4JHSA

Crystal structure of a c-terminal two domain fragment of human beta-2-glycoprotein 1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
142
structure length
142
Chain Sequence
KCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-2-glycoprotein 1
publication title Crystal structure of a C-terminal two domain fragment of human beta-2-glycoprotein 1
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 24
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
A PF09014 Sushi_2 Beta-2-glycoprotein-1 fifth domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 4jhsA01
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 4jhsA02
5HYUB 1FBRA 2G7IA 3EJHA 1MD8A 3ZD1A 1VVCA 2XWBF 3GXEA 1GHQB 3O8EB 2UWNA 4F4OC 1H2QP 3RJ3D 1O9AA 2JRAA 2RL0A 1OK9A 4DJZA 1QO6A 2LOJA 2WIIC 2B5ID 1NWVA 2XRDA 2YRAA 2YBYA 3NFPI 1GKGA 4JHSA 4K12A 2XRBA 2IZ4A 3KXVA 4J38B 4AYDA 4IGDA 1QGBA 1ZJKA 4ONTD 1CKLA 1VVDA 5FO8C 4A5WB 1OJWA 4KKDA 3INBC 5JPMG 1E5GA 1PPQA 4ZH1D 4CSYA 1HCCA 1OK2A 3OP8A 5HYTB 1SS2A 2EC3A 2RKZA 2JGWA 1MD7A 2RLQA 2V8EA 1H03P 1ELVA 1OJVA 3MQLA 3GOVA 1Q3XA 2CKUA 3KZJA 4B2SA 1G4GA 1C1ZA 3SW0X 4B2RA 5HZPB 1H2PP 1Z92B 2JGXA 3IU3I 4YNXA 2CG6A 2KRIA 1GPZA 4MUCA 4AYMA 2RLPA 1HFHA 3OEDC 4LOSA 1G4FA 2KMSA 1HFIA 2O39C 2QY0A 2IZ3A 2W81A 4AYEA 2W80A 1OJYA 3ZD2A 2XWJI 3IX0A 1TPMA 1H04P 2BZMA 3OXUD 2RKYA 1E88A 2EHFA 5HYPA 3CALA 3TVJA 4C16A 1QUBA 1GKNA 1OK3A 5I0QB 1SRZA 3R62A 1LY2A 1TPGA 4LOTA 2ERJA 3L89M 3T5OA 4PZ5A 2A55A 1U5MA 2MCZA 2MCYA 4WJG2 3ZRZA 4AYIA 3ERBA 3M7PA 1TPNA 1E8BA 2CG7A 2XQWC 4FXGG 1OK1A 1UOTP
chains in the Genus database with same CATH superfamily
5HYUB 1FBRA 2G7IA 3EJHA 1MD8A 3ZD1A 1VVCA 2XWBF 3GXEA 1GHQB 3O8EB 2UWNA 4F4OC 1H2QP 3RJ3D 2Y8SA 1O9AA 2JRAA 2RL0A 1OK9A 4DJZA 1QO6A 2LOJA 2WIIC 2B5ID 1NWVA 3CI0J 2XRDA 4BWCA 2YRAA 2YBYA 3NFPI 1GKGA 4JHSA 4K12A 2XRBA 2IZ4A 3KXVA 4J38B 4AYDA 4IGDA 1QGBA 4N7EA 1ZJKA 4ONTD 5DN5A 1CKLA 1VVDA 5FO8C 4APLA 4A5WB 1OJWA 4KKDA 4PO7A 3INBC 5JPMG 3WSXA 1E5GA 3NJAA 3WSYA 1PPQA 4ZH1D 4CSYA 1HCCA 1OK2A 3OP8A 3K3TA 5HYTB 1SS2A 2EC3A 2RKZA 2JGWA 1MD7A 2RLQA 2V8EA 1H03P 1ELVA 1OJVA 3MQLA 3GOVA 4MSLA 1Q3XA 2CKUA 3KZJA 4B2SA 1G4GA 1C1ZA 3SW0X 2X2ZA 4B2RA 5HZPB 1H2PP 1Z92B 2JGXA 3IU3I 2I2LA 4YNXA 2CG6A 2KRIA 1GPZA 4MUCA 4AYMA 3FGRA 2RLPA 3F6KA 1HFHA 3OEDC 4LOSA 1G4FA 2KMSA 1HFIA 2O39C 3ZLEA 2QY0A 2IZ3A 2W81A 4AYEA 2W80A 1OJYA 3ZD2A 2XWJI 3IX0A 2ZYCA 1TPMA 1H04P 2BZMA 3OXUD 1RLHA 2RKYA 2Y8RA 1E88A 2EHFA 5HYPA 3VWOA 3CALA 3TVJA 4C16A 1QUBA 1GKNA 1OK3A 5I0QB 1SRZA 3R62A 2Y8TA 3ZLDA 1LY2A 1TPGA 4LOTA 2ERJA 3L89M 3T5OA 4PZ5A 2A55A 1U5MA 2MCZA 2MCYA 4WJG2 3ZRZA 4AYIA 3ERBA 3FGTA 3M7PA 1TPNA 5DN4A 1E8BA 2CG7A 4YIZA 2XQWC 4FXGG 1OK1A 1UOTP
chains in the Genus database with same CATH topology
5HYUB 1FBRA 2G7IA 3EJHA 1MD8A 3ZD1A 1VVCA 2XWBF 3GXEA 1GHQB 3O8EB 2UWNA 4F4OC 1H2QP 3RJ3D 1O9AA 2JRAA 2RL0A 1OK9A 4DJZA 1QO6A 2LOJA 2WIIC 2B5ID 1NWVA 2XRDA 2YRAA 2YBYA 3NFPI 1GKGA 4JHSA 4K12A 2XRBA 2IZ4A 3KXVA 4J38B 4AYDA 4IGDA 1QGBA 1ZJKA 4ONTD 1CKLA 1VVDA 5FO8C 4A5WB 1OJWA 4KKDA 3INBC 5JPMG 1E5GA 1PPQA 4ZH1D 4CSYA 1HCCA 1OK2A 3OP8A 5HYTB 1SS2A 2EC3A 2RKZA 2JGWA 1MD7A 2RLQA 2V8EA 1H03P 1ELVA 1OJVA 3MQLA 3GOVA 1Q3XA 2CKUA 3KZJA 4B2SA 1G4GA 1C1ZA 3SW0X 4B2RA 5HZPB 1H2PP 1Z92B 2JGXA 3IU3I 4YNXA 2CG6A 2KRIA 1GPZA 4MUCA 4AYMA 2RLPA 1HFHA 3OEDC 4LOSA 1G4FA 2KMSA 1HFIA 2O39C 2QY0A 2IZ3A 2W81A 4AYEA 2W80A 1OJYA 3ZD2A 2XWJI 3IX0A 1TPMA 1H04P 2BZMA 3OXUD 2RKYA 1E88A 2EHFA 5HYPA 3CALA 3TVJA 4C16A 1QUBA 1GKNA 1OK3A 5I0QB 1SRZA 3R62A 1LY2A 1TPGA 4LOTA 2ERJA 3L89M 3T5OA 4PZ5A 2A55A 1U5MA 2MCZA 2MCYA 4WJG2 3ZRZA 4AYIA 3ERBA 3M7PA 1TPNA 1E8BA 2CG7A 2XQWC 4FXGG 1OK1A 1UOTP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HYU B;  1FBR A;  2G7I A;  3EJH A;  1MD8 A;  3ZD1 A;  1VVC A;  2XWB F;  3GXE A;  1GHQ B;  3O8E B;  2UWN A;  4F4O C;  1H2Q P;  3RJ3 D;  1O9A A;  2JRA A;  2RL0 A;  1OK9 A;  4DJZ A;  1QO6 A;  2LOJ A;  2WII C;  2B5I D;  1NWV A;  2XRD A;  2YRA A;  2YBY A;  3NFP I;  1GKG A;  4JHS A;  4K12 A;  2XRB A;  2IZ4 A;  3KXV A;  4J38 B;  4AYD A;  4IGD A;  1QGB A;  1ZJK A;  4ONT D;  1CKL A;  1VVD A;  5FO8 C;  4A5W B;  1OJW A;  4KKD A;  3INB C;  5JPM G;  1E5G A;  1PPQ A;  4ZH1 D;  4CSY A;  1HCC A;  1OK2 A;  3OP8 A;  5HYT B;  1SS2 A;  2EC3 A;  2RKZ A;  2JGW A;  1MD7 A;  2RLQ A;  2V8E A;  1H03 P;  1ELV A;  1OJV A;  3MQL A;  3GOV A;  1Q3X A;  2CKU A;  3KZJ A;  4B2S A;  1G4G A;  1C1Z A;  3SW0 X;  4B2R A;  5HZP B;  1H2P P;  1Z92 B;  2JGX A;  3IU3 I;  4YNX A;  2CG6 A;  2KRI A;  1GPZ A;  4MUC A;  4AYM A;  2RLP A;  1HFH A;  3OED C;  4LOS A;  1G4F A;  2KMS A;  1HFI A;  2O39 C;  2QY0 A;  2IZ3 A;  2W81 A;  4AYE A;  2W80 A;  1OJY A;  3ZD2 A;  2XWJ I;  3IX0 A;  1TPM A;  1H04 P;  2BZM A;  3OXU D;  2RKY A;  1E88 A;  2EHF A;  5HYP A;  3CAL A;  3TVJ A;  4C16 A;  1QUB A;  1GKN A;  1OK3 A;  5I0Q B;  1SRZ A;  3R62 A;  1LY2 A;  1TPG A;  4LOT A;  2ERJ A;  3L89 M;  3T5O A;  4PZ5 A;  2A55 A;  1U5M A;  2MCZ A;  2MCY A;  4WJG 2;  3ZRZ A;  4AYI A;  3ERB A;  3M7P A;  1TPN A;  1E8B A;  2CG7 A;  2XQW C;  4FXG G;  1OK1 A;  1UOT P; 
#chains in the Genus database with same CATH topology
 5HYU B;  1FBR A;  2G7I A;  3EJH A;  1MD8 A;  3ZD1 A;  1VVC A;  2XWB F;  3GXE A;  1GHQ B;  3O8E B;  2UWN A;  4F4O C;  1H2Q P;  3RJ3 D;  2Y8S A;  1O9A A;  2JRA A;  2RL0 A;  1OK9 A;  4DJZ A;  1QO6 A;  2LOJ A;  2WII C;  2B5I D;  1NWV A;  3CI0 J;  2XRD A;  4BWC A;  2YRA A;  2YBY A;  3NFP I;  1GKG A;  4JHS A;  4K12 A;  2XRB A;  2IZ4 A;  3KXV A;  4J38 B;  4AYD A;  4IGD A;  1QGB A;  4N7E A;  1ZJK A;  4ONT D;  5DN5 A;  1CKL A;  1VVD A;  5FO8 C;  4APL A;  4A5W B;  1OJW A;  4KKD A;  4PO7 A;  3INB C;  5JPM G;  3WSX A;  1E5G A;  3NJA A;  3WSY A;  1PPQ A;  4ZH1 D;  4CSY A;  1HCC A;  1OK2 A;  3OP8 A;  3K3T A;  5HYT B;  1SS2 A;  2EC3 A;  2RKZ A;  2JGW A;  1MD7 A;  2RLQ A;  2V8E A;  1H03 P;  1ELV A;  1OJV A;  3MQL A;  3GOV A;  4MSL A;  1Q3X A;  2CKU A;  3KZJ A;  4B2S A;  1G4G A;  1C1Z A;  3SW0 X;  2X2Z A;  4B2R A;  5HZP B;  1H2P P;  1Z92 B;  2JGX A;  3IU3 I;  2I2L A;  4YNX A;  2CG6 A;  2KRI A;  1GPZ A;  4MUC A;  4AYM A;  3FGR A;  2RLP A;  3F6K A;  1HFH A;  3OED C;  4LOS A;  1G4F A;  2KMS A;  1HFI A;  2O39 C;  3ZLE A;  2QY0 A;  2IZ3 A;  2W81 A;  4AYE A;  2W80 A;  1OJY A;  3ZD2 A;  2XWJ I;  3IX0 A;  2ZYC A;  1TPM A;  1H04 P;  2BZM A;  3OXU D;  1RLH A;  2RKY A;  2Y8R A;  1E88 A;  2EHF A;  5HYP A;  3VWO A;  3CAL A;  3TVJ A;  4C16 A;  1QUB A;  1GKN A;  1OK3 A;  5I0Q B;  1SRZ A;  3R62 A;  2Y8T A;  3ZLD A;  1LY2 A;  1TPG A;  4LOT A;  2ERJ A;  3L89 M;  3T5O A;  4PZ5 A;  2A55 A;  1U5M A;  2MCZ A;  2MCY A;  4WJG 2;  3ZRZ A;  4AYI A;  3ERB A;  3FGT A;  3M7P A;  1TPN A;  5DN4 A;  1E8B A;  2CG7 A;  4YIZ A;  2XQW C;  4FXG G;  1OK1 A;  1UOT P; 
#chains in the Genus database with same CATH homology
 5HYU B;  1FBR A;  2G7I A;  3EJH A;  1MD8 A;  3ZD1 A;  1VVC A;  2XWB F;  3GXE A;  1GHQ B;  3O8E B;  2UWN A;  4F4O C;  1H2Q P;  3RJ3 D;  1O9A A;  2JRA A;  2RL0 A;  1OK9 A;  4DJZ A;  1QO6 A;  2LOJ A;  2WII C;  2B5I D;  1NWV A;  2XRD A;  2YRA A;  2YBY A;  3NFP I;  1GKG A;  4JHS A;  4K12 A;  2XRB A;  2IZ4 A;  3KXV A;  4J38 B;  4AYD A;  4IGD A;  1QGB A;  1ZJK A;  4ONT D;  1CKL A;  1VVD A;  5FO8 C;  4A5W B;  1OJW A;  4KKD A;  3INB C;  5JPM G;  1E5G A;  1PPQ A;  4ZH1 D;  4CSY A;  1HCC A;  1OK2 A;  3OP8 A;  5HYT B;  1SS2 A;  2EC3 A;  2RKZ A;  2JGW A;  1MD7 A;  2RLQ A;  2V8E A;  1H03 P;  1ELV A;  1OJV A;  3MQL A;  3GOV A;  1Q3X A;  2CKU A;  3KZJ A;  4B2S A;  1G4G A;  1C1Z A;  3SW0 X;  4B2R A;  5HZP B;  1H2P P;  1Z92 B;  2JGX A;  3IU3 I;  4YNX A;  2CG6 A;  2KRI A;  1GPZ A;  4MUC A;  4AYM A;  2RLP A;  1HFH A;  3OED C;  4LOS A;  1G4F A;  2KMS A;  1HFI A;  2O39 C;  2QY0 A;  2IZ3 A;  2W81 A;  4AYE A;  2W80 A;  1OJY A;  3ZD2 A;  2XWJ I;  3IX0 A;  1TPM A;  1H04 P;  2BZM A;  3OXU D;  2RKY A;  1E88 A;  2EHF A;  5HYP A;  3CAL A;  3TVJ A;  4C16 A;  1QUB A;  1GKN A;  1OK3 A;  5I0Q B;  1SRZ A;  3R62 A;  1LY2 A;  1TPG A;  4LOT A;  2ERJ A;  3L89 M;  3T5O A;  4PZ5 A;  2A55 A;  1U5M A;  2MCZ A;  2MCY A;  4WJG 2;  3ZRZ A;  4AYI A;  3ERB A;  3M7P A;  1TPN A;  1E8B A;  2CG7 A;  2XQW C;  4FXG G;  1OK1 A;  1UOT P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...