4JHQA

Crystal structure of avidin - 6-(6-biotinamidohexanamido)hexanoylferrocene complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
124
structure length
124
Chain Sequence
RKCSLTGKWTNDLGSNMTIGAVNSKGEFTGTYTTAVTATSNEIKESPLHGTQNTINKRTQPTFGFTVNWKFSESTTVFTGQCFIDRNGKEVLKTMWLLRSSVNDIGDDWKATRVGINIFTRLRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Avidin
publication title Ferrocene-Biotin Conjugates Targeting Cancer Cells: Synthesis, Interaction with Avidin, Cytotoxic Properties and the Crystal Structure of the Complex of Avidin with a Biotin-Linker-Ferrocene Conjugate
doi rcsb
molecule tags Biotin-binding protein
total genus 28
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 4jhqA00
4GJSA 1PTSA 4GDAA 1MOYA 4Z28A 1VWCB 3MG5A 1N4JA 1VWFB 3SZJA 1SWOA 4CPFA 3WYPA 1I9HA 1RSTB 1SLFB 2IZHB 4Y59A 3RDQA 5B5GA 5K68A 1STRB 2QCBA 4BX6B 1SWDA 2IZFB 3RDMA 4Z2OA 1STSB 1LDOA 1Y53X 4YVBA 1VWOB 2RTDB 2A5CA 3RDSA 3RY2A 5K67A 4OKAA 2CAMA 1LUQA 1VWPB 4CPHA 2IZBA 1HQQA 1VWIB 3T2WA 2UZ2A 4U46A 2RTRB 3WZNA 1VWGB 1SWEA 2IZGB 3RE5A 1VWNB 3MM0A 2ZSCA 1NQNA 2WPUA 1VWMB 1SWPA 4GGRA 1LCVA 1VWDB 4Z2VA 4DNEA 1SWNA 1LDQA 2OFAA 1VWJB 2IZEB 1SREA 4BX7B 1KL5A 4BX5A 5JD2A 1VWAB 5CHKA 1RXKA 2Y3EA 2RTCB 2IZDB 4CPIA 5F2BA 1LCWA 1N9YA 2UYWA 1HXZA 4IRWA 1SWBA 1VWLB 1VWKB 2OF9A 3VHIA 1SWJA 1SWQA 1Y55X 2GH7A 3EW1A 5L3YA 2Y3FA 2RTHB 4JNJA 1RXHA 4JO6A 4I60A 1SLDB 5IRAA 5B5FA 5CSEA 1HXLA 1SRJA 1SWUA 2RTFB 2RTQB 4Z6JA 2RTGB 2RTKA 1LELA 3VHHA 1MM9A 1SWRA 3T6FA 4Y5DA 1WBIA 2F01A 1KFFA 2FHNX 1HY2A 4JHQA 2RTEB 3RDUA 1SLGB 1MEPA 1VWHB 2C1QA 1SWKA 4GJVA 2C4IA 2IZLB 2RTBB 4BCSA 1N43A 2IZCB 3WZQA 3WZOA 1AVEA 2G5LA 1SWGA 1IJ8A 4GGTA 1NC9A 4BX6A 1SRIA 3T6LA 5IRWA 3RY1A 2FHLA 2RTMA 1SWTA 3RDXA 1VWEB 3RDOA 2A8GA 4CPHB 3VGWA 2IZIA 1RXJA 2MF6A 3X00A 1SWLA 2C1SA 4GGZA 3T2XA 1MK5A 1STPA 3WYQA 3WZPA 1VYOA 3SZIA 3SZHA 4Z2PA 3EW2A 2BC3A 2OFBA 1SWCA 1SWHA 4BBOA 2RTIB 4BJ8A 1KL4A 1SRFA 2Y32A 2IZJA 4GD9A 1VWQB 2RTJA 1NQMA 4BX5B 1RSUB 2AVIA 1AVDA 1VWBB 4BX7A 1SRHA 1SLEB 2IZAA 1SWAA 3PK2A 2A5BA 1NBXA 5IRUA 1DF8A 1SWFA 4Z27A 1NDJA 1KL3A 1RAVA 1N9MA 1N7YA 2JGSA 1SRGA 2OF8A 1Y52X 3FDCA 2IZKA 3RE6A 1VWRB 2RTLA 2RTPB 1LCZA 3VHMA 4CPEA 4EKVA 2RTNB 2RTOB 2RTAA 1SWSA
chains in the Genus database with same CATH superfamily
1DZJA 5BVSA 1MOYA 1VWCB 3O19A 4QZTA 1DC9A 1SWOA 2BS6A 1Y9LA 1L6MA 4ZCBA 1IKJA 2GTFX 3WJEA 1OSPO 1KZWA 3RDQA 2A0AA 5B5GA 4MISA 1FEMA 1YUPA 1U17A 4A1YA 2IZFB 1TVQA 1A18A 5B11O 3WOVA 4B55A 1G7NA 3BS2A 3V8UA 3ZWEA 5B2AO 1FE3A 3S26A 4ORWA 2WEWA 1YWDA 3NR3A 3T2WA 1JJXA 4EFGA 4MEEA 4YDBA 2WR6A 1GKAA 2IZGB 3RE5A 1ZNLA 3MM0A 4QNIA 3CKFA 4GNWA 1MX7A 2ZAIA 3HWEA 4GGRA 4DCBA 2BT9A 2LKKA 3UEXA 1BRQA 3I17A 4Z2VA 5D45A 2O62A 1OPBA 2OFAA 2IZEB 4ML7B 4LQZA 3ZW1B 1UYOX 1HMSA 2FS7A 3F6ZB 3WBGA 2OZQA 2A3FX 4ZH9A 2QOSC 4IB6A 3P6GA 1QWDA 1RXKA 1DF3A 5K06A 5FFHA 1NGLA 4IRWA 4AZMA 1PBOA 1VWLB 2K23A 1EPAA 2FR2A 4IMNA 1SWQA 1Y55X 5H9LA 4AYHA 5BVTA 4KH8A 2X8FA 4NYRA 5H9AA 1RXHA 4JO6A 4IB9A 5EZ2A 5IRAA 1E00A 4Z6JA 1GT5A 1KT6A 4GK9A 1UREA 1RLBE 1T68X 2RTKA 5B3MO 3FEKA 4RUNA 4Y0QA 1O1UA 4TKHA 2WWPA 3BU1A 4Y0SA 4XMDA 1AVGI 2OVEA 4RUUA 1IFBA 2C1QA 4LZUA 1N0SA 1T0VA 2IZLB 2AF5A 2RCQA 2WSJA 3FW4A 3KQ0A 3FR2A 3PDFA 4LKTA 3WZQA 4I6SA 3WJFA 1AVEA 3JSQA 4GGTA 1IJ8A 3I0AA 2ANSA 4HPCA 1I78A 1SRIA 1XKIA 3NBXX 3Q6LA 1YWCA 3RY1A 3ZW2A 4BX6A 3DTQA 4N7CA 1SWTA 3RDXA 5AJCA 1EXSA 2LFOA 4R0BA 4U8UO 2MF6A 2G79A 4Y0RA 5AEOA 2KT4B 5C0NA 3NPOA 4MIRA 1SWLA 4GGZA 5BVQA 5LJBA 1GKAB 1SMPI 2CBRA 5FENA 2OYBO 3FA8A 3WZPA 4BOEA 4ZHCA 2KW1A 4NP1A 4ODDA 1KT5A 1GGLA 2OFBA 1R0UA 4ON1A 1X8NA 3RZYA 1KL4A 1SRFA 2Y32A 1MUPA 2X56A 1MX8A 2AMMX 3FEPA 5FQ6E 1LICA 2FWVA 3N91A 4IB7A 4AZNA 1RSUB 2AVIA 1AVDA 2DJGA 1Y0GA 4FBVA 4YKMA 3EMMA 4MVLA 1SWAA 1JZUA 3AKNA 3APUA 2ALLX 1LNMA 1SXXA 4CDDA 2AH7X 4O4XA 2Q2MA 4WBKA 3GE2A 4ZGFA 1NDJA 1KL3A 1RAVA 2OF8A 2OY7A 4A1HA 1HBQA 1Y52X 1MDCA 2L9CA 5F1EA 2RTLA 3OJYC 3FA9A 4TKJA 1SY1A 5DPQA 4YFRA 3P02A 1E2TA 1W5RA 3ZZVA 2FTBA 1CBSA 3FIDA 2W2FA 3OE3A 4I9SA 1JQPA 2G78A 3FIQA 1PTSA 4GJSA 4XMHA 1OBPA 3SZJA 1HMRA 1VWFB 3EYCA 4CPFA 3SLOA 3VE2A 4GKCA 4HPBA 1GX9A 1RSTB 1SLFB 4IBAA 1GT4A 2OVSA 2YMSA 3BY0A 2HYSA 2M4LA 2AL0X 1ERBA 2BLGA 3WJCA 3RDMA 4BX6B 3PQUA 4Z2OA 5HTDA 2FRSA 3D4RA 5D4AA 1X8QA 1BEBA 2Q39A 2X4MA 4YVBA 3CKGA 2OY8A 2RTDB 3RY2A 4QZUA 2RA6A 2OL6O 3FR4A 1VWPB 2LA7A 3PP6A 3DSZA 1YP7A 4U46A 3ZI8A 1IIUA 3WZNA 4Y0PA 2AKQA 1KXOA 1OPAA 2RQ0A 1JMXA 1SWEA 2GJ5A 2ZAGA 3APWA 2LB6A 3PEDA 3ZUOA 1E5PA 1B0OA 4LKPA 1VWMB 3APXA 1SWPA 2EU7X 4DNEA 3F9DA 3QQ2A 1ZNGA 4ZHHA 1SY2A 4YCEA 3U03A 5KIDA 1KL5A 2IFBA 5JD2A 3P6FA 4MVKA 2RTCB 2GTLO 4N7DA 5F58A 1SXWA 5F2BA 1Z24A 2E4JA 1K24A 4YFQA 2CZTA 3NADA 1VWKB 3VHIA 5HBSA 3EW1A 5L3YA 1ZNEA 2JN3A 1TW4A 1G74A 5AJBA 4ZR2A 3VG6A 5KICA 5LKEA 2X34A 3BU9A 3D97A 5CSEA 2HMBA 1BWYA 1SWUA 1I4UA 2L5PA 3Q34A 1QY0A 1DZMA 1QFVA 4FBOA 4NYQA 4KIIA 4MVEA 1LELA 1KQWA 3APVA 3LTWA 2Q4NA 4QYPA 4Y5DA 5EPQA 4ZH6A 3P6DA 2G7BA 1WBIA 5LJGA 3C77X 5F6ZA 4CDFA 1UZ2X 1SY0A 3FW5A 4YGHA 4KCAA 4TLJA 2OY1O 2YG2A 4GETA 4GJVA 2RTBB 2MHDA 3IA8A 4K19A 5FAZA 2IZCB 3JS1A 1JIWI 3HPEA 4A8ZA 3TGBA 3FLLA 5BYPA 1NC9A 5HCCC 1CBRA 3VE1A 5IRWA 2MM3A 2Z4IA 3VG4A 2RTMA 1O8VA 2AT6X 3UEUA 2G8CO 3KFHA 1PMPA 1JJUA 2IZIA 4ZHFA 3KZAA 4OMWA 4CK4A 4D6AA 2RD7C 1A3YA 3F8AA 2OY5O 4U8UN 1S2PA 4QYNA 4CSBA 4OS0A 1MK5A 3WYQA 2QO5A 4EEJA 4OS3A 1ICNA 1VYOA 5EDBA 5HTEA 2NP1A 3SZHA 3WJDA 3HTYA 1HN2A 2MWHA 3NQKA 4BBOA 2RTIB 4BJ8A 3SAOA 2FT9A 4CV7A 5LJDA 2CZUA 1X71A 3O2YA 3C78X 4QAEA 4BX7A 1QFTA 1VWBB 1B56A 1SRHA 3BLGA 2NNQA 5B27A 3PK2A 4OELA 3VU1A 3EC5A 4YMYA 4ZJ0A 3GAQA 1QY2A 4YFPA 1NBXA 4I9RA 1DF8A 1QABE 2HLVA 1MVGA 2K62A 4YGZA 1SWFA 4Z27A 1BSOA 3FA7A 3VG5A 3VPJE 2KTDA 1LFOA 1BSYA 4GZVA 2JGSA 1N9MA 3B2IA 5H8TA 1HQPA 1TOUA 5D47A 5HA0A 1IW2A 1BJ7A 2JW1A 2RTPB 1RBPA 1GT3A 1VYFA 3C76X 2I5VO 1D2UA 2RTAA 2RTOB 2ACPX 1X8PA 1SWSA 1E06A 2DM5A 3K3LA 2OFMX 4I3CA 2FGSA 4Z28A 3MG5A 1N4JA 1BBPA 2IZHB 4GUZA 4GNYA 2F73A 4TJZA 4TQ2A 4OS8A 1TXLA 1LDOA 1Y53X 3ZQ3A 1XCAA 1ZNDA 2AT0X 2W2AA 2A5CA 4QQ1A 3RDSA 5HWZA 1EW3A 1EALA 2ASNX 2OFRX 4OKAA 5K67A 4UU3A 2FLJA 1LUQA 2HZRA 3CQRA 4TNNA 3ZW0A 2IZBA 3OBLA 1QY1A 3MBTA 4ID2A 2BS5A 1VWIB 1FTPA 2ACOA 3SLJA 4NNSA 2RTRB 4PJ2A 5HZQA 4ALBA 4QRLA 1ZNHA 1LPJA 5LJCA 4L1NA 3UAQA 4O4UA 1DFVA 2MO5A 1O1VA 4LZVA 2CM9A 1VWNB 2ZSCA 1I04A 3P6CA 2WPUA 5AQ6A 2KTSA 2FKGA 1ZRYA 1HBPA 1LCVA 1VWDB 3B2LA 3CWKA 3L4RA 3NQ3A 1SWNA 3FR5A 1ALBA 4XMFA 3UEVA 1VWJB 2X32A 5IO7A 1NP4A 2FKJA 4QGXA 2OVDA 1GX8A 4BX7B 1I06A 1SXYA 4BX5A 4XMEA 1JBHA 5CHKA 2JMBA 2Y3EA 2R74A 2PY1A 2OL8O 2MJIA 5DG4A 3U0DA 1LCWA 1N9YA 1G5WA 4ZFXA 1KT4A 2OF9A 3MVFA 4FGIB 5L8NA 1SWJA 2GH7A 1A2DA 1CRBA 1FDQA 1PM1X 3NX1A 2RTHB 4JNJA 1W6FA 1U18A 2AT5X 3D9WA 3UEWA 1D3SA 2WUTA 1WUBA 4M6SA 1NP1A 3PQSA 2QOMA 1YWAA 3VG7A 1SRJA 2RTFB 2X55A 5HZ8A 5EEEA 1BLRA 3QKGA 1YWBA 2Q9SA 2CM4A 2RTGB 3EBWA 3JQOA 5CYBA 1PBYA 3VHHA 4BGFA 3PH6A 1AELA 4FQBB 1GM6A 1IFCA 2KD2A 3STKA 1BM5A 1HMTA 1HY2A 1S44A 2RTEB 4JHQA 4GH7A 5EDCA 3BDRA 1SY3A 3KVNA 4BCSA 2GC9A 4ORXA 1LIDA 1N43A 1P6PA 2A2UA 4GRJA 4ORRA 4U3QA 3WZOA 3ELXA 2G5LA 4HPDA 4NNTA 1T8VA 3T6LA 4HFOA 1B8EA 4C5PA 1EIIA 2FHLA 5H9NA 2WEXA 2BHVA 3CBCA 1BRPA 3RDOA 1CBIA 3VGWA 1RXJA 3KFGA 4AZRA 2XSTA 5HAEA 2NNEA 3STMX 1TOWA 3NQ9A 4ZHDA 1OBUA 1STPA 1UYNX 4NLJA 1QQSA 1E02A 3KFIA 1SXUA 4Z2PA 1QG5A 4DQ3A 1KT7A 1SWHA 2F09A 2R73A 2X46A 3FENA 4HPAA 3S5VA 3S5XA 4GD9A 1X8OA 1OEEA 1VWQB 1Y9TA 5EEDA 4O4OA 5CE4A 3EM0A 5IXGA 2A2GA 3SOTA 4BX5B 1EI5A 5HCEC 3HWGA 5LJEA 1SLEB 4ZHGA 2IZAA 4EXZA 4I3BA 4I95A 5FQ7E 5IRUA 4JGLA 4AZQA 3HK1A 5HZ9A 4CDEA 4YCHA 3WJGA 4COTA 4EQAC 5H9KA 2VDFA 3HWDA 4QGWA 2R56A 3RKGA 1AQBA 1N7YA 1SRGA 3FDCA 1YP6A 1CBQA 1PEEA 3RE6A 1VWRB 3TGAA 1W4TA 1ZNKA 1ERXA 3BRNA 5F6BA 2QO6A 4CPEA 1JYJA 2FR3A 4ES7A 4IAWA 3PPTA 4QGVA 1CJ5A 1OEKA 1OEJA 1YIVA 4GDAA 1KOIA 3HOEA 5HCDC 1ADLA 1ACDA 1JV4A 3E3CA 3WYPA 1I9HA 4WFVA 4DQ4A 2WQ9A 4Y59A 4ORSA 4UU2A 5K68A 1STRB 4INNA 2QCBA 1JJJA 1SWDA 2DJFA 2POAA 5IO5A 1STSB 2X8TA 1LIBA 1LKEA 2I5ZO 2RN4A 1VWOB 2QMIA 3BX7A 3IFBA 2Q2PA 4FBRA 2VFCA 4A60A 2L68A 4TKBA 2CAMA 1VPRA 1ICMA 3EBKA 3LV4A 4NV8A 1VYGA 4U8UM 4CPHA 1HQQA 5IO6A 4YGGA 2UZ2A 3RWXA 2N93A 4O3YA 3HOLA 1VWGB 4YH0A 4ARHA 1KGLA 2OL7A 5LKFA 4CDCA 5D8JA 1NQNA 2L67A 4IMOA 4WFUA 1A57A 1EPBA 2JOZA 1KQXA 1LDQA 4EDEA 1H91A 1DZKA 3MX7A 3OD9A 4BVMA 1SREA 2BSZA 4BQUA 5L8IA 5FQ8E 1VWAB 3P24A 4ALOA 3P6EA 2IZDB 1LF7A 2HZQA 4YDAA 3WXQA 2AT3X 4CPIA 1OBQA 2UYWA 3O22A 1HXZA 3CQNA 4O49A 4U9CA 2Z4HA 4IABA 1SWBA 4XMGA 3WVMA 2JU8A 1KZXA 4M7MA 1FJ1E 2RCTA 2QM9A 2Y3FA 1DZPA 2LBVA 2VFBA 4I60A 1SLDB 5B5FA 1B4MA 3H3IA 1HXLA 1ML7A 4NLIA 1LIFA 2NNDA 2HNXA 2RTQB 4KT5A 5F7GA 3STNA 3T1DA 5LJKA 3T6FA 3D95A 1MM9A 1SWRA 1X89A 3G7XA 3P6HA 4MVIA 5B10O 1LIEA 4O3ZA 2F01A 1KFFA 2FHNX 3RDUA 1SLGB 1MEPA 1VWHB 1JYDA 1SWKA 2OVAA 2C4IA 4O4SA 1EUOA 4NW4A 4GE1A 3FELA 2LBAA 4KC8A 1SWGA 5HZ5A 1BSQA 3AUMO 3NP1A 1JMZA 4L3RA 3VG2A 5L8OA 1AB0A 3B2JA 1U0XA 1VWEB 3AKMA 3HWFA 2A8GA 4GDZA 1KT3A 4O9SA 5D48A 1FELA 1EQDA 2GTLN 4CPHB 3B2KA 4YKOA 4NV7A 4AW8A 1GX3A 3SLTA 4AZOA 2FS6A 4XMCA 4ORUA 4D6BA 3X00A 4IAXA 4OEMA 2C1SA 4PSQA 3T2XA 4ZGUA 1IKEA 2W2BA 3CBSA 1EIOA 3LHNA 4HWMA 4O3XB 4ORYA 1SA8A 3SZIA 3FYFA 4O3WA 2AT8X 2P8GA 5KHPA 3EW2A 3TGCA 2BC3A 1SWCA 1GXAA 2HKDA 4I3DA 3S60A 3CMPA 2IZJA 2RTJA 1X8UA 3TZSA 1NQMA 2XKLA 2JU3A 5B29A 3ZW1A 3U9PC 3RSWA 3PH5A 2CBSA 2X45A 4AZPA 3ELZA 1K3BA 2A5BA 3TF6A 3FA6A 1G85A 2GTLM 3AEHA 4KC7A 4OMXA 5JR8A 3ZUIA 2JU7A 2QO4A 1I05A 3FMZA 3PECA 4YBPA 2WQAE 3RBYA 3ZW0B 3BX8A 3D96A 3KFFA 5HZ6A 3VG3A 4IB8A 1S7DA 1GT1A 2IZKA 3CR6A 1LCZA 4GU8A 3VHMA 1FENA 2PI3O 3NX2A 4WHIA 3WJBA 4EKVA 5LJHA 2RTNB 2A13A 5HA1A 1DV9A 3B2HA 4YBUA 3BSZE 2X8SA
chains in the Genus database with same CATH topology
4GJSA 1PTSA 4GDAA 1MOYA 4Z28A 1VWCB 3MG5A 1N4JA 1VWFB 3SZJA 1SWOA 4CPFA 3WYPA 1I9HA 1RSTB 1SLFB 2IZHB 4Y59A 3RDQA 5B5GA 5K68A 1STRB 2QCBA 4BX6B 1SWDA 2IZFB 3RDMA 4Z2OA 1STSB 1LDOA 1Y53X 4YVBA 1VWOB 2RTDB 2A5CA 3RDSA 3RY2A 5K67A 4OKAA 2CAMA 1LUQA 1VWPB 4CPHA 2IZBA 1HQQA 1VWIB 3T2WA 2UZ2A 4U46A 2RTRB 3WZNA 1VWGB 1SWEA 2IZGB 3RE5A 1VWNB 3MM0A 2ZSCA 1NQNA 2WPUA 1VWMB 1SWPA 4GGRA 1LCVA 1VWDB 4Z2VA 4DNEA 1SWNA 1LDQA 2OFAA 1VWJB 2IZEB 1SREA 4BX7B 1KL5A 4BX5A 5JD2A 1VWAB 5CHKA 1RXKA 2Y3EA 2RTCB 2IZDB 4CPIA 5F2BA 1LCWA 1N9YA 2UYWA 1HXZA 4IRWA 1SWBA 1VWLB 1VWKB 2OF9A 3VHIA 1SWJA 1SWQA 1Y55X 2GH7A 3EW1A 5L3YA 2Y3FA 2RTHB 4JNJA 1RXHA 4JO6A 4I60A 1SLDB 5IRAA 5B5FA 5CSEA 1HXLA 1SRJA 1SWUA 2RTFB 2RTQB 4Z6JA 2RTGB 2RTKA 1LELA 3VHHA 1MM9A 1SWRA 3T6FA 4Y5DA 1WBIA 2F01A 1KFFA 2FHNX 1HY2A 4JHQA 2RTEB 3RDUA 1SLGB 1MEPA 1VWHB 2C1QA 1SWKA 4GJVA 2C4IA 2IZLB 2RTBB 4BCSA 1N43A 2IZCB 3WZQA 3WZOA 1AVEA 2G5LA 1SWGA 1IJ8A 4GGTA 1NC9A 4BX6A 1SRIA 3T6LA 5IRWA 3RY1A 2FHLA 2RTMA 1SWTA 3RDXA 1VWEB 3RDOA 2A8GA 4CPHB 3VGWA 2IZIA 1RXJA 2MF6A 3X00A 1SWLA 2C1SA 4GGZA 3T2XA 1MK5A 1STPA 3WYQA 3WZPA 1VYOA 3SZIA 3SZHA 4Z2PA 3EW2A 2BC3A 2OFBA 1SWCA 1SWHA 4BBOA 2RTIB 4BJ8A 1KL4A 1SRFA 2Y32A 2IZJA 4GD9A 1VWQB 2RTJA 1NQMA 4BX5B 1RSUB 2AVIA 1AVDA 1VWBB 4BX7A 1SRHA 1SLEB 2IZAA 1SWAA 3PK2A 2A5BA 1NBXA 5IRUA 1DF8A 1SWFA 4Z27A 1NDJA 1KL3A 1RAVA 1N9MA 1N7YA 2JGSA 1SRGA 2OF8A 1Y52X 3FDCA 2IZKA 3RE6A 1VWRB 2RTLA 2RTPB 1LCZA 3VHMA 4CPEA 4EKVA 2RTNB 2RTOB 2RTAA 1SWSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GJS A;  1PTS A;  4GDA A;  1MOY A;  4Z28 A;  1VWC B;  3MG5 A;  1N4J A;  1VWF B;  3SZJ A;  1SWO A;  4CPF A;  3WYP A;  1I9H A;  1RST B;  1SLF B;  2IZH B;  4Y59 A;  3RDQ A;  5B5G A;  5K68 A;  1STR B;  2QCB A;  4BX6 B;  1SWD A;  2IZF B;  3RDM A;  4Z2O A;  1STS B;  1LDO A;  1Y53 X;  4YVB A;  1VWO B;  2RTD B;  2A5C A;  3RDS A;  3RY2 A;  5K67 A;  4OKA A;  2CAM A;  1LUQ A;  1VWP B;  4CPH A;  2IZB A;  1HQQ A;  1VWI B;  3T2W A;  2UZ2 A;  4U46 A;  2RTR B;  3WZN A;  1VWG B;  1SWE A;  2IZG B;  3RE5 A;  1VWN B;  3MM0 A;  2ZSC A;  1NQN A;  2WPU A;  1VWM B;  1SWP A;  4GGR A;  1LCV A;  1VWD B;  4Z2V A;  4DNE A;  1SWN A;  1LDQ A;  2OFA A;  1VWJ B;  2IZE B;  1SRE A;  4BX7 B;  1KL5 A;  4BX5 A;  5JD2 A;  1VWA B;  5CHK A;  1RXK A;  2Y3E A;  2RTC B;  2IZD B;  4CPI A;  5F2B A;  1LCW A;  1N9Y A;  2UYW A;  1HXZ A;  4IRW A;  1SWB A;  1VWL B;  1VWK B;  2OF9 A;  3VHI A;  1SWJ A;  1SWQ A;  1Y55 X;  2GH7 A;  3EW1 A;  5L3Y A;  2Y3F A;  2RTH B;  4JNJ A;  1RXH A;  4JO6 A;  4I60 A;  1SLD B;  5IRA A;  5B5F A;  5CSE A;  1HXL A;  1SRJ A;  1SWU A;  2RTF B;  2RTQ B;  4Z6J A;  2RTG B;  2RTK A;  1LEL A;  3VHH A;  1MM9 A;  1SWR A;  3T6F A;  4Y5D A;  1WBI A;  2F01 A;  1KFF A;  2FHN X;  1HY2 A;  4JHQ A;  2RTE B;  3RDU A;  1SLG B;  1MEP A;  1VWH B;  2C1Q A;  1SWK A;  4GJV A;  2C4I A;  2IZL B;  2RTB B;  4BCS A;  1N43 A;  2IZC B;  3WZQ A;  3WZO A;  1AVE A;  2G5L A;  1SWG A;  1IJ8 A;  4GGT A;  1NC9 A;  4BX6 A;  1SRI A;  3T6L A;  5IRW A;  3RY1 A;  2FHL A;  2RTM A;  1SWT A;  3RDX A;  1VWE B;  3RDO A;  2A8G A;  4CPH B;  3VGW A;  2IZI A;  1RXJ A;  2MF6 A;  3X00 A;  1SWL A;  2C1S A;  4GGZ A;  3T2X A;  1MK5 A;  1STP A;  3WYQ A;  3WZP A;  1VYO A;  3SZI A;  3SZH A;  4Z2P A;  3EW2 A;  2BC3 A;  2OFB A;  1SWC A;  1SWH A;  4BBO A;  2RTI B;  4BJ8 A;  1KL4 A;  1SRF A;  2Y32 A;  2IZJ A;  4GD9 A;  1VWQ B;  2RTJ A;  1NQM A;  4BX5 B;  1RSU B;  2AVI A;  1AVD A;  1VWB B;  4BX7 A;  1SRH A;  1SLE B;  2IZA A;  1SWA A;  3PK2 A;  2A5B A;  1NBX A;  5IRU A;  1DF8 A;  1SWF A;  4Z27 A;  1NDJ A;  1KL3 A;  1RAV A;  1N9M A;  1N7Y A;  2JGS A;  1SRG A;  2OF8 A;  1Y52 X;  3FDC A;  2IZK A;  3RE6 A;  1VWR B;  2RTL A;  2RTP B;  1LCZ A;  3VHM A;  4CPE A;  4EKV A;  2RTN B;  2RTO B;  2RTA A;  1SWS A; 
#chains in the Genus database with same CATH topology
 1DZJ A;  5BVS A;  1MOY A;  1VWC B;  3O19 A;  4QZT A;  1DC9 A;  1SWO A;  2BS6 A;  1Y9L A;  1L6M A;  4ZCB A;  1IKJ A;  2GTF X;  3WJE A;  1OSP O;  1KZW A;  3RDQ A;  2A0A A;  5B5G A;  4MIS A;  1FEM A;  1YUP A;  1U17 A;  4A1Y A;  2IZF B;  1TVQ A;  1A18 A;  5B11 O;  3WOV A;  4B55 A;  1G7N A;  3BS2 A;  3V8U A;  3ZWE A;  5B2A O;  1FE3 A;  3S26 A;  4ORW A;  2WEW A;  1YWD A;  3NR3 A;  3T2W A;  1JJX A;  4EFG A;  4MEE A;  4YDB A;  2WR6 A;  1GKA A;  2IZG B;  3RE5 A;  1ZNL A;  3MM0 A;  4QNI A;  3CKF A;  4GNW A;  1MX7 A;  2ZAI A;  3HWE A;  4GGR A;  4DCB A;  2BT9 A;  2LKK A;  3UEX A;  1BRQ A;  3I17 A;  4Z2V A;  5D45 A;  2O62 A;  1OPB A;  2OFA A;  2IZE B;  4ML7 B;  4LQZ A;  3ZW1 B;  1UYO X;  1HMS A;  2FS7 A;  3F6Z B;  3WBG A;  2OZQ A;  2A3F X;  4ZH9 A;  2QOS C;  4IB6 A;  3P6G A;  1QWD A;  1RXK A;  1DF3 A;  5K06 A;  5FFH A;  1NGL A;  4IRW A;  4AZM A;  1PBO A;  1VWL B;  2K23 A;  1EPA A;  2FR2 A;  4IMN A;  1SWQ A;  1Y55 X;  5H9L A;  4AYH A;  5BVT A;  4KH8 A;  2X8F A;  4NYR A;  5H9A A;  1RXH A;  4JO6 A;  4IB9 A;  5EZ2 A;  5IRA A;  1E00 A;  4Z6J A;  1GT5 A;  1KT6 A;  4GK9 A;  1URE A;  1RLB E;  1T68 X;  2RTK A;  5B3M O;  3FEK A;  4RUN A;  4Y0Q A;  1O1U A;  4TKH A;  2WWP A;  3BU1 A;  4Y0S A;  4XMD A;  1AVG I;  2OVE A;  4RUU A;  1IFB A;  2C1Q A;  4LZU A;  1N0S A;  1T0V A;  2IZL B;  2AF5 A;  2RCQ A;  2WSJ A;  3FW4 A;  3KQ0 A;  3FR2 A;  3PDF A;  4LKT A;  3WZQ A;  4I6S A;  3WJF A;  1AVE A;  3JSQ A;  4GGT A;  1IJ8 A;  3I0A A;  2ANS A;  4HPC A;  1I78 A;  1SRI A;  1XKI A;  3NBX X;  3Q6L A;  1YWC A;  3RY1 A;  3ZW2 A;  4BX6 A;  3DTQ A;  4N7C A;  1SWT A;  3RDX A;  5AJC A;  1EXS A;  2LFO A;  4R0B A;  4U8U O;  2MF6 A;  2G79 A;  4Y0R A;  5AEO A;  2KT4 B;  5C0N A;  3NPO A;  4MIR A;  1SWL A;  4GGZ A;  5BVQ A;  5LJB A;  1GKA B;  1SMP I;  2CBR A;  5FEN A;  2OYB O;  3FA8 A;  3WZP A;  4BOE A;  4ZHC A;  2KW1 A;  4NP1 A;  4ODD A;  1KT5 A;  1GGL A;  2OFB A;  1R0U A;  4ON1 A;  1X8N A;  3RZY A;  1KL4 A;  1SRF A;  2Y32 A;  1MUP A;  2X56 A;  1MX8 A;  2AMM X;  3FEP A;  5FQ6 E;  1LIC A;  2FWV A;  3N91 A;  4IB7 A;  4AZN A;  1RSU B;  2AVI A;  1AVD A;  2DJG A;  1Y0G A;  4FBV A;  4YKM A;  3EMM A;  4MVL A;  1SWA A;  1JZU A;  3AKN A;  3APU A;  2ALL X;  1LNM A;  1SXX A;  4CDD A;  2AH7 X;  4O4X A;  2Q2M A;  4WBK A;  3GE2 A;  4ZGF A;  1NDJ A;  1KL3 A;  1RAV A;  2OF8 A;  2OY7 A;  4A1H A;  1HBQ A;  1Y52 X;  1MDC A;  2L9C A;  5F1E A;  2RTL A;  3OJY C;  3FA9 A;  4TKJ A;  1SY1 A;  5DPQ A;  4YFR A;  3P02 A;  1E2T A;  1W5R A;  3ZZV A;  2FTB A;  1CBS A;  3FID A;  2W2F A;  3OE3 A;  4I9S A;  1JQP A;  2G78 A;  3FIQ A;  1PTS A;  4GJS A;  4XMH A;  1OBP A;  3SZJ A;  1HMR A;  1VWF B;  3EYC A;  4CPF A;  3SLO A;  3VE2 A;  4GKC A;  4HPB A;  1GX9 A;  1RST B;  1SLF B;  4IBA A;  1GT4 A;  2OVS A;  2YMS A;  3BY0 A;  2HYS A;  2M4L A;  2AL0 X;  1ERB A;  2BLG A;  3WJC A;  3RDM A;  4BX6 B;  3PQU A;  4Z2O A;  5HTD A;  2FRS A;  3D4R A;  5D4A A;  1X8Q A;  1BEB A;  2Q39 A;  2X4M A;  4YVB A;  3CKG A;  2OY8 A;  2RTD B;  3RY2 A;  4QZU A;  2RA6 A;  2OL6 O;  3FR4 A;  1VWP B;  2LA7 A;  3PP6 A;  3DSZ A;  1YP7 A;  4U46 A;  3ZI8 A;  1IIU A;  3WZN A;  4Y0P A;  2AKQ A;  1KXO A;  1OPA A;  2RQ0 A;  1JMX A;  1SWE A;  2GJ5 A;  2ZAG A;  3APW A;  2LB6 A;  3PED A;  3ZUO A;  1E5P A;  1B0O A;  4LKP A;  1VWM B;  3APX A;  1SWP A;  2EU7 X;  4DNE A;  3F9D A;  3QQ2 A;  1ZNG A;  4ZHH A;  1SY2 A;  4YCE A;  3U03 A;  5KID A;  1KL5 A;  2IFB A;  5JD2 A;  3P6F A;  4MVK A;  2RTC B;  2GTL O;  4N7D A;  5F58 A;  1SXW A;  5F2B A;  1Z24 A;  2E4J A;  1K24 A;  4YFQ A;  2CZT A;  3NAD A;  1VWK B;  3VHI A;  5HBS A;  3EW1 A;  5L3Y A;  1ZNE A;  2JN3 A;  1TW4 A;  1G74 A;  5AJB A;  4ZR2 A;  3VG6 A;  5KIC A;  5LKE A;  2X34 A;  3BU9 A;  3D97 A;  5CSE A;  2HMB A;  1BWY A;  1SWU A;  1I4U A;  2L5P A;  3Q34 A;  1QY0 A;  1DZM A;  1QFV A;  4FBO A;  4NYQ A;  4KII A;  4MVE A;  1LEL A;  1KQW A;  3APV A;  3LTW A;  2Q4N A;  4QYP A;  4Y5D A;  5EPQ A;  4ZH6 A;  3P6D A;  2G7B A;  1WBI A;  5LJG A;  3C77 X;  5F6Z A;  4CDF A;  1UZ2 X;  1SY0 A;  3FW5 A;  4YGH A;  4KCA A;  4TLJ A;  2OY1 O;  2YG2 A;  4GET A;  4GJV A;  2RTB B;  2MHD A;  3IA8 A;  4K19 A;  5FAZ A;  2IZC B;  3JS1 A;  1JIW I;  3HPE A;  4A8Z A;  3TGB A;  3FLL A;  5BYP A;  1NC9 A;  5HCC C;  1CBR A;  3VE1 A;  5IRW A;  2MM3 A;  2Z4I A;  3VG4 A;  2RTM A;  1O8V A;  2AT6 X;  3UEU A;  2G8C O;  3KFH A;  1PMP A;  1JJU A;  2IZI A;  4ZHF A;  3KZA A;  4OMW A;  4CK4 A;  4D6A A;  2RD7 C;  1A3Y A;  3F8A A;  2OY5 O;  4U8U N;  1S2P A;  4QYN A;  4CSB A;  4OS0 A;  1MK5 A;  3WYQ A;  2QO5 A;  4EEJ A;  4OS3 A;  1ICN A;  1VYO A;  5EDB A;  5HTE A;  2NP1 A;  3SZH A;  3WJD A;  3HTY A;  1HN2 A;  2MWH A;  3NQK A;  4BBO A;  2RTI B;  4BJ8 A;  3SAO A;  2FT9 A;  4CV7 A;  5LJD A;  2CZU A;  1X71 A;  3O2Y A;  3C78 X;  4QAE A;  4BX7 A;  1QFT A;  1VWB B;  1B56 A;  1SRH A;  3BLG A;  2NNQ A;  5B27 A;  3PK2 A;  4OEL A;  3VU1 A;  3EC5 A;  4YMY A;  4ZJ0 A;  3GAQ A;  1QY2 A;  4YFP A;  1NBX A;  4I9R A;  1DF8 A;  1QAB E;  2HLV A;  1MVG A;  2K62 A;  4YGZ A;  1SWF A;  4Z27 A;  1BSO A;  3FA7 A;  3VG5 A;  3VPJ E;  2KTD A;  1LFO A;  1BSY A;  4GZV A;  2JGS A;  1N9M A;  3B2I A;  5H8T A;  1HQP A;  1TOU A;  5D47 A;  5HA0 A;  1IW2 A;  1BJ7 A;  2JW1 A;  2RTP B;  1RBP A;  1GT3 A;  1VYF A;  3C76 X;  2I5V O;  1D2U A;  2RTA A;  2RTO B;  2ACP X;  1X8P A;  1SWS A;  1E06 A;  2DM5 A;  3K3L A;  2OFM X;  4I3C A;  2FGS A;  4Z28 A;  3MG5 A;  1N4J A;  1BBP A;  2IZH B;  4GUZ A;  4GNY A;  2F73 A;  4TJZ A;  4TQ2 A;  4OS8 A;  1TXL A;  1LDO A;  1Y53 X;  3ZQ3 A;  1XCA A;  1ZND A;  2AT0 X;  2W2A A;  2A5C A;  4QQ1 A;  3RDS A;  5HWZ A;  1EW3 A;  1EAL A;  2ASN X;  2OFR X;  4OKA A;  5K67 A;  4UU3 A;  2FLJ A;  1LUQ A;  2HZR A;  3CQR A;  4TNN A;  3ZW0 A;  2IZB A;  3OBL A;  1QY1 A;  3MBT A;  4ID2 A;  2BS5 A;  1VWI B;  1FTP A;  2ACO A;  3SLJ A;  4NNS A;  2RTR B;  4PJ2 A;  5HZQ A;  4ALB A;  4QRL A;  1ZNH A;  1LPJ A;  5LJC A;  4L1N A;  3UAQ A;  4O4U A;  1DFV A;  2MO5 A;  1O1V A;  4LZV A;  2CM9 A;  1VWN B;  2ZSC A;  1I04 A;  3P6C A;  2WPU A;  5AQ6 A;  2KTS A;  2FKG A;  1ZRY A;  1HBP A;  1LCV A;  1VWD B;  3B2L A;  3CWK A;  3L4R A;  3NQ3 A;  1SWN A;  3FR5 A;  1ALB A;  4XMF A;  3UEV A;  1VWJ B;  2X32 A;  5IO7 A;  1NP4 A;  2FKJ A;  4QGX A;  2OVD A;  1GX8 A;  4BX7 B;  1I06 A;  1SXY A;  4BX5 A;  4XME A;  1JBH A;  5CHK A;  2JMB A;  2Y3E A;  2R74 A;  2PY1 A;  2OL8 O;  2MJI A;  5DG4 A;  3U0D A;  1LCW A;  1N9Y A;  1G5W A;  4ZFX A;  1KT4 A;  2OF9 A;  3MVF A;  4FGI B;  5L8N A;  1SWJ A;  2GH7 A;  1A2D A;  1CRB A;  1FDQ A;  1PM1 X;  3NX1 A;  2RTH B;  4JNJ A;  1W6F A;  1U18 A;  2AT5 X;  3D9W A;  3UEW A;  1D3S A;  2WUT A;  1WUB A;  4M6S A;  1NP1 A;  3PQS A;  2QOM A;  1YWA A;  3VG7 A;  1SRJ A;  2RTF B;  2X55 A;  5HZ8 A;  5EEE A;  1BLR A;  3QKG A;  1YWB A;  2Q9S A;  2CM4 A;  2RTG B;  3EBW A;  3JQO A;  5CYB A;  1PBY A;  3VHH A;  4BGF A;  3PH6 A;  1AEL A;  4FQB B;  1GM6 A;  1IFC A;  2KD2 A;  3STK A;  1BM5 A;  1HMT A;  1HY2 A;  1S44 A;  2RTE B;  4JHQ A;  4GH7 A;  5EDC A;  3BDR A;  1SY3 A;  3KVN A;  4BCS A;  2GC9 A;  4ORX A;  1LID A;  1N43 A;  1P6P A;  2A2U A;  4GRJ A;  4ORR A;  4U3Q A;  3WZO A;  3ELX A;  2G5L A;  4HPD A;  4NNT A;  1T8V A;  3T6L A;  4HFO A;  1B8E A;  4C5P A;  1EII A;  2FHL A;  5H9N A;  2WEX A;  2BHV A;  3CBC A;  1BRP A;  3RDO A;  1CBI A;  3VGW A;  1RXJ A;  3KFG A;  4AZR A;  2XST A;  5HAE A;  2NNE A;  3STM X;  1TOW A;  3NQ9 A;  4ZHD A;  1OBU A;  1STP A;  1UYN X;  4NLJ A;  1QQS A;  1E02 A;  3KFI A;  1SXU A;  4Z2P A;  1QG5 A;  4DQ3 A;  1KT7 A;  1SWH A;  2F09 A;  2R73 A;  2X46 A;  3FEN A;  4HPA A;  3S5V A;  3S5X A;  4GD9 A;  1X8O A;  1OEE A;  1VWQ B;  1Y9T A;  5EED A;  4O4O A;  5CE4 A;  3EM0 A;  5IXG A;  2A2G A;  3SOT A;  4BX5 B;  1EI5 A;  5HCE C;  3HWG A;  5LJE A;  1SLE B;  4ZHG A;  2IZA A;  4EXZ A;  4I3B A;  4I95 A;  5FQ7 E;  5IRU A;  4JGL A;  4AZQ A;  3HK1 A;  5HZ9 A;  4CDE A;  4YCH A;  3WJG A;  4COT A;  4EQA C;  5H9K A;  2VDF A;  3HWD A;  4QGW A;  2R56 A;  3RKG A;  1AQB A;  1N7Y A;  1SRG A;  3FDC A;  1YP6 A;  1CBQ A;  1PEE A;  3RE6 A;  1VWR B;  3TGA A;  1W4T A;  1ZNK A;  1ERX A;  3BRN A;  5F6B A;  2QO6 A;  4CPE A;  1JYJ A;  2FR3 A;  4ES7 A;  4IAW A;  3PPT A;  4QGV A;  1CJ5 A;  1OEK A;  1OEJ A;  1YIV A;  4GDA A;  1KOI A;  3HOE A;  5HCD C;  1ADL A;  1ACD A;  1JV4 A;  3E3C A;  3WYP A;  1I9H A;  4WFV A;  4DQ4 A;  2WQ9 A;  4Y59 A;  4ORS A;  4UU2 A;  5K68 A;  1STR B;  4INN A;  2QCB A;  1JJJ A;  1SWD A;  2DJF A;  2POA A;  5IO5 A;  1STS B;  2X8T A;  1LIB A;  1LKE A;  2I5Z O;  2RN4 A;  1VWO B;  2QMI A;  3BX7 A;  3IFB A;  2Q2P A;  4FBR A;  2VFC A;  4A60 A;  2L68 A;  4TKB A;  2CAM A;  1VPR A;  1ICM A;  3EBK A;  3LV4 A;  4NV8 A;  1VYG A;  4U8U M;  4CPH A;  1HQQ A;  5IO6 A;  4YGG A;  2UZ2 A;  3RWX A;  2N93 A;  4O3Y A;  3HOL A;  1VWG B;  4YH0 A;  4ARH A;  1KGL A;  2OL7 A;  5LKF A;  4CDC A;  5D8J A;  1NQN A;  2L67 A;  4IMO A;  4WFU A;  1A57 A;  1EPB A;  2JOZ A;  1KQX A;  1LDQ A;  4EDE A;  1H91 A;  1DZK A;  3MX7 A;  3OD9 A;  4BVM A;  1SRE A;  2BSZ A;  4BQU A;  5L8I A;  5FQ8 E;  1VWA B;  3P24 A;  4ALO A;  3P6E A;  2IZD B;  1LF7 A;  2HZQ A;  4YDA A;  3WXQ A;  2AT3 X;  4CPI A;  1OBQ A;  2UYW A;  3O22 A;  1HXZ A;  3CQN A;  4O49 A;  4U9C A;  2Z4H A;  4IAB A;  1SWB A;  4XMG A;  3WVM A;  2JU8 A;  1KZX A;  4M7M A;  1FJ1 E;  2RCT A;  2QM9 A;  2Y3F A;  1DZP A;  2LBV A;  2VFB A;  4I60 A;  1SLD B;  5B5F A;  1B4M A;  3H3I A;  1HXL A;  1ML7 A;  4NLI A;  1LIF A;  2NND A;  2HNX A;  2RTQ B;  4KT5 A;  5F7G A;  3STN A;  3T1D A;  5LJK A;  3T6F A;  3D95 A;  1MM9 A;  1SWR A;  1X89 A;  3G7X A;  3P6H A;  4MVI A;  5B10 O;  1LIE A;  4O3Z A;  2F01 A;  1KFF A;  2FHN X;  3RDU A;  1SLG B;  1MEP A;  1VWH B;  1JYD A;  1SWK A;  2OVA A;  2C4I A;  4O4S A;  1EUO A;  4NW4 A;  4GE1 A;  3FEL A;  2LBA A;  4KC8 A;  1SWG A;  5HZ5 A;  1BSQ A;  3AUM O;  3NP1 A;  1JMZ A;  4L3R A;  3VG2 A;  5L8O A;  1AB0 A;  3B2J A;  1U0X A;  1VWE B;  3AKM A;  3HWF A;  2A8G A;  4GDZ A;  1KT3 A;  4O9S A;  5D48 A;  1FEL A;  1EQD A;  2GTL N;  4CPH B;  3B2K A;  4YKO A;  4NV7 A;  4AW8 A;  1GX3 A;  3SLT A;  4AZO A;  2FS6 A;  4XMC A;  4ORU A;  4D6B A;  3X00 A;  4IAX A;  4OEM A;  2C1S A;  4PSQ A;  3T2X A;  4ZGU A;  1IKE A;  2W2B A;  3CBS A;  1EIO A;  3LHN A;  4HWM A;  4O3X B;  4ORY A;  1SA8 A;  3SZI A;  3FYF A;  4O3W A;  2AT8 X;  2P8G A;  5KHP A;  3EW2 A;  3TGC A;  2BC3 A;  1SWC A;  1GXA A;  2HKD A;  4I3D A;  3S60 A;  3CMP A;  2IZJ A;  2RTJ A;  1X8U A;  3TZS A;  1NQM A;  2XKL A;  2JU3 A;  5B29 A;  3ZW1 A;  3U9P C;  3RSW A;  3PH5 A;  2CBS A;  2X45 A;  4AZP A;  3ELZ A;  1K3B A;  2A5B A;  3TF6 A;  3FA6 A;  1G85 A;  2GTL M;  3AEH A;  4KC7 A;  4OMX A;  5JR8 A;  3ZUI A;  2JU7 A;  2QO4 A;  1I05 A;  3FMZ A;  3PEC A;  4YBP A;  2WQA E;  3RBY A;  3ZW0 B;  3BX8 A;  3D96 A;  3KFF A;  5HZ6 A;  3VG3 A;  4IB8 A;  1S7D A;  1GT1 A;  2IZK A;  3CR6 A;  1LCZ A;  4GU8 A;  3VHM A;  1FEN A;  2PI3 O;  3NX2 A;  4WHI A;  3WJB A;  4EKV A;  5LJH A;  2RTN B;  2A13 A;  5HA1 A;  1DV9 A;  3B2H A;  4YBU A;  3BSZ E;  2X8S A; 
#chains in the Genus database with same CATH homology
 4GJS A;  1PTS A;  4GDA A;  1MOY A;  4Z28 A;  1VWC B;  3MG5 A;  1N4J A;  1VWF B;  3SZJ A;  1SWO A;  4CPF A;  3WYP A;  1I9H A;  1RST B;  1SLF B;  2IZH B;  4Y59 A;  3RDQ A;  5B5G A;  5K68 A;  1STR B;  2QCB A;  4BX6 B;  1SWD A;  2IZF B;  3RDM A;  4Z2O A;  1STS B;  1LDO A;  1Y53 X;  4YVB A;  1VWO B;  2RTD B;  2A5C A;  3RDS A;  3RY2 A;  5K67 A;  4OKA A;  2CAM A;  1LUQ A;  1VWP B;  4CPH A;  2IZB A;  1HQQ A;  1VWI B;  3T2W A;  2UZ2 A;  4U46 A;  2RTR B;  3WZN A;  1VWG B;  1SWE A;  2IZG B;  3RE5 A;  1VWN B;  3MM0 A;  2ZSC A;  1NQN A;  2WPU A;  1VWM B;  1SWP A;  4GGR A;  1LCV A;  1VWD B;  4Z2V A;  4DNE A;  1SWN A;  1LDQ A;  2OFA A;  1VWJ B;  2IZE B;  1SRE A;  4BX7 B;  1KL5 A;  4BX5 A;  5JD2 A;  1VWA B;  5CHK A;  1RXK A;  2Y3E A;  2RTC B;  2IZD B;  4CPI A;  5F2B A;  1LCW A;  1N9Y A;  2UYW A;  1HXZ A;  4IRW A;  1SWB A;  1VWL B;  1VWK B;  2OF9 A;  3VHI A;  1SWJ A;  1SWQ A;  1Y55 X;  2GH7 A;  3EW1 A;  5L3Y A;  2Y3F A;  2RTH B;  4JNJ A;  1RXH A;  4JO6 A;  4I60 A;  1SLD B;  5IRA A;  5B5F A;  5CSE A;  1HXL A;  1SRJ A;  1SWU A;  2RTF B;  2RTQ B;  4Z6J A;  2RTG B;  2RTK A;  1LEL A;  3VHH A;  1MM9 A;  1SWR A;  3T6F A;  4Y5D A;  1WBI A;  2F01 A;  1KFF A;  2FHN X;  1HY2 A;  4JHQ A;  2RTE B;  3RDU A;  1SLG B;  1MEP A;  1VWH B;  2C1Q A;  1SWK A;  4GJV A;  2C4I A;  2IZL B;  2RTB B;  4BCS A;  1N43 A;  2IZC B;  3WZQ A;  3WZO A;  1AVE A;  2G5L A;  1SWG A;  1IJ8 A;  4GGT A;  1NC9 A;  4BX6 A;  1SRI A;  3T6L A;  5IRW A;  3RY1 A;  2FHL A;  2RTM A;  1SWT A;  3RDX A;  1VWE B;  3RDO A;  2A8G A;  4CPH B;  3VGW A;  2IZI A;  1RXJ A;  2MF6 A;  3X00 A;  1SWL A;  2C1S A;  4GGZ A;  3T2X A;  1MK5 A;  1STP A;  3WYQ A;  3WZP A;  1VYO A;  3SZI A;  3SZH A;  4Z2P A;  3EW2 A;  2BC3 A;  2OFB A;  1SWC A;  1SWH A;  4BBO A;  2RTI B;  4BJ8 A;  1KL4 A;  1SRF A;  2Y32 A;  2IZJ A;  4GD9 A;  1VWQ B;  2RTJ A;  1NQM A;  4BX5 B;  1RSU B;  2AVI A;  1AVD A;  1VWB B;  4BX7 A;  1SRH A;  1SLE B;  2IZA A;  1SWA A;  3PK2 A;  2A5B A;  1NBX A;  5IRU A;  1DF8 A;  1SWF A;  4Z27 A;  1NDJ A;  1KL3 A;  1RAV A;  1N9M A;  1N7Y A;  2JGS A;  1SRG A;  2OF8 A;  1Y52 X;  3FDC A;  2IZK A;  3RE6 A;  1VWR B;  2RTL A;  2RTP B;  1LCZ A;  3VHM A;  4CPE A;  4EKV A;  2RTN B;  2RTO B;  2RTA A;  1SWS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...