4JHBA

Crystal structure of relb double mutants: y300f/i335f
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
110
structure length
110
Chain Sequence
LVPRGSHMNTSELRICRINKESGPCTGGEELFLLCDKVQKEDISVVFSTASWEGRADFSQADVHRQFAIVFKTPPYEDLEISEPVTVNVFLQRLTDGVCSEPLPFTYLPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription factor RelB
publication title Crystal structure of RelB double mutants: Y300F/I335F
rcsb
source organism Mus musculus
molecule tags Transcription
total genus 17
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2013-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jhbA00
2J6EL 4K7PL 4U1NB 1EVUA 2BERA 3MJ8A 1YMHB 2UY6A 1EHLL 1Z2KA 2XTLA 4ZODA 1E28A 3C87A 1ZGLP 5A16B 5GJTH 3GSQB 5FDWA 1CFSB 2C4FT 5FF6B 3C8DA 1RD6A 2UYLB 4HS6A 5A2IH 1FVEA 4NN6B 3ZYZA 5J12B 3OG6B 1ROWA 1R3HB 1IC7L 4PJBA 3C2AL 1E27A 4BSWA 2VXSL 1PZ5B 4TNVK 1MI5E 5DHVH 4DGYL 3W0WB 4QRUA 4MZ3A 4XPAL 5DMJB 1IAKA 4LCWA 4Y16A 2VDRH 5JXEC 4XVTH 1O7VA 2ADGB 5MEQB 4ZQKB 5TE6L 4XPBL 4P46C 1ITCA 3OAYK 3LDBC 5EDXA 3RA7H 2BSSA 5I1HL 5I73B 1WWBX 3CX5J 3T65A 1NGXA 5TQ2L 5JW4M 4PJGF 5I1KL 2ATKB 3DIFB 3SE3A 1RV6X 1T5WA 3CMOH 4AM0A 8FABB 1S7RA 1DDHB 3P9LB 1PG7L 3FMGL 4L9DA 2XA8L 4PJ7E 4DW2H 3SQBA 3P0YH 4YX2L 4XP6H 2EYRB 4JFXB 2NY0C 4F37F 3DYMA 3OJMB 4NN5C 1W8OA 5DD1H 1AE6L 1U6AH 5LBSL 3QISA 1NLDH 4JPWH 3WJLC 3UDWC 1P4BH 1H3TA 1U0QA 1H9VA 4OD1H 1NL0H 4NQSB 4RGOL 2ZG1A 3DX8A 3L95A 3GMRA 5BV7H 3B6SA 1G7PB 2L7UA 2M8XA 5T1DL 3O4LE 3B43A 4U7MA 3H7BB 4M1DL 2GTWA 1EXUB 1XF1A 4JFZL 4QHMA 3NTCL 2F54E 3BESR 4PP2B 4KKAD 4TOYH 3V0VA 2PN5A 5HPMB 3QNZA 4FFZL 4G8FB 2EE3A 3F7QA 1RULL 4MJIE 5DQDL 1A0QH 1I1AD 3T3PE 1HOCA 2AXFB 4ZUTA 5CEZE 4XP1L 3SBWC 3DRTA 3BPNB 2X4PA 3NZ8B 3QUYC 5CSZB 4JFEE 4IRJB 5JORA 4AMKH 1BVLB 3O0RH 1JGLL 2R0KL 4K3EH 5FGRA 3CFKB 1JTTA 1U92A 3MV8D 3ZKSD 3GSUA 5IB3B 2G9HB 3ARBD 4MAYC 5CEZH 4M7LH 3G6JA 4OD3H 3IF1A 5IBUB 3TIEA 3MRHA 1AD9A 1LD9A 3OZ9L 2F5BL 4U3XA 4DTGH 4OFVA 1HN1A 4FZ8L 1U3ZA 1T89A 3U0PB 5CZVH 1T2QH 3BO8A 2NY3D 4DN3L 1ED3A 1MHEB 3VFGH 3FB6A 1HQRA 1HNFA 3ZHLA 5KSVB 1KN4L 1S7UA 3DROA 3WN5C 4HQQL 1CT8A 3RGVC 3GIVA 3VXPA 4D94A 3GNML 3GB7B 3VFVA 3MLWL 4MQTB 1DE4B 3KGRA 4ERSL 3IGAA 2J88H 1NAKL 3NIDE 5JZ7C 1P9MA 4UTAH 2KZ1B 3PWPB 4P3DA 1YPZA 4ONFL 3MA9H 4YZFF 1UACH 4FQCL 1JPGB 5E8EB 2GUOA 1DBJL 3H3PL 4OGAC 5EC1B 4C58B 4OSUL 4M93C 4I3GA 2DQJL 2ICEA 3D2UD 3K8MA 5KAQF 4LPTA 3VH8A 1H0DA 3K80A 5EOCJ 1AI1H 2R0WL 3ILPB 2YUVA 3OXRA 1XFPA 3KHOA 5E2UL 3HS0A 4XPGH 1CDHA 4OCSL 3RWJB 5C3LD 4IDLA 2DQHL 2F15A 3S34L 2PCPA 3C6LC 2V7HB 4GMSL 5F1OB 2I9LA 4PJEB 2DBJA 3G9AB 4QNPE 4F2MA 3SKJL 3STZB 5HDOA 3ARQA 1CE1H 4ZUUB 2VISA 5FGBA 4MJ4A 4OLUL 2CIIB 1JPSL 4P4RA 1A1NA 5KS9B 2WW8A 2YRLA 1FYTA 2G75B 1UB5A 4HWNA 3QQNA 5EBGA 1BQHB 4K94H 4YXLL 3T4YA 3L5WB 2IAND 1QHOA 4Z18A 5MENA 1M71A 3QEUA 4RMUA 1NGPH 1UH4A 3SDAA 1J86A 3NABH 3V6FA 2PKDA 5BS0B 1YY9D 5IWLA 5ECJE 3PF2A 2JJUA 4G6JH 5KTEL 1G9NL 3FFCE 3ULVC 1ZEAL 2BRRL 2R2CA 3HNTL 3BXNB 4NQCD 1CICB 4P3WA 1N4XL 3FT3A 3WE6B 1XF3A 4W4OA 2GSGA 4WHDA 4CMMB 5ESQA 5F96L 1KEGH 1EHNA 4U7SA 1UXSA 1TVBB 1CR9L 4O02H 4WTWA 5C6WH 1S7TB 2HKFL 5HVGB 4YDKH 1FE8H 2CQVA 1F4YL 4PTUB 3QIWC 4FXGA 1BM3H 4XP5H 5DRWA 3MRIA 4OFDA 5E95B 1BQSA 1UKQA 1RURL 2LAAA 1YNKL 2PXYC 2HKHL 5F3HA 4KZDL 2Y5EA 5FYJL 2LU3A 4UT7L 4PJDB 1ZA6A 2A1WL 4R26L 5T3ZH 3AS1A 4HUXA 2IFFL 1G7MA 1N0XL 3FB8B 2E9JA 3TBWA 3TJHD 5DRXB 4XBGA 1DSFH 1OB1A 4JN1H 1ADQL 3F58H 4QY8B 3OL2A 1I8MB 5CJQH 3WLWC 2F9BT 4IJ3B 3RUGA 4BH8A 3HZMB 5IW6A 3T3PF 1NJ9A 2AQ1A 1NEUA 2GSIB 3FO1A 2WWKO 1LMKA 2CIKB 4IIQA 4HWZB 1B4RA 4P2QA 3ZE0E 4LLQA 1IKNC 5C0RL 5C0CE 1OTSC 4ZDHB 1F42A 1GGYA 2P8MB 3UYRL 1MIML 1G7LB 3QZWG 4JFDB 1IM3A 4MDJB 5JHLH 1MRCL 4JRWA 4PGBA 3VD4A 3CD4A 3U4BH 3OR6A 1AQDB 2QBWA 3F7VA 3VFOA 5GRUL 4Y19D 2R4SL 1HH9B 4X0KA 3KYKL 4OQTH 1SEQH 2JCCA 3DI2B 4HV8B 1QFWM 4GUPB 1Z5LB 1NCCL 4G9DA 5E70A 1WUNT 1NANI 3KPNB 4MS8D 5FHAL 2WINB 3HUJE 4Z9KB 4K7FB 2YSSB 2P5WE 2H1PH 1JPFB 2NY5C 1CXIA 2D7TH 5LAXA 5D93B 1NDMB 1CG9B 4M6OL 1KIPB 2HJLB 3KWWB 4KAQH 1KF9B 1WIUA 1B4JH 3WFBL 2C3VB 3FQXA 3MOAL 2VKXA 3AS0A 3B9DA 4GKOA 1RZJL 5JLZA 4Y4HD 1AO7D 3MV9E 2AP2A 1MCSA 4WV1C 1WEJH 3NACL 3NIDF 3DYPA 3FHAA 5D7JA 1DVFD 1ZLUK 2WIIB 4KFZC 1JWUB 4O51A 3PIQA 2Q7YB 1BGXL 5E2WH 5D1ZB 1U91B 1YMMD 4PP1C 2C3HA 4RMTA 3GHEL 4PD4J 2AK4D 3B9VA 3U9UA 3IXTB 1BFOB 4IOFC 1A3LL 3J7HA 1SJEB 3FRUB 4DGIL 4NC1C 5C9JA 3DNKA 4GOSA 5H94B 2OTWB 4PJ5D 4YH6A 5GRJL 4OZIB 4X83A 3X14B 4X7FC 1OTUD 4LCUB 3T4AB 4MXVE 3LN5A 4A2LA 5E9DD 4NQDA 4EDWH 4PRPB 4DKFL 4ZUSA 4F7MB 4U2ZA 2QV2A 4KJWD 4XPHL 3REVA 4D0DB 5GIRB 5K9OA 3TNMA 2Z92B 3A6CL 2DIJA 1W8NA 4LSSH 4HJGA 4QNPF 2QQLH 4ODUB 4L29A 5AUMB 4ZSOA 2EDNA 5ENWA 2OR7A 4KRPB 4KHTL 4D3CH 4XX1G 2Z8WC 3CXHK 3ARDB 4XVUC 3U79A 4P5KA 4QF1A 1I7RB 4FQIH 4U31A 5AYUH 4OV6F 3TCXA 4N8VA 5JW4N 5EO0B 4PS4H 4XCFL 5IB2B 5GS3A 3RVTD 4QYOA 3H8NA 4BQ8A 3JWOH 3KPOA 3EYUH 4LU5L 3HG1E 3RL2A 3V5KB 4F7CA 1RJLA 5GRYA 2EKSB 2CDEB 2Q76A 3S9DB 5FDYA 4ELMB 2O93L 3D0LA 3F7YB 2P8LB 2EIZA 2BXYA 1ND0A 4TYUA 3IRPX 2W0FA 4FABL 1X44A 3P9MB 3KPRA 1PDKA 2DQIH 2EXYD 3MV7D 3MV01 2DL9A 3O4OB 3S88L 3C9NB 3MBED 3IJHA 4TUKL 1TQBB 5K33A 1FNEB 3OGCB 3MRJA 1XGQB 5E00B 1KFAL 2QR0B 5SX5K 1IGFL 1V7MH 4RGNE 5F88B 1JPTL 1LWRA 2FZ3A 4IDJL 3PJSB 1VPOL 1R5IA 1NMCC 4B53A 3BP6B 2ITCA 2WZPD 1FZKA 3STBA 1TCRB 2UV3A 2H6PA 5D6CB 5J57B 2W60A 1F00I 4AIXA 5IOPA 3H9SE 4NNXB 4KUCF 3ZKND 4MQ7A 3AAZA 1X5ZA 3INUL 2Y9RT 3O2DA 4UILL 1JJUA 4QT5B 5BOPA 1G6RB 5J8OA 3DJ9A 1CFNB 1V8HA 4KUZH 1U8HB 4GAGH 1UM6H 2VDQH 2KPNA 5C71A 1NC2B 4HIXL 3GM0A 1IFHL 4KJYA 3TT3L 2P5EA 3PL6C 3B8YA 1C16B 1OAKL 3BAEH 5LGKA 3RJDA 5DT1H 2A6KA 5J89A 4N0CC 3D3VB 2DLHA 3SDCB 2V2XA 3VXRA 3BDBA 3K74B 3SDXE 3PWUB 2K7QA 1A8JH 4TQEH 2R8SH 5EOTA 1EFXB 3AS2A 2IPKA 2FX9L 4K3GA 3SOBL 1K4DA 4X99B 3OGOE 3PWVB 4TVPL 2FIKA 4GG6B 5D9SB 1XCQB 4R7DA 5C0AD 5JNYB 4KWUA 1I8KA 4CAGA 4KMLB 4MD0B 1CQKA 1E0OB 5A2FA 4LDOB 3G5VA 4MB3A 3S36X 3V6ZA 1RZGB 3TM6A 3VG9B 5E6IA 5L6YH 4IHOB 3K1DA 4WENB 4YHPB 3QUXA 4PJ9B 2A73B 5DVOA 1ZE3C 5DS8A 2GT9A 4LPXA 1YQVH 3F65A 5C07D 4FXKB 3NBNA 4OZHF 1BBJA 4JZJB 4LMQI 1WBZA 3TBYA 1LDPH 4PJIA 5TE7H 4DZ8B 5I2IA 1OAZH 3WS6A 1JNHA 3HPJB 3HRZA 2ITDB 4WGVB 5HJ3B 1QD0A 5DYOA 5I1IH 2GY7B 2X4QB 1UCBL 3S36L 1AFVH 3UTTD 1DFBL 1QP1A 4G3YH 4MQXD 1JGEB 1S8DA 4UDUA 2AJZB 1S9YA 2CLZA 4MXVF 1OHQA 4WUUD 3V5DA 5J0BA 2H26A 3PGFL 3ZL4L 1MJ7H 2F58L 3HE7B 3TPUA 1GOHA 5FOJA 2VDKH 5F7YC 1UB6A 2VQ1B 4QRSB 3DARA 5IFJB 1LO0L 4X6DE 2AEPL 3FKUS 5INCA 4AEHH 1S9KC 2OTPA 1AHWC 3ZYJA 3C5SB 4JAMA 3MUHL 1CZ8H 3C5ZD 3G5YA 5HHME 2HRLA 4QHKJ 4Y5VA 2ZCLH 1S7XB 1XF5B 4KI5C 3P4OB 4BZ1L 4D9RD 5TH2A 2IMMA 1R3KB 3IU3B 1SVCP 3L3KB 3EYOA 5C0BA 1OVZA 3CFBB 4JCLA 4LHJB 1KJVB 5SWZE 3FFDA 3UTSA 5I66A 4B7LA 3QCVL 1KYOK 1KJMA 1TJIL 1T0MA 3GBML 5D7IA 4AJ0A 2IPUK 5T1KD 5CSBA 1MOEA 2OMNA 5FYKU 3CSPA 4WNQA 1X4YA 4BQBA 3TJEH 4NHCH 1T7WA 2BNUB 3CCHA 1URLA 4WIQA 1OCWH 2FR4B 2NW3B 1TZGL 1BX2A 3GMPB 5F7DA 5EZLA 4YBLB 4NSKA 1EO5A 4WWKD 4BQCA 5CJXC 5TGBB 3O6FC 2WQRA 1K4CA 3QEQA 4G6ML 3RTQA 2CPCA 4G6FB 2CKBA 1RHHA 4IRSC 1KSRA 1KB9J 3KLSA 5KSAD 5ELIA 5I19L 4G8IA 3DV6A 2Z8VC 1MCLA 1MQKH 5L2KB 3MA7B 1X7QA 3LEYH 5IMOA 5IQ7H 2Z35A 2NLJB 3IU4H 2VXVH 4MZ2A 5EU4B 4HBCH 4Z0XA 3DTXA 2WQ8A 4OB5H 3SJVD 3HMWH 2ZKHL 3UZQA 3NCMA 4OT1H 1XF2B 3I2CH 3WS3B 2QQKL 2GJ6D 3BT2L 4P9HL 1PSKL 3CU1A 3G6AA 3SPVB 2HWZH 4JM2A 1FV1A 1KT2B 2WUCL 5TE4H 1XR9B 4CVZA 5CEYB 2R0ZL 1UM5H 3MRFB 5JIPA 2X89A 4IOIA 2Z93B 3AM8A 3VFMA 1QBLL 2EDXA 1M05A 3WJJC 1JNLH 1OF2B 2EDRA 1E4KA 1SM3L 4XRCB 3RDTD 3RGHA 4LAQL 1A9BA 4UB0L 3ARVA 1G0XA 4DEPB 3O3UN 4P5MA 5CHNA 5HVHC 3Q6FB 3T0EA 4JZNA 4MCYB 4E5XB 3RIFK 4LCYA 4ZFFB 5C92A 1R24A 5HYSA 1OTTC 1S7WB 3EOBB 4JJHA 5T1MA 1RIVL 3I75A 2ZUQB 3OB0K 1VCAA 4M9PA 1B2WL 5E08L 3BUYA 1CN4A 4LEOA 1J0JA 4P5TC 1NC4A 3UTZA 3ZHDA 4Q7DA 4XNMB 3S6CA 3TGXA 5IJKC 3KAAA 1IKFL 1EEZB 1QLEL 3HRPA 3UO1H 5FO9B 1O5DT 5JO5B 3MRKB 1YC8A 4LLVB 1HXYA 3VDBA 1RZIA 4PJ8A 2VUOA 2HMID 4N0FB 4Q0XL 1WZ1L 4NQCB 4IMKC 4Y5XB 1T4KA 4HAFA 3CSGA 4K3DL 2VLRA 3N0PB 3GEWB 4RGMB 4P2RA 3ZKQD 4ORGA 1TVDA 4YDVB 4PY7A 3VW3L 3MYJB 3WXWH 4U4BA 1FNSH 1ZWIB 3L5IA 3NAAL 4MNGB 3V52L 5J06A 1U8LB 4DVRH 3MX0A 4YAQB 3QIBD 5E8NA 3TZVB 3U6RA 5SWSA 3PP3K 4OJFH 5D72L 3MNVA 1R5VA 43C9A 4I2XB 1H5BC 1YEDA 5D2NA 5MHSD 2I60H 1NBZB 1IM9B 5DK2B 4XNZB 4UMGA 1FNAA 3MRMB 2FO4B 1IGCL 2XWJA 5FO8B 3LPFA 3T0XA 4EI5A 1I3RA 5EU6A 2NR6C 4XCCL 4ZNEA 4H25A 5JW3H 4XWOC 1EA9C 1F11B 5DJ2B 1ZVSA 4KVNH 3O8XB 3OHXA 3QCUL 3DMMB 4X6DF 3PHQA 5DFVC 3TNNB 1XEDA 4OI9A 1TLKA 4E0RA 1IEBB 4OZ4A 5DRZA 2IBGA 4Y16C 1QSED 4BZ2H 1JF1B 4XC1H 4ZUVB 4K9EH 3DRQB 3WDJA 5HGGS 5I16B 3ROLA 1RK0B 4OGYL 4OZFB 3GJFK 5CKGA 3PWPE 3FQUB 3BPOC 2HVKA 1VADB 4XMLH 1L9NA 4P4KA 4PYGA 5L7XL 2BSTA 4DGVL 2VE6A 2UY7A 3SE3C 1I7TA 2E6JA 5FXCH 3TA3D 1F3RB 1CK0L 4HXAH 4L8SC 1FAKT 3BUTA 4PY8I 1AXTH 4X6EB 4CBPA 1MHHA 5DC4B 5KVDL 5DLMH 4CNIA 4JB9L 3ZDZF 2ID5A 2J3SA 4G43A 4NKOA 3P4NA 4PRNB 3O41A 3BVNB 3LKRA 1C5BH 2RB8A 1A5FH 3BKYL 1F58L 1J8HE 3L3DB 3UBXI 4GG8B 5DZOA 1D5MB 1OARL 4P2OD 3WHE1 4C83B 4LQ1A 1CL7H 4PJEE 2IH1B 4Y4HB 1EERB 4PRID 1AO7B 3QNYB 5BRZD 1P7KA 4R4ND 4YHOH 4ALAH 2H8PB 1ZHLB 1NFDB 4LCIH 3SO5A 3QFJB 2AJSL 2HN7A 2XPGB 2JK5B 4BJLA 5KS9E 1JRHH 4WU5A 2XWTA 4M6NH 3NIFE 1UENA 1IVLA 5JHDD 3LKNB 1G7QA 2A6DA 1TETH 4ODTL 5AWNH 5DC9B 4K2UL 1HZHH 3T04D 3RPIA 2CKBL 2HFFA 3F7PC 5E4IA 1B6UA 5BS0E 2ADJB 4L4VB 1GPOH 5E4EB 3WIFA 2EO1A 2FJFB 3JZ7A 1ZMYA 4PJ5B 1NMBH 1MFBL 1MREL 2RBLA 2VLLA 1JRHI 4NKDA 4U1JB 4OFKA 5LWYH 2NX5B 4PUBL 1UADC 1U9KA 1NGZA 2BVOB 2NY6C 4YDLB 4EUPA 1JN6B 4P3CL 2VABB 3BYYA 4LHUB 2H9GB 2V9TA 1HIMH 2PYEB 1PJ9A 2Q20A 1KIQB 2ORBL 2RFXA 5FV2A 2NY4D 1R3LA 1VB9A 4KI1A 1A4JB 4JRXD 2OZ4A 3ALWA 1T89C 3VFNB 1HINL 3SGJC 4PJDE 3W5NA 5DJXB 1KLUA 4F9PA 5CD5D 1P84K 4TRPH 4PJHB 2OX5A 2Z31C 4NZRL 1YUHB 1F2QA 4V1DD 1JFQH 3VFTB 5IM7B 1R5WA 5I8KL 5BVJA 2JJSC 4XPTL 1UH3A 5ISZD 4BA8A 3GSRB 1FNLA 3U30B 4R6UA 5FM4A 1QRNA 1CLCA 1RUML 5GRVL 1F90L 1KCVL 4L8DB 2WBKA 3X11B 5HYJD 5DZNA 5DD0L 2VXQH 5DD3H 3ZTNH 1QFUH 3PDGA 4UIKH 2LFGA 4XXCC 1YJDC 5EZOH 4Y4FD 1TDQA 2HJKB 5EN2B 5T33H 2CJUH 5IT2L 4K07A 2GFBB 4MDIB 4FQHB 4LCCA 4I0PB 4ZOCA 4FQ1L 4XCYB 4QRRB 3BP7B 2X4RB 3C08L 4GBXC 1NFKA 2AXGA 1I9RH 1TTUA 2AV7A 4Y4KA 3AREB 4WI8A 2AJ3B 3BZFA 4W6YB 5ACZB 3VWKB 1QSFA 3MOQA 4APQB 5SV4A 3ARXA 1D6VL 1NEZA 3CH8A 3ALXA 1J0KA 3OTTA 4GMTH 3LN4A 1CGWA 3HI6L 1FO0A 3GMMA 1MFCH 4RFNC 4LGSB 1NCBH 1FP5A 4MD4B 3WXVH 2EDLA 4N8PA 1ZLVH 4GW4A 3EYQD 2FO1A 2QEJA 1PY9A 1J1OH 3IVKA 3JWDH 3BEWB 4YWGL 4KDWA 2ADIA 4BH7B 1GAFL 3QDJB 1CF8H 4R4BA 2CUIA 3CPLA 4NO0A 5GISH 4NZJA 1MJ8L 5JPNA 1EFQA 3VFSA 3EW3B 3VGDA 2FEEI 2VL5B 1CFTB 3WFCL 2Y1VA 3TWCL 4RAVB 3SDAC 1BEYH 4Y5YC 3VFUA 3BQUA 3OKDA 4HG4J 1QZ1A 1EBPA 4WW1B 3JTTB 3OX8A 3WKML 1JUFB 2E8ZA 1ES0A 1EX0A 4O00A 4AYFA 3NH7H 4UUJB 5CJOL 2C3WA 6FABL 4W4OC 3O6MH 5C0AB 2UZIL 1IARB 4OZIE 1PD6A 1DR9A 4OV5A 4J23A 1RUAL 4RBPH 2PF6A 5HHOA 5J3HD 4BK4A 1G7IA 4PRPE 5ITBH 4Q9RH 4FTVA 4WW2B 4OBSA 1NDGB 2XXMB 4G7VL 3O6LL 3QT2A 1CD0A 4PJXA 2OR9L 5C09A 5I1LA 2XIDA 3LKSA 2YPLD 5F9WC 1MPAH 3K1KC 1DANT 1YDPB 4XAKE 3TCLB 4N5UA 3P0VL 3EOAB 4KK9C 3EZ8A 4MX7B 3MNZA 5KS9F 2HFGL 4YUEH 1A9EB 4WO4B 4Z7NE 4RFOL 2F74B 2YD6A 2DLTA 3QH3B 3NIFF 5CINH 4PPTA 1OGAD 4RSVA 5DRNB 3P73A 5HGHB 3D39A 4PR5A 2NXYD 1YN7B 1IL1A 3UTTB 1E4XH 4TTDC 4NKIL 3ULUL 3A67L 4HGWA 3RZCC 2XZQH 1T2JA 1WISA 3MBXH 4ELME 3MV11 1Y6KR 3QXAB 4X8JA 3VE0B 4ZG1A 2DQTH 5I17B 4OQ1A 2ARWA 5DJ8B 5I1CL 3MO1A 1QUNA 4WUUB 3CFJB 3CH1B 4LRIA 4M4RA 1VFBB 3IDXH 4NHUA 4QOKA 2G5BB 4X4XB 5LCVH 1ZT1B 2QADD 3KYNA 2QHLA 4LKXB 3I50H 1DANU 3GUTA 5FV1L 3EHBC 5ICZB 3C5JA 3OKMA 5J9PA 2DQUH 2APVA 1SYVB 4RISL 5F3BB 3BWAA 4OFYD 5DMGC 4P0DA 1U3HD 1U8KA 4FQJL 1SJVA 5D8JH 4OLZL 2GITB 5DJCB 4PB9L 3DGCR 25C8L 3GGWA 3KS0J 3W39B 1LO3L 4TSBH 4GO6B 2O5YL 4XCNA 3CK0L 4PJDF 3MRQA 4TNWF 1WLHA 1QQDA 2WUBL 5IG7A 5C0ND 4GQ9H 3KYMA 4UNVA 4RZCB 2YA2A 5DHVA 3JV4B 5ACMA 2F5AL 1CLOL 1BZ9B 4OCYL 3H9HA 3CDYA 1JGUL 1YEIL 3LEXA 3MRCA 4L8BB 4R90L 4H5SB 3QUMH 3C8KA 2W9DH 3EJZC 5D7JC 1SHMA 2NY0B 3ULSA 2GJZA 1T1ZB 4W6XB 2ZUYA 1F4WL 3VCLA 4MVBC 1KXVC 4B7IA 1T04A 2FL5A 3N1MC 4HPOH 1TVHA 3MRBB 4X5WB 3J8F7 1F4XL 1XMWA 2HT2D 5F7NC 4I5BA 4M8QB 3FHQA 4LL9A 3E6HB 3D3VE 3NA9H 1MCPL 3RZWA 2NCMA 3D85D 5EU3B 5KSAB 3CFEA 5C08E 4JY5H 3LKPB 2FGWL 3U0TB 3L3JB 2VLJD 4XP9L 4X7DC 2PO6D 3DUHA 3W81A 4GG6E 3LY6A 2P7TB 3MLRH 2WBJB 5TDPA 5GGUB 2R2HB 5GZND 4KKLD 2ZUUA 5C2BH 1DUZA 2VOTA 5E99H 4MXWH 3RVUD 3FAWA 1CFVH 4UIMA 3A6OA 3VGAB 3L5XL 4P23D 1K3IA 1Y0LA 3BEVA 2PW2B 2WMPA 1K2DB 5HSFA 3FT4B 3W2DH 3FO9B 3QUYB 5J4MA 1DCLA 1DBKH 2HRPH 4MAUL 4Z77B 4JDVB 3UTQA 3IS1X 3B83A 1U8NA 3TIDA 3WLBA 1R3IL 5HI4C 1Q94A 3SE8H 1R0AL 1PZUB 2HTKC 3DX6A 4XAWL 4URTB 1FO0L 4LLUB 1N5YH 4MAYB 4PRHA 1QHPA 2Z8SA 2JIXB 4QGTA 3QG6B 1AXSB 4POZC 1KXQE 1EK3A 1ZOXA 4OI7A 2X41A 3I9GL 1U8IA 3MROA 4ENEC 3U4AA 4D9LH 3SGEH 4F57L 3R8QA 4X6FB 5DK0A 5HYEA 2ZSVB 3O3EB 1U58A 2CMRH 3MRGB 5GRXG 4G9FA 5DQJB 4M7LT 3T0VA 4OZIF 4NQTA 4JFEA 5E1AB 3WN5B 1FNGA 2X5PA 3RGVB 5HGAB 1S9VA 1X5GA 5I15L 4I4WA 2RCSL 1HHJA 2YPKB 1YNTB 3IFPA 4U1LB 4JFQA 3SGEI 3L3OB 3FO2A 4HUKB 4ONOA 1AP2B 2VDOL 5E94A 3S35H 1C8PA 1BJ1J 2P44B 3EDEA 2X4OB 3AB0C 4Q97A 2VSDA 3Q0HA 5DGRA 4X7TB 4S11A 1YEGL 4GKZB 4XVSL 5DXWA 2AKRB 5FAAA 5KG9A 1KBGL 4Z7NF 3PWNB 4F7TB 1N5AB 2ADFH 3EO1A 4H8WL 1K5NB 4U1HA 4FQLL 2DI8A 4M93B 5D96C 2BP3A 2VN4A 2X4UB 2ZCHH 4O2FA 5AZ2H 2HFEA 4N0UB 3LV3B 4ZTPL 2VIRA 3AC0A 2R4RH 1EUTA 3MCLH 3FQRB 3S97C 4ISVA 3GK8H 4MD5B 1PKOA 4N8CH 3W5MA 3EJJX 4XMKL 5IFAL 4G80A 5DR5H 3C6LB 1JK8B 1EVTC 5SX4H 4J3UA 5AZEL 3M07A 5IMKB 5GGRB 3VI3E 1EAPB 5HYQB 3BP5B 5EIIA 2ZSWB 3S37L 1A6VL 4L4TA 5ALCL 5TDOA 3AROA 2SEBB 3UX9B 5HGBA 3RL1B 5C7XH 2UUDK 3SKUD 3K46A 4NKMB 5L2KE 5SX4I 3EYSH 1J1XL 3TFKC 4PB0H 5FOBA 1EIBA 4HKZB 3QUXC 5EO9B 3LRHA 3Q5OA 4PJAB 1LK3H 4ELKB 1A7RH 4WUKH 5GJTL 5IESH 4L9LA 1H3WM 1ZHBA 2EYSA 5HY9A 3B3IB 1KC5H 5BZDA 4JJ5A 5C0EA 2OXHA 1C1EH 2YPVH 3I6GB 3U46A 4RGNC 1I1AA 1OQXA 4HLJA 4U7KA 2DOCA 3IDGA 3IDIA 1FFNA 3GBNL 1Y18B 4FQQA 1JNNH 1MCHA 3OB8A 3DV4A 3B9EA 3WS6C 2X4SA 3AMLA 5B8CC 2VDRL 3EAKA 2H2PC 2YEZA 4XVTL 1J0HA 1DLFL 4PRIB 5FUCC 2Y23A 3V6OE 5BRZB 1WBYA 2Y5TA 3LRSB 2AABH 4HF5L 3BH8A 3RA7L 3VFRB 5CBEA 4GG6F 5F9DC 3MUGA 3MV8A 3SGKA 4DAGL 2EEBA 2ZJSH 3ARBA 2OP4H 4N8VG 4F8QA 5C8JB 4B41A 3CMOL 5F9JA 2HT4C 3BOVA 5EWIH 4UU9B 1IGJB 1L6XA 3D25A 4DW2L 5DTFA 3P0YL 3RHWK 1E4WH 4H26B 1VACA 4OKVA 3DPBA 3CZFB 1N64H 4O2CA 5DDHA 3T0BA 3ELAT 3IKCA 4MMXC 4OF6A 1HXMB 5DJZA 3HAEB 3QEGL 5DD1L 2WP3O 1NLDL 4JPWL 1P4BL 1WGOA 5HPOA 4JFOB 4PV9B 4OD1L 1NL0L 4WI3A 5K9KB 3WO4C 3QJHA 4FG6C 3WDIA 5BV7L 1CVRA 3MQIA 4Z7VF 3UYPA 4KZEH 2AJVH 1FFOB 5F7HA 4MNGE 1K8IB 4IMLB 2H3NB 4Z7UB 4NBXB 3H3KA 3MREA 4TOYL 5I0ZA 1BJ8A 1ZK9A 3WUWA 5T1LA 4I2XE 2NZIA 5C0DB 3QXTA 5JW5B 1A0QL 1DLHB 3PWJB 4OQTA 1KEMH 4U1KB 3TBSA 2B5IC 1VKXB 3LEVH 4YPGA 3ARRA 3H42H 1EMTH 2IFGA 4HJ0D 5HHVL 2P24B 1RZKC 5FGCB 1A7PH 5C0CA 5AYQA 4AMKL 1VEPA 3D2UA 5I1AB 1HHKA 2B2XH 4K3EL 5CILH 3S4SA 4WV1B 4HLZG 2V2WB 1LE5B 4ONGH 1TIUA 4AENB 3VXQA 4PBWD 4G8EB 2X6MA 2X2YA 4O9HH 5CEZL 4M7LL 5T3XE 5GGQH 2CLVB 4ONHA 4OD3L 1UJTA 3L7FA 4WDIB 5GGVH 5F7WC 5SV3A 3CC5A 1CVSC 1XZ0A 4XP4H 2P5WA 2ZCKL 4RRPG 2AS5M 1L4IA 1MJUH 2FBJH 4GAYB 1Q0XH 1WF5A 5GS0H 5CZVL 3D0VB 3VGHA 3LD8C 3OKYA 1OGTB 3PABB 2HLFD 4JM2C 1RU9H 4ZFOA 1IILE 1CBVH 1QOKA 5T3XH 5IBTH 5IKCB 2IANA 1MY5A 3AM8C 3PHOB 1XCTA 2R69L 2JE8A 3NFSH 1XAUA 1E4KC 4OZFH 5IMMB 4OZHA 3R4DA 3H9YA 2C1OB 2J88L 4UTAL 1T6VN 2ATPA 3C60A 5IHZB 3MA9L 3TH4T 1UACL 4JFHD 1MUJA 3RNQB 5FYLE 1AO7E 2IAMC 3MFGB 1IGIH 1T03H 5JOPD 4QHKI 3SKMB 1A7QH 5D7LD 1NFDE 2BCKB 3QFJE 5C0GA 3ILQC 1QYGL 1LDSA 5D1XD 5JTWA 1QFHA 1NCTA 3R0NA 1AI1L 3QHZH 5HHPA 3T3ME 4D2NA 3FTGA 4XPGL 4C56A 3V4VH 2IJ0C 5FYLH 2XTJD 1FIGH 1XGUA 1ZLSL 2C7UA 4JHAH 4L4VE 1AR1D 3MCKA 4JG0H 1B3JA 2BVPA 4NN6C 4PJ5E 3M17B 4JKPH 4GAJH 1CE1L 2HA1A 2NX5E 2Q6WB 1I1FA 5MI0C 5C0JB 1KGCD 1I8IB 2G60H 2APBA 5ICXB 5IEHA 4FZEH 4OLWH 3BDXA 4ZOEA 1FH5H 5DEFB 5D2NC 4LLYB 1NMCB 2PYEE 3N06B 1D5IH 4TSAH 4KK8D 3LB6C 3VXUB 1NGPL 1U8QA 3MMEB 1F3JA 5IGXL 3NABL 2MPAH 4YDIH 4J1UA 2OL3B 4OD2B 3KLDA 2F8XC 5I1JH 1MVUA 4X4YB 3RU8H 4Y19A 1D5BB 3ZYOA 1JI1A 3FZUC 4C4KO 3VXNB 4KKCC 4PJHE 5C2UB 1OGAB 4XNXH 2D7NA 3LZFH 1NGWB 1XIWA 2PYFB 4X9FA 1NCDL 3VD5A 5DJ0B 5E5UB 1PYWA 3EGSB 4QHUB 1QKZH 3ARUA 4O02L 1FYTD 3AS3A 4UBDC 1N7MH 4YJZL 3RPKA 1GIGH 3PL6B 3CLEH 5EOQH 3C09C 4YDKL 3QUZB 3RY4A 4DK6A 4PREA 4U6HA 1BM3L 4RX4D 3U82B 4JFFD 1I85A 3GKWH 2ARJQ 3T08A 5JOFB 3WFEL 5J1AB 3L3IA 5T3ZL 2R1WA 2ED9A 1OAYH 3KXFB 3QHFH 4A2MA 1UWGH 3OR7A 4NDMB 4GW1A 1DSFL 1DVFA 4JN1L 4QRRE 2BVQB 4M1CC 5CJQL 1H15A 4K8RC 2BNRB 4PRDA 4HK0A 5E5RB 2FSEB 2R1XA 3BPLC 1BP3B 1YMMA 3VXSD 4OLXH 1K9TA 5D7SH 2WV3A 1JYWA 1FZMA 2ESVD 1GCFA 5HGDA 4HDIA 4J6RH 4WY7L 1MCOH 3WKNA 4PJFF 4RWYH 2VZ1A 1V7NH 3ULUC 1IGYA 3JTSB 1T1YA 3MRLB 5CZXD 3BGAA 2EYTB 3D69A 3T77B 2E6PA 2RJMA 4JY6A 5JHLL 5E9DA 4TUOA 3U4BL 4LDEB 5I1EH 2PTVA 3NIGE 1AY1H 3G6DH 4OQTL 1SEQL 4EBQL 2W1NA 3QDJE 1XF4B 1JIBA 3CXHJ 3HC0B 2ERJC 3MLYH 4TVPD 5FHBL 4R0LA 3L3HB 4POUB 3PDDA 2H1PL 2HT3C 2IEPA 4KK5D 1U95A 4P2QD 3PWLB 1MCFA 2PO6B 3R06A 3WHXA 4KAQL 5JPMA 4I18A 3S3JA 4UQ3B 2WBWB 3GIZH 3W9EB 4HT1H 3JV5A 5C0AE 1UQSB 4ZNCD 3ARGA 3HZYA 1U3JA 4HD9A 1WEJL 5FIEA 1FNHA 4H1LG 3NN8B 5BJTB 1Q9WB 3QXDA 4YHNB 3G08A 4RQQB 3NPSC 3MV7A 1PAMA 3WBDA 2A83B 5E2WL 4ZFOL 3MBEA 2ARJA 1OSPH 2Y06H 3OJVC 3CVHH 2AW2A 3B9KD 3UAJD 4EIGB 1NFDF 3TYGH 5IHLB 3P11H 3VXMB 1BOYA 5DHYB 1YEHL 1HSAB 2XN9B 5F89A 1IMHC 3ARFD 2VDNH 2OI9C 4G42A 2GKIA 3TBVA 2XNAA 5EUOB 5B39B 4N0YH 4JGMA 3U7WH 4EDWL 1TNNA 3L6FB 2A74B 5ICYB 4HBQA 3MNWA 2NNAA 5DMYA 2CXGA 3SN6N 3DVNA 3UTTE 5CMAB 1AGDB 4MCZB 4LSSL 3DI3B 5MEPB 1QO3B 2QQLL 3MLXH 2V5SA 2QTEA 32C2A 3E0GA 5ANMA 5GGSB 3QUKB 4QXGH 4JDZB 4MSWB 4LCCC 5DFTA 4D3CL 4IRSB 4RMQA 1X5LA 5CCKH 2IQAA 4JO1H 4FQIL 5AYUL 3IDNA 3D18B 4CMHB 3O6KH 1FVCB 4PS4L 4Y4KC 1VENA 4GW5B 1YNLH 1MAML 3DSFH 1WAAE 3DUUB 5ETUA 3ZT6A 3GSNH 1MEXH 2HVJA 4LPUA 1ZA3A 3JWOL 4X6CB 5IW3A 3ZKMC 3EYUL 4KGLA 4XNUH 4IBLT 3QJFB 2EDQA 2YWZA 1R3JA 1VGEH 4D9RE 3CDGB 1I3GL 4ZD3H 1P4LB 4AT6B 3C8HA 1CICC 4UDTB 2DQIL 2VXTH 5BZWA 3BZEB 4OGZA 3QCTH 2EEAA 5BOZG 3OWEA 4LLWB 2P8PB 1DN0A 5E8OB 5GGVY 3IJYA 5FGSA 1KN2H 5KSBB 2F53D 1AJ7H 1R3HA 5D5MB 4FA8A 1V7ML 1KB5A 5IVNA 4NO3B 5KZCD 1OPGH 1S78C 3BQUC 3DVGA 2OSLB 3OAUH 4Z7OE 1KTLA 5HVHB 4JN2B 2DQDH 1D7FA 1IC4L 2MKLC 3BD3A 5C07A 1A14H 5MEQA 4ZQKA 1CDGA 1FG2B 1II4E 2HFTA 1JYXA 5DUBA 3KPRD 2V5RA 4P5TB 5J6GB 2VZOA 4J12A 2BFVH 4LKCB 4IOSD 5DUML 3V0WH 5IQ9B 1WFOA 5I8CB 4KUZL 4U1IA 4GAGL 1ORQB 3S5LG 3CX2A 1UM6L 1NBVH 2VDQL 2R29H 1Z9MA 1W0VB 2UWEB 3TO2B 1XH3B 3UJIL 4MNQD 4BFIB 4I13B 2JKXA 1VHPA 1BD2E 5DT1L 1T3FA 3MLUH 1PX3A 5F93C 4LSDA 5CZKA 4HK3N 1KCRH 1D9KD 2KL6A 5H8DA 4RMVA 1KENH 3NIGF 1SY6H 3MR9B 1FSKB 5EFIA 1XGTB 5EORL 3HHRB 2LVEA 3IJSB 4D9QD 4PFEA 3IFLH 4MWFB 3OJDB 3W9DA 4CW1B 4LAJH 1G7PA 3HE6D 3N1QC 4XB8A 5BW7A 2GK2A 1I7UA 3MJ8B 1CU4L 4MA1B 2BNQD 3WNOA 3V7AE 3O3BA 4OF0A 1KYOJ 1MAJA 1E28B 5CLWA 3B5HA 5HDQH 4Y0GA 1WTGT 2YN5A 5FDWB 5IW1A 1T66C 3WNKA 5L6YL 4HS6B 1VGKA 4LOUC 1AC0A 4LRIC 1FVEB 1HYSC 4NCC2 2B0SH 2BHYA 5CSZA 3UYOD 4EXKA 1OP5H 5T1KA 4GQPH 3I6KB 4HKJA 2W92A 4PJBB 1E27B 1LEKA 5M94B 4BSWB 1YQ2A 2FWOA 3L1OH 2DWDA 4OAWA 4JLRA 4WW2F 4LARH 1U8JB 1VFUA 3DETD 2G2RA 4OF5A 2Y36L 1IAKB 4LCWB 4Y16B 4Q6IC 3HB3C 1LDPL 1AIFA 5TE7L 4WWKA 1U36A 5D1ZC 1OAZL 2CO7B 1RI8A 2G9HA 3OG4B 4HWEH 1A22B 1Q9LA 5HI5D 5I1IL 3BPOB 2BSSB 5E6ID 2ZNWA 1AFVL 5DJAB 5CGYC 1NGXB 4G3YL 5DUPH 1T5WB 3B2VH 2EDDA 2R2BA 4MJ5A 2QHRH 5HHNA 1OL0A 1FL5A 4P49A 1MJ7L 3BWUC 4DFIA 1NLBH 4N0UE 3D1MC 1YEFL 2VDKL 3UBXA 3SJVA 5A3ID 1NEZG 3RQ3A 4MB4A 1NAMA 3TESA 2GJ6A 1ZHKA 2ZOLA 2GK0B 3PNWA 1PW3A 4YHZL 5I1DA 3DX8B 3L95B 4XVJH 3KPSD 5IMLA 1EJOH 4U0RB 1A1MA 1I7ZA 4Q2ZA 2V5MA 4AG4H 2E9BA 1WAAF 4QHMB 1W72A 1QG3A 3V4UL 3V0VB 3VRLE 3I84A 3QNZB 4Q9CA 4ZAKC 3EJYC 5EC1A 1YYML 3RDTA 1YEKL 4BM7A 4Y7MA 4OCLC 5A2LH 2XY1A 1HOCB 2Y25A 2NY2D 3TJEL 3QPQC 4NHCL 4ZUTB 1OCWL 1XGYH 3DRTB 1UXWA 2X4PB 5GSVA 1ZVYA 1J8HA 5JORB 4PJAE 1AKJA 4Z95L 4XZUA 2XFXA 4YHIA 4X80L 3ULVE 3O4OC 2KQNA 4POYA 4WVRA 3WO3B 3JUZA 3MLSH 1IAMA 3M1BA 2NY6B 3VJ6A 1U92B 3KS0H 2FYYA 3GSUB 4M3KB 1AH1A 2I26N 3G6JB 1MQKL 2FATH 1CFQA 5TDNB 3IF1B 5KS9A 4I0KA 3LPWA 3TIEB 4OCWH 3LEYL 5IQ7L 3ULVH 3IU4L 3MRHB 2VXVL 1LD9B 4HLZH 4HBCL 2IALA 4J8RA 4JPKH 5IVZA 3L5WA 4JRYD 4OB5L 1PVHA 4PRIE 3HMWL 3KPMA 4HWBA 3BO8B 3BJ91 5BRZE 4OT1L 3T2QA 3I2CL 3FB6B 4J3VA 1HQRB 1IGMH 3RTQD 3QEQD 4NO5A 1OW0A 3QIBA 2YBRA 3VXPB 1CT8B 2UZYB 3GIVB 3RWHB 4KY1H 2HWZL 3BXNA 3VFVB 4O5LL 5TE4L 5B38G 1K6QH 2CSPA 2GCYA 3WHE0 3KPTA 1FRGH 1UM5L 3IGAB 1GGBL 1NBYA 5FUZH 1EV2E 4R3SA 1KCLA 3AGVA 4E41A 1JNLL 4F58H 4MA7H 5D7KD 4R7NA 1QLFA 4P3DB 4MA8H 3MPCA 4UOW0 3DOSA 3WNLA 1NPUA 4H0IA 2XKNA 1MLCA 5JUEH 2GUOB 4ZYKA 4KQ4H 1AC6A 4EJ1C 2ICEB 3VH8B 1H0DB 4AEEA 3MLZH 3OXRB 5B3NA 4Z7UE 1EO7A 3HS0B 2X1WL 3HAEH 1A7BA 4FOMA 4UT9L 2Q3AA 2PCPB 2GSIA 3AY4A 1PKQB 2BVTA 2VWEC 1XR8A 4JR9H 3V7MA 1YN6A 4YHLH 2I9LB 1JF6A 3TA3A 1C08A 5FYKE 4B5EA 3H9ZA 4NQEB 2BVYA 3Q1SH 3T0ED 4ORZC 4LVHC 5FGCE 5JQ6H 1BOGB 4S2SA 5A40E 1J10A 2Y72A 3LS5L 1A1NB 3EDKA 3WXWL 4JZJC 4ETQA 1FNSL 3ZO0A 1UB5B 3WFDH 1NC4D 3E2HB 1AQDA 4ZUWB 4DVRL 1ZLWH 4YHMH 3T4YB 2NY5H 1JV5A 2OS7A 5MENB 1CE6A 3QEUB 4OJFL 5FYKH 4JG1L 5KVGH 3SDAB 4P2OA 3U1SH 43CAB 3V6FB 4Y5YB 3IKKA 2I60L 2R23A 4K23H 4Z76A 5EZIH 5K93A 4PJ8D 5L2JA 2DL2A 3ALPA 3QXWA 4ZXBA 5E2JA 3RVVD 2F8VA 5K59E 3FT3B 2EXWD 2IC2A 4KKAC 4NC1E 3LIZH 4LSRH 1XF3B 1NGYA 2GSGB 1S7QA 5JW3L 4P2RD 2R2EB 1IAII 2AXHA 1BJ1H 2BOCA 1B88A 3G5ZA 1UXSB 4F9LA 5JHDA 2FD6H 5BMFH 3ORJA 1I1YA 4FXGB 5DF0A 2X4TA 1UZ6E 3TF7C 5DRWB 5ID1A 3MRIB 5MERB 4BZ2L 4XC1L 4L8CA 1Q1JH 3MRNA 5F3HB 4K9EL 2WIIA 3U7YH 1KIRB 4KQ3L 1ZA6B 3UEZA 5F9WB 3PGCA 4HUXB 5KSUA 1G7MB 1MVFA 5KBNC 2PTUA 3OAYH 3TBWB 4XBGB 3OKNA 1MCWM 1OB1B 4XMLL 5LGJA 3VRLF 3SGKC 4HIIA 4EI5D 3EOTH 3L3GA 3GSOA 2Q1EA 2H2SD 1BFOA 3RUGB 4BH8B 3NCEB 1A6TA 1OT2A 4UV7L 3SE9H 2DYPD 5IW6B 2VMFA 4IEFB 1NJ9B 2AJXH 4QRQB 1AXTL 3P77B 4H88L 5B3JF 3FO1B 5BVPH 5DLML 2ZOKA 5GGTA 4OZIA 4IIQB 1P84J 3OSKA 5HI3D 4JRXA 4P2QB 5DA4A 3RZCB 4LLQB 3ULVF 2VZUA 1JE6A 2NY3C 1CGSH 4I3RH 2GTZA 4M1GH 4PRAA 4Z5RA 4D0DA 1SMOA 4XNYH 3MUY1 1IM3B 4PGBB 1CL7L 4V1DA 3OR6B 4ODUA 2CXKA 3F7VB 5BXFA 4P4KD 3VFOB 4X0KB 3EFFA 3QDMD 3R8BB 4CVWA 2JCCB 4YHOL 3MLTB 5ISZA 3U36A 4ALAL 3QIUD 1Q9OA 4LCIL 4JKKA 2V2TB 4G9DB 5LKNA 3ROOA 4CDGC 2GIYA 5HYJA 5DVMA 1JRHL 3V2AR 4B50A 4M6NL 2ZWLT 5C0FB 4Y4FA 1TETL 5AWNL 4QKXB 1JHTA 3VXUE 1S5IH 3E8UH 4OZGA 2CGRH 1CDBA 4NFBA 4NOFA 1GPOL 3FQXB 3F7YA 3MXVH 2W91A 3O81A 4HZAA 4PLJC 4LQFL 3PV6A 1NMBL 4XXDB 4L3EA 5JLZB 1GHFH 2NY1D 2Q3ZA 2YZ8A 1FORH 5EUKB 5LWYL 1OGAE 4XMPH 3QAZC 3K0WA 4MMZC 3WEXA 1NCAH 2P45B 4R97B 5D7JB 5F9OH 4YFDB 3DYOA 5E2VL 1I4FA 4AIZA 4U6YA 4KHXH 4O51B 3N9GL 2YUXA 4HWBL 3PIQB 1HIML 3VD7A 2OL3H 5E00A 1LNUA 2V17H 5KANG 1FCCA 3QUMA 4XHJD 3U9UB 4S1QL 2FX8H 1HDMA 4XT1C 2E5EA 5C9JB 1J5OH 1G1CA 1K8DA 3K7UA 1YECH 3MRDA 1RSFA 5D6CA 2LVCA 4JO3H 1IEAA 3KXFE 3BIBX 4TRPL 4V2CB 2X05A 3LN5B 1IJ9A 3BX7C 4NQDB 3LVEA 4ZUSB 2YC1A 1JFQL 2BNRE 1A7OH 1YY9C 4OBRA 4PV8A 5DD5H 3TNMB 5EIVA 2MHAA 1B0RA 2EECA 4HJGB 4Y1AD 1UA6H 4WHTA 4L29B 2ICWJ 1T21B 5ENWB 4ZSOB 2AI0H 5DD3L 1G9MC 3GSWA 1QFUL 4UIKL 5HHXH 4QF1B 2EH7H 5EZOL 4TULH 2CJUL 1U93A 4N8VB 1KPVA 2HYMA 4YXHH 2VNCA 4ODSH 5C08A 1DJSA 4QYOB 4GKSA 4XCEB 3TZVC 2X7LB 3WFZA 5HDBF 5D70H 3KPOB 5DWUH 4Q9QH 3O2WH 5AAWA 5FM5O 4NN7B 4F7CB 1RJLB 2EIBA 1XCQA 2J6EH 1FGVH 5LGHH 2Q76B 4TNVF 2YPLA 3D6GA 1DQLH 3D0LB 2EIZB 2ENYA 1ND0B 5GS1A 3TJHC 4L3CB 3U9PH 2W0FB 3GMOB 1MFCL 4PGDA 3BP4A 1RZGA 5IF0A 2FEEL 1WT5A 3OAZK 1C7TA 3L5HA 1MELA 3WXVL 5IB1A 3JWNC 4U1SA 3UMTA 3MRJB 1M1SA 3L7EA 3IXAA 3JWDL 3DVFA 4BQ6A 2BHUA 1OTTD 4HIHA 2FZ3B 2IPTL 4HUVA 1R5IB 5L8JB 2ITCB 4Z7VA 1FZKB 1QSFD 3AB0B 4KJPD 1VERA 2DM7A 2RGSA 4J3WA 2W60B 2O61B 1BF8A 1BEYL 2HTLD 4LLMA 1ONQB 4MQ7B 5BQ7A 3AAZB 2ITDA 3PQYD 1DUYA 2DMBA 3HNVH 1LE9A 3BKJH 4RDQG 3NH7L 4F3FA 1JGEA 2PW1A 1P69B 3VXME 35C8H 4OFYA 1U3HA 3MGOA 4MS8C 3X13A 2XN9E 3WL9A 3EYFA 2OK0H 3FMGH 4NT6A 5EUOE 4KJYB 2DQFB 2P5EB 4NIKB 5GS2D 3HE7A 2DRUA 2A6KB 3AXLA 5ITBL 4Q9RL 1A64A 2VQ1A 2WNGA 3DECA 3QNXB 2V2XB 1QR1A 3VXRB 1A6ZA 1HEZA 4JDTH 3BN3B 5EOTB 4Y4HC 1BZ7A 1MPAL 2AK1H 2IPKB 2VAAB 5IEKA 1K4DB 4NQVA 2FIKB 2MJWA 1DVFC 1KTDA 5EOCL 4LSTH 4YUEL 2H41A 5ADPL 4ZOAA 2YXFA 5CINL 3RY5A 1WFNA 2NR6D 2Q8BL 1F2XK 5FKPA 3QI9A 3V6ZB 4U6VH 4X6CE 5D2LA 5E6IB 1E4XL 1S7SA 5J11C 3D85A 2JJTC 3QUXB 1BIHA 5E4EC 2XZQL 2VLJA 5DS8B 1LQSR 2DQTL 2GT9B 3BISA 3FL7A 5LXGH 3ZHKA 3TN0D 2DAVA 1J9CT 3IDXL 4HIEA 1AR2A 2AGJH 4KV5E 1JGLH 5IVOA 2VERN 1BBJB 2DLIA 3I50L 1WBZB 4KJWC 4X7SH 4P23A 4WFHE 3LQAC 2DQUL 4BYHA 4PJIB 5I2IB 1DQDH 1T1XA 1TPXC 3Q3GB 1JNHB 5B8CB 5KSBE 3BD5A 5D5ME 5DYOB 5D8JL 3G5XA 4PRBA 2A6JB 1SEBA 4TSBL 3MA7A 4QXUH 4KDVA 1S8DB 4UDUB 5EU4A 5MP6H 3SKOA 4GQ9L 3F5WA 1S9YB 2CLZB 3LPGA 4DUXA 3T0AA 4QRPA 5IBLD 3RVTC 3V5DB 2H26B 2M1KA 1P5VA 2YS4A 3TPUB 4HSQA 2V5TA 2VR9A 1UB6B 4HQQH 3GNMH 4QTHA 5I8OL 3QUML 5EU5A 3T2PA 2NY2B 3U30C 1GZPB 3FB5A 2J8UF 1MH5A 1EAJA 4ERSH 1B6DA 4JAMB 4OM0H 3G5YB 4QCIA 2EXYC 4CDHA 1M7XA 4Y5VB 4C55A 1BPVA 5FKAB 3MBEC 5CGTA 1G7JA 4GAFB 3I85A 4XBEH 1C5DA 5TH2B 4LNRA 3EYOB 5C0BB 5I66B 4NPYA 3UTSB 3FFDB 4HPYL 5D1QA 2A0LD 3Q6FA 1KJMB 3SDYH 1T0MB 1O0VA 4JY5L 2ILLA 1J87A 4FQ2H 4QTIH 1MCJA 1S7WA 3AMKA 5D7IB 1DBJH 1TZHB 4QO1A 2CDFA 3MLRL 1QFOA 3MLPA 2D7PA 2D4FA 1OY3B 3CCHB 5E99L 3LMJH 4MXWL 1CFVL 3ZKNC 1BX2B 5C86A 4KRMB 4LLDA 5EZLB 5F7DB 1ACYH 4NSKB 2AXJA 1MI5D 2QSVA 3SCMA 2AEIT 3W2DL 3MRKA 2FEDD 4HH9A 4JQIH 3RTQB 1DBKL 2HRPL 1LO4L 2CKBB 1RHHB 2ZUVA 3UJTL 1FZJB 4EIZC 1MNUH 4Y5XA 4G8IB 3DV6B 1QLRB 3MGTA 3SE8L 1JPSH 4PJBE 2L7JA 3VRJA 4QHNB 1ZWIA 4ZOBA 5IMOB 5CJBA 1N5YL 3P30H 1HHIA 2Z35B 3NGBC 5JDSA 3OKKA 1LO2H 4LCWE 3PP4H 4Z0XB 4M5YH 4YAQA 3DTXB 3T0DA 4KI5F 1HHHA 4R8WH 3BE1H 3UPRA 1ZTXH 4WFFE 5CUSL 4D9LL 2CR6A 1NBZA 5I74C 5DK2A 2CMRL 3G6AB 4NCC1 4PJCA 3BSZH 5FO8A 4JM2B 1FV1B 1N4XH 5FYJE 2B1AH 3PE9A 5EUOF 5EZJA 1CCZA 4CVZB 4K7PX 4PJFA 4IOIB 1GRWA 3VFMB 1M05B 1YEEL 1U2HA 3TH3T 2NXZD 5EBLA 2VZVA 2F54D 4LGRB 3S35L 1A9BB 1F5WA 2NY7H 4P5MB 2R15A 5CHNB 2K9UA 5HVWA 1YNKH 2HKHH 4MJID 1R24B 5HYSB 4Y2DD 5FYJH 5T1MB 1LP9A 2A1WH 3I75B 4R26H 3VMPA 3ARSA 1EZVY 4MJ2A 4LRNH 1N0XH 3BUYB 4LEOB 5CEZD 2VLME 4X5XA 2ADFL 1CDUA 4MHHI 3UTZB 5AG9A 1DQML 4JFED 2KUTA 2WK2A 1QBML 5C70A 2ZCHL 4X6CF 5AZ2L 3CSBA 1Z3GH 3G04A 4YEFA 5HVFB 4F33A 2R4RL 2BMKB 3MCLL 4M43H 4MQXC 1HXYB 3BIAX 3KJ4C 4FQXA 2LV4A 1JBJA 3GK8L 2DM4A 1DQTA 4N8CL 1BAFH 4WJ5A 5DR5L 2VLRB 4JHWL 1R6VA 2NZ9D 4KV5F 4P2RB 4Z0BH 1N2RA 4ORGB 4GG8A 5GJSH 1PG7X 1D5MA 2JB6A 2ICCA 1NCWL 2A77H 5MI0B 4PBVC 3QNYA 4RFEA 5E8NB 2EDHA 4FRWA 3TVMD 4R2GD 5D5MF 5SWSB 2XKUA 3MNVB 1MWAH 1R5VB 1NFDA 4LASH 5DEGA 3C5ZC 1YEDB 43C9B 5ABDE 5D2NB 3G6JE 2XPGA 1N59A 3EYSL 4JO4L 1HSBA 1YEJH 2A38A 5IFHL 3MJ6A 4OM1H 2XWJB 2EEDA 3ARTA 1P5UA 5F7LB 1EJ6A 4PB0L 4X5LA 5ERWB 4EI5B 1I3RB 5EU6B 1LK3L 4M6OH 1RUPH 1A7RL 2CKNA 2H32B 4H25B 4WUKL 5IESL 1ZVSB 1GGTA 4JQXC 3WFBH 4L4VA 4L4TD 5IB5A 3OHXB 3QRFM 3LHPL 3PHQB 4GRLD 1H3GA 2QKIA 1KC5L 1GC1C 4OZ4B 1P1ZB 5DRZB 1C1EL 2YPVL 1ADQA 4UNTA 4HUWA 2JELH 5ALBH 4WWKC 1H3UA 1UEMA 3C09B 1FAIH 1M7IB 1GZQA 2VITA 3ROLB 1TXKA 1BGXH 4WFEE 2HVKB 4G8GA 2BSTB 2VE6B 5KSAC 2FCBA 1RJYA 1I7TB 2AABL 3SDDD 2R0LH 4YIQA 5AD0A 1RUKL 2ZJSL 2WBJC 1MHHB 2OP4L 3MLVH 4CNIB 4MA3A 4GRWB 1INDH 4G43B 4NKOB 3P4NB 5EWIL 1PGRB 3BPLB 3O41B 3VGAC 4DKFH 3LKRB 1E4WL 1YJDH 4M8VA 1G7HA 1GJIA 2E9WA 4KTDH 1RVFH 3DXAA 1N64L 1PKQE 5GRZA 4FN0A 4L8DA 2DKUA 1WZLA 2NY1B 4Z7QE 4NQEE 4RIRA 3T2NL 2XV6B 5DQ9A 2HN7B 2VQTA 4MDIA 4KZEL 2AJVL 1KLFA 4WU5B 5I0DA 4XCYA 3RDTC 1J8KA 2E7MA 3GMLB 5T3ZD 2ERJB 1G7QB 2EDEA 3GSXA 2VXUH 3WSQH 5MENE 5JQHC 1ZXQA 5ACZA 3VWKA 3HMXH 3GSVA 3NCYS 2BRQA 4PYHA 4UINL 3WIFB 1FL3A 1KEML 4L1DA 5GZOD 3LEVL 1W0WA 3H42L 2XG4A 1EMTL 4FABH 3TO4D 2VLLB 3H7LA 4NKDB 5D7LA 3RY6A 3C6SA 4YNYA 4D0CA 4AK1A 1A7PL 1IZKA 1NGZB 5F8RC 1JWSA 5D1XA 4NRXA 1F6LL 4JQVA 4AQOA 4EUPB 4JKLA 4LSPH 5TF1L 2B2XL 3T8XA 3B5TA 5CILL 1NCUA 4ONGL 4KUCD 2HMIC 2OJEA 2RFXB 3QDJA 4MQSB 5DMKA 4O9HL 3QYCA 1P6FA 1R3LB 3NPSB 3MRPA 4UI2A 5T1LD 5INDA 5GGVL 1G0YR 4NC2B 2OLDA 4XP4L 3VFPA 3QQ9D 1MJUL 1Q0XL 1OW0C 5GS0L 3QIBC 1AGBA 5C0CD 2CDGA 2VQUA 3RUGE 4DKEH 1RU9L 4LEXH 1R5WB 2E6QA 2OI9B 3CVHA 4LF3A 1IE5A 4TVPE 1QRNB 4UQ2A 1D3CA 1Z0NA 3TT3H 3NFSL 3WNNA 3BI9X 5E2TH 5KANI 4HMEA 9CGTA 5K9JH 4HUNB 4XPFH 4POZD 1JHKL 3N85H 4LCCB 1A02N 2IQ9H 2I5YH 2P5WD 5C6PB 4M6AA 1S9WA 3D9AH 3ET9F 3OB0H 2AXGB 1IGIL 1ZT7A 1T03L 1JMZA 2AV7B 4Y4KB 2JCCE 1CXEA 3EOAA 3HZVA 1A7QL 3AU1A 1UJ3A 1JGDA 3BZFB 1QSFB 4RX4A 4JFFA 2CUMA 1NEZB 3NVQA 3MV9D 3LN4B 1ORSA 1FO0B 3GMMB 4TSCH 3O45B 3U4EA 3CUPA 3V4VL 1YN7A 3VG0H 5C6TH 3TA3C 5FYLL 2D4DA 4XNQB 1FIGL 5IBUG 3GSNA 5KVEH 2IH3A 4IM8A 4GW4B 4JHAL 3C60D 4LSUH 4PJ7F 1UG9A 3VE0A 2CRMA 4JG0L 4JPVL 5DJ8A 3IVKB 5HTSA 4GAJL 2ADIB 1HHGA 1UVQA 2N7BA 3VXSA 1T7VA 4R4BB 3CPLB 4NO0B 1TNMA 5JPNB 2ESVA 3VFSB 4LP4A 5C0IA 1T83C 4N0RA 4YQXH 4ZO8A 3UBXG 3FCTA 3PP3H 4FZEL 3ZE1E 1WAAA 2FB4H 1U3YA 3BQUB 1D5IL 3JXAA 4TSAL 3UPCA 4FNLH 3IDJA 3OX8B 4N5EC 4C56D 1CD1A 4R4NC 1ES0B 3S36H 3MYZA 5JXEA 2MPAL 4YDIL 5CLTA 3RRQA 4KROB 1A21A 4P46A 3RU8L 4NWTH 1TTFA 4L5FH 4RZCA 4GSDH 4OV5B 1DBML 3UZEA 3VWJD 5HHOB 5JMOC 3LZFL 4N9OB 1G7IB 4NQDE 2LTQC 3I02B 5JA8B 4FTVB 1M4KA 2D7OA 1EEQA 4UNUA 4DKAA 1QKZL 3IAGC 4S1DD 4P57A 4WHYG 2AEPH 1GIGL 1KG0A 4PJXB 5EOQL 5C09B 1RMFH 4AH2A 5I1LB 4Z7QF 3JBG7 2AJUH 2AV1A 2RQ8A 4ZSOE 1INQA 4HC1H 5D71H 3WIIL 3GJFH 2JB5L 4BZ1H 4LFHG 3UDWA 3MNZB 3X3FH 2RR3A 1OAYL 3QHFL 1UWGL 5E8PA 4M03A 2X09A 4XGZA 1BVKB 3LKPA 3P73B 5IHUL 3D39B 3EIFA 4PR5B 1XIWD 1MFAL 2NY4C 3ZMRA 1IL1B 4EN3D 1SY6A 3MJ7A 4HGWB 1X5IA 4Q74A 5D7SL 3B4NA 4EOWH 5EO1A 1VFMA 3B9KA 4X8JB 1GOGA 1SYSA 5CD5C 1BQHG 4IS6B 4I9WD 1TZGH 4RGND 4C59B 3MO1B 3RVWC 1CI5A 1Q38A 2DJSA 1BD2A 4NHUB 5KW9H 4QOKB 1MCOL 3ZT7A 4PG9A 1V7NL 4G6MH 3KYNB 5JIHA 1P2CA 3ARFA 2Q87A 1OLLA 3GUTB 3H9SD 4N90E 3C5JB 3OKMB 3RWFA 1IQDA 2J12B 3BH9A 5EBWA 1MQ8A 1AY1L 3G6DL 3FRPG 4Q6IB 1G1YA 2OMBA 3GGWB 1MCBA 3HZKA 1LEIA 4ESKA 4XCNB 3MRQB 4MAYA 1QQDB 3MLYL 4HUUA 4ZPTA 3KYMB 2YD5A 3IDYC 3VA2C 1ZT4A 5DHVB 1DTUA 3SKNA 5TFSH 1BECA 1A6UL 2ENSA 3H9HB 3RIFF 2ZSVA 1BQUA 3LEXB 1PQZA 2YA1A 3MRCB 1WZKA 2XQBH 2ZNXA 3C8KB 3GIZL 4A6YB 5TPWH 2WUCH 4HT1L 5E1AA 1MLBA 3ULSB 2GJZB 3B2UD 2R0ZH 3VDCA 3VCLB 2DKMA 5CIPA 3IAQA 1T04B 2FL5B 2DLEA 1TVHB 2P5EE 2MTPA 1JWMA 5HD8D 1YNTA 3L3OA 4I5BB 3O2DH 4HMCA 4PLNC 4CVXA 1FPTH 3EYQC 3VXRE 2X4OA 3CFEB 1M6OA 1OSPL 1WQVT 2Y06L 3CVHL 1Z9OA 3QQ3A 4YK4B 2JCCF 4CADA 5DURB 5TQ0H 2YZ1A 3TYGL 2DIAA 3P11L 4U2YA 5E08H 3PWNA 4F7TA 1CXKA 1N5AA 5TDPB 2F53A 1DUZB 5CP3A 1K5NA 3QQ4A 4ZAKB 5L8LB 5KVFH 5BV7B 3N50A 2VDNL 4P59L 4UIMB 3QWOA 4JO2H 1Y0LB 3ARGD 2E7LA 2GHWB 2BSED 3U7WL 4LSQH 2OR8A 2BOBB 1JZ4A 5EPMA 1KCUH 1TTGA 2BVEA 1WZ1H 3UTQB 3LCYA 3QPXH 3O2VH 1U8NB 3TIDB 2B7DT 3C6LA 3WLBB 4LSVH 3GI9H 3JSSA 1SVZA 3GMQA 4QXGL 1Q94B 4JM4H 5J3HC 1P7QD 3RVXD 3RI5K 1H8SA 3DX6B 5DO2D 2D2OA 2Y6SD 5L88L 3ISWA 2MQCA 2WIMA 3ZE1F 4PRHB 4Z78A 3QRGH 4MNQA 1YNLL 4PJIE 1L0XA 3DSFL 4RDQF 2YUZA 3GSNL 4KTEH 4K3HA 5D72H 3QA3A 5T5FH 3X12A 1D9KA 5DK0B 1K3ZA 1D6EA 4R9HA 3O9WD 1NUGA 1U58B 1VGEL 5FUCE 4M61B 1IGCH 1T80A 4G9FB 1WT5C 1WV7T 2YRZA 4AL8H 5HHMD 3HE6A 4NRYA 5ILTH 1U8MB 2Q86B 1S9VB 4I4WB 2NXYC 1HHJB 1RK1B 1JZ5A 1Y6MR 4XI5D 1T7ZA 3QCTL 1TQCC 2BNQA 3ZE0F 3IFPB 4JFQB 3FO2B 5E94B 1HCVA 4Y88A 2F19L 3QUZC 2IAMD 1KN2L 5ID0A 1BIIA 3CDCA 1AJ7L 3H3BC 4KGJA 4RRPA 3QIWA 1BF2A 1OPGL 3OAUL 5KG9B 2QADC 1FGNH 3UTOA 1DBAL 2DQDL 3EO1B 2PXYA 5I6XB 1BZQK 5C0BE 3ZT5A 3HA0A 4U1HB 1A14L 3UTSE 5L7XH 2B4CC 3MZGB 4KTYA 5FB8A 1MCDA 1QFPA 4XB7A 4DZBA 1U3HC 2KKQA 2V7NA 4O2FB 3VFRA 3NZHH 2HFEB 3HUJF 5D7IE 3BN9D 2Z0BA 2M26A 2BFVL 4XWGH 3V0WL 1SJHA 2ED8A 5KVDH 1FFQA 4ISVB 1ZHNA 5C0NC 4GLRH 1NBVL 2R29L 4WEBH 4G80B 5GXBB 1TJHL 1KJ3H 2J4WH 5EIIB 1OM3H 1TCMA 3MLUL 4L4TB 2IADA 5TDOB 1MHCA 3GI8H 4HS3B 3M8OH 4LVHB 3IB4A 1IKNA 1KCRL 5J1SC 4P99A 4BELD 5HGBB 2DMCA 1A3QA 2ICWI 3F7RA 1KENL 1SY6L 4PV9A 1OWWA 5GSRA 4LK4A 2YK1H 4UT6H 3K8LA 3TT1L 2AJSH 3RIAK 3IFLL 4KKBD 3RWDA 2P46B 1FFOA 1W0YT 4KKCD 5D7KE 1UFUA 2D0GA 3FQWA 4EDXA 3KPSA 1RJZA 2J8OA 1RZKH 5FOBB 3GJEA 4K2UH 4Y2OA 1IC5H 4M5ZH 2CKBH 5HDQL 2CK0H 2C5DC 1DQQA 2PO6C 4FXLA 4L9LB 5JW5A 3MSPA 1ZHBB 4I77H 2EYSB 2J1KA 1MFBH 5GZNC 4KKLC 5HY9B 4XBPB 5BZDB 4JJ5B 2B0SL 4X9IA 5C0EB 3RVUC 3RX5A 3U46B 4RCAA 3KNBB 1H3VA 4X6BA 1I1AB 4P23C 1YA5A 3SY0A 2AQ3A 1FFNB 3L1OL 4LNVA 4FQQB 2J2ZA 4YFLI 3DV4B 4WV1A 2EDFA 5EB9A 1RHFA 4F7PA 1V5JA 2YEZB 5K9QG 3EOYG 4HWEL 5EBMA 1FBIH 1WBYB 3V5HA 1ACZA 5DD6A 2Y5TB 2UVFA 3BH8B 5CBEB 3RX7A 1HINH 3ZLQC 3MUGB 4W4NA 3MV8B 5D6DA 4M6ML 2Z91A 3ARBB 5DUPL 3REWB 4Q9BA 4HEME 3B2VL 4E42A 5F9JB 3CSYA 1N6QH 1I9EA 4IRJD 1OGTA 4EEEA 3D25B 5L9DH 4RMRA 1NLBL 1VACB 4JRYA 2W65A 4O2CB 3ZYIA 5DDHB 3IKCB 2X44D 1MCQA 1Q9KA 3BKCL 1KELH 2NY3B 1F90H 2W38A 4ODVL 2COQA 2YOCA 5I30L 2EKJA 5IMMA 2VLRE 1LO5A 4G5ZH 4O2EA 2WM0A 3K8KA 3UJJH 3QJHB 1RUQH 4IRZH 4OLVH 2EDOA 1EJOL 1WC7A 5IIEA 4CMHC 3VXTA 4AG4L 3BPCA 3RNQA 3MREB 2EZ0D 3WUWB 1I8LA 4P2YA 5SWSE 1JZ7A 3W0WE 4BFGA 5T1LB 2WP3T 2IWGA 5DVNA 5D2NE 5D4QA 3BMVA 4M48H 1EGJA 2X4NA 4V2BA 1T22A 4YPGB 3O3AA 4TVSa 1AGEA 1FNFA 1A2YA 3KLHD 3I6LE 5C0CB 4ZS7H 5EU6E 4ZNEE 3D2UB 4MYWB 5DJYA 1BREA 2OXGA 1VFAA 3BIKA 1HHKB 4WI4A 5JW4R 3PXHA 3OBAA 3QAZB 3S4SB 3HPLA 3OKEA 4HFUH 4O58H 3DURA 3MLSL 3TYFA 4QHLA 4PG2A 4U0QB 3VXQB 3DO7A 4OLYH 4ONHB 4YHYC 3RP1A 3SDXF 2LAGB 2FATL 3L7FB 4LVOC 4OCWL 5FK9A 1T5XA 3CC5B 3ULVL 2H32H 5A2KH 2DLGA 2IG2L 2FX7H 1XZ0B 2NYYD 3E6FB 4YO0A 4JPKL 5F1SA 2PR4H 1J8HD 1AKJD 4YR6A 5D7IF 2OL3A 4LFHD 2EO9A 4H0HB 4OD2A 2O5ZH 4NQXA 1D5BA 2IANB 3VXNA 1T20A 1XCTB 2VDLL 1F3DJ 1VEMA 4H1LA 3OQ3B 4GRWE 1NGQH 3V4PL 4L1HA 1FRGL 4OZHB 2VLKA 5FUZL 5I71B 3O6LH 4F8TA 4F58L 4MA7L 2VSCA 3C60B 4YFLF 4XH2A 4MA8L 1INEL 3AUVA 4PBXA 1MUJB 3BDYH 3IFOA 3ULUE 5FCUH 1FSKC 5BS0D 4K8RH 5DMIH 5J1AA 4N9GA 4ZMAT 4KQ4L 2HFGH 5C0GB 3KXFA 2W59A 2DIBA 1D5XB 5IVXA 4NDMA 1CICD 3MLZL 3CVIH 4FP8H 1QNZH 4MA1C 4LGPB 2H45A 3QDAA 5HHPB 3FTGB 4C56B 1GOFA 2VZSA 3L9RA 3ULUH 4ETYA 4AEIL 1XGUB 4E41D 2K7PA 4M7ZB 2C7UB 3T1FA 5F8QC 4JR9L 4HS8L 3BRFA 3MCKB 4YHLL 3RAJH 2J8UA 4JM2F 1CD9B 4M7JL 4HFWA 2DYPA 3Q1SL 1N8ZA 5FECA 1G9NC 1CTOA 1QEWA 5JQ6L 4ZTOL 7CGTA 1I1FB 2P1YA 4HIJA 4HMDA 3IFNL 2WLYA 2UUDH 3NFNA 3T77A 4JE4B 2Y7QA 3WFDL 1FVDA 5IEHB 2XZAH 2CK2A 4YHML 2NY5L 1KPRA 1IAIL 1U8QB 5FYKL 1F3JB 3U1SL 5ESVB 2EDKA 4J1UB 5DJDB 3QWRD 1MVUB 1TITA 4K23L 4Y19B 4HWUA 4KXZH 4PLKD 3WIHH 3O11A 3QDMA 5EZIL 3L3HA 4EUPH 3QIUA 3LS4H 1MFDH 1WJ3A 3P4MA 3LIZL 4LSRL 3CIQA 1TZIB 1XIWB 1B0WA 1P4IH 3GFUA 1PYWB 1KACB 4I3SH 1HILA 2Z8RA 3V9FA 3FO0H 5BMFL 1X5AA 4PREB 1QRNE 2OZ4H 4U6HB 4YDJA 4HJ0C 4KXZI 3U2SA 2HG5A 3QDGA 3TBTA 2RIKA 3NN8A 1J88A 3L3IB 1AHWA 1XGRA 4U0RC 2R1WB 2HJFA 4S10A 4RQQA 4WHYH 2VDMH 3OR7B 1S9XA 4PGEA 1QACA 4ZXBD 4GW1B 1JZ6A 1DVFB 4H0GA 3RX8A 3EOTL 2VN7A 4XP9H 4O4YH 1H15B 3S5LA 5JMRA 1DN2A 4PRDB 2EE2A 5KOVC 3SE9L 4HK0B 3VXMA 4DQOL 2R1XB 1V3MA 1YMMB 1QSFE 2AJXL 1A7NL 1CL7I 2AK4B 1FZMB 2I9TB 3R0MA 4J4PD 5EUOA 5EG6C 1UGNA 5HGDB 4HDIB 5J11B 1JCKA 3K81A 3S98A 4DKDC 1CGSL 2HLFC 2O26U 4I3RL 5FFLA 3PGDA 4HKXA 4MAUH 4XNYL 1AGDA 1YC7A 2CR3A 4JY6B 2AJYL 5D1ZD 5E9DB 3O6FA 1QO3A 4TUOB 3QDHA 3MZTA 4MSWA 1EGJL 4XAWH 4F7EA 1RZJC 1YZZA 1SBSH 3KPQA 4Y1AA 1TPXB 3TEUA 2X70A 3QWQB 4R0LB 1L7TH 3EO0A 1A6WH 2W0LA 4M62H 3VGEA 1U95B 4X6CA 3LSOA 4WGWB 4B0MM 4F57H 1HE7A 1RIHH 1S5IL 1RZFL 5LG1A 3E8UL 3R06B 2CGRL 5F7EH 3WHXB 5JPMB 1NUFA 3CDGA 5JIKA 4I18B 4OZFG 3MXVL 3P3YA 3EFDH 5D1XC 4YBQD 4JQVC 3EYVA 1GHFL 4LBEA 1FORL 4KRPD 4UTBH 4XAKD 4BSVA 2DD8H 4XMPL 5HYIA 3H2WA 4NJAH 3HZYB 5HHOE 1NCAL 3ARDD 4JKMA 3BZEA 4YE4H 3KYOA 5F9OL 2XTJC 1P9MC 4KHXL 4FTVE 3QXDB 2VDOH 3G08B 1AR1C 4X7CC 4ZFZA 3MV7B 2OL3L 4PJXE 2XQYK 1HNGA 5C09E 5D5MA 2XRAH 3MBEB 2V17L 2ARJB 1WFTA 2GY5A 4XVSH 4EQ2A 4JFDE 4JANA 2GEEA 1J5OL 1BQLH 1YECL 4U05A 2MWCA 3UC0L 5F89B 4JO3L 1FZOA 1RIUH 4L3ED 4PGCA 4G42B 1GSMA 2XNAB 4QEGA 3TBVB 2BVUA 1BWMA 4PJGA 3UTPE 5CEXA 4JZOA 4P5TA 4KK8C 4NRZA 3D39E 3WYRA 2NNAB 1A7OL 5IJKA 3RWIA 5KN5A 3PQYA 3IETA 4XMKH 4HULB 4R96A 1NH6A 1UA6L 1XH3A 32C2B 5ANMB 4JFYA 3DGGA 4BFIA 2AI0L 5FGBC 4HX1A 4QOKE 5HHXL 3JUYA 2EH7L 2HH0H 4TULL 5E7BA 3L5JA 2XICA 3IDNB 3QP3A 3UPAA 4YXHL 4X9GA 3E2HC 4YZFE 15C8L 4KDTA 1BFTA 4ODSL 5ETUB 3Q6GH 2HVJB 1EUUA 1ZA3B 3NGBB 4NYLB 4LP5A 5D70L 5CD3B 4MGXA 4Q9QL 5DWUL 1VESA 5J7CC 3MJ9H 3O2WL 5CBAA 5IWLC 2OQJA 1R3JB 4LHUG 5LGHL 1FGVL 3NCCB 5FA3A 1NBQA 5BCAA 1L9MA 1DQLL 1H5BA 3F6IA 4D0BA 3KDMA 1JPST 1NC2D 3V0AC 1ZGLA 4U1MA 3U9PL 5I74B 2FHCA 3ES6A 2BJMH 1EEUA 3QSKB 4DUVA 2I07A 5BZWB 3S96A 5H37H 3D3VD 4OCXH 4JFPA 4HUMB 4WI5A 3SDCD 3VFWB 1NUNB 3RKDD 4R4FH 1DN0B 1N3NB 5C08D 3IJYB 2YD7A 1EFXD 1CDIA 4Q58C 3I6KA 4GXVH 1KB5B 3GBNH 4PJEF 3EO9H 1AGFA 3DVGB 3RHWF 1U8JA 1KTLB 1Q0YH 5CZXC 5CP7A 3TN0A 5C07B 1U8OA 1DLFH 4LPVA 3FQTB 2FJHA 1WBXB 5DUBB 3DHMA 3HNVL 4FMFA 1E6JH 4HF5H 4A6YH 3BKJL 5DJAA 1TENA 4S0SD 1P53A 4DAGH 5B38A 1KJ2A 4PJ9D 4U1IB 35C8L 2FLRT 1FL6B 3ZTJH 1MFNA 2C4FU 5KVMC 1KNOB 3OXSA 1I9JH 2OK0L 4IIQC 4L8SA 4KK5C 5DC0A 3KJ4B 1KLGA 2FJGA 1T3FB 3NOIA 3VGBA 1ERNA 2ZUSA 2BX5A 3QEGH 1YY8A 4LVNC 4GS7B 2DWEA 3BYTA 4JDTL 2GK0A 5EFIB 2AK1L 5AAMA 3W9DB 4Z8FH 1E4XI 3FB7B 4YHKH 3JVGA 4BKLA 1GGCH 4LSTL 3FT2A 4X4MA 4OIBA 1C5CL 1I7UB 3C5ZB 4PRHE 5E5MA 1E4JA 3R1GH 3RKPA 3O3BB 4F15B 2X1PA 5L0QB 3HE7D 3B9KC 3UAJC 4U6VL 5FYJU 3KR3H 5IW1B 5F7UA 2A9NH 1VGKB 2ZZUT 1L0QA 1MWAA 4RNRA 1PLGH 3UCRA 4G9FE 3WCYA 5MEOA 5HHVH 3ARFC 4NNPH 3ECBA 1DBBH 3ZE2E 5LXGL 5T1KB 4HKJB 2VDPH 1LEKB 2AGJL 2FWOB 2DWDB 4R97C 4OAWB 4JLRB 5DI8A 1PX4A 5EC2B 2G2RB 1XGPA 4KJQD 4X7SL 1A4KA 1DP0A 4PJXF 1AIFB 5GRVK 4WWKB 4CU7A 1MI5A 2I25N 1DQDL 4L4JA 1U41A 1JL8A 1Q9LB 3QI9D 2DBLH 5LQBH 4JVWA 2IGFL 5TDNA 3T1WA 3E3QC 4QXUL 4HXBH 1G6RH 5MP6L 2ZCKH 4MJ5B 2R2BB 3MTRA 5HHNB 12E8H 3SGJA 1FL5B 1A1OA 5F6HJ 3DX7B 2BY2A 2Z31A 3RWHA 3UBXB 4PJ7A 1BLNB 4G6FD 3SJVB 2R69H 5IJVA 3HCVA 2BSRA 3DBXA 1NAMB 2VZ3A 2JJSA 2GJ6B 1ZHKB 1ZSDA 2ZOLB 4OM0L 3PNWB 2VWEE 5I1DB 5L2KD 4WI2A 5K9QI 5I18H 5IMLB 1G6VK 5B22A 1A1MB 4XBEL 4L4TE 1I7ZB 4Q2ZB 4H20L 4XXCA 4YXKH 3HLAB 4QRPD 3O4LA 1W72B 2Y07L 3S3PA 3SDYL 5IR1B 3HI5H 3KLAA 4EVNA 4QTIL 4FQ2L 2VR4A 3RDTB 4JY4B 2F54A 5CAYB 1ZKAA 1QYGH 4I1NB 4NN7C 4GBXA 4PLJD 2E7LC 2N4IA 4MJIA 1EEYA 3LMJL 4NNYA 4Y2DA 3BHBA 1UXWB 5GSVB 4PTTA 5FO7A 4CUCA 1J8HB 3QZWB 1ACYL 1AKJB 4XZUB 2XFXB 4YHIB 5F6IC 3IT8D 4NCDA 4OCRH 1ZLSH 2R56H 1PKQA 2X42A 4MXQD 4JQIL 1RFDH 3M1BB 5D1QD 2DJ4A 3VJ6B 4NQEA 1MNUL 2EC9T 3HMXA 2FYYB 5I8EA 4P9HC 2MMXA 1JHLH 4JGUA 3FAXA 1I9IH 1LK2A 1BOGA 3OMZA 4OUUA 1CFQB 3RWGA 1VEOA 3P30L 2PNDA 2QSCH 4ZUWA 5H2BA 1LO2L 1D9KC 3PP4L 1AQKH 3K4DA 3S37X 4M5YL 1GH7A 2IALB 4J8RB 5IVZB 5H35A 4R8WL 3KPMB 3BE1L 3WFHA 5IGXH 1ZTXL 43CAA 5FA4A 4M4PA 1HCFX 4Y5YA 3ZSTA 3SCMD 1CFBA 3RWCA 1UZ8A 3HE6C 4NO5B 3QIBB 2YBRB 3TVMA 1B0GA 2CLRB 3MV8E 3STLB 3VRIA 4AIOA 2E7CA 3BSZL 1WITA 4ZFGH 4WCYH 2B1AL 5FM8A 4UV4H 2GCYB 5T3ZE 3BW9A 4GRMA 1NCDH 2R2EA 4NZTH 4ELMF 4ZS6D 1NBYB 2EC9U 4S1RH 4R3SB 2B20A 3BD4A 4E41B 4EKXA 3IDMA 5CWSA 3FOMA 1QLFB 4R7NB 1Q72H 1D5ZA 2NY7L 1OAUH 3TZVD 3W11D 3FN3A 2VUYA 1KJ2L 5MERA 4X98B 2XKNB 1MLCB 4GRLA 5T5NF 4ZYKB 3WFEH 2DJUA 3DLQR 1KIRA 1IM9D 4FFYH 5JXAL 5SWQA 4P9ML 3DETC 4LRNL 2E7BA 1F6AB 3S7GA 1HWHB 1QSEB 1JMXA 1BFVH 2NW2A 4U49A 1QPXA 4EI6A 5HI5C 3NFPA 1Z3GL 2R9HD 3O8XD 5E6IC 5GS0D 4EZMA 3DMMD 4M43L 4QRQA 4X9HA 3P77A 1XR8B 1PEZA 2Q7NA 4QXTA 1YN6B 1WZMA 2KQMA 1C08B 4G6AD 3TA3B 4HAGA 3SDDA 3V7AG 1BAFL 3ZE2F 4RAUA 3QG7H 5T3XD 3RZCA 4WY7H 4S2SB 1NANH 1CS6A 4I48B 4Z0BL 5GJSL 4FFWD 4ETQB 4DVBA 5A3IC 4CRPA 2A77L 1M7DA 4NOBA 4GFTB 1UM4H 1JV5B 4EBQH 3MLTA 1CE6B 4DUWA 1MWAL 1QFWH 4LASL 4P2OB 3QFDA 2HP4A 4GKNA 2V2TA 1HKFA 3EDJA 4BSJA 2R23B 5FHBH 3O3DB 4Z76B 4FQXD 2WWMD 1YEJL 5L2JB 3QBTB 4OM1L 4BK5A 4ZXBB 5C0FA 2A6IA 3FFCA 2VYRE 1NGYB 1RUPL 1S7QB 2MSPA 4OI8A 3RBSA 3PUCA 2BOCB 3G5ZB 3P0GB 5AG8A 1B90A 1QFWI 5JHDB 2X9YA 5BO1H 1YYLH 3H6JA 4XXDA 2IANE 5FYLD 2NY2C 1E6OH 2LTQB 4XP6L 1I1YB 5EUKA 5IV2A 2X4TB 5DK3A 1MIEH 5ID1B 5A2JH 5I75C 1QVOA 2UZXB 4J3XA 2JELL 5ALBL 4L8CB 3QFJD 3MRNB 4RAHA 4OZHE 1FAIL 4Y5VC 2Q8AH 1U6AL 1JF5A 4ACPA 3TO4A 3PGCB 4MJ6A 2YA0A 4NQCE 5KSUB 3LQZA 3UXFA 3MODH 3OKNB 4HHAA 5D6DC 5LGJB 4HIIB 5DFWH 3L3GB 3GSOB 1X3DA 3GMNB 1A6TB 3S3SA 1FLRH 2R0LL 1DQJA 4L4VD 4NUGH 1YEHH 1T1WA 3RWEA 3MLVL 4HC1A 3GJFA 3KPLA 2ZOKB 4F37K 2NY4B 4FFVD 1INDL 2NX5D 4JRXB 1G9MH 1S7VA 3QULA 4C56E 2GTZB 1YJDL 4PRAB 4LHUD 4Z5RB 4KTDL 1RVFL 4KMQA 3VA6A 3RTQC 3KG5A 1V05A 2PYED 2R1YA 3ABZA 4G8GD 4V1DB 5BXFB 1F45A 1HKLH 1T21A 3O0RL 3EFFB 1KTRL 2BHZA 3U36B 5ISZB 3LKOB 1Q9OB 1FJ1A 4TTGA 1KULA 3ROOB 1OP3H 3KPPB 5HYJB 3S8WA 4PGZA 3RJQB 1I8LC 5A43C 1WCQA 1MAMH 1OSZA 3A6BH 1T0NA 4QRTA 3CFDA 3SEPA 4XCEA 2X7LA 2QLVB 3FJTA 4Y4FB 2VXUL 3WSQL 1JHTB 3HUJA 2K1MA 3IDYB 4OZGB 4DTGL 4G7YH 3HMXL