4JI1E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4ji1E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji1E02
1ZXNA 2F4VE 1B62A 4UTGA 4B3SI 1EKZA 4Z7CA 5LMUI 2WW4A 1PIEA 2X7IA 2J7KA 1DARA 4P7AA 4OOGC 4DR5I 4LF7E 3ADLA 3LLHA 4X66E 1Z0BA 1XNRI 1X49A 4DV5I 3QT6A 4HY1A 4YHHE 1D6TA 2DB2A 2RS6A 3ZKDA 4B3RE 4DV6E 4PU9A 3LTOA 3HULA 2R42A 3J81C 2RSMA 4GKKI 4JI2E 4DPTA 4YY3I 1HNXI 2EZ6A 4HACB 3WU3A 2UUBI 4AQYE 2UUAE 2NA2A 5BR8E 4B3ME 4DPWA 1T4LB 4DV3E 4NXNI 2VQEI 3HTXA 4JI7I 4DV2I 4JI8E 4DV0I 4JI6E 3GONA 1EI1A 1UEKA 4DR4I 4JV5I 1MU5A 4LF9I 4DV1E 1N33I 4LF5E 1U2RA 2UUBE 4NXME 1FJGI 2CPNA 4JI0E 1IBME 4DR1E 2VF3A 4JG4A 4DPUA 1KIJA 5A2QC 2BM1A 4LF8E 1ZM4A 2L3JA 3ZKBA 1NHJA 4DV4E 1NZ0A 4WYQB 4DR6I 4DV2E 2GS8A 2E1RA 2LJHA 1HR0E 2BV3A 5L3JA 4JI7E 1BKNA 4DR2E 3H4LA 2L2NA 1EA6A 1MX0A 4JI8I 4M30A 2UUAI 1XHKA 1ZM3A 2V2ZA 1YYOA 1N34I 4JI2I 3QT5A 4NXMI 4WUBA 4AQYI 1WHNA 3VYYA 2NUEA 4DR1I 4B3RI 2JVAA 3ZZTA 4WUCA 4YHHI 2R3VA 4HYMA 1GQEA 5FLXQ 3ADJA 4DR2I 2UXDI 1ELOA 1A6FA 1OJ4A 2HHHI 2HKEA 4R1FA 4MYUA 3K1JA 1NHHA 1HNWI 1H7UA 2NPFA 2LTSA 1Z5AA 4RPFA 1HNZI 4B3SE 1IBMI 2L2KB 1FJGE 1X48A 4OX9E 2LBSB 1HNXE 4X65E 3J80Q 4HACA 2B7TA 4DKKA 1O0WA 4DUZE 2YT4A 2NUFA 2CZ9A 3Q1QA 4UT4A 1YZ9A 1YYWA 4DR3I 2DEJA 1HR0I 3OTOI 1RQ0A 4JYAE 1Z5CA 3B78A 4DV7E 4K0KE 2B7VA 2BM0A 4YY3E 1Z59A 4HXZA 4JI1I 1N32I 2DMYA 3D4JA 4JI0I 3T1YI 1ZBTA 3ZZ0A 2AJ4A 3V5RA 2UU9I 5FLXC 2HK3A 1IBKI 2L2MA 5IWAI 2ZITA 1FI4A 4JI3I 2VQFI 4DV5E 1UILA 1XNRE 2ZM6E 4X62I 4DU8A 4LF7I 3PYFA 1YYKA 1STUA 1J5EE 4LFAI 4DXLA 1X47A 1FWLA 2HFSA 4FWGA 4X62E 1FWKA 4GKJI 2Q2EB 4XTJA 2E5LI 4DR7E 1H73A 4JI3E 4DUZI 1IBKE 2UU9E 3QT8A 2LRSA 2V2QA 4USMA 5IWAE 3C4BA 2NUGA 1N32E 4JI1E 4P52A 4LFBE 2HK2A 1ZM2A 4LF5I 1H74A 3C4TA 4FN5A 1XMQI 5A2QQ 4LF4I 2RS7A 2UXCI 4DR3E 3CWVA 3J7Yp 4DUYI 4LFCI 4JI4I 4JYAI 4Z7YA 5LMUE 2X36A 4K0KI 3ADGA 3T1HE 2ZBKB 4JI5I 5GMDA 2UUCE 1VISA 5GMEA 2LTRA 1XMOI 5BR8I 4B3MI 1S16A 1Z0CA 4FW9A 4DV4I 4KHPI 5LMNE 1WUUA 2N3GA 4X64E 4ZVIA 4LF6E 1N36I 4B3TI 4DV6I 1HNZE 4FWHA 1I94E 2MDRA 1RC7A 1H7SA 1N33E 1RREA 3JAMC 1Z0EA 1B63A 2B3TB 2UUCI 1MG7A 4FWDA 1T4NA 3T1HI 3B8HA 5CFFE 1DI2A 1NHIA 2UXDE 1Z0TA 2JY9A 2LUQA 1FNMA 2VQEE 2LUPB 1UHZA 3J7AG 2A2CA 3B82A 2L33A 1PKPA 4KQVA 3ZZUA 4B3TE 4DPYA 4X64I 4URLA 3LPSA 4OX9I 2F4VI 1PVGA 4USKA 2HKJA 1N34E 2DIXA 1HNWE 1H72C 1IBLE 1RR9A 3J80C 2LJPA 3PYEA 1KKHA 1Z0WA 1XNQE 4DUYE 2UXCE 1J26A 4PRVA 2DEIA 3WU4A 3M6AA 4I3HA 4GKJE 3K17A 4LF8I 1T4OA 2EFGA 2V2VA 1N36E 4LF6I 4WUDA 1I94I 4M2ZA 5LL6R 1S4EA 1Z0GA 4LFBI 2RTXA 1Z5BA 4DV1I 1KTVA 1ZXMA 4JV5E 2XEXA 5LMNI 2L3CA 3QT7A 2IHR1 5IT9C 4LF9E 4DV0E 4M1KA 4JI6I 2E5LE 2KHXA 1ZM9A 4DR4E 3T1YE 4DV3I 3PYGA 3LNUA 1XNQI 4JI5E 4PRXA 1Z0VA 4LFAE 3WU6A 1J5EI 4DR6E 1KVKA 4WFTA 4DPXA 1XMQE 2UXBE 4MYTA 4X8WA 1N0VC 4KHPE 1QU6A 3ADIA 1N0UA 1WHQA 3ZM7A 4GKKE 3F0NA 2A2DA 3VYXA 5IT9Q 3P1XA 4X66I 4ED4A 2V34A 4JI4E 4LFCE 3WU5A 4NXNE 3PYDA 1K47A 4DU7A 3JAMQ 2UXBI 3V2UC 4LF4E 2OI2A 2HFUA 4DR5E 1QZRA 3OTOE 4DV7I 2HHHE 2ZM6I 2V8PA 3J7AM 2N3HA 1IBLI 1FKAE 2VQFE 1XMOE 4EMDA 4DR7I 3J81Q 4X65I
chains in the Genus database with same CATH superfamily
1ZXNA 2KONA 5A6AA 2F4VE 2N8XA 3M7ND 2V88A 4BC9A 1B62A 2AE8A 4UTGA 2YSPA 1Z1BA 4B3SI 1EKZA 2MC5A 2C37B 4Z7CA 3P3CA 4LTYA 3EPHA 5JEAC 5LMUI 1UDQA 2WW4A 2ODRC 2RQLA 2YSOA 1PIEA 3U1YA 2YTJA 2X7IA 2J7KA 4U3BA 4MU1A 1ZU1A 1DARA 4P7AA 2EM4A 4OOGC 4DR5I 4LF7E 2G7HA 2FGGA 2V83A 3ADLA 3PS3A 1A1JA 5C0XC 3LLHA 4X66E 2M1SA 1Z0BA 1XNRI 1TN9A 1X49A 5KL3A 2O3ZA 4DV5I 3HPSA 3QT6A 4HY1A 4YHHE 1D6TA 1EH7A 2YTIA 2DB2A 1KJKA 1P42A 2RS6A 3ZKDA 3PS1A 2EPXA 5C0XE 2LVHA 4F9AB 4DV6E 4B3RE 4PU9A 3LTOA 1YH8A 2NN6A 3HULA 4BA1B 2R42A 3J81C 2RSMA 4GKKI 2EPCA 2WP8A 1PJSA 4JI2E 5AE1A 1EH6A 4QNJA 3K85A 2C39B 4DPTA 4YY3I 1HNXI 2EZ6A 4HACB 3WU3A 2UUBI 2PO0A 4AQYE 4O43A 2UUAE 2NA2A 1DQ3A 2EL6A 2YTQA 2EMXA 2VF1A 5BR8E 3EPJA 4B3ME 2YRMA 4DPWA 4OO1B 1T4LB 4QNKA 1JK1A 2EPRA 2EM8A 5DNYA 1SR9A 4DV3E 3P76A 1MEYC 4NXNI 1A1GA 2VQEI 3HTXA 4BHCA 1WJPA 1Y4SA 4U3DA 4JI7I 2DMIA 2YTFA 3GLLA 4OO1F 4DV2I 4JI8E 4DV0I 4GZNC 3VHTB 2EN1A 2JT2A 1NCSA 4JI6E 4J8ZA 1EI1A 3GONA 2EN2A 3TQMA 1UEKA 3GMEA 4DR4I 4JV5I 2VE7C 5KL6A 1MU5A 4LF9I 4DV1E 5C0XB 1N33I 2PNLA 2GHFA 4LF5E 3IWBA 1P47A 1U2RA 1B69A 2WNRB 2UUBE 4NXME 2VESA 1TF3A 5DNXA 1FJGI 2CPNA 4JI0E 2WBSA 1IBME 4DR1E 2VF3A 4OO1D 5ELWA 4JG4A 4DPUA 5A2QC 1KIJA 4MU0A 4R2AA 2BM1A 4LF8E 2Z5BB 1ZM4A 2EPMX 4MU4A 5K36A 5JEAE 2L3JA 1ZBQA 3ZKBA 1NHJA 4DV4E 2YU8A 1HK7A 1NZ0A 1WRJA 4WYQB 3FIGA 3BGHA 4DR6I 2EMFA 4DV2E 2BA0D 2EM6A 2GS8A 2E1RA 3M7NG 1Y4UA 4R2PA 3MHHC 2EL5A 2JP9A 2LJHA 1HR0E 2BV3A 4ZYGA 4FW3A 2Z5EA 5L3JA 2BR2A 4JI7E 5KL4A 1BKNA 4DR2E 1A1KA 3H4LA 5C0XD 2L2NA 4GEQB 1EA6A 4R2RA 1MX0A 4JI8I 4M30A 4N3OA 4LPFA 3UK3C 2JE6A 2PO0B 2UUAI 2BB8A 2R1FA 1XHKA 4IFDC 4N4RB 2IOQA 2Z5CB 1E3PA 2JXPA 3HQ1A 1ZM3A 4BS9A 2V89A 2LJUA 4WXCA 2V2ZA 2I13A 2JOXA 4IZJA 1YYOA 1N34I 4O24A 4JI2I 2PO2B 3DJWA 3EPLA 3QT5A 2YWQA 2EPZA 3MHSC 4NXMI 4WUBA 4AQYI 1WHNA 5T6JA 3VYYA 2NUEA 2IERA 4LOMA 4DR1I 4B3RI 4WX9A 2GO3A 5JEAF 2JVAA 4X9JA 2CSHA 1YHCA 3ZZTA 4WUCA 3BBGA 4YHHI 2R3VA 4HYMA 2HGHA 2ODRD 4L5NC 1GQEA 5FLXQ 3ADJA 4F6MA 4DR2I 2UXDI 1ELOA 1RHYA 2J7JA 4R2QA 1A6FA 3BIDA 1EH8A 1LLMC 4ZYEA 5FWKA 2EMCA 2YRHA 1A1LA 5EL9A 2EOYA 1OJ4A 2IESA 4MLVA 2EQ3A 2JYAA 2HKEA 4R1FA 2HHHI 4IFDA 4MYUA 5IXMB 5KL5A 3K1JA 4OKGA 2L6MA 2MDGA 3KZYA 2EPPA 1NHHA 1HNWI 2EN8A 3L7ZB 1H7UA 2BA1G 2NPFA 2LTSA 1Z5AA 4RPFA 4IZKB 1HNZI 4B3SE 1IBMI 4HEIA 2L2KB 1FJGE 1YUIA 1X48A 4O5GA 2GO4A 4OX9E 2LBSB 4WSPA 1HNXE 4X65E 4LCGA 3RMPA 4O4KA 3J80Q 2EOEA 4BHBA 2F8BA 2BBGA 2DGCA 2EMGA 4HACA 2F1DA 2ELYA 2B7TA 2EMAA 5LLQA 2EOSA 2FV4B 2B9DA 4MQYA 2EN6A 4F9CB 1Y5YA 4DKKA 2Z5CA 1O0WA 5AC4A 4DUZE 1Y6ZA 1XXEA 2PNMA 2YT4A 4IZJD 2NUFA 2JE6B 2EPNA 2CZ9A 3Q1QA 4UT4A 2V8QB 1YZ9A 1L4SA 4OO1C 1YYWA 1USVA 4DR3I 2VRDA 4WXDA 2BR2B 2DEJA 2EMBA 2EMIA 3OTOI 1HR0I 1RQ0A 1TF6A 4JYAE 5ADZA 1Z5CA 4F9BB 3B78A 4DV7E 1R6MA 3CDJA 4K0KE 1OYSA 4ZYHA 3B4TA 5DROA 2B7VA 2BM0A 3UHMA 2EL4A 2O1UA 2L8TA 4YY3E 1YUJA 1Z59A 4HXZA 3KZZA 2LV2A 4JI1I 1N32I 5A69A 3M99B 2YTOA 2DMYA 4ISAA 3D4JA 4JI0I 3H09A 2PO2A 3T1YI 1ZBTA 3ZZ0A 4F6NA 4LCFA 2AJ4A 2WNRA 2NN6C 1BBOA 3V5RA 2FTXB 2GQ0A 5FLXC 2HK3A 2UU9I 4TUIA 1IBKI 2L2MA 2EPKX 1ZAAC 5IWAI 2ZITA 1FI4A 1IQSA 1RMDA 2ELZA 1IMUA 2JOBA 3M85G 3Q6NA 2VQFI 4JI3I 4DV5E 1UILA 2M7QA 1XNRE 1AH5A 1X6FA 2WBUA 2ZM6E 4X62I 2EMZA 2C37A 4DU8A 4LF7I 2JEAA 2ADRA 5A6JA 1PJTA 3PYFA 1YYKA 1STUA 4R8OA 2EM0A 1J5EE 4LFAI 2EOOA 4BBYA 2EN7A 2LCEA 5C0XA 4NZVA 2CVEA 4DXLA 1X47A 1FWLA 4KZSA 1G2DC 2HFSA 4FWGA 4IFDF 1GZ6A 4LCHA 1QNTA 3DD6A 2LMZA 4X62E 1FWKA 4GKJI 1GTKA 5A6BA 2WCC3 2YTDA 4FW4A 4IFDE 4R2DA 4IZKA 4OO1E 1UBDC 3C6KA 2EOQA 1YFHA 2Q2EB 4XTJA 2RPCA 3DF6A 2WP8B 2E5LI 4DR7E 1H73A 4JI3E 4IFDD 2Q8UA 3KWRA 4DUZI 1IBKE 2UU9E 3QT8A 2EM3A 2LRSA 2V2QA 4USMA 5IWAE 3C4BA 2ENAA 2NUGA 1N32E 4JI1E 3THOB 4P52A 2CTDA 4LFBE 2HJJA 4DMIA 2HK2A 3HPZA 2KOUA 2LE2A 2LO3A 1G2FC 2EPAA 1ZM2A 2D9HA 2CGEA 2NN6B 3HJCA 3PRYA 2O1TA 4LF5I 1H74A 1OYPA 3C4TA 4FN5A 1XMQI 5A2QQ 4LF4I 2EMWA 2RS7A 2UXCI 2L92A 4DR3E 3CWVA 3J7Yp 4DUYI 4LFCI 4R2SA 1NEIA 4JI4I 1ZR9A 2NABA 4Z7YA 4JYAI 5LMUE 5A6BD 3EPKA 2X36A 2LT7A 3QG5C 4K0KI 2WBTA 3H1CA 3ADGA 5K36E 1SFEA 5AC5A 2EMYA 3T1HE 2ZBKB 4JI5I 5GMDA 4R2CA 4AIDA 2UUCE 4LU9A 1YSAC 1VISA 1JK2A 5GMEA 2LTRA 2DLKA 4L8NA 1XMOI 2EOMA 4FK5C 5BR8I 4B3MI 1S16A 1X6EA 1Z0CA 2YRKA 4M9VC 4IJDA 3U1KA 1KYQA 2EPOA 2NN6D 4IZJB 2GLIA 4FW9A 4DV4I 1OYRA 4KHPI 5LMNE 1DGCA 2E1MA 1WUUA 2DSYA 2N3GA 2R76A 3JU0A 5AE2A 2EN4A 4X64E 4ZVIA 4LF6E 1N36I 4B3TI 3ECRA 5F3WA 1IQOA 4DV6I 1HNZE 4FWHA 3JTZA 1I94E 5TSEA 2MDRA 1RC7A 4HTGA 5K36C 1H7SA 2PNZA 1N33E 3JAMC 1RREA 1Z0EA 5AASA 4FW6A 2EWLA 2CT1A 1B63A 2B3TB 2UUCI 1MG7A 2JEBA 4FWDA 3OMLA 1T4NA 4KWYA 2EOFA 2NN6E 3T1HI 3B8HA 5CFFE 4BMJA 1DI2A 3THNA 4I8OA 4FW7A 1NHIA 2UXDE 1Z0TA 2Z5BA 2JY9A 2LUQA 2NN6F 1FNMA 4AIMA 1PDAA 2EOZA 2VQEE 2EOHA 4NBQA 5DRRA 5KL7A 2LUPB 1UHZA 4AM3A 3J7AG 2A2CA 3B82A 2L33A 2WZOA 2H36X 1PKPA 4KQVA 3ZZUA 4B3TE 4DPYA 4X64I 3L00A 2EJ4A 4URLA 3LPSA 2EQ0A 4OX9I 2EE8A 3HKMA 4RH8A 1PVGA 2HKJA 4USKA 1N34E 3GCMA 2F4VI 2DIXA 2EMHA 2I9IA 2RSIA 4Q28A 4BC7A 1A1HA 1HNWE 1T38A 1H72C 1A1IA 3F6HA 2EOXA 2YPNA 2A25A 2EM9A 2ENCA 2M9AA 5IV8B 1IBLE 2C39A 1Y60A 2C38A 4MU3A 1RR9A 3J80C 2LJPA 3PYEA 4MLQA 4F2JC 1KKHA 2O1VA 2MKDA 1Z0WA 2BA1D 2M4IA 1XNQE 4BA2A 3P3EA 1AAYA 4DUYE 2UXCE 3Q6MA 1J26A 4PRVA 4GQUA 2V87A 3AV0A 2HC5A 2DEIA 3M6AA 3WU4A 4NHRA 2JPAA 3AUZA 4I3HA 2EM2A 1UN6B 4GKJE 1R6LA 2YTGA 2BA0G 2CG9A 1T4OA 3K17A 2JEBB 4LF8I 4BA2B 3KRNA 5JEAA 3BF2A 2DRPA 2EFGA 4OZEA 2V2VA 1N36E 4LF6I 2EOJA 4WUDA 5C0XF 4M0VA 2C38B 2PO1A 1I94I 1VI7A 4M2ZA 2JWOA 4Q35B 4FW5A 5LL6R 1T39A 5KL2A 4TUGA 4R2EA 1S4EA 1Z0GA 4LFBI 2RTXA 1Z5BA 4DV1I 2EP3A 1KTVA 1ZXMA 1X6HA 4JV5E 2XEXA 2E72A 2K7IA 3K6QA 2L3CA 3QT7A 5LMNI 1A1FA 2IHR1 2PO1B 5A6KA 2YTPA 2EQ1A 5IT9C 4WSGA 4LF9E 2EMLA 4RHBB 4DV0E 2YTNA 1BB8A 4M1KA 2JEAB 3P3GA 4ZYDA 2E5LE 4JI6I 2YU5A 2KHXA 2V86A 1ZM9A 1YPNA 3EQ1A 4DR4E 3T1YE 5DNLA 5JEAD 4DV3I 3PYGA 3LNUA 1XNQI 2MC6A 4JI5E 4PRXA 2ENHA 3CDIA 1F2IG 3VK6A 1Z0VA 3L7ZA 4LFAE 3WU6A 1J5EI 4DR6E 1X5WA 3LMLA 2EPUA 1KVKA 2O1WA 5K36F 2EM7A 4WFTA 4DPXA 1XMQE 2UXBE 5DRPA 2PNZB 4MYTA 4X8WA 3M85D 4P7DA 1N0VC 2V85A 2EPLX 1QU6A 4KHPE 3ADIA 2EORA 1WXRA 3MSWA 3F6GA 3NZKA 2MKNA 4IFDB 5K36D 1N0UA 1WHQA 2EOIA 3ZM7A 4GKKE 1E3HA 2IOPA 2A2DA 3F0NA 5JEAB 4WPYA 3VYXA 4BA1A 3C6MA 5IT9Q 3P1XA 4OO1A 2YZTA 4J3DA 4X66I 4ED4A 2V34A 1UDNA 3ZOQB 1UDSA 1BBGA 3IWCA 2EN3A 4BCAA 1PJQA 5DRQA 4JI4E 4LFCE 3WU5A 4NXNE 2J65A 3PYDA 1K47A 4DU7A 3IWDA 1UDOA 3P06A 3JAMQ 3V2UC 2UXBI 4LF4E 2OI2A 5AE3A 3HXLA 2YTEA 4MDTA 1MGTA 2HFUA 4DR5E 1QZRA 4IS9A 3OTOE 1X3CA 4IS1C 3PS2A 5K36B 1N3GA 4DV7I 2HHHE 4F54A 2ZM6I 2K4VA 2EM5A 2V8PA 3J7AM 2JR1A 2N3HA 2GPIA 1USUA 4P78A 2DLQA 2PRTA 1IBLI 1FKAE 2VQFE 4R03A 1XMOE 4EMDA 4DR7I 5EKWA 3J81Q 4X65I 2EMKA
chains in the Genus database with same CATH topology
1ZXNA 2KONA 2F4VE 2V88A 4BC9A 1B62A 4UTGA 4B3SI 1EKZA 2MC5A 4Z7CA 5LMUI 4LTYA 2WW4A 2ODRC 1PIEA 2X7IA 2J7KA 1DARA 4P7AA 4OOGC 4DR5I 4LF7E 2G7HA 2FGGA 2V83A 3ADLA 3LLHA 4X66E 2M1SA 1Z0BA 1XNRI 1X49A 4DV5I 3HPSA 3QT6A 4HY1A 4YHHE 1D6TA 2DB2A 2RS6A 3ZKDA 4F9AB 4DV6E 4B3RE 4PU9A 3LTOA 3HULA 2R42A 3J81C 2RSMA 4GKKI 4JI2E 5AE1A 4DPTA 3K85A 4YY3I 1HNXI 2EZ6A 4HACB 3WU3A 2UUBI 4AQYE 2UUAE 2NA2A 1DQ3A 2VF1A 5BR8E 4B3ME 4DPWA 1T4LB 5DNYA 1SR9A 4DV3E 4NXNI 2VQEI 3HTXA 1Y4SA 4JI7I 4DV2I 4JI8E 4DV0I 4JI6E 4J8ZA 1EI1A 3GONA 1UEKA 4DR4I 4JV5I 2VE7C 1MU5A 4LF9I 4DV1E 1N33I 2PNLA 4LF5E 3IWBA 1U2RA 2UUBE 4NXME 1FJGI 2CPNA 4JI0E 1IBME 4DR1E 2VF3A 4JG4A 4DPUA 5A2QC 1KIJA 2BM1A 2Z5BB 4LF8E 1ZM4A 2L3JA 1ZBQA 3ZKBA 1NHJA 4DV4E 1NZ0A 1HK7A 4WYQB 3FIGA 4DR6I 4DV2E 2GS8A 2E1RA 1Y4UA 2LJHA 1HR0E 2BV3A 2Z5EA 5L3JA 4JI7E 1BKNA 4DR2E 3H4LA 2L2NA 4GEQB 1EA6A 1MX0A 4JI8I 4M30A 4N3OA 2UUAI 1XHKA 2IOQA 2Z5CB 3HQ1A 1ZM3A 4BS9A 2V89A 2V2ZA 2JOXA 4IZJA 1YYOA 1N34I 4JI2I 3DJWA 3QT5A 4NXMI 4WUBA 4AQYI 1WHNA 5T6JA 3VYYA 2NUEA 4DR1I 4B3RI 2JVAA 3ZZTA 4WUCA 4YHHI 2R3VA 4HYMA 2ODRD 4L5NC 1GQEA 5FLXQ 3ADJA 4DR2I 2UXDI 1ELOA 1A6FA 5FWKA 1OJ4A 2HHHI 2HKEA 4R1FA 4MYUA 3K1JA 2L6MA 1NHHA 1HNWI 1H7UA 2NPFA 2LTSA 1Z5AA 4RPFA 4IZKB 1HNZI 4B3SE 1IBMI 2L2KB 1FJGE 1X48A 4OX9E 2LBSB 4WSPA 1HNXE 4X65E 3RMPA 3J80Q 2F8BA 4HACA 2B7TA 2FV4B 2B9DA 4F9CB 2Z5CA 4DKKA 1O0WA 4DUZE 1Y6ZA 4IZJD 2PNMA 2YT4A 2NUFA 2CZ9A 3Q1QA 4UT4A 2V8QB 1YZ9A 1YYWA 1USVA 4DR3I 2DEJA 1HR0I 3OTOI 1RQ0A 4JYAE 5ADZA 1Z5CA 4F9BB 3B78A 4DV7E 4K0KE 2B7VA 2BM0A 2O1UA 2L8TA 4YY3E 1Z59A 4HXZA 4JI1I 1N32I 2DMYA 3D4JA 4JI0I 3H09A 3T1YI 1ZBTA 3ZZ0A 2AJ4A 3V5RA 2FTXB 2GQ0A 5FLXC 2HK3A 2UU9I 4TUIA 1IBKI 2L2MA 5IWAI 2ZITA 1FI4A 4JI3I 2JOBA 3Q6NA 2VQFI 4DV5E 1UILA 2M7QA 1XNRE 2ZM6E 4X62I 4DU8A 4LF7I 3PYFA 1YYKA 1STUA 4R8OA 1J5EE 4LFAI 4BBYA 4DXLA 1X47A 1FWLA 4KZSA 2HFSA 4FWGA 1GZ6A 2LMZA 4X62E 1FWKA 4GKJI 4IZKA 2Q2EB 4XTJA 3DF6A 2E5LI 4DR7E 1H73A 4JI3E 3KWRA 4DUZI 1IBKE 2UU9E 3QT8A 2LRSA 2V2QA 4USMA 5IWAE 3C4BA 2NUGA 1N32E 4JI1E 4P52A 4LFBE 4DMIA 2HK2A 3HPZA 2KOUA 2LE2A 2CGEA 1ZM2A 3HJCA 3PRYA 2O1TA 4LF5I 1H74A 3C4TA 4FN5A 1XMQI 5A2QQ 4LF4I 2RS7A 2UXCI 2L92A 4DR3E 3CWVA 3J7Yp 4DUYI 4LFCI 4JI4I 4JYAI 4Z7YA 5LMUE 2X36A 4K0KI 3ADGA 3T1HE 2ZBKB 4JI5I 5GMDA 2UUCE 4LU9A 1VISA 5GMEA 2LTRA 4L8NA 1XMOI 5BR8I 4B3MI 1S16A 1Z0CA 4IZJB 4FW9A 4DV4I 4KHPI 5LMNE 1WUUA 2E1MA 2DSYA 2N3GA 3JU0A 5AE2A 4X64E 4ZVIA 4LF6E 1N36I 4B3TI 4DV6I 5F3WA 1HNZE 4FWHA 3JTZA 1I94E 2MDRA 1RC7A 1H7SA 1N33E 3JAMC 1RREA 1Z0EA 5AASA 2EWLA 1B63A 2B3TB 2UUCI 1MG7A 4FWDA 3OMLA 1T4NA 3T1HI 3B8HA 5CFFE 4BMJA 1DI2A 4I8OA 1NHIA 2UXDE 1Z0TA 2Z5BA 2JY9A 2LUQA 1FNMA 2VQEE 2LUPB 1UHZA 3J7AG 2A2CA 3B82A 2L33A 2WZOA 2H36X 1PKPA 4KQVA 3ZZUA 4B3TE 4DPYA 4X64I 4URLA 3LPSA 4OX9I 2F4VI 1PVGA 2HKJA 4USKA 1N34E 2DIXA 4Q28A 4BC7A 1HNWE 1H72C 3F6HA 1IBLE 1RR9A 3J80C 2LJPA 3PYEA 1KKHA 2O1VA 1Z0WA 2M4IA 1XNQE 4DUYE 2UXCE 3Q6MA 1J26A 4PRVA 2V87A 3AV0A 2DEIA 3WU4A 3M6AA 3AUZA 4I3HA 4GKJE 2CG9A 3K17A 4LF8I 1T4OA 2EFGA 2V2VA 1N36E 4LF6I 4WUDA 4M0VA 1I94I 4M2ZA 2JWOA 5LL6R 1S4EA 4TUGA 1Z0GA 4LFBI 2RTXA 1Z5BA 4DV1I 1KTVA 1ZXMA 4JV5E 2XEXA 5LMNI 3K6QA 2L3CA 3QT7A 2IHR1 5IT9C 4LF9E 4DV0E 4M1KA 4JI6I 2E5LE 2KHXA 2V86A 1ZM9A 4DR4E 3T1YE 4DV3I 3PYGA 3LNUA 1XNQI 2MC6A 4JI5E 4PRXA 3VK6A 1Z0VA 4LFAE 3WU6A 1J5EI 4DR6E 3LMLA 1KVKA 2O1WA 4WFTA 4DPXA 1XMQE 2UXBE 4MYTA 4X8WA 4P7DA 1N0VC 2V85A 4KHPE 1QU6A 3ADIA 1WXRA 3MSWA 3F6GA 1N0UA 1WHQA 3ZM7A 4GKKE 2IOPA 2A2DA 3F0NA 4WPYA 3VYXA 5IT9Q 3P1XA 2YZTA 4X66I 4ED4A 2V34A 3ZOQB 3IWCA 4BCAA 4JI4E 4LFCE 3WU5A 4NXNE 3PYDA 1K47A 4DU7A 3IWDA 3P06A 3JAMQ 2UXBI 3V2UC 4LF4E 2OI2A 5AE3A 3HXLA 2HFUA 4DR5E 1QZRA 3OTOE 4DV7I 2HHHE 4F54A 2ZM6I 2K4VA 2V8PA 3J7AM 2JR1A 2N3HA 1USUA 4P78A 1IBLI 1FKAE 2VQFE 4R03A 1XMOE 4EMDA 4DR7I 3J81Q 4X65I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZXN A;  2F4V E;  1B62 A;  4UTG A;  4B3S I;  1EKZ A;  4Z7C A;  5LMU I;  2WW4 A;  1PIE A;  2X7I A;  2J7K A;  1DAR A;  4P7A A;  4OOG C;  4DR5 I;  4LF7 E;  3ADL A;  3LLH A;  4X66 E;  1Z0B A;  1XNR I;  1X49 A;  4DV5 I;  3QT6 A;  4HY1 A;  4YHH E;  1D6T A;  2DB2 A;  2RS6 A;  3ZKD A;  4B3R E;  4DV6 E;  4PU9 A;  3LTO A;  3HUL A;  2R42 A;  3J81 C;  2RSM A;  4GKK I;  4JI2 E;  4DPT A;  4YY3 I;  1HNX I;  2EZ6 A;  4HAC B;  3WU3 A;  2UUB I;  4AQY E;  2UUA E;  2NA2 A;  5BR8 E;  4B3M E;  4DPW A;  1T4L B;  4DV3 E;  4NXN I;  2VQE I;  3HTX A;  4JI7 I;  4DV2 I;  4JI8 E;  4DV0 I;  4JI6 E;  3GON A;  1EI1 A;  1UEK A;  4DR4 I;  4JV5 I;  1MU5 A;  4LF9 I;  4DV1 E;  1N33 I;  4LF5 E;  1U2R A;  2UUB E;  4NXM E;  1FJG I;  2CPN A;  4JI0 E;  1IBM E;  4DR1 E;  2VF3 A;  4JG4 A;  4DPU A;  1KIJ A;  5A2Q C;  2BM1 A;  4LF8 E;  1ZM4 A;  2L3J A;  3ZKB A;  1NHJ A;  4DV4 E;  1NZ0 A;  4WYQ B;  4DR6 I;  4DV2 E;  2GS8 A;  2E1R A;  2LJH A;  1HR0 E;  2BV3 A;  5L3J A;  4JI7 E;  1BKN A;  4DR2 E;  3H4L A;  2L2N A;  1EA6 A;  1MX0 A;  4JI8 I;  4M30 A;  2UUA I;  1XHK A;  1ZM3 A;  2V2Z A;  1YYO A;  1N34 I;  4JI2 I;  3QT5 A;  4NXM I;  4WUB A;  4AQY I;  1WHN A;  3VYY A;  2NUE A;  4DR1 I;  4B3R I;  2JVA A;  3ZZT A;  4WUC A;  4YHH I;  2R3V A;  4HYM A;  1GQE A;  5FLX Q;  3ADJ A;  4DR2 I;  2UXD I;  1ELO A;  1A6F A;  1OJ4 A;  2HHH I;  2HKE A;  4R1F A;  4MYU A;  3K1J A;  1NHH A;  1HNW I;  1H7U A;  2NPF A;  2LTS A;  1Z5A A;  4RPF A;  1HNZ I;  4B3S E;  1IBM I;  2L2K B;  1FJG E;  1X48 A;  4OX9 E;  2LBS B;  1HNX E;  4X65 E;  3J80 Q;  4HAC A;  2B7T A;  4DKK A;  1O0W A;  4DUZ E;  2YT4 A;  2NUF A;  2CZ9 A;  3Q1Q A;  4UT4 A;  1YZ9 A;  1YYW A;  4DR3 I;  2DEJ A;  1HR0 I;  3OTO I;  1RQ0 A;  4JYA E;  1Z5C A;  3B78 A;  4DV7 E;  4K0K E;  2B7V A;  2BM0 A;  4YY3 E;  1Z59 A;  4HXZ A;  4JI1 I;  1N32 I;  2DMY A;  3D4J A;  4JI0 I;  3T1Y I;  1ZBT A;  3ZZ0 A;  2AJ4 A;  3V5R A;  2UU9 I;  5FLX C;  2HK3 A;  1IBK I;  2L2M A;  5IWA I;  2ZIT A;  1FI4 A;  4JI3 I;  2VQF I;  4DV5 E;  1UIL A;  1XNR E;  2ZM6 E;  4X62 I;  4DU8 A;  4LF7 I;  3PYF A;  1YYK A;  1STU A;  1J5E E;  4LFA I;  4DXL A;  1X47 A;  1FWL A;  2HFS A;  4FWG A;  4X62 E;  1FWK A;  4GKJ I;  2Q2E B;  4XTJ A;  2E5L I;  4DR7 E;  1H73 A;  4JI3 E;  4DUZ I;  1IBK E;  2UU9 E;  3QT8 A;  2LRS A;  2V2Q A;  4USM A;  5IWA E;  3C4B A;  2NUG A;  1N32 E;  4JI1 E;  4P52 A;  4LFB E;  2HK2 A;  1ZM2 A;  4LF5 I;  1H74 A;  3C4T A;  4FN5 A;  1XMQ I;  5A2Q Q;  4LF4 I;  2RS7 A;  2UXC I;  4DR3 E;  3CWV A;  3J7Y p;  4DUY I;  4LFC I;  4JI4 I;  4JYA I;  4Z7Y A;  5LMU E;  2X36 A;  4K0K I;  3ADG A;  3T1H E;  2ZBK B;  4JI5 I;  5GMD A;  2UUC E;  1VIS A;  5GME A;  2LTR A;  1XMO I;  5BR8 I;  4B3M I;  1S16 A;  1Z0C A;  4FW9 A;  4DV4 I;  4KHP I;  5LMN E;  1WUU A;  2N3G A;  4X64 E;  4ZVI A;  4LF6 E;  1N36 I;  4B3T I;  4DV6 I;  1HNZ E;  4FWH A;  1I94 E;  2MDR A;  1RC7 A;  1H7S A;  1N33 E;  1RRE A;  3JAM C;  1Z0E A;  1B63 A;  2B3T B;  2UUC I;  1MG7 A;  4FWD A;  1T4N A;  3T1H I;  3B8H A;  5CFF E;  1DI2 A;  1NHI A;  2UXD E;  1Z0T A;  2JY9 A;  2LUQ A;  1FNM A;  2VQE E;  2LUP B;  1UHZ A;  3J7A G;  2A2C A;  3B82 A;  2L33 A;  1PKP A;  4KQV A;  3ZZU A;  4B3T E;  4DPY A;  4X64 I;  4URL A;  3LPS A;  4OX9 I;  2F4V I;  1PVG A;  4USK A;  2HKJ A;  1N34 E;  2DIX A;  1HNW E;  1H72 C;  1IBL E;  1RR9 A;  3J80 C;  2LJP A;  3PYE A;  1KKH A;  1Z0W A;  1XNQ E;  4DUY E;  2UXC E;  1J26 A;  4PRV A;  2DEI A;  3WU4 A;  3M6A A;  4I3H A;  4GKJ E;  3K17 A;  4LF8 I;  1T4O A;  2EFG A;  2V2V A;  1N36 E;  4LF6 I;  4WUD A;  1I94 I;  4M2Z A;  5LL6 R;  1S4E A;  1Z0G A;  4LFB I;  2RTX A;  1Z5B A;  4DV1 I;  1KTV A;  1ZXM A;  4JV5 E;  2XEX A;  5LMN I;  2L3C A;  3QT7 A;  2IHR 1;  5IT9 C;  4LF9 E;  4DV0 E;  4M1K A;  4JI6 I;  2E5L E;  2KHX A;  1ZM9 A;  4DR4 E;  3T1Y E;  4DV3 I;  3PYG A;  3LNU A;  1XNQ I;  4JI5 E;  4PRX A;  1Z0V A;  4LFA E;  3WU6 A;  1J5E I;  4DR6 E;  1KVK A;  4WFT A;  4DPX A;  1XMQ E;  2UXB E;  4MYT A;  4X8W A;  1N0V C;  4KHP E;  1QU6 A;  3ADI A;  1N0U A;  1WHQ A;  3ZM7 A;  4GKK E;  3F0N A;  2A2D A;  3VYX A;  5IT9 Q;  3P1X A;  4X66 I;  4ED4 A;  2V34 A;  4JI4 E;  4LFC E;  3WU5 A;  4NXN E;  3PYD A;  1K47 A;  4DU7 A;  3JAM Q;  2UXB I;  3V2U C;  4LF4 E;  2OI2 A;  2HFU A;  4DR5 E;  1QZR A;  3OTO E;  4DV7 I;  2HHH E;  2ZM6 I;  2V8P A;  3J7A M;  2N3H A;  1IBL I;  1FKA E;  2VQF E;  1XMO E;  4EMD A;  4DR7 I;  3J81 Q;  4X65 I; 
#chains in the Genus database with same CATH topology
 1ZXN A;  2KON A;  5A6A A;  2F4V E;  2N8X A;  3M7N D;  2V88 A;  4BC9 A;  1B62 A;  2AE8 A;  4UTG A;  2YSP A;  1Z1B A;  4B3S I;  1EKZ A;  2MC5 A;  2C37 B;  4Z7C A;  3P3C A;  4LTY A;  3EPH A;  5JEA C;  5LMU I;  1UDQ A;  2WW4 A;  2ODR C;  2RQL A;  2YSO A;  1PIE A;  3U1Y A;  2YTJ A;  2X7I A;  2J7K A;  4U3B A;  4MU1 A;  1ZU1 A;  1DAR A;  4P7A A;  2EM4 A;  4OOG C;  4DR5 I;  4LF7 E;  2G7H A;  2FGG A;  2V83 A;  3ADL A;  3PS3 A;  1A1J A;  5C0X C;  3LLH A;  4X66 E;  2M1S A;  1Z0B A;  1XNR I;  1TN9 A;  1X49 A;  5KL3 A;  2O3Z A;  4DV5 I;  3HPS A;  3QT6 A;  4HY1 A;  4YHH E;  1D6T A;  1EH7 A;  2YTI A;  2DB2 A;  1KJK A;  1P42 A;  2RS6 A;  3ZKD A;  3PS1 A;  2EPX A;  5C0X E;  2LVH A;  4F9A B;  4DV6 E;  4B3R E;  4PU9 A;  3LTO A;  1YH8 A;  2NN6 A;  3HUL A;  4BA1 B;  2R42 A;  3J81 C;  2RSM A;  4GKK I;  2EPC A;  2WP8 A;  1PJS A;  4JI2 E;  5AE1 A;  1EH6 A;  4QNJ A;  3K85 A;  2C39 B;  4DPT A;  4YY3 I;  1HNX I;  2EZ6 A;  4HAC B;  3WU3 A;  2UUB I;  2PO0 A;  4AQY E;  4O43 A;  2UUA E;  2NA2 A;  1DQ3 A;  2EL6 A;  2YTQ A;  2EMX A;  2VF1 A;  5BR8 E;  3EPJ A;  4B3M E;  2YRM A;  4DPW A;  4OO1 B;  1T4L B;  4QNK A;  1JK1 A;  2EPR A;  2EM8 A;  5DNY A;  1SR9 A;  4DV3 E;  3P76 A;  1MEY C;  4NXN I;  1A1G A;  2VQE I;  3HTX A;  4BHC A;  1WJP A;  1Y4S A;  4U3D A;  4JI7 I;  2DMI A;  2YTF A;  3GLL A;  4OO1 F;  4DV2 I;  4JI8 E;  4DV0 I;  4GZN C;  3VHT B;  2EN1 A;  2JT2 A;  1NCS A;  4JI6 E;  4J8Z A;  1EI1 A;  3GON A;  2EN2 A;  3TQM A;  1UEK A;  3GME A;  4DR4 I;  4JV5 I;  2VE7 C;  5KL6 A;  1MU5 A;  4LF9 I;  4DV1 E;  5C0X B;  1N33 I;  2PNL A;  2GHF A;  4LF5 E;  3IWB A;  1P47 A;  1U2R A;  1B69 A;  2WNR B;  2UUB E;  4NXM E;  2VES A;  1TF3 A;  5DNX A;  1FJG I;  2CPN A;  4JI0 E;  2WBS A;  1IBM E;  4DR1 E;  2VF3 A;  4OO1 D;  5ELW A;  4JG4 A;  4DPU A;  5A2Q C;  1KIJ A;  4MU0 A;  4R2A A;  2BM1 A;  4LF8 E;  2Z5B B;  1ZM4 A;  2EPM X;  4MU4 A;  5K36 A;  5JEA E;  2L3J A;  1ZBQ A;  3ZKB A;  1NHJ A;  4DV4 E;  2YU8 A;  1HK7 A;  1NZ0 A;  1WRJ A;  4WYQ B;  3FIG A;  3BGH A;  4DR6 I;  2EMF A;  4DV2 E;  2BA0 D;  2EM6 A;  2GS8 A;  2E1R A;  3M7N G;  1Y4U A;  4R2P A;  3MHH C;  2EL5 A;  2JP9 A;  2LJH A;  1HR0 E;  2BV3 A;  4ZYG A;  4FW3 A;  2Z5E A;  5L3J A;  2BR2 A;  4JI7 E;  5KL4 A;  1BKN A;  4DR2 E;  1A1K A;  3H4L A;  5C0X D;  2L2N A;  4GEQ B;  1EA6 A;  4R2R A;  1MX0 A;  4JI8 I;  4M30 A;  4N3O A;  4LPF A;  3UK3 C;  2JE6 A;  2PO0 B;  2UUA I;  2BB8 A;  2R1F A;  1XHK A;  4IFD C;  4N4R B;  2IOQ A;  2Z5C B;  1E3P A;  2JXP A;  3HQ1 A;  1ZM3 A;  4BS9 A;  2V89 A;  2LJU A;  4WXC A;  2V2Z A;  2I13 A;  2JOX A;  4IZJ A;  1YYO A;  1N34 I;  4O24 A;  4JI2 I;  2PO2 B;  3DJW A;  3EPL A;  3QT5 A;  2YWQ A;  2EPZ A;  3MHS C;  4NXM I;  4WUB A;  4AQY I;  1WHN A;  5T6J A;  3VYY A;  2NUE A;  2IER A;  4LOM A;  4DR1 I;  4B3R I;  4WX9 A;  2GO3 A;  5JEA F;  2JVA A;  4X9J A;  2CSH A;  1YHC A;  3ZZT A;  4WUC A;  3BBG A;  4YHH I;  2R3V A;  4HYM A;  2HGH A;  2ODR D;  4L5N C;  1GQE A;  5FLX Q;  3ADJ A;  4F6M A;  4DR2 I;  2UXD I;  1ELO A;  1RHY A;  2J7J A;  4R2Q A;  1A6F A;  3BID A;  1EH8 A;  1LLM C;  4ZYE A;  5FWK A;  2EMC A;  2YRH A;  1A1L A;  5EL9 A;  2EOY A;  1OJ4 A;  2IES A;  4MLV A;  2EQ3 A;  2JYA A;  2HKE A;  4R1F A;  2HHH I;  4IFD A;  4MYU A;  5IXM B;  5KL5 A;  3K1J A;  4OKG A;  2L6M A;  2MDG A;  3KZY A;  2EPP A;  1NHH A;  1HNW I;  2EN8 A;  3L7Z B;  1H7U A;  2BA1 G;  2NPF A;  2LTS A;  1Z5A A;  4RPF A;  4IZK B;  1HNZ I;  4B3S E;  1IBM I;  4HEI A;  2L2K B;  1FJG E;  1YUI A;  1X48 A;  4O5G A;  2GO4 A;  4OX9 E;  2LBS B;  4WSP A;  1HNX E;  4X65 E;  4LCG A;  3RMP A;  4O4K A;  3J80 Q;  2EOE A;  4BHB A;  2F8B A;  2BBG A;  2DGC A;  2EMG A;  4HAC A;  2F1D A;  2ELY A;  2B7T A;  2EMA A;  5LLQ A;  2EOS A;  2FV4 B;  2B9D A;  4MQY A;  2EN6 A;  4F9C B;  1Y5Y A;  4DKK A;  2Z5C A;  1O0W A;  5AC4 A;  4DUZ E;  1Y6Z A;  1XXE A;  2PNM A;  2YT4 A;  4IZJ D;  2NUF A;  2JE6 B;  2EPN A;  2CZ9 A;  3Q1Q A;  4UT4 A;  2V8Q B;  1YZ9 A;  1L4S A;  4OO1 C;  1YYW A;  1USV A;  4DR3 I;  2VRD A;  4WXD A;  2BR2 B;  2DEJ A;  2EMB A;  2EMI A;  3OTO I;  1HR0 I;  1RQ0 A;  1TF6 A;  4JYA E;  5ADZ A;  1Z5C A;  4F9B B;  3B78 A;  4DV7 E;  1R6M A;  3CDJ A;  4K0K E;  1OYS A;  4ZYH A;  3B4T A;  5DRO A;  2B7V A;  2BM0 A;  3UHM A;  2EL4 A;  2O1U A;  2L8T A;  4YY3 E;  1YUJ A;  1Z59 A;  4HXZ A;  3KZZ A;  2LV2 A;  4JI1 I;  1N32 I;  5A69 A;  3M99 B;  2YTO A;  2DMY A;  4ISA A;  3D4J A;  4JI0 I;  3H09 A;  2PO2 A;  3T1Y I;  1ZBT A;  3ZZ0 A;  4F6N A;  4LCF A;  2AJ4 A;  2WNR A;  2NN6 C;  1BBO A;  3V5R A;  2FTX B;  2GQ0 A;  5FLX C;  2HK3 A;  2UU9 I;  4TUI A;  1IBK I;  2L2M A;  2EPK X;  1ZAA C;  5IWA I;  2ZIT A;  1FI4 A;  1IQS A;  1RMD A;  2ELZ A;  1IMU A;  2JOB A;  3M85 G;  3Q6N A;  2VQF I;  4JI3 I;  4DV5 E;  1UIL A;  2M7Q A;  1XNR E;  1AH5 A;  1X6F A;  2WBU A;  2ZM6 E;  4X62 I;  2EMZ A;  2C37 A;  4DU8 A;  4LF7 I;  2JEA A;  2ADR A;  5A6J A;  1PJT A;  3PYF A;  1YYK A;  1STU A;  4R8O A;  2EM0 A;  1J5E E;  4LFA I;  2EOO A;  4BBY A;  2EN7 A;  2LCE A;  5C0X A;  4NZV A;  2CVE A;  4DXL A;  1X47 A;  1FWL A;  4KZS A;  1G2D C;  2HFS A;  4FWG A;  4IFD F;  1GZ6 A;  4LCH A;  1QNT A;  3DD6 A;  2LMZ A;  4X62 E;  1FWK A;  4GKJ I;  1GTK A;  5A6B A;  2WCC 3;  2YTD A;  4FW4 A;  4IFD E;  4R2D A;  4IZK A;  4OO1 E;  1UBD C;  3C6K A;  2EOQ A;  1YFH A;  2Q2E B;  4XTJ A;  2RPC A;  3DF6 A;  2WP8 B;  2E5L I;  4DR7 E;  1H73 A;  4JI3 E;  4IFD D;  2Q8U A;  3KWR A;  4DUZ I;  1IBK E;  2UU9 E;  3QT8 A;  2EM3 A;  2LRS A;  2V2Q A;  4USM A;  5IWA E;  3C4B A;  2ENA A;  2NUG A;  1N32 E;  4JI1 E;  3THO B;  4P52 A;  2CTD A;  4LFB E;  2HJJ A;  4DMI A;  2HK2 A;  3HPZ A;  2KOU A;  2LE2 A;  2LO3 A;  1G2F C;  2EPA A;  1ZM2 A;  2D9H A;  2CGE A;  2NN6 B;  3HJC A;  3PRY A;  2O1T A;  4LF5 I;  1H74 A;  1OYP A;  3C4T A;  4FN5 A;  1XMQ I;  5A2Q Q;  4LF4 I;  2EMW A;  2RS7 A;  2UXC I;  2L92 A;  4DR3 E;  3CWV A;  3J7Y p;  4DUY I;  4LFC I;  4R2S A;  1NEI A;  4JI4 I;  1ZR9 A;  2NAB A;  4Z7Y A;  4JYA I;  5LMU E;  5A6B D;  3EPK A;  2X36 A;  2LT7 A;  3QG5 C;  4K0K I;  2WBT A;  3H1C A;  3ADG A;  5K36 E;  1SFE A;  5AC5 A;  2EMY A;  3T1H E;  2ZBK B;  4JI5 I;  5GMD A;  4R2C A;  4AID A;  2UUC E;  4LU9 A;  1YSA C;  1VIS A;  1JK2 A;  5GME A;  2LTR A;  2DLK A;  4L8N A;  1XMO I;  2EOM A;  4FK5 C;  5BR8 I;  4B3M I;  1S16 A;  1X6E A;  1Z0C A;  2YRK A;  4M9V C;  4IJD A;  3U1K A;  1KYQ A;  2EPO A;  2NN6 D;  4IZJ B;  2GLI A;  4FW9 A;  4DV4 I;  1OYR A;  4KHP I;  5LMN E;  1DGC A;  2E1M A;  1WUU A;  2DSY A;  2N3G A;  2R76 A;  3JU0 A;  5AE2 A;  2EN4 A;  4X64 E;  4ZVI A;  4LF6 E;  1N36 I;  4B3T I;  3ECR A;  5F3W A;  1IQO A;  4DV6 I;  1HNZ E;  4FWH A;  3JTZ A;  1I94 E;  5TSE A;  2MDR A;  1RC7 A;  4HTG A;  5K36 C;  1H7S A;  2PNZ A;  1N33 E;  3JAM C;  1RRE A;  1Z0E A;  5AAS A;  4FW6 A;  2EWL A;  2CT1 A;  1B63 A;  2B3T B;  2UUC I;  1MG7 A;  2JEB A;  4FWD A;  3OML A;  1T4N A;  4KWY A;  2EOF A;  2NN6 E;  3T1H I;  3B8H A;  5CFF E;  4BMJ A;  1DI2 A;  3THN A;  4I8O A;  4FW7 A;  1NHI A;  2UXD E;  1Z0T A;  2Z5B A;  2JY9 A;  2LUQ A;  2NN6 F;  1FNM A;  4AIM A;  1PDA A;  2EOZ A;  2VQE E;  2EOH A;  4NBQ A;  5DRR A;  5KL7 A;  2LUP B;  1UHZ A;  4AM3 A;  3J7A G;  2A2C A;  3B82 A;  2L33 A;  2WZO A;  2H36 X;  1PKP A;  4KQV A;  3ZZU A;  4B3T E;  4DPY A;  4X64 I;  3L00 A;  2EJ4 A;  4URL A;  3LPS A;  2EQ0 A;  4OX9 I;  2EE8 A;  3HKM A;  4RH8 A;  1PVG A;  2HKJ A;  4USK A;  1N34 E;  3GCM A;  2F4V I;  2DIX A;  2EMH A;  2I9I A;  2RSI A;  4Q28 A;  4BC7 A;  1A1H A;  1HNW E;  1T38 A;  1H72 C;  1A1I A;  3F6H A;  2EOX A;  2YPN A;  2A25 A;  2EM9 A;  2ENC A;  2M9A A;  5IV8 B;  1IBL E;  2C39 A;  1Y60 A;  2C38 A;  4MU3 A;  1RR9 A;  3J80 C;  2LJP A;  3PYE A;  4MLQ A;  4F2J C;  1KKH A;  2O1V A;  2MKD A;  1Z0W A;  2BA1 D;  2M4I A;  1XNQ E;  4BA2 A;  3P3E A;  1AAY A;  4DUY E;  2UXC E;  3Q6M A;  1J26 A;  4PRV A;  4GQU A;  2V87 A;  3AV0 A;  2HC5 A;  2DEI A;  3M6A A;  3WU4 A;  4NHR A;  2JPA A;  3AUZ A;  4I3H A;  2EM2 A;  1UN6 B;  4GKJ E;  1R6L A;  2YTG A;  2BA0 G;  2CG9 A;  1T4O A;  3K17 A;  2JEB B;  4LF8 I;  4BA2 B;  3KRN A;  5JEA A;  3BF2 A;  2DRP A;  2EFG A;  4OZE A;  2V2V A;  1N36 E;  4LF6 I;  2EOJ A;  4WUD A;  5C0X F;  4M0V A;  2C38 B;  2PO1 A;  1I94 I;  1VI7 A;  4M2Z A;  2JWO A;  4Q35 B;  4FW5 A;  5LL6 R;  1T39 A;  5KL2 A;  4TUG A;  4R2E A;  1S4E A;  1Z0G A;  4LFB I;  2RTX A;  1Z5B A;  4DV1 I;  2EP3 A;  1KTV A;  1ZXM A;  1X6H A;  4JV5 E;  2XEX A;  2E72 A;  2K7I A;  3K6Q A;  2L3C A;  3QT7 A;  5LMN I;  1A1F A;  2IHR 1;  2PO1 B;  5A6K A;  2YTP A;  2EQ1 A;  5IT9 C;  4WSG A;  4LF9 E;  2EML A;  4RHB B;  4DV0 E;  2YTN A;  1BB8 A;  4M1K A;  2JEA B;  3P3G A;  4ZYD A;  2E5L E;  4JI6 I;  2YU5 A;  2KHX A;  2V86 A;  1ZM9 A;  1YPN A;  3EQ1 A;  4DR4 E;  3T1Y E;  5DNL A;  5JEA D;  4DV3 I;  3PYG A;  3LNU A;  1XNQ I;  2MC6 A;  4JI5 E;  4PRX A;  2ENH A;  3CDI A;  1F2I G;  3VK6 A;  1Z0V A;  3L7Z A;  4LFA E;  3WU6 A;  1J5E I;  4DR6 E;  1X5W A;  3LML A;  2EPU A;  1KVK A;  2O1W A;  5K36 F;  2EM7 A;  4WFT A;  4DPX A;  1XMQ E;  2UXB E;  5DRP A;  2PNZ B;  4MYT A;  4X8W A;  3M85 D;  4P7D A;  1N0V C;  2V85 A;  2EPL X;  1QU6 A;  4KHP E;  3ADI A;  2EOR A;  1WXR A;  3MSW A;  3F6G A;  3NZK A;  2MKN A;  4IFD B;  5K36 D;  1N0U A;  1WHQ A;  2EOI A;  3ZM7 A;  4GKK E;  1E3H A;  2IOP A;  2A2D A;  3F0N A;  5JEA B;  4WPY A;  3VYX A;  4BA1 A;  3C6M A;  5IT9 Q;  3P1X A;  4OO1 A;  2YZT A;  4J3D A;  4X66 I;  4ED4 A;  2V34 A;  1UDN A;  3ZOQ B;  1UDS A;  1BBG A;  3IWC A;  2EN3 A;  4BCA A;  1PJQ A;  5DRQ A;  4JI4 E;  4LFC E;  3WU5 A;  4NXN E;  2J65 A;  3PYD A;  1K47 A;  4DU7 A;  3IWD A;  1UDO A;  3P06 A;  3JAM Q;  3V2U C;  2UXB I;  4LF4 E;  2OI2 A;  5AE3 A;  3HXL A;  2YTE A;  4MDT A;  1MGT A;  2HFU A;  4DR5 E;  1QZR A;  4IS9 A;  3OTO E;  1X3C A;  4IS1 C;  3PS2 A;  5K36 B;  1N3G A;  4DV7 I;  2HHH E;  4F54 A;  2ZM6 I;  2K4V A;  2EM5 A;  2V8P A;  3J7A M;  2JR1 A;  2N3H A;  2GPI A;  1USU A;  4P78 A;  2DLQ A;  2PRT A;  1IBL I;  1FKA E;  2VQF E;  4R03 A;  1XMO E;  4EMD A;  4DR7 I;  5EKW A;  3J81 Q;  4X65 I;  2EMK A; 
#chains in the Genus database with same CATH homology
 1ZXN A;  2KON A;  2F4V E;  2V88 A;  4BC9 A;  1B62 A;  4UTG A;  4B3S I;  1EKZ A;  2MC5 A;  4Z7C A;  5LMU I;  4LTY A;  2WW4 A;  2ODR C;  1PIE A;  2X7I A;  2J7K A;  1DAR A;  4P7A A;  4OOG C;  4DR5 I;  4LF7 E;  2G7H A;  2FGG A;  2V83 A;  3ADL A;  3LLH A;  4X66 E;  2M1S A;  1Z0B A;  1XNR I;  1X49 A;  4DV5 I;  3HPS A;  3QT6 A;  4HY1 A;  4YHH E;  1D6T A;  2DB2 A;  2RS6 A;  3ZKD A;  4F9A B;  4DV6 E;  4B3R E;  4PU9 A;  3LTO A;  3HUL A;  2R42 A;  3J81 C;  2RSM A;  4GKK I;  4JI2 E;  5AE1 A;  4DPT A;  3K85 A;  4YY3 I;  1HNX I;  2EZ6 A;  4HAC B;  3WU3 A;  2UUB I;  4AQY E;  2UUA E;  2NA2 A;  1DQ3 A;  2VF1 A;  5BR8 E;  4B3M E;  4DPW A;  1T4L B;  5DNY A;  1SR9 A;  4DV3 E;  4NXN I;  2VQE I;  3HTX A;  1Y4S A;  4JI7 I;  4DV2 I;  4JI8 E;  4DV0 I;  4JI6 E;  4J8Z A;  1EI1 A;  3GON A;  1UEK A;  4DR4 I;  4JV5 I;  2VE7 C;  1MU5 A;  4LF9 I;  4DV1 E;  1N33 I;  2PNL A;  4LF5 E;  3IWB A;  1U2R A;  2UUB E;  4NXM E;  1FJG I;  2CPN A;  4JI0 E;  1IBM E;  4DR1 E;  2VF3 A;  4JG4 A;  4DPU A;  5A2Q C;  1KIJ A;  2BM1 A;  2Z5B B;  4LF8 E;  1ZM4 A;  2L3J A;  1ZBQ A;  3ZKB A;  1NHJ A;  4DV4 E;  1NZ0 A;  1HK7 A;  4WYQ B;  3FIG A;  4DR6 I;  4DV2 E;  2GS8 A;  2E1R A;  1Y4U A;  2LJH A;  1HR0 E;  2BV3 A;  2Z5E A;  5L3J A;  4JI7 E;  1BKN A;  4DR2 E;  3H4L A;  2L2N A;  4GEQ B;  1EA6 A;  1MX0 A;  4JI8 I;  4M30 A;  4N3O A;  2UUA I;  1XHK A;  2IOQ A;  2Z5C B;  3HQ1 A;  1ZM3 A;  4BS9 A;  2V89 A;  2V2Z A;  2JOX A;  4IZJ A;  1YYO A;  1N34 I;  4JI2 I;  3DJW A;  3QT5 A;  4NXM I;  4WUB A;  4AQY I;  1WHN A;  5T6J A;  3VYY A;  2NUE A;  4DR1 I;  4B3R I;  2JVA A;  3ZZT A;  4WUC A;  4YHH I;  2R3V A;  4HYM A;  2ODR D;  4L5N C;  1GQE A;  5FLX Q;  3ADJ A;  4DR2 I;  2UXD I;  1ELO A;  1A6F A;  5FWK A;  1OJ4 A;  2HHH I;  2HKE A;  4R1F A;  4MYU A;  3K1J A;  2L6M A;  1NHH A;  1HNW I;  1H7U A;  2NPF A;  2LTS A;  1Z5A A;  4RPF A;  4IZK B;  1HNZ I;  4B3S E;  1IBM I;  2L2K B;  1FJG E;  1X48 A;  4OX9 E;  2LBS B;  4WSP A;  1HNX E;  4X65 E;  3RMP A;  3J80 Q;  2F8B A;  4HAC A;  2B7T A;  2FV4 B;  2B9D A;  4F9C B;  2Z5C A;  4DKK A;  1O0W A;  4DUZ E;  1Y6Z A;  4IZJ D;  2PNM A;  2YT4 A;  2NUF A;  2CZ9 A;  3Q1Q A;  4UT4 A;  2V8Q B;  1YZ9 A;  1YYW A;  1USV A;  4DR3 I;  2DEJ A;  1HR0 I;  3OTO I;  1RQ0 A;  4JYA E;  5ADZ A;  1Z5C A;  4F9B B;  3B78 A;  4DV7 E;  4K0K E;  2B7V A;  2BM0 A;  2O1U A;  2L8T A;  4YY3 E;  1Z59 A;  4HXZ A;  4JI1 I;  1N32 I;  2DMY A;  3D4J A;  4JI0 I;  3H09 A;  3T1Y I;  1ZBT A;  3ZZ0 A;  2AJ4 A;  3V5R A;  2FTX B;  2GQ0 A;  5FLX C;  2HK3 A;  2UU9 I;  4TUI A;  1IBK I;  2L2M A;  5IWA I;  2ZIT A;  1FI4 A;  4JI3 I;  2JOB A;  3Q6N A;  2VQF I;  4DV5 E;  1UIL A;  2M7Q A;  1XNR E;  2ZM6 E;  4X62 I;  4DU8 A;  4LF7 I;  3PYF A;  1YYK A;  1STU A;  4R8O A;  1J5E E;  4LFA I;  4BBY A;  4DXL A;  1X47 A;  1FWL A;  4KZS A;  2HFS A;  4FWG A;  1GZ6 A;  2LMZ A;  4X62 E;  1FWK A;  4GKJ I;  4IZK A;  2Q2E B;  4XTJ A;  3DF6 A;  2E5L I;  4DR7 E;  1H73 A;  4JI3 E;  3KWR A;  4DUZ I;  1IBK E;  2UU9 E;  3QT8 A;  2LRS A;  2V2Q A;  4USM A;  5IWA E;  3C4B A;  2NUG A;  1N32 E;  4JI1 E;  4P52 A;  4LFB E;  4DMI A;  2HK2 A;  3HPZ A;  2KOU A;  2LE2 A;  2CGE A;  1ZM2 A;  3HJC A;  3PRY A;  2O1T A;  4LF5 I;  1H74 A;  3C4T A;  4FN5 A;  1XMQ I;  5A2Q Q;  4LF4 I;  2RS7 A;  2UXC I;  2L92 A;  4DR3 E;  3CWV A;  3J7Y p;  4DUY I;  4LFC I;  4JI4 I;  4JYA I;  4Z7Y A;  5LMU E;  2X36 A;  4K0K I;  3ADG A;  3T1H E;  2ZBK B;  4JI5 I;  5GMD A;  2UUC E;  4LU9 A;  1VIS A;  5GME A;  2LTR A;  4L8N A;  1XMO I;  5BR8 I;  4B3M I;  1S16 A;  1Z0C A;  4IZJ B;  4FW9 A;  4DV4 I;  4KHP I;  5LMN E;  1WUU A;  2E1M A;  2DSY A;  2N3G A;  3JU0 A;  5AE2 A;  4X64 E;  4ZVI A;  4LF6 E;  1N36 I;  4B3T I;  4DV6 I;  5F3W A;  1HNZ E;  4FWH A;  3JTZ A;  1I94 E;  2MDR A;  1RC7 A;  1H7S A;  1N33 E;  3JAM C;  1RRE A;  1Z0E A;  5AAS A;  2EWL A;  1B63 A;  2B3T B;  2UUC I;  1MG7 A;  4FWD A;  3OML A;  1T4N A;  3T1H I;  3B8H A;  5CFF E;  4BMJ A;  1DI2 A;  4I8O A;  1NHI A;  2UXD E;  1Z0T A;  2Z5B A;  2JY9 A;  2LUQ A;  1FNM A;  2VQE E;  2LUP B;  1UHZ A;  3J7A G;  2A2C A;  3B82 A;  2L33 A;  2WZO A;  2H36 X;  1PKP A;  4KQV A;  3ZZU A;  4B3T E;  4DPY A;  4X64 I;  4URL A;  3LPS A;  4OX9 I;  2F4V I;  1PVG A;  2HKJ A;  4USK A;  1N34 E;  2DIX A;  4Q28 A;  4BC7 A;  1HNW E;  1H72 C;  3F6H A;  1IBL E;  1RR9 A;  3J80 C;  2LJP A;  3PYE A;  1KKH A;  2O1V A;  1Z0W A;  2M4I A;  1XNQ E;  4DUY E;  2UXC E;  3Q6M A;  1J26 A;  4PRV A;  2V87 A;  3AV0 A;  2DEI A;  3WU4 A;  3M6A A;  3AUZ A;  4I3H A;  4GKJ E;  2CG9 A;  3K17 A;  4LF8 I;  1T4O A;  2EFG A;  2V2V A;  1N36 E;  4LF6 I;  4WUD A;  4M0V A;  1I94 I;  4M2Z A;  2JWO A;  5LL6 R;  1S4E A;  4TUG A;  1Z0G A;  4LFB I;  2RTX A;  1Z5B A;  4DV1 I;  1KTV A;  1ZXM A;  4JV5 E;  2XEX A;  5LMN I;  3K6Q A;  2L3C A;  3QT7 A;  2IHR 1;  5IT9 C;  4LF9 E;  4DV0 E;  4M1K A;  4JI6 I;  2E5L E;  2KHX A;  2V86 A;  1ZM9 A;  4DR4 E;  3T1Y E;  4DV3 I;  3PYG A;  3LNU A;  1XNQ I;  2MC6 A;  4JI5 E;  4PRX A;  3VK6 A;  1Z0V A;  4LFA E;  3WU6 A;  1J5E I;  4DR6 E;  3LML A;  1KVK A;  2O1W A;  4WFT A;  4DPX A;  1XMQ E;  2UXB E;  4MYT A;  4X8W A;  4P7D A;  1N0V C;  2V85 A;  4KHP E;  1QU6 A;  3ADI A;  1WXR A;  3MSW A;  3F6G A;  1N0U A;  1WHQ A;  3ZM7 A;  4GKK E;  2IOP A;  2A2D A;  3F0N A;  4WPY A;  3VYX A;  5IT9 Q;  3P1X A;  2YZT A;  4X66 I;  4ED4 A;  2V34 A;  3ZOQ B;  3IWC A;  4BCA A;  4JI4 E;  4LFC E;  3WU5 A;  4NXN E;  3PYD A;  1K47 A;  4DU7 A;  3IWD A;  3P06 A;  3JAM Q;  2UXB I;  3V2U C;  4LF4 E;  2OI2 A;  5AE3 A;  3HXL A;  2HFU A;  4DR5 E;  1QZR A;  3OTO E;  4DV7 I;  2HHH E;  4F54 A;  2ZM6 I;  2K4V A;  2V8P A;  3J7A M;  2JR1 A;  2N3H A;  1USU A;  4P78 A;  1IBL I;  1FKA E;  2VQF E;  4R03 A;  1XMO E;  4EMD A;  4DR7 I;  3J81 Q;  4X65 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...