4JHSA

Crystal structure of a c-terminal two domain fragment of human beta-2-glycoprotein 1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
142
structure length
142
Chain Sequence
b'KCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-2-glycoprotein 1
publication title Crystal structure of a C-terminal two domain fragment of human beta-2-glycoprotein 1
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 24
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
A PF09014 Sushi_2 Beta-2-glycoprotein-1 fifth domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 4jhsA01
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 4jhsA02
1GPZA 4AYMA 3IX0A 2LOJA 2MCZA 2BZMA 4K12A 4JHSA 3KXVA 5HYTB 1TPMA 2EC3A 3M7PA 2XRDA 1U5MA 1E5GA 3ERBA 2CG7A 2B5ID 2MCYA 2W80A 1QO6A 1VVCA 4LOSA 4PZ5A 4A5WB 1H2QP 1QUBA 2V8EA 2ERJA 5HYUB 2YRAA 1O9AA 4AYDA 5I0QB 1TPGA 4KKDA 4B2RA 2KMSA 5FO8C 1OJYA 1OK2A 4AYIA 1LY2A 2RLPA 4MUCA 2CKUA 3ZD1A 2WIIC 1Z92B 1OK9A 3OP8A 2JRAA 2G7IA 1ZJKA 2IZ3A 2KRIA 4IGDA 1G4FA 1OJWA 5JPMG 1TPNA 3INBC 3ZRZA 2RLQA 2RL0A 2EHFA 3NFPI 3OEDC 3GOVA 2YBYA 2A55A 4LOTA 4J38B 1GHQB 1CKLA 2XWJI 3ZD2A 2XWBF 2XQWC 5HZPB 2XRBA 4DJZA 1Q3XA 1OK3A 2QY0A 2O39C 4ONTD 1MD7A 1UOTP 4WJG2 3CALA 3KZJA 4F4OC 3EJHA 3L89M 1VVDA 4FXGG 3R62A 1G4GA 2W81A 2JGXA 1HFIA 3O8EB 3OXUD 4B2SA 2IZ4A 3IU3I 3T5OA 1HCCA 3GXEA 4C16A 1OJVA 2UWNA 3MQLA 4ZH1D 4AYEA 2CG6A 1E88A 1E8BA 1H2PP 3RJ3D 1SS2A 1FBRA 1C1ZA 1ELVA 1HFHA 1H04P 1MD8A 1GKGA 1NWVA 1H03P 1PPQA 1GKNA 1QGBA 1SRZA 3SW0X 4YNXA 2JGWA 1OK1A 2RKYA 2RKZA 4CSYA 5HYPA 3TVJA
chains in the Genus database with same CATH superfamily
1GPZA 4AYMA 3K3TA 3IX0A 2LOJA 2MCZA 2BZMA 4K12A 4JHSA 3KXVA 3WSYA 5HYTB 1TPMA 3FGRA 2EC3A 3M7PA 2XRDA 1U5MA 3ZLEA 1E5GA 3ERBA 2CG7A 2B5ID 3NJAA 2MCYA 2Y8SA 3CI0J 3VWOA 2W80A 1QO6A 1VVCA 4LOSA 4PZ5A 4A5WB 1H2QP 2Y8RA 1QUBA 2V8EA 2ERJA 1RLHA 5HYUB 3FGTA 2YRAA 1O9AA 4AYDA 5I0QB 1TPGA 4KKDA 4B2RA 2KMSA 5FO8C 1OJYA 1OK2A 4AYIA 4BWCA 1LY2A 3ZLDA 2RLPA 4MUCA 2CKUA 3ZD1A 2WIIC 1Z92B 1OK9A 3OP8A 4MSLA 2JRAA 2G7IA 1ZJKA 2IZ3A 2KRIA 4IGDA 1G4FA 1OJWA 5JPMG 1TPNA 3INBC 3ZRZA 2RLQA 5DN4A 2RL0A 2EHFA 3NFPI 3WSXA 3OEDC 4YIZA 3GOVA 2YBYA 2A55A 4LOTA 4J38B 1GHQB 1CKLA 2XWJI 3ZD2A 2XWBF 2XQWC 4N7EA 2ZYCA 5HZPB 2XRBA 4DJZA 1Q3XA 1OK3A 2QY0A 2O39C 4APLA 3F6KA 4ONTD 1MD7A 1UOTP 4WJG2 3CALA 3KZJA 4F4OC 3EJHA 3L89M 1VVDA 4FXGG 3R62A 1G4GA 2W81A 2JGXA 1HFIA 3O8EB 3OXUD 4B2SA 2IZ4A 3IU3I 3T5OA 1HCCA 3GXEA 4C16A 1OJVA 2UWNA 3MQLA 4ZH1D 4AYEA 2CG6A 1E88A 1E8BA 1H2PP 3RJ3D 1SS2A 1FBRA 2X2ZA 1C1ZA 1ELVA 1HFHA 1H04P 1MD8A 1GKGA 1NWVA 1H03P 1PPQA 1GKNA 1QGBA 1SRZA 4PO7A 2Y8TA 3SW0X 4YNXA 2JGWA 1OK1A 5DN5A 2RKYA 2RKZA 4CSYA 5HYPA 2I2LA 3TVJA
chains in the Genus database with same CATH topology
1GPZA 4AYMA 3IX0A 2LOJA 2MCZA 2BZMA 4K12A 4JHSA 3KXVA 5HYTB 1TPMA 2EC3A 3M7PA 2XRDA 1U5MA 1E5GA 3ERBA 2CG7A 2B5ID 2MCYA 2W80A 1QO6A 1VVCA 4LOSA 4PZ5A 4A5WB 1H2QP 1QUBA 2V8EA 2ERJA 5HYUB 2YRAA 1O9AA 4AYDA 5I0QB 1TPGA 4KKDA 4B2RA 2KMSA 5FO8C 1OJYA 1OK2A 4AYIA 1LY2A 2RLPA 4MUCA 2CKUA 3ZD1A 2WIIC 1Z92B 1OK9A 3OP8A 2JRAA 2G7IA 1ZJKA 2IZ3A 2KRIA 4IGDA 1G4FA 1OJWA 5JPMG 1TPNA 3INBC 3ZRZA 2RLQA 2RL0A 2EHFA 3NFPI 3OEDC 3GOVA 2YBYA 2A55A 4LOTA 4J38B 1GHQB 1CKLA 2XWJI 3ZD2A 2XWBF 2XQWC 5HZPB 2XRBA 4DJZA 1Q3XA 1OK3A 2QY0A 2O39C 4ONTD 1MD7A 1UOTP 4WJG2 3CALA 3KZJA 4F4OC 3EJHA 3L89M 1VVDA 4FXGG 3R62A 1G4GA 2W81A 2JGXA 1HFIA 3O8EB 3OXUD 4B2SA 2IZ4A 3IU3I 3T5OA 1HCCA 3GXEA 4C16A 1OJVA 2UWNA 3MQLA 4ZH1D 4AYEA 2CG6A 1E88A 1E8BA 1H2PP 3RJ3D 1SS2A 1FBRA 1C1ZA 1ELVA 1HFHA 1H04P 1MD8A 1GKGA 1NWVA 1H03P 1PPQA 1GKNA 1QGBA 1SRZA 3SW0X 4YNXA 2JGWA 1OK1A 2RKYA 2RKZA 4CSYA 5HYPA 3TVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GPZ A;  4AYM A;  3IX0 A;  2LOJ A;  2MCZ A;  2BZM A;  4K12 A;  4JHS A;  3KXV A;  5HYT B;  1TPM A;  2EC3 A;  3M7P A;  2XRD A;  1U5M A;  1E5G A;  3ERB A;  2CG7 A;  2B5I D;  2MCY A;  2W80 A;  1QO6 A;  1VVC A;  4LOS A;  4PZ5 A;  4A5W B;  1H2Q P;  1QUB A;  2V8E A;  2ERJ A;  5HYU B;  2YRA A;  1O9A A;  4AYD A;  5I0Q B;  1TPG A;  4KKD A;  4B2R A;  2KMS A;  5FO8 C;  1OJY A;  1OK2 A;  4AYI A;  1LY2 A;  2RLP A;  4MUC A;  2CKU A;  3ZD1 A;  2WII C;  1Z92 B;  1OK9 A;  3OP8 A;  2JRA A;  2G7I A;  1ZJK A;  2IZ3 A;  2KRI A;  4IGD A;  1G4F A;  1OJW A;  5JPM G;  1TPN A;  3INB C;  3ZRZ A;  2RLQ A;  2RL0 A;  2EHF A;  3NFP I;  3OED C;  3GOV A;  2YBY A;  2A55 A;  4LOT A;  4J38 B;  1GHQ B;  1CKL A;  2XWJ I;  3ZD2 A;  2XWB F;  2XQW C;  5HZP B;  2XRB A;  4DJZ A;  1Q3X A;  1OK3 A;  2QY0 A;  2O39 C;  4ONT D;  1MD7 A;  1UOT P;  4WJG 2;  3CAL A;  3KZJ A;  4F4O C;  3EJH A;  3L89 M;  1VVD A;  4FXG G;  3R62 A;  1G4G A;  2W81 A;  2JGX A;  1HFI A;  3O8E B;  3OXU D;  4B2S A;  2IZ4 A;  3IU3 I;  3T5O A;  1HCC A;  3GXE A;  4C16 A;  1OJV A;  2UWN A;  3MQL A;  4ZH1 D;  4AYE A;  2CG6 A;  1E88 A;  1E8B A;  1H2P P;  3RJ3 D;  1SS2 A;  1FBR A;  1C1Z A;  1ELV A;  1HFH A;  1H04 P;  1MD8 A;  1GKG A;  1NWV A;  1H03 P;  1PPQ A;  1GKN A;  1QGB A;  1SRZ A;  3SW0 X;  4YNX A;  2JGW A;  1OK1 A;  2RKY A;  2RKZ A;  4CSY A;  5HYP A;  3TVJ A; 
#chains in the Genus database with same CATH topology
 1GPZ A;  4AYM A;  3K3T A;  3IX0 A;  2LOJ A;  2MCZ A;  2BZM A;  4K12 A;  4JHS A;  3KXV A;  3WSY A;  5HYT B;  1TPM A;  3FGR A;  2EC3 A;  3M7P A;  2XRD A;  1U5M A;  3ZLE A;  1E5G A;  3ERB A;  2CG7 A;  2B5I D;  3NJA A;  2MCY A;  2Y8S A;  3CI0 J;  3VWO A;  2W80 A;  1QO6 A;  1VVC A;  4LOS A;  4PZ5 A;  4A5W B;  1H2Q P;  2Y8R A;  1QUB A;  2V8E A;  2ERJ A;  1RLH A;  5HYU B;  3FGT A;  2YRA A;  1O9A A;  4AYD A;  5I0Q B;  1TPG A;  4KKD A;  4B2R A;  2KMS A;  5FO8 C;  1OJY A;  1OK2 A;  4AYI A;  4BWC A;  1LY2 A;  3ZLD A;  2RLP A;  4MUC A;  2CKU A;  3ZD1 A;  2WII C;  1Z92 B;  1OK9 A;  3OP8 A;  4MSL A;  2JRA A;  2G7I A;  1ZJK A;  2IZ3 A;  2KRI A;  4IGD A;  1G4F A;  1OJW A;  5JPM G;  1TPN A;  3INB C;  3ZRZ A;  2RLQ A;  5DN4 A;  2RL0 A;  2EHF A;  3NFP I;  3WSX A;  3OED C;  4YIZ A;  3GOV A;  2YBY A;  2A55 A;  4LOT A;  4J38 B;  1GHQ B;  1CKL A;  2XWJ I;  3ZD2 A;  2XWB F;  2XQW C;  4N7E A;  2ZYC A;  5HZP B;  2XRB A;  4DJZ A;  1Q3X A;  1OK3 A;  2QY0 A;  2O39 C;  4APL A;  3F6K A;  4ONT D;  1MD7 A;  1UOT P;  4WJG 2;  3CAL A;  3KZJ A;  4F4O C;  3EJH A;  3L89 M;  1VVD A;  4FXG G;  3R62 A;  1G4G A;  2W81 A;  2JGX A;  1HFI A;  3O8E B;  3OXU D;  4B2S A;  2IZ4 A;  3IU3 I;  3T5O A;  1HCC A;  3GXE A;  4C16 A;  1OJV A;  2UWN A;  3MQL A;  4ZH1 D;  4AYE A;  2CG6 A;  1E88 A;  1E8B A;  1H2P P;  3RJ3 D;  1SS2 A;  1FBR A;  2X2Z A;  1C1Z A;  1ELV A;  1HFH A;  1H04 P;  1MD8 A;  1GKG A;  1NWV A;  1H03 P;  1PPQ A;  1GKN A;  1QGB A;  1SRZ A;  4PO7 A;  2Y8T A;  3SW0 X;  4YNX A;  2JGW A;  1OK1 A;  5DN5 A;  2RKY A;  2RKZ A;  4CSY A;  5HYP A;  2I2L A;  3TVJ A; 
#chains in the Genus database with same CATH homology
 1GPZ A;  4AYM A;  3IX0 A;  2LOJ A;  2MCZ A;  2BZM A;  4K12 A;  4JHS A;  3KXV A;  5HYT B;  1TPM A;  2EC3 A;  3M7P A;  2XRD A;  1U5M A;  1E5G A;  3ERB A;  2CG7 A;  2B5I D;  2MCY A;  2W80 A;  1QO6 A;  1VVC A;  4LOS A;  4PZ5 A;  4A5W B;  1H2Q P;  1QUB A;  2V8E A;  2ERJ A;  5HYU B;  2YRA A;  1O9A A;  4AYD A;  5I0Q B;  1TPG A;  4KKD A;  4B2R A;  2KMS A;  5FO8 C;  1OJY A;  1OK2 A;  4AYI A;  1LY2 A;  2RLP A;  4MUC A;  2CKU A;  3ZD1 A;  2WII C;  1Z92 B;  1OK9 A;  3OP8 A;  2JRA A;  2G7I A;  1ZJK A;  2IZ3 A;  2KRI A;  4IGD A;  1G4F A;  1OJW A;  5JPM G;  1TPN A;  3INB C;  3ZRZ A;  2RLQ A;  2RL0 A;  2EHF A;  3NFP I;  3OED C;  3GOV A;  2YBY A;  2A55 A;  4LOT A;  4J38 B;  1GHQ B;  1CKL A;  2XWJ I;  3ZD2 A;  2XWB F;  2XQW C;  5HZP B;  2XRB A;  4DJZ A;  1Q3X A;  1OK3 A;  2QY0 A;  2O39 C;  4ONT D;  1MD7 A;  1UOT P;  4WJG 2;  3CAL A;  3KZJ A;  4F4O C;  3EJH A;  3L89 M;  1VVD A;  4FXG G;  3R62 A;  1G4G A;  2W81 A;  2JGX A;  1HFI A;  3O8E B;  3OXU D;  4B2S A;  2IZ4 A;  3IU3 I;  3T5O A;  1HCC A;  3GXE A;  4C16 A;  1OJV A;  2UWN A;  3MQL A;  4ZH1 D;  4AYE A;  2CG6 A;  1E88 A;  1E8B A;  1H2P P;  3RJ3 D;  1SS2 A;  1FBR A;  1C1Z A;  1ELV A;  1HFH A;  1H04 P;  1MD8 A;  1GKG A;  1NWV A;  1H03 P;  1PPQ A;  1GKN A;  1QGB A;  1SRZ A;  3SW0 X;  4YNX A;  2JGW A;  1OK1 A;  2RKY A;  2RKZ A;  4CSY A;  5HYP A;  3TVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...