 1CXIA 4JQIL 1JPFB 4F3FA 5C86A 4PUBL 3OKEA 5DHVA 1KJVB 2JELL 3NH7L 1A7NH 2RBLA 4LGSB 3MJ9L 4R2GB 3G5VA 2VITB 2YMXL 4AEIL 1P84K 15C8L 1BFTA 4OCNC 4XXCA 3B5GA 3FT4B 1HN1A 1RZIA 4P23C 4FP8L 1IAIL 2EE9A 5AG9A 2CLRB 4NJ9L 1A5FL 2E7LC 5I73B 2E9BA 2XG5A 2RIKA 3TNNB 4KK9C 3BESR 4L8SA 4LF3B 5F1NA 1UQSA 4V1DB 4D9QD 2E9JA 4JY4A 3RKPA 4L9DA 5JOPE 1RD6A 5EULV 4KUCF 3FRUB 5ESAB 2O5ZH 4O4YL 3ISWA 5TPWH 3UBXB 4K23H 2PYFA 3JV4A 4P57A 3C6LC 1YNTB 3BUYA 2NW3A 4FABH 5HHXH 5IB2A 1NMBL 2R0KH 3JTTB 1TIUA 3OAYH 4P9HC 4LHUB 5K9QI 3QXAB 1ZHBB 2DQGL 4MQXC 1RZ8B 4Z7WA 3QEUB 4BZ1L 1MLBA 3MRCA 1YJDC 3MRPA 1S78C 3SCMC 3GSNA 3MV7A 1ZS8B 4UQ3A 1E4JA 1FZJA 1FPTH 4PJXB 3TYGL 3EDFA 4HXAH 4LLYA 3BT2H 4P46B 3O6LH 3MLYL 1S7QA 4WUUE 3SGKC 1IGIL 5C0IB 4JN2B 2DMCA 1ZT4B 4S0TD 2CPCA 3V4UL 3G5XB 1DBBH 1RIHH 3RI5F 2LE9A 4MQ7B 5BZWB 1DJSA 4I2XB 2R4SL 2H3NA 4MJIB 4M7KH 1XAUA 5D5MF 2DJSA 1YMME 3QI9C 1TVBA 1RY7B 3O3AA 2AJZB 2FX8H 3C08H 3U7YH 3F7RA 5KS9B 4JDTH 2I9LA 4NC0B 3O41A 4QXGH 2VITA 3AS0A 1ITBB 4K8RH 5I1KH 2FO4B 2N1KA 1WBZA 4A2LA 5CEYB 5HPOA 4JFXA 5E1AB 3MXWL 3GI8L 5MHSE 2FIKB 2HWZH 5E8NA 4NM8L 1OTTC 4PBXA 2ADJB 5KW9L 3RDTC 4BELD 4LQ1A 3BKYH 3VFSB 4PIRF 1CLCA 3ARDD 4LNRB 3SKJH 2A77H 1S5IL 3AREA 1ETZA 3IT8D 5TPWL 3MA9H 5DTFA 1DN0B 5CP3H 3FFCB 2LU7A 3G08B 2X9YA 1N2RA 1R5WA 1A64A 3MMEA 3DX7B 4HS8L 1MOEA 3GK8H 3L5WB 5DEZA 4LCWD 3UBXA 5EWIL 1MPAL 1LQSR 3L3OB 1SBSH 2ITDA 3WKNA 3C5ZA 4P2OB 3QEQD 5C0CA 2JIXB 4WUUD 4KROD 1WUNT 4PRDB 5MI0C 3EDKA 2CLZB 1CICC 4KJPD 4M1DH 4ZS6C 4KAQL 2FHBA 5D93C 1EHLL 4NN6B 4Y5VA 3NA4A 1UWEH 2BC4A 2UZYB 2DM2A 3TWCL 4MHHG 1KCKA 5D7IB 1DQJA 2FEEI 1PW3A 1ZGLP 4ZS7H 4YFDB 2OSLA 4JZNB 1CU4L 2FJHA 4WI3A 2MJWA 5KOMC 1VPOH 2A83A 4I8DA 5F7UA 4RRPA 2EDYA 1AGDA 1LP9F 1K8DB 5CD3A 4PRAB 3U4EB 3O3BA 4JAMB 4ZTPH 5DWUH 3SO3B 3HHRB 1SMAA 4CW1A 5DHVB 4MLIA 2I5YL 4XNQA 5C6TH 5DJ0B 2GSGA 5TDPB 4TUKH 1CK0H 1LEGA 5CJXC 4NDMB 2DD8H 1G9NC 2IFFL 3WL9B 5EORH 1NGPL 1XGPB 1K6QH 3HE6D 3BP4A 3CVHB 4U1IB 2J8UA 4FG6D 1FSKC 4JFEA 1AXSA 1ZA3A 4PGDB 4ZPVA 2XG4A 4ZUTB 5J89A 3PWNB 1WV7T 3E6HA 5I1HH 2D7TH 2D4DA 4PJXE 4NP4L 3WJLC 3HMXA 2DJUA 5ERWB 4K7PH 2EECA 3SDDD 1OSZB 2YD7A 3TESA 1FYTB 4QRPD 5FKPA 3QNZB 5HI3D 5GGSA 3A6BH 4L29A 4OLUL 3QQ4A 4KMTH 4IOIB 5GS2D 1NCWL 1G7MA 2WUCL 3EDDA 2YPLA 3HMXH 1J7VR 5J1TC 1OAYL 1T1ZB 4BH7B 3H2WA 4TULL 5H8DA 4NC2B 3FN9A 3ARBA 3C5JA 4OZIE 4HC1L 2R0WH 5FGBA 3ME0A 3MRIB 5I2IB 1LE9A 1BWMA 1RPQA 3VXSE 4RFNC 5H94A 4O58L 4QHUA 2J5LC 1CLOL 5GGRY 4OIAA 3IF1B 4I3RL 1S7RA 5FXCH 5L2KE 4QRSB 2ZKHL 4CU6A 2PYEE 1ORQB 3IETB 4LP5A 5HDBE 5LAXA 4HW6A 3RGVA 1ZT7B 5JMOC 3LS4H 2F9BT 3NPSB 3NCCB 1FHGA 4Q2ZA 2DQDH 1EX0A 3IFOA 3VXQB 1F8TH 1KLFA 5L88L 1LNUB 4NQCE 1MHCA 4MD4A 3V0AC 3MRHA 5HY9A 3CXDH 5IT2L 3Q5TA 1F45A 4F7EA 2W9LA 1YEGL 3RWHB 1TDQA 4XX1G 4LPTA 1MHHA 2X4TA 4LLVB 3DETC 5KVDH 3DVNA 1EMTL 1MCBA 1O5DT 1XIWC 2F53D 1XGPA 4QXWA 1EBPA 1P2CA 3FOLA 2HVJB 3N85L 1L7TL 3EBAA 4ODWB 4Z7WF 4MAYA 4OGZA 4NWTL 3WLWD 5JW3L 1UXWB 2VZ3A 1HK6A 2H9GA 1YN6B 1RZGA 4BFBD 4HBCL 4XAWL 1KNOB 2YS4A 1D6EA 1FVEB 1AKJD 4Z7OF 5KSVA 4PYGA 1T89A 4X9HA 5HVGB 5A16A 4BUHA 4P2RB 3U36A 1C5DA 1RJZB 1YMMA 3THMH 3GEWB 4FFYL 4OM0H 1Q38A 3DO3A 4IMKC 3QDHA 4HD9A 5GGTH 3GHBH 2VWEE 3X3GH 4DUXA 3NOIA 3C09B 2QADD 1TVHB 1I8LC 4F9LA 5L2JB 4WFFE 2V7NB 4U1JA 4D0DB 1TQCB 2VJXA 3PGFL 4QNPE 1NLDH 1WT5C 2MHAB 2GEEA 4MDIA 4I4WB 2DWDA 5FV1L 4KDTA 1CVSC 2GJZB 4D9RE 1TPXB 2R4SH 5JORB 5GSRA 2CO6B 2QHLA 3LQZA 3L5HA 4TTDC 2EXYC 1SEBA 1R5VB 5JIKA 1ZXQA 5CGTA 2LU3A 5DK3A 5CSBA 1MY5A 2Z8RA 3WNLA 1MJJA 1T7VA 4PRPD 4PJBA 2IPKA 2Z31C 3DVIA 3JWOL 1AFVH 3UBXG 3LQAL 3F58H 1XF1A 2IBZY 3MACH 1SYSA 4Z7VB 3NCMA 1SJHA 4Y4KA 1T5WB 3UJTL 1ZHLB 4YHKL 4CJ0A 2E7CA 4YAQB 2Q8BL 2WBJB 3DURA 3KPNB 3QH3B 4XHJD 2EE3A 3CXDL 5IT2H 1Z2KA 4XNXH 5IF0B 1ADQA 3STZA 4ODXA 4Y4FC 3O4OC 5EOQH 2ICEA 4JB9L 4NSKB 1XR9A 3ZDXE 1QR1B 2ADIA 4U6XA 4GFTB 4JRYB 5I30H 3OKLB 3VRJB 5C8JA 5HYSG 2DBJA 3TNMB 4Z18A 2ZSVA 4LCCB 4WFGD 3TA3D 1LD9A 3NCJH 1P7QD 2JCCF 3NFPB 4MJ6B 2PTTB 5D72H 3ZE2E 4GKNA 1P5UA 1NUFA 4J3OC 3DV4A 2W65B 4AH2A 3V5DB 4PP1C 1GGYA 4ZUVB 3HB3C 1D5MB 1KB5B 5EZJA 2UWEF 3U0PA 2E9IA 2NPLX 3CC5A 1I7RB 4IHOA 4NRZB 1GC1C 4JN2A 1Q9KB 4YXLL 5DVNA 5FA4A 5FM5O 3VXRA 5A40E 2AQ1A 3GUTB 3O3EA 2VQ1A 1HXYA 2PYEA 4PGCA 4KFZC 2DQEL 5I8KL 1M05B 3C60A 5FUCE 1OP3K 3KPTA 3M07A 3WD5H 5SWSA 4D3CL 3U4BL 3IJSA 2MOVA 3RL2B 1M7IA 4P57B 1F3DH 2W38A 4ORGA 3F7VA 4LRNH 1S7TB 3AMKA 1PYWB 3HI1A 2LABA 4LSQL 4ODUA 4ZNEA 5E9DE 2ZCKL 4MD0A 4BZYA 4P59L 4JO3L 1KN4L 4XCYA 3QQ9C 4JFXB 4RNRB 3FT3A 3O11A 2X9WA 4C58B 1A6VH 2QSQA 5E00B 3RBGA 4PR5A 1CG9B 5EG6C 1U8MA 2Z31A 1YEFL 3AS1A 1U3HB 1L9MA 3MFFB 5B38G 5I8OL 2VMFA 2VR4A 4M6AA 4N1HB 4ZUWA 1Q8MA 5SWQB 2YPVL 4XBPB 4JVWA 3UJIL 2H2PD 5IHZA 2VYRE 3CK0H 5BV7L 3MUZ1 1C7SA 4KJYA 1W0WA 1KFAL 1RZ7H 2R69L 5E8DL 5F9OL 1KJMA 1EEYA 1E4KA 4H1LB 5K59F 3L3HA 1ZWIA 3I02A 4YUEH 1C08A 5E2UL 4QHMB 5HDLA 4DK3A 4M8VA 4YGAB 1D6VH 1PFCA 4KJYB 4J3XA 2PTVA 3ARRA 1C5BL 2C3VB 1BAFH 4RFOH 1XIWB 3TPUA 4Z6AT 4Y16D 4I3SH 4OZFG 5DGRA 3ES6B 1SVZA 2AJXH 3NAAL 1CT8B 4PJCE 4YC2B 1NCCL 3QEGH 4LLWA 5GRVL 3TO2B 4PRHA 4I48A 3IVKB 4UT9H 3TJEH 1D7FA 1CE6B 3B2UC 1KCSL 1JZ6A 2IH1B 1KIRA 3T0DA 2BOBA 1JGEB 2QL1A 2FWOA 3B2UD 1G7QB 4WW2B 2NW3B 4E41B 3VU2A 3S36H 3BEVB 3D18B 1WIUA 2HT3C 3LSOB 5EZIH 5IMMA 4OIIH 32C2A 3L95B 3MBXH 3MRNA 3DUSA 5IMOB 1VERA 5A2IH 5I15H 1M05A 3C60B 3SKJL 5AAWA 4GH7B 4WEMB 4M5ZH 3IU3B 5C08E 3CH1B 5BV7B 3GNMH 4N0YH 5DLML 4L3EE 5IIEB 3KGRA 3U0WH 4DW2L 1VENA 4WW2C 1IGYB 1NBVH 4UOJA 4HZLA 5GS0H 1WZ1H 5DHYA 4NM4H 4JO1L 3D69A 4P2CG 3ZHKA 4QNPF 3OF6A 2H8PA 4QWWC 3MLTB 2DWEB 4L1HA 4PJ8D 3OAZK 1OB1B 4KZDH 2LAGB 5L6YH 1KT2B 1LO2L 2GT9A 1D9KD 1A6TB 4ZFFB 2RJMA 4MNQE 3MLSL 1DEEB 1R6VA 4HV8A 5TH2A 4R90H 4JRYA 2YUXA 2IGFL 4Y19A 4G7VH 5M7QA 3SDAB 3QUML 4B5EA 3AROA 4Z7OE 5F89B 5GS0C 4XVJL 1VEOA 4M7LH 3DX8A 2P49B 3TJHD 5IVXB 4GUPB 1Q0YL 2WINA 3S5LG 5I2IA 5ISZB 1SHMA 2E3VA 5GGUA 4DUVA 1RZJL 1RJLA 2NY5C 3E1F1 3BRFA 4O5LL 2YSSA 4F33A 3KHOA 4UAOB 2VL4A 5EN2B 2YPKB 4PJEF 5C3LD 4NZRL 3MRFB 2HFGH 5LGJA 4WUUA 3O9WA 4NO5B 1FVDB 5DO2C 1Z9OA 2EEBA 1O0VA 1BZQK 5KVGH 4I4WA 3S37H 4U4BA 1N8ZA 2VDLL 4M9PA 1JPGB 1MHPL 4LQFL 4S1SL 1LO5A 2Y1VA 1EO8H 4N0RA 4PTTB 2IANE 4OCYH 1FG9C 5D2NA 5F7EH 5C0CB 3NGBB 3D0LA 1RUKH 2HMIC 1NCUA 3KPLB 1PG7H 4NN6C 3GRWA 3AUVA 3L5XH 4ZFGL 2R4RH 4D9LH 1CICB 5L8JB 5DZOA 2EDQA 2NY6B 4F57H 4RNRA 1MAKA 1RULH 1XT5A 1MQKH 4U1SB 3VFOA 1RZKH 1FVCA 2JLLA 3C2AH 1JTPA 4DQOL 5T3XH 4S1QL 4LU5H 5HYJD 2J2ZA 4LEXL 4W6XB 5E7BA 4JFHD 3WDJA 1DUYB 4KHXH 4EI6B 3IU4L 3TIEB 1MREH 3BIAX 3QFJE 1YEIL 1BGXL 3S4SB 1AXIB 1I4FB 4N90D 4OT1H 1VADA 5ACZB 4KKLC 3OKMA 2R1WB 1YQVL 3MLZH 3OSKA 1NANH 1W72B 3GNML 4HK3J 5C8JB 3RZCD 1J8HE 1S7WA 5C07D 2XI9A 1EH9A 1PZUB 4ODTH 1U6AH 4H0GA 4RMQA 4EN3B 3BZ4A 1R3IH 3LH2L 2DQJL 5E1AA 2X5PA 1CQKA 2GITA 2G9HA 4JDZB 4JO2L 5IB3A 4CMMB 1B2WH 2YBRA 4M6NH 1VEMA 3EO1B 5AYUH 4N8VA 1RZIB 4DVBB 5JXAH 3WIHA 4NT6B 4ONFL 1MVUB 1FFOA 3QP3A 5JDSA 4EDWL 4PG2C 4PJXA 1IM3B 3QDGD 4YHIA 5C3TA 4K7FB 4NFBA 3IDXH 3MGAA 2OL3A 2APTA 4RISH 4Y5VB 1FNHA 2XN9A 3RHWF 2Z0BA 5KSAC 1WTGT 2L4OA 4QY8B 3MNWB 5TQ2L 1E4KC 2EDTA 1G6RL 2VERN 4PJGF 4HKJB 5F96H 1U91A 1S8DA 1JFQL 1JGUL 2WZPD 1QFHA 1FNGA 2CGRH 4MA7H 4I18B 1JL8A 2KUTA 2FX9L 4OT1L 4OKVA 3RPIB 4G8GA 4JRXD 2ZCLH 1I8KA 1YQVH 4FTVA 3QDJE 2BOCB 2XZZA 3WHXA 4PY8J 3JTTA 2NY3B 4OFDA 1R3JA 5E9DD 1E28A 1TZIB 3K74B 5EU3B 3IXAB 1HIML 1QRKA 3MRJA 3C5SA 1MLCA 3FT4A 4MJ2A 1YYMH 4QKXB 3DYPA 3PWPB 5T3ZH 1Q9OB 1L0QA 6CGTA 4MAYB 1I7TA 1QSFB 4OZIB 5F7HA 1QKZL 5BS0A 2A0LD 1SY6A 4GAJH 4IIQC 4GKNB 5HGGS 4BSWA 4MJ4A 5KSVB 2R2BA 4XMPH 2BCKB 5JUEL 2Q7YB 2R2HA 1XMWA 1FG2B 3MXVH 4R0LA 5CIPA 1WC7A 5D70H 5F44A 1IMHC 5DJCA 4TPRL 4HMEA 1EJOH 1KCUL 4LSRH 5T5FH 1IAII 4P2RD 3ZE0E 5IBTH 3PIQA 4U49A 1CDYA 3WFZA 5D7JC 4WHYG 4RGOH 1RFDL 5HHVL 5DUBB 4E9LA 3BZEA 3CMOH 1GCFA 5I6XC 3SKNA 5D9SA 1CFNA 1K3IA 3MGOB 1J05A 1RUQL 4A6YA 2XPGB 1VSCA 4I18C 4JGUA 1BQHA 3IDNA 5TE7H 2H6PA 4UILH 4ZFZA 5IQ7L 4OLVL 5ID0A 1AQDA 1A2YB 4OUUA 2Y07H 4KI5F 3EZJB 1GC1H 5GGRB 1BZ7A 5CINH 5C0DA 2YZ8A 4B50A 3P11L 1FRGL 3WNPA 3DTXB 4LCUB 3O6ML 1BQSA 2EH7L 1KV3A 3DVFA 3B9EA 2GJ6B 1F4AA 3L3JA 1A47A 2W0FB 2OMNA 4A6YL 1HSBA 4CRPA 4NZUL 4OD3H 3EFDH 4DCQB 4YPGA 4PRPE 1DLFL 2F5BH 2W91A 1FFQA 4TVSa 5F8QC 1LE9B 3ZE1F 2IQAB 1NQBA 5BRZD 3WV0A 2R15A 3ZSTA 1MCKA 2R23B 1XF5A 3SGEH 2A74B 4GRLC 4N0CD 1I3VA 4QHUB 4YBHA 3HC4H 1MJUL 1CDCA 2CH8A 4YPGB 1DQTA 4QYOB 1NFIB 5DFTA 5E70A 4XBGA 3D85D 4ERSL 3T65A 1HOCB 3HI1B 4TRPL 3CMOL 2DLIA 1XF5B 3EOYG 1G7HA 4BSVB 4X99A 43C9A 3BISA 3BPNB 4XAKE 4G7YH 2AJ3B 4J7RA 3T3MF 1XGQA 3X3FH 2SEBA 3HZVA 4HIEA 5DZNA 4FQQB 4CN4A 4HLJA 3GUTA 5FYKD 2VSCA 2IPTL 3ULUH 1V3LA 1KLUA 2HP4A 2I07B 2HN7B 4R4NC 2R56H 4XZUB 2AS5M 1I1AB 2Z35B 1KF9B 5AWNH 3VFTA 5IVZB 5J7CC 5EDXA 3DMMD 3MLVH 2FX7L 1S3KH 4KKCC 5E6IA 3X17A 2X1QA 1A7QH 3RVWD 3U82B 1T3FB 4Q6IB 1NBYA 2ESVE 3HAEA 1LEGB 3BFOA 3BOVA 2ADGB 2K3TA 1FGVL 4G8GD 1KPVA 4TNVK 5IV2B 4LSTL 5DQ9B 4HUXA 5FYLL 5IM7B 4FZEH 2KBGA 3RWEA 3TBVB 3MBEB 5DUBA 4Z78B 2D7NA 3Q48A 4BSJA 2KZWA 4KZEH 4YDKH 2W60A 4MB3A 1ZKAA 2FIKA 4U33A 3CFBB 2WANA 2RHEA 3K8LA 4UAOC 4DOHE 1FZKB 4P5TC 3EYOA 4ZYKA 1TPXC 4GAYB 3FHAA 1ES0B 5EU6A 4GRWH 2YN3A 1R0AH 5HI4C 2AJVL 5DSCA 1K8DA 5D5MA 3X13A 4XMKH 1J0IA 2DYPA 5I1IH 1OAZH 3IYLW 3RNQB 3ARDC 3M17B 3FFCE 4OCSL 4EI5C 3TV3H 5DTFB 2R8SL 1HDMA 1A14H 5FO9A 1FV1A 4Z7WB 4TNWF 3GBNL 2XKNB 4X98B 1X4ZA 4MYWB 3S4SG 3SGKA 3VFMA 1YNKL 4NHCH 3AU1B 3KXFD 1JIBA 3RDTB 4HKXA 4X7TB 3UO1L 5E8EB 3PABB 1MFNA 3TV3L 4R7NB 4EUPG 1QLRB 2WWKO 2Z8WC 1DVFA 1KTDA 1A7RL 4EVNB 2NCMA 4ZUTA 4HWNA 3DHJA 1MAMH 1Y0LA 3DHMA 2FIRT 3SE8L 5EU4B 3MYJB 3JWDL 5E7FA 2HTLC 1CD1A 1HNGA 5F9JB 4DKEH 4LF3A 4Y19D 4BK5A 3N50A 1P6AB 3BEWA 4D3CH 5I0ZA 5J13C 4LPUA 1WIPA 3MR9A 5KTEL 1P7KA 1K2DB 3LKSB 2OTWB 5DHVH 3OJ2C 3RVTC 2YBRB 2FH8A 4ONGL 1DE4A 5BV7C 4OLZH 5KVEH 4XPHL 1X5KA 4FFVC 1J0HA 5E8NB 3WO4C 1JHKL 2OTWA 4HF5L 1AR1C 4OFIA 4OZHE 3W0WB 1B0GA 4I0PD 4FQ2L 4EZMA 4XAKD 3DARA 2YD2A 1FN4A 3MBEA 4K9EH 2VKXA 3MLZL 4XCNA 4XPTL 4LOUC 3TIEA 5BO1H 5ADOH 3ARGC 4OCYL 1PKOA 4JE4B 4MGXA 2EE2A 4M43L 4IJ3B 3QIBA 2AERT 4WHCA 5SWZD 3OAYK 1AHWA 3ZKXC 4WUKH 1G9NL 4YK4C 1EIBA 2EDOA 1V3JA 4KRPB 3P4MB 2Y07L 5ESVB 4PJBE 4WTWA 5BZWA 4Q58C 1UJ3A 4AM0B 1FO0A 3KWWB 5D2NE 4EI5A 5FGRA 3WIIL 1BQLL 1F3RB 1U8HA 3OJMB 3QPQD 4RSVA 3B8SA 3ESVF 3VWJC 3SDAD 1P4IH 4F58H 4E41E 2XKNA 4NC1C 4PJCF 4NZUH 1EEZA 4OD3L 5AEAA 5E8EA 1A3QA 5B39B 3MRCB 1AD0A 5J12C 2AEQL 5GSVA 5IB1B 2H9GB 4PBVC 1QP1A 1XGUB 2AI0L 5M95B 1UM5L 4OB5L 5FOBB 3U36B 1A22B 1P7HL 4R9HA 3RZCA 2VZOA 3QJFA 2V9QA 1KIPB 4P2QA 4CMHB 1T0NA 3MRDA 3QUYC 2CIIA 5DEGA 4YFLF 4IRSC 4F15C 2P5EA 1JRHH 4P5KA 2X6MA 5L9DL 1YYML 4P2RE 3SDCC 4LSUH 3W39A 3OKEB 3VDBA 4JFPA 4NBZB 3UTSB 4P9HL 1WZ1L 2H6PB 1CZ8L 4XH2B 5HYSA 1UB5B 4PLKC 5FIEA 3CFDB 1S5HB 5I1JH 1A6ZB 3I6KB 4P2OD 2ZUSA 1MLBB 3TVMC 5IEHB 1WGOA 4NQVA 1UH2A 2P8PB 3KPRA 2KKQA 1YMMD 4NUJA 2KQMA 4XP5L 3MJ8B 4Q6IC 1KN2L 4XNUL 4L8BB 2Q76A 2H32H 5ANMA 1I3GH 2AVGA 2GKIA 3O8XD 4QT5A 3O6LL 2FR4A 4PJAE 1N5YH 3QDJD 1S9XB 2HRPH 4AIZA 2GY7B 4ONFH 3Q6FB 1OM3L 2DQTH 3CFEB 1X6NA 2C3WA 3NIGF 5GS0L 1B0RA 4U7SA 4CVXB 2HFEA 4JY6A 4NRYB 2WSKA 4R7NA 3RNKB 3W11C 4X7EC 1U36A 1MI5D 2J88H 2NY2C 5ALBH 1VGEH 4DAGH 1TCRB 3O4OB 3RWIB 5CSZB 4X7DC 4YR6A 4O58H 4X4XB 4HJGA 2CKBA 5J6HA 3NFSH 3MLYH 4NNYA 2VLJB 5CLWA 1YEIH 1GGBL 3HN3A 4RCAA 1J5OL 2XWTB 3AREB 5JXAL 3IDGA 4KGLA 2E6JA 4GRLD 2W0FA 4UINL 1IGTB 1WC7B 3UYPA 3BH8B 4JZOB 4DGYL 3QYCA 4JPWH 3V6BR 2EO9A 3PV6B 3VFRA 1INQB 4LPWA 4FQPA 3GRWL 1N6QL 1RQ5A 3PIQB 1I9EA 1DVFC 5CEZH 2IC2A 3ELAT 3PDDA 1JPST 2ZJSL 3O6FC 5IKCB 2YD8A 4HGWB 2HJFA 4Q97A 4PFEA 2P24A 4JVUA 4N8CL 4H1LA 1A6ZA 4K7PL 5D7JB 4HIIB 4XPFL 3WCYA 1VDGA 2E8ZA 2AJYL 3EYFA 3EO1A 5EOCL 3IB4A 1KC5H 4K7PY 1C5CL 1HXMA 2CXKA 3T1WA 1WBXA 4WFEE 4J2XA 3E2HB 3RX7A 2Q86B 5CMAB 3OKOA 4PR5B 1ED3B 4PJIA 1A4KB 4FQJH 4KI5E 1LDPL 1RI8A 3MODL 4GT7A 1J86A 1BREA 4G80B 4QXTB 5TJWK 1BIIB 4KAQH 5GJSL 4HPOL 5E5MA 3MLPA 3V95A 3VWKC 1X4XA 2FRGP 1J5OH 1KELL 2NW2B 1WAAF 3VXPB 1GGBH 3CX5K 4UMGA 2X05A 1MCJA 3GMOA 4DVRH 3GK8L 3PF2A 1OAQH 1M7IB 1VADB 4KRPC 5EU3A 3PG2A 4UOW1 3ULUD 3CFEA 5SX4I 3TBYA 2N7BA 1YPZA 4S1DC 3FQNB 3IGAB 2OJZL 5I74B 1OVZA 4Y4KC 5JHDE 2DLTA 4M3KB 1AGEB 5ILTL 1NMCC 1T21A 5DC4B 3HPLB 5IBLC 5CJQL 4OLYL 3TT1H 3PWLA 1EZVY 4Y2OA 4PG9B 3HUJF 5HD8C 1CDJA 5BZDB 1RUMH 2CUIA 2ZWLT 5DMYA 4ZD3L 1T6WA 3BQUD 1MAJA 3F58L 3JV0A 4ZDHA 2HYMA 1XF2A 1MPAH 2BMKA 4V1DA 1W0WB 2R29L 4JFPB 4WI2A 4YXKL 4NRXB 4HS8H 3UTSA 5LKNA 3QIUB 1ACYH 4GKZA 5HHPB 4XXDA 4A6YH 3WIFA 1N5AB 1U8PB 3LIZH 5TF1L 2C3HA 2EDWA 3DGGB 3CLEH 3F6LA 5KSBA 4HEPG 3UJJH 4NIKB 1DR9A 4YZFF 3EJYD 5CEZE 4XC1L 1FH5H 1UA6L 4AL8H 3LB6D 3UPRB 3FMGH 1IC4L 5E99H 2FZ3A 2QHRL 4U05A 4ZUUA 5BOZG 3GI9H 3BPOB 1IKFH 1NFDE 4NCC1 4P9HH 1M71B 2OJEB 5EO0A 3RKDC 3LKOB 2J12B 3RWCA 4D94A 2YWZA 4Q0XH 2RFXB 2BERA 3BXNB 2D7PA 1KT2A 1W2KT 2PXYD 4JVPA 2AP2A 2Z91B 5ICXA 4JREC 3HG1B 1DBMH 1N4XH 1MIML 2HLAA 2BHZA 1FVDA 1QSEA 4H88L 3ARZA 2ERJC 4X6EB 3W82A 1QHPA 3K80A 3MOBL 3G04A 4UB0L 4WWID 5E95B 1K85A 5AD0A 3TIDB 3MUGB 4U1MB 1AJ7H 5D2LF 1JI2A 3MLWH 4HH8A 3VXPA 3BPLB 5F7YC 3RGHA 1IM9A 1FDLH 4GBXC 4XTRC 3VD9A 3I75A 2R69H 3AU1A 1MFEL 3DJ9A 4H88H 4X6CE 5INCA 3DSNA 3CMGA 4C57C 3QUZC 3VXUA 5IBLD 4UTAL 1LK3H 3MREB 5C0AB 3FFDA 1FN4B 3VGHA 3HA0A 2X4SB 1QNZL 4FQXD 5EU6B 4DGVL 2V9TA 3LQAC 1S9VB 4FXLA 4NKDA 1N59A 3NAAH 2B1AL 4H0IA 5FDYA 5AUMA 1G7IA 2DOCA 3Q5OA 4I3SL 1C8PA 1TQBC 4Y89A 3RPKA 2AGJL 2CR3A 3L3DB 2YMXH 1HDMB 3P2TA 1M4KA 2E5EA 3QHTC 2DQHH 2AJSH 1MFAH 1F4YL 4DGIL 1JPFA 4F3FB 2V7HB 4EQ3A 4OZIF 3CLEL 3SY0A 1QRND 4XVUC 2BNRB 2C3VA 3BWAA 1QFOA 3O4LD 4HK0B 5CP7B 4IMLA 2FJFB 2ERJB 4NQCA 1EMTH 5DVKA 5IM7A 4U1KB 5FHBL 3CFBA 4NO2A 1Z0MA 3NCYS 4N8VG 1RUML 2HVKA 2WAHA 2MPAH 4ZD3H 5T1LD 2OR9H 5IW6A 2GYSA 2FEDD 3BPOC 1E6OH 4LSDA 1ZHNB 1HHJB 2AXJA 4O00A 1I4FA 4GXVH 2YKLL 3P4NA 2IALB 1UB6A 1KB9J 5KJRL 3TO4D 3D39D 1OWWA 4HIXH 1CTNA 2ZCKH 1MQ8A 4RBPK 5DS8B 3FT2B 4NQDA 3ARWA 4V1DD 1KYOJ 2L0DA 5FO9B 3MFFA 1AY1L 3K81A 2X42A 4HWEH 3HMWH 5I1GH 4LLUA 2NR6C 5IGXL 3RWGA 1CF8L 4DEPB 3OGCB 2YD3A 1FAKT 1HH9B 1ADQL 3QG7H 4FTVB 5DS8A 3M1BB 2KPNA 3N1FC 4Q9QL 4X7FC 1PKQB 2ZUWA 5JOFA 4YX2L 1NGPH 2BNQD 2HTKD 3CXHJ 4AQ1B 1T2QL 5I1DB 1ZWIB 3I02B 4XVSL 3JUZA 3KDMB 2NX5E 2XA8H 3I6LD 4WCYH 4EUPB 3PWNA 1H8SA 2Y23A 1TCMA 3LKQA 3HNSL 5HHOE 5I19L 3GJFH 4WFGE 3JWOH 4YDVA 1RJLB 2NY2D 4EXKA 1CDIA 4TSCL 2GJ6A 4Y8AA 1KUMA 4JM2F 3VFNA 1JGUH 3OAZH 1OY3B 2BOBB 3LD8B 3QXDA 4WV1C 2WP3O 3SKOA 1U3HA 1J8HB 1KACB 2CLVB 5I1LA 1OAXL 1CE6A 5SX5H 4Y2DB 1A6AB 4Y8DC 2DQFA 5ENWB 4OZGA 4NOBA 4GXVL 2DQHL 3CX5J 4Z0XB 2ZJSH 5GGUB 4WI9A 3NIGE 1I8MA 4J6RL 3DRTA 3H3BC 4WWKA 2Y25A 3GMPB 1T20B 3HE6A 1KJMB 3HE7C 4UV4H 1RIVH 4M9OA 4Z7QF 3T08A 2J8HA 2FJFA 3O8XC 1BQHG 4DGVH 5DFVC 1CFNB 3IXTA 5DD1H 5MP6H 3O9WC 3V7AG 2QTEA 1MCEA 2ARJA 4IMLB 3GSRB 4OFPA 3PQYB 1G7LA 2V6HA 5J56B 1MIEL 4ZOAA 2XKSA 5DWUL 3TVMD 2ED9A 3BZDA 3FQUB 1OGAB 2YXMA 3D69B 1JN6B 2VUYA 3PWVA 3O81A 1WEJL 1VFAB 1YUHA 4P5MB 3CZFB 2E6PA 3LRSB 4PJAA 5TDNA 4EXPX 5K59E 1S8DB 1ZVHA 4LPVA 4YEEA 5T1DH 2EYSA 3VRIB 4NM8H 4UDTB 3ARDB 4GRLA 4NQDB 3L5WA 4DFIA 3LSOA 5IMMB 2A6JA 2KDGA 3T4AA 5IR1B 3PWPA 4OGAD 3TBWB 2GUOA 3HI6L 3KYMA 4H5SB 2J5LB 2XKUA 3Q3GB 5L9DH 3DMMA 3GHBL 3UTSD 1BD2D 4RWHA 5CEZD 1SQ2N 4UI2A 4LU5L 4LHUG 5E2JA 3TBTB 1I7ZB 5HYJA 5GGRA 5CUSH 5JLZB 4RQQB 5LCVH 2CIKB 4FQIL 3WSQL 1NAMA 4L8DB 3CFJA 3RGVD 1MEXH 4JFOB 2BSRB 1KXVC 2F5BL 4PV9A 5EU5A 4QRRE 5D1XC 2VLMD 3H9HA 1S7SA 3NN8B 2F53E 4JPKL 3BO8B 3UAJD 5FYKH 1ORSB 2VXTL 2CO7B 4JR9L 1DE4B 3B9AA 4LVHB 4XNQB 5HDOA 1AGBB 1ZE3C 4IRJB 1XGTB 4B7LA 1N8ZB 4H8WC 3PGDA 2Z93A 4QO1A 4F8QA 1KIQA 1HSAA 1FPTL 4BZ1H 4XTRD 2ZG2A 3P9MA 3R06B 5A43C 3QWRA 3WJJA 4DFHA 5MP6L 4GMSH 3TCLA 5TGBA 3ULUF 2PYED 4YPJA 3GSRA 4PBWD 1CXKA 2DIAA 5IBUG 1HSAB 4M6OH 4YNYA 4ETQA 1G7PA 3LEXB 3BKML 4RFOL 3VWJA 1KEGH 1RFDH 5HHVH 4R4FL 4U1SA 1UKTA 4OF5A 4PRDA 1NCDH 4P9ML 1ZLVH 2DMKA 5JA9A 1PSKL 1ZS8A 4UQ3B 5I1AB 1QPPA 1U93B 1XR8A 2VL5A 3S96B 3T2QA 5E00A 5BV7H 3P0YL 5DEFA 4C56D 1UM4H 3T04D 4Z7NF 1WFOA 1EFXD 3M8OL 3VI3E 3LB6C 3VXME 5GJSH 2M2DA 4PPTA 4MNGE 4OLYH 3TT1L 3IU3A 1OD7A 3HAEG 3EAKA 5C9JB 5LXGH 1UWXH 4YHOH 1UWGL 3WUWG 1NCWH 1MNUH 1Y18B 3FOLB 3HUJE 2VE6B 3SPVB 2MTPA 4PJ7F 1IGFH 2EDBA 5EPMB 4M1GH 2CK0L 5JHDB 2Q3AA 1DQLH 4L8SB 5F1NB 1OAXH 2H2SC 3K2MC 1B88A 4HUVA 4KDWA 1Q9LB 5HHNA 4NQTA 3ZT6A 4XPFH 5IFAL 4GS7C 2WNGA 1FGNL 2CUHA 4WUUB 2EDJA 4IHOB 4OIIL 3WO3B 1B3JA 4DN3H 2HAZA 3QWQB 4MD4B 3WIHL 2XWJB 4PJCB 4HCRA 4X6DB 4G43A 4HGWA 3RTQA 3VGDA 4YEFA 1T3FA 1VFBA 4FQLH 2F54D 3BDXA 5GPRA 4HH9A 5D7JA 5ID0B 1SEBB 3MJ9H 2APXA 4IMKA 5IHBA 2HT4D 2EIBA 4TVPE 4XP1L 3V8CA 3U48A 1CCZA 3ZKXB 1H0DB 1FZMB 4C55A 4FS0A 4EI6A 4N1CA 4OJFL 2VDPH 5EBLB 3SJVD 2PXYA 1CU4H 1LEKA 2G2RA 2PN5A 3B6SA 1AHWC 2J6EL 5DFVD 1N6QH 4Q7DA 3EDJA 3T77A 1RJZA 4QRQA 3AB0C 3KYOB 1A6UH 1V7NH 3F65A 4MA8H 3WFBL 3IS0X 3VMNA 3UO1H 1WCBB 3CSBA 1I1FB 4HWUA 2CRZA 1DL7H 3KPOB 1MWAH 3BGFC 3V0VA 3IDIB 5T1KB 4LSSL 3BN9D 4C4KO 4OFYD 3HC3L 3P30L 3E8UH 4UU9B 1I1FA 5C07A 1YY8A 5D7LA 1RULL 2P5ED 5HHOB 2FX7H 1X5LA 3IFNH 4YC2C 3TNNA 1RK0B 1G9MH 2X4PB 3EYSL 3KJ4B 4JFEB 5EPMA 3BKCL 3CLFH 5CP3A 4NRZA 4WY7H 1INEH 5KVGL 4YDKL 5IESL 1JRHI 5D1ZD 5C0DB 3LAFA 1NBYB 4IRZL 5GS2H 3MRQA 3AAZA 3G04B 3VGBA 1EK3A 4OCMC 2N7AA 3BD4A 2PF6A 1LP9A 2AQ2A 4P3WA 1RJCA 4GW4B 4OD2A 5IVXE 1YYLH 5I73C 1EZVX 2HKFH 1U8NA 4ZSOA 5BVJA 1W72H 1AQKH 2XXCB 4HK0A 2X1WL 2VISB 2OP4H 3TH3T 4OI8A 3D25B 5LQBL 2F19H 2X1PA 2XXMB 4Q9CA 2B7DT 2WK2A 4U1KA 4ISVA 1UA6H 3HZYA 2X4QA 4KKAD 4AL8L 3VW3L 1G6RB 2NY3D 1AP2A 4QHNB 5IIEA 1EGJL 2QKIB 4FN0A 2PW2A 1OT1A 2O5ZL 1X3DA 1YJDL 4HJGB 1IGJB 1MI5A 4Z76B 1IGIH 4PS4H 1ZSDB 3TA3B 1FNEA 1QQDA 5C09D 3VXTA 3V2AR 3WXVL 3LKNA 2F53B 3SE4A 2FLRT 3D0VB 1QZ1A 1FE8L 4R26H 3REVA 5B8CC 2DL9A 4AEFA 3OKYA 4OM1L 3QXTA 5DURB 2QV2A 5SX4H 1IILE 1ZLVK 1LMKA 2HT2C 3LMJL 4MXWH 3SBWC 4I18A 3QISA 3B43A 4YE4L 4CGTA 3BH9A 4PYHA 3HCVB 4MNQA 1T04A 4F80A 1YEKL 4JKLA 1YN7A 3H9ZA 1INDL 4ODUB 5EC1A 3WDHA 1LP9E 1X5JA 5DI8A 8FABA 4M7LL 2JJWA 2XFXA 3O2DL 4L9LB 4JJHA 1I85A 4Z7WE 1T04B 4Y0GA 4HCRH 2B4CH 3MJ8A 4OZ4A 1LE5B 3AGVA 2MCG1 1KJ3L 3QIWA 1MEXL 1T2XA 1EEUA 2OP4L 3DECA 3OB8A 5BVPL 3F7PC 5F88B 3VFGL 5CBAB 2EEDA 3SEPA 4RFEB 4YHMH 1DN0A 4IOFC 3GM8A 4HWZB 3UTOA 3EHBC 3KHQA 4MJ5B 3GJFK 5AZ2H 5T3XE 3EYVB 3WUWA 1IM3A 2NY7L 2B2XH 4EN3D 4FFZL 3W39B 2BSTB 5KTEH 1D5MA 5EZJB 4WWKD 3CDGA 1TJIL 1G9NH 2IBZX 3R06A 4K71B 5BOPA 3F6IA 5E4EB 1D5IH 5FA4B 3VXSA 5FCUH 4K3JH 4OQTA 4K55A 4JPIB 3HUJB 1U8IB 3HI5L 3QIBC 4RWYH 4UUJB 3JWDH 1A7OL 2HJLA 4PJ9A 4QTHB 1RZ8A 2DTSA 5FCSH 1CS6A 1HZHL 3DROB 2DDQL 1NUDA 1GGCH 1G6RH 3EYFB 5SV4A 5CJOL 4MB4A 3F7VB 3BHBA 3MV7B 4R7DA 3TYFA 5D2LE 2YD9A 4N0UB 1ZV5A 3NBNA 4PJ9B 4QTHA 5DJ8A 4JDVA 2BXYA 4UINH 1KIUA 1FZOB 3FFCD 2GK0A 3MV9B 4R4BA 4NFCA 4I1NB 5HVHB 4K3DL 1CYGA 2BVOA 4LLVA 2NNAA 5IW1B 4PJFF 2JIXD 1SJHB 4Y4KB 1F00I 1Y18A 2GJJA 4Z0BL 3SPVA 4TVPH 1ZMYA 2FLBT 2ICWA 1R5WB 3U2SA 3VD7A 1BEYH 5IW1A 4PJXF 2DKSA 3MLUL 3BH9B 3KYMB 1MSPA 1NKRA 4M48H 3RDTA 3FB6A 3RVTD 1UXWA 1J11A 3HI5H 3WNKA 5E8DH 1UT9A 2AGJH 3LKQB 1U8QB 4NUGH 5EN2A 3TNMA 5CMAA 2W0KA 1QSFE 4GAYA 4LK4A 4GKOA 4UV7L 4JY4B 3UAJC 5LGJB 1H15B 5DC9B 5EOCJ 3HNVH 1UQSB 4NQDE 1C7TA 3JVGC 3PQYD 3WXWH 2DYP