4JI0D

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
208
structure length
208
Chain Sequence
GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRPSDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRLDNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQLVIEFYSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 54
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00163 Ribosomal_S4 Ribosomal protein S4/S9 N-terminal domain
D PF01479 S4 S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1050.10 Mainly Alpha Orthogonal Bundle Ribosomal Protein S4 Delta 41; Chain A, domain 1 Ribosomal Protein S4 Delta 41; Chain A, domain 1 4ji0D01
3.10.290.10 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A RNA-binding S4 domain 4ji0D02
2K6PA 1P9KA 4DV1D 1N33D 4DR3D 4LF5D 1XNRD 1HNWD 4DR2D 4LFBD 1KSKA 3T1HD 4YHHD 4JV5D 4X65D 2UUBD 1FKAD 2UXBD 3T1YD 1I94D 3KBGA 4LGTA 4JI0D 4JI3D 2KTLA 4KHPD 4DV6D 1H3EA 5IWAD 4JYAD 1FJGD 1JH3A 1DM9A 1C06A 2VQED 4JI2D 1N36D 4JI4D 1VIOA 4LF4D 4JI1D 2VQFD 4B3SD 2HHHD 4B3RD 1N34D 4NXMD 2UUAD 2ZM6D 4AQYD 4DUYD 4LFAD 1IBMD 5BR8D 1C05A 2JANA 1XMOD 4YY3D 1HNXD 4DV2D 4LF7D 4DV4D 4LF6D 4DR7D 1XMQD 1J5ED 2UXDD 4DV5D 1IBLD 4DR4D 4GKJD 5LMND 1HNZD 4B3MD 4DR6D 4DV0D 1KSLA 4JI6D 2F4VD 1N32D 4X64D 4DV3D 5LMUD 4NXND 4JI5D 4GKKD 4X66D 4LF8D 4DUZD 4DV7D 1XNQD 4DR1D 4OUDA 1KSVA 1HR0D 4JI7D 4DR5D 2E5LD 4JI8D 2UU9D 2UXCD 2ISTA 3DH3A 4LF9D 4K0KD 2UUCD 1IBKD 4X62D 1H3FA 4B3TD 3HP7A 3OTOD 4OX9D 4LFCD
chains in the Genus database with same CATH superfamily
2K6PA 1P9KA 4DV1D 1N33D 4DR3D 4LF5D 1XNRD 1HNWD 4DR2D 4LFBD 4W5VB 2NVUB 3J80E 1KSKA 3T1HD 4YHHD 4JV5D 5IT9E 4X65D 4NNJA 2UUBD 1FKAD 3ONHA 5KNLA 2UXBD 3T1YD 1I94D 3KBGA 5FLXE 2L3NA 4LGTA 3JAME 4JI0D 4JI3D 2KTLA 4KHPD 4DV6D 3J7AF 1H3EA 5IWAD 4JYAD 1FJGD 1JH3A 1Y8XB 1DM9A 1C06A 4II2A 2VQED 4JI2D 1N36D 4JI4D 1VIOA 2LQ7A 3ONGA 4LF4D 1Y8QB 4JI1D 4II3A 2VQFD 4B3SD 2HHHD 4B3RD 1N34D 4NXMD 2UUAD 2ZM6D 4AQYD 4DUYD 4LFAD 1IBMD 1Y8RB 3KYDB 5BR8D 1C05A 2JANA 1XMOD 4YY3D 1HNXD 4DV2D 4LF7D 4DV4D 4LF6D 4DR7D 2I1SA 1XMQD 1J5ED 3FN1A 2UXDD 4DV5D 1IBLD 4DR4D 5A2QE 4GKJD 5LMND 1HNZD 4B3MD 4DR6D 4DV0D 1KSLA 4JI6D 2F4VD 1N32D 4X64D 4DV3D 5LMUD 4NXND 4JI5D 4GKKD 4X66D 4LF8D 4DUZD 4DV7D 1XNQD 2ZTBA 4DR1D 4OUDA 1KSVA 1HR0D 4JI7D 3CMMA 4DR5D 2E5LD 5LL6S 5FQ2B 4JI8D 2UU9D 2UXCD 2ISTA 3DH3A 4LF9D 4K0KD 2UUCD 1IBKD 4X62D 1H3FA 4B3TD 3HP7A 3OTOD 3KYCB 4OX9D 4LFCD 3J81E
chains in the Genus database with same CATH topology
2K6PA 1P9KA 4DV1D 1N33D 4DR3D 4LF5D 1XNRD 1HNWD 4DR2D 4LFBD 1KSKA 3T1HD 4YHHD 4JV5D 4X65D 2UUBD 1FKAD 2UXBD 3T1YD 1I94D 3KBGA 2L3NA 4LGTA 4JI0D 4JI3D 2KTLA 4KHPD 4DV6D 1H3EA 5IWAD 4JYAD 1FJGD 1JH3A 1DM9A 1C06A 2VQED 4JI2D 1N36D 4JI4D 1VIOA 4LF4D 4JI1D 2VQFD 4B3SD 2HHHD 4B3RD 1N34D 4NXMD 2UUAD 2ZM6D 4AQYD 4DUYD 4LFAD 1IBMD 5BR8D 1C05A 2JANA 1XMOD 4YY3D 1HNXD 4DV2D 4LF7D 4DV4D 4LF6D 4DR7D 1XMQD 1J5ED 2UXDD 4DV5D 1IBLD 4DR4D 4GKJD 5LMND 1HNZD 4B3MD 4DR6D 4DV0D 1KSLA 4JI6D 2F4VD 1N32D 4X64D 4DV3D 5LMUD 4NXND 4JI5D 4GKKD 4X66D 4LF8D 4DUZD 4DV7D 1XNQD 4DR1D 4OUDA 1KSVA 1HR0D 4JI7D 4DR5D 2E5LD 4JI8D 2UU9D 2UXCD 2ISTA 3DH3A 4LF9D 4K0KD 2UUCD 1IBKD 4X62D 1H3FA 4B3TD 3HP7A 3OTOD 4OX9D 4LFCD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K6P A;  1P9K A;  4DV1 D;  1N33 D;  4DR3 D;  4LF5 D;  1XNR D;  1HNW D;  4DR2 D;  4LFB D;  1KSK A;  3T1H D;  4YHH D;  4JV5 D;  4X65 D;  2UUB D;  1FKA D;  2UXB D;  3T1Y D;  1I94 D;  3KBG A;  4LGT A;  4JI0 D;  4JI3 D;  2KTL A;  4KHP D;  4DV6 D;  1H3E A;  5IWA D;  4JYA D;  1FJG D;  1JH3 A;  1DM9 A;  1C06 A;  2VQE D;  4JI2 D;  1N36 D;  4JI4 D;  1VIO A;  4LF4 D;  4JI1 D;  2VQF D;  4B3S D;  2HHH D;  4B3R D;  1N34 D;  4NXM D;  2UUA D;  2ZM6 D;  4AQY D;  4DUY D;  4LFA D;  1IBM D;  5BR8 D;  1C05 A;  2JAN A;  1XMO D;  4YY3 D;  1HNX D;  4DV2 D;  4LF7 D;  4DV4 D;  4LF6 D;  4DR7 D;  1XMQ D;  1J5E D;  2UXD D;  4DV5 D;  1IBL D;  4DR4 D;  4GKJ D;  5LMN D;  1HNZ D;  4B3M D;  4DR6 D;  4DV0 D;  1KSL A;  4JI6 D;  2F4V D;  1N32 D;  4X64 D;  4DV3 D;  5LMU D;  4NXN D;  4JI5 D;  4GKK D;  4X66 D;  4LF8 D;  4DUZ D;  4DV7 D;  1XNQ D;  4DR1 D;  4OUD A;  1KSV A;  1HR0 D;  4JI7 D;  4DR5 D;  2E5L D;  4JI8 D;  2UU9 D;  2UXC D;  2IST A;  3DH3 A;  4LF9 D;  4K0K D;  2UUC D;  1IBK D;  4X62 D;  1H3F A;  4B3T D;  3HP7 A;  3OTO D;  4OX9 D;  4LFC D; 
#chains in the Genus database with same CATH topology
 2K6P A;  1P9K A;  4DV1 D;  1N33 D;  4DR3 D;  4LF5 D;  1XNR D;  1HNW D;  4DR2 D;  4LFB D;  4W5V B;  2NVU B;  3J80 E;  1KSK A;  3T1H D;  4YHH D;  4JV5 D;  5IT9 E;  4X65 D;  4NNJ A;  2UUB D;  1FKA D;  3ONH A;  5KNL A;  2UXB D;  3T1Y D;  1I94 D;  3KBG A;  5FLX E;  2L3N A;  4LGT A;  3JAM E;  4JI0 D;  4JI3 D;  2KTL A;  4KHP D;  4DV6 D;  3J7A F;  1H3E A;  5IWA D;  4JYA D;  1FJG D;  1JH3 A;  1Y8X B;  1DM9 A;  1C06 A;  4II2 A;  2VQE D;  4JI2 D;  1N36 D;  4JI4 D;  1VIO A;  2LQ7 A;  3ONG A;  4LF4 D;  1Y8Q B;  4JI1 D;  4II3 A;  2VQF D;  4B3S D;  2HHH D;  4B3R D;  1N34 D;  4NXM D;  2UUA D;  2ZM6 D;  4AQY D;  4DUY D;  4LFA D;  1IBM D;  1Y8R B;  3KYD B;  5BR8 D;  1C05 A;  2JAN A;  1XMO D;  4YY3 D;  1HNX D;  4DV2 D;  4LF7 D;  4DV4 D;  4LF6 D;  4DR7 D;  2I1S A;  1XMQ D;  1J5E D;  3FN1 A;  2UXD D;  4DV5 D;  1IBL D;  4DR4 D;  5A2Q E;  4GKJ D;  5LMN D;  1HNZ D;  4B3M D;  4DR6 D;  4DV0 D;  1KSL A;  4JI6 D;  2F4V D;  1N32 D;  4X64 D;  4DV3 D;  5LMU D;  4NXN D;  4JI5 D;  4GKK D;  4X66 D;  4LF8 D;  4DUZ D;  4DV7 D;  1XNQ D;  2ZTB A;  4DR1 D;  4OUD A;  1KSV A;  1HR0 D;  4JI7 D;  3CMM A;  4DR5 D;  2E5L D;  5LL6 S;  5FQ2 B;  4JI8 D;  2UU9 D;  2UXC D;  2IST A;  3DH3 A;  4LF9 D;  4K0K D;  2UUC D;  1IBK D;  4X62 D;  1H3F A;  4B3T D;  3HP7 A;  3OTO D;  3KYC B;  4OX9 D;  4LFC D;  3J81 E; 
#chains in the Genus database with same CATH homology
 2K6P A;  1P9K A;  4DV1 D;  1N33 D;  4DR3 D;  4LF5 D;  1XNR D;  1HNW D;  4DR2 D;  4LFB D;  1KSK A;  3T1H D;  4YHH D;  4JV5 D;  4X65 D;  2UUB D;  1FKA D;  2UXB D;  3T1Y D;  1I94 D;  3KBG A;  2L3N A;  4LGT A;  4JI0 D;  4JI3 D;  2KTL A;  4KHP D;  4DV6 D;  1H3E A;  5IWA D;  4JYA D;  1FJG D;  1JH3 A;  1DM9 A;  1C06 A;  2VQE D;  4JI2 D;  1N36 D;  4JI4 D;  1VIO A;  4LF4 D;  4JI1 D;  2VQF D;  4B3S D;  2HHH D;  4B3R D;  1N34 D;  4NXM D;  2UUA D;  2ZM6 D;  4AQY D;  4DUY D;  4LFA D;  1IBM D;  5BR8 D;  1C05 A;  2JAN A;  1XMO D;  4YY3 D;  1HNX D;  4DV2 D;  4LF7 D;  4DV4 D;  4LF6 D;  4DR7 D;  1XMQ D;  1J5E D;  2UXD D;  4DV5 D;  1IBL D;  4DR4 D;  4GKJ D;  5LMN D;  1HNZ D;  4B3M D;  4DR6 D;  4DV0 D;  1KSL A;  4JI6 D;  2F4V D;  1N32 D;  4X64 D;  4DV3 D;  5LMU D;  4NXN D;  4JI5 D;  4GKK D;  4X66 D;  4LF8 D;  4DUZ D;  4DV7 D;  1XNQ D;  4DR1 D;  4OUD A;  1KSV A;  1HR0 D;  4JI7 D;  4DR5 D;  2E5L D;  4JI8 D;  2UU9 D;  2UXC D;  2IST A;  3DH3 A;  4LF9 D;  4K0K D;  2UUC D;  1IBK D;  4X62 D;  1H3F A;  4B3T D;  3HP7 A;  3OTO D;  4OX9 D;  4LFC D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...