4JI1E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4ji1E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji1E02
3OTOI 3J7Yp 4X8WA 1NHHA 4JYAI 2YT4A 4FWDA 2HFSA 4DR2I 2HFUA 4B3RI 4JI4E 2L2NA 2RTXA 1H7SA 3ZM7A 4KQVA 4DV1E 4M2ZA 1STUA 4ED4A 4JI1E 4HYMA 2DIXA 3LLHA 1Z0TA 1FWLA 1XHKA 1N32E 3QT6A 4X65I 4DR4I 1O0WA 1XMQI 4DR6E 5FLXQ 2UUCE 2UXDE 4DR5I 5L3JA 1YZ9A 1DARA 2UU9I 5BR8I 1ZM2A 3LTOA 5IWAI 3ZKBA 3LPSA 2EZ6A 4DV5I 4X64I 1OJ4A 4LFBE 4JI8E 4X66I 1Z0EA 2UUBI 4JV5I 2DEJA 4AQYI 2UUAI 4DPWA 2VQFI 3F0NA 5A2QQ 4DV3I 1XNRI 2UXBE 1IBME 2NUGA 4P7AA 4DU8A 1H72C 1Z5BA 1N34I 1N0VC 4DR7E 2BV3A 4NXME 4LF5E 2Q2EB 5GMEA 2JY9A 2R42A 2V34A 4FWGA 1KVKA 4GKJI 2CZ9A 1XNQE 1ZM4A 4UT4A 1IBLI 4DR1E 1XMOI 2V2ZA 2RS7A 5CFFE 1I94E 4M1KA 3B82A 4LF6I 2J7KA 4LF9E 4DV6I 4LFCI 1NHJA 2V2QA 4JI0E 2LBSB 1WUUA 4LF4E 1HNWE 2XEXA 2F4VE 1PVGA 4PU9A 1J5EE 4DUZE 4JI2I 4K0KE 1Z0CA 1T4NA 4P52A 4JI5E 1NHIA 1DI2A 3P1XA 4DU7A 1FJGE 4DV4I 4DR3E 4XTJA 2DMYA 1BKNA 4JI6E 4M30A 4YY3E 3PYGA 4WFTA 4B3MI 3VYYA 5LMNI 1KIJA 3T1HE 4WUCA 2LTSA 1K47A 2L2MA 3PYDA 4B3TI 3PYEA 3QT8A 1Z5CA 3OTOE 2UXCI 4JYAE 2A2CA 4DUYE 2L2KB 1RC7A 4WYQB 4I3HA 1PKPA 4DR2E 4LF7I 4UTGA 4B3RE 2IHR1 3Q1QA 4GKKI 3QT5A 1ELOA 4JI4I 2R3VA 4USMA 2ZITA 1J26A 1WHNA 1KKHA 4JI3I 4NXNE 1HNXE 4DPUA 1Z0VA 1HNZI 1ZBTA 1PIEA 4X65E 4HXZA 4DR4E 1EKZA 1XMQE 1H74A 2NUEA 1ZM9A 1RR9A 3J7AG 2HKEA 2N3HA 3HTXA 2UXDI 1UHZA 4KHPE 3QT7A 5BR8E 2X7IA 4WUDA 5IWAE 4HACA 4OOGC 4DV2I 4X66E 2UUBE 4AQYE 4FWHA 1N36I 2UUAE 2V8PA 4DV3E 4OX9E 1XNRE 3JAMQ 1FI4A 1H73A 2UXBI 1N34E 2LRSA 4DR7I 2DB2A 1X49A 4DV7E 4EMDA 2ZM6E 4USKA 1S4EA 1EI1A 4DKKA 2E5LI 1MU5A 2RS6A 2EFGA 1XMOE 4YHHI 1XNQI 1ZXMA 1YYWA 3ZZTA 1N0UA 4DR1I 2LUPB 4LF6E 3ADJA 2B7VA 4LFCE 3LNUA 2HHHI 1N33E 4LFAI 4JI7E 1H7UA 4LF4I 2HK3A 1HNWI 1EA6A 4R1FA 3ADLA 4LF8I 4JI2E 4DPTA 3M6AA 1VISA 4FW9A 4X62I 2VQEI 1HR0I 1IBKI 2VF3A 4DV4E 4MYUA 4JI5I 1T4OA 1ZM3A 3J80Q 3J7AM 1X47A 3K17A 4JI6I 4DV0I 2WW4A 3HULA 4ZVIA 4B3SE 2L3CA 1FKAE 5LMNE 1D6TA 4HY1A 5LL6R 1FWKA 3JAMC 3ZZUA 2E1RA 1X48A 3T1YI 5LMUI 3VYXA 3B78A 4B3TE 2BM0A 1QZRA 2L33A 1KTVA 3V2UC 2UXCE 5GMDA 2HKJA 5IT9Q 3D4JA 1MX0A 1GQEA 4DUYI 1T4LB 4LF7E 2LUQA 3V5RA 4DV1I 1UILA 2N3GA 4GKKE 2DEIA 4PRVA 3K1JA 1FNMA 2AJ4A 3J81C 1Z0BA 4JI1I 4JI3E 2A2DA 1N32I 4NXNI 1HNXI 1RQ0A 1HNZE 3GONA 2NUFA 3WU5A 1QU6A 4DR6I 4DR5E 4DPXA 2UUCI 2UU9E 2OI2A 4FN5A 4DV5E 2B3TB 4X64E 1ZXNA 4MYTA 2HK2A 4JV5E 2NPFA 4JI8I 4LFBI 2LTRA 2VQFE 3WU3A 3C4BA 4DV2E 4KHPI 4RPFA 3J80C 1Z5AA 1IBMI 1U2RA 1N36E 1NZ0A 1Z0GA 4NXMI 4OX9I 4LF5I 3B8HA 4GKJE 3C4TA 1YYKA 4WUBA 1Z0WA 1IBLE 1MG7A 1RREA 4DV7I 2ZM6I 3J81Q 2E5LE 2ZBKB 4DV6E 1I94I 4YHHE 4LF9I 1WHQA 1Z59A 5IT9C 2X36A 3WU6A 2L3JA 4JI0I 3ZZ0A 2LJHA 2F4VI 2HHHE 2MDRA 1J5EI 4DUZI 1N33I 2NA2A 4LFAE 4Z7YA 4K0KI 2BM1A 2JVAA 3PYFA 2GS8A 4LF8E 4JG4A 4JI7I 3ADIA 1B62A 4X62E 2VQEE 1HR0E 1FJGI 4DR3I 3CWVA 1IBKE 2LJPA 2RSMA 2KHXA 2B7TA 4DPYA 4YY3I 5FLXC 1B63A 4PRXA 4B3ME 3WU4A 4DV0E 1S16A 4Z7CA 3T1HI 1A6FA 1UEKA 4URLA 3ADGA 2V2VA 4B3SI 1YYOA 4HACB 2CPNA 3H4LA 4DXLA 3T1YE 5A2QC 5LMUE 3ZKDA
chains in the Genus database with same CATH superfamily
1F2IG 1ZBQA 2JE6B 3F6HA 3CDJA 3OTOI 3J7Yp 4X8WA 4N4RB 4KZSA 2GLIA 2YT4A 4Q35B 1NHHA 2CGEA 4FWDA 4JYAI 2LVHA 2EN2A 2MKNA 4F54A 3M7ND 2PRTA 2NN6F 5EKWA 2HFSA 2R1FA 2JPAA 4DR2I 2EOXA 2HFUA 1YUIA 3P76A 4B3RI 4JI4E 5JEAF 2L2NA 2RTXA 1G2FC 3ZOQB 4BCAA 4WPYA 1H7SA 1NCSA 3PRYA 3ZM7A 4KQVA 2EMZA 4DV1E 1KYQA 2N8XA 4M2ZA 1STUA 4ED4A 1WRJA 2J7JA 2JEAB 4JI1E 4HYMA 2JWOA 4TUGA 2O1UA 4P7DA 2DIXA 3LLHA 2PO0A 1Z0TA 4BA1B 1FWLA 2M4IA 1XHKA 3BBGA 1N32E 1USUA 3QT6A 4X65I 4DR4I 1O0WA 1XMQI 2NN6B 4DR6E 2DSYA 2ELZA 5FLXQ 2UUCE 2EPNA 5AE1A 2UXDE 5C0XF 4DR5I 2MKDA 5L3JA 4R2DA 3HJCA 2HJJA 1YZ9A 4I8OA 2VESA 1A1HA 1DARA 1Y4UA 5JEAB 2UU9I 5BR8I 2H36X 3K85A 1ZM2A 2BA0D 3LTOA 5IWAI 2EMHA 2GPIA 3ZKBA 3LPSA 2KONA 2EZ6A 4X64I 4DV5I 1OJ4A 4LFBE 4JI8E 1YPNA 4X66I 2V88A 1Z0EA 2UUBI 4JV5I 2DEJA 4AQYI 3U1YA 2HC5A 3VK6A 2UUAI 4DPWA 2GO4A 2Z5CB 3F0NA 2VQFI 5A2QQ 4DV3I 2EOFA 1XNRI 2L8TA 5KL2A 1IBME 2NUGA 2UXBE 4P7AA 1RMDA 4DU8A 3BF2A 2F8BA 1TN9A 1H72C 2EL6A 4O5GA 4L5NC 1Z5BA 1N34I 1GZ6A 1N0VC 4DR7E 3M7NG 2CG9A 2BV3A 3M85D 2YTJA 4NXME 4LF5E 5C0XB 2Q2EB 2YSPA 3EPJA 5GMEA 2EL5A 2LMZA 2JY9A 1PJQA 2R42A 4IFDD 3B4TA 4R2CA 2EMWA 2KOUA 1KVKA 2V34A 4FWGA 4GKJI 4MU1A 2CZ9A 4WSPA 4ZYEA 1XNQE 1ZM4A 2EN6A 1T38A 2PNZB 4UT4A 1IBLI 3HXLA 4DR1E 1XMOI 4LOMA 2V8QB 1UN6B 2JP9A 2V2ZA 2RS7A 5CFFE 2EPMX 1I94E 2RQLA 2WBUA 3B82A 4FW3A 4M1KA 4LF6I 2J7KA 5DROA 2EL4A 4LF9E 4DV6I 3FIGA 2NN6E 4LFCI 1NHJA 2V2QA 5F3WA 5AE3A 2LBSB 4JI0E 4LF4E 1WUUA 1HNWE 2EJ4A 2XEXA 5JEAE 2ADRA 2F4VE 2Z5BA 1PVGA 4PU9A 2EMLA 1X6EA 5IXMB 2YTOA 4DUZE 1J5EE 4JI2I 4K0KE 5EL9A 1Z0CA 4GEQB 1T4NA 2EPCA 4FK5C 4IFDA 4P52A 2YTIA 3EPHA 5K36E 2JOBA 4JI5E 1NHIA 1DI2A 3P1XA 2EM4A 3L7ZA 4DU7A 1FJGE 2CVEA 4DV4I 2EM3A 1VI7A 4DR3E 4QNKA 4IFDC 3DJWA 4XTJA 1R6LA 2DMYA 4U3BA 1BKNA 4RH8A 2IOQA 4JI6E 4M30A 3M85G 3UHMA 2LJUA 2YU8A 2EPPA 5KL5A 5C0XE 4IS1C 4YY3E 2EP3A 3PYGA 4ISAA 4WFTA 5T6JA 4OO1E 5A6BD 4BHCA 5A69A 2L92A 4B3MI 3VYYA 2EPUA 5LMNI 1KIJA 3T1HE 3NZKA 2GHFA 4WUCA 2LO3A 1Y60A 1X3CA 4P78A 2M7QA 4O43A 5DRQA 2LTSA 1K47A 2L2MA 3PYDA 3KRNA 4NHRA 4B3TI 3PYEA 1JK2A 3QT8A 3K6QA 4GQUA 4LU9A 1Z5CA 3QG5C 3Q6NA 3OTOE 5DNLA 2UXCI 2C37A 4JYAE 1E3PA 2PNMA 2A2CA 4DUYE 3UK3C 2L2KB 2JOXA 4WYQB 4BMJA 1RC7A 1BBGA 2JR1A 2FV4B 4I3HA 1B69A 2BR2A 2EOMA 2JEBB 1PKPA 2V85A 4DR2E 2V87A 3PS1A 4UTGA 4LF7I 2C39B 4B3RE 2IHR1 3Q1QA 4GKKI 2WBSA 3QT5A 2V89A 4MU4A 4BA2B 4R2SA 5A6BA 1ELOA 2EN1A 2R3VA 4USMA 1P42A 2ZITA 3HQ1A 4F9AB 4JI4I 5K36F 1J26A 1WHNA 2YTPA 1TF6A 1KKHA 4JI3I 4NXNE 2C38A 1HNXE 4DPUA 1IQSA 1Z0VA 2YRHA 2WNRB 2EMKA 4AIDA 4IJDA 2EOEA 2DLKA 1ZU1A 2DMIA 1HNZI 1ZBTA 1PIEA 4X65E 4HXZA 4DR4E 4LCGA 4U3DA 2PO1B 4OO1F 5K36A 1EKZA 1XMQE 1H74A 2NUEA 1ZM9A 2DRPA 1RR9A 3J7AG 2HKEA 2N3HA 3P3CA 3HTXA 4O4KA 2WP8B 1SFEA 1Y5YA 2UXDI 1UHZA 4KHPE 3QT7A 5AC4A 1UBDC 5BR8E 2X7IA 2EQ0A 4WUDA 4IZKA 5K36B 5IWAE 5KL3A 2F1DA 4OOGC 4HACA 5DNXA 2EPLX 4FW6A 4DV2I 4Q28A 2NN6D 4AIMA 4M9VC 1UDSA 1A1GA 2YSOA 2JE6A 1X5WA 4X66E 2WZOA 2UUBE 1AH5A 4AQYE 5LLQA 4FWHA 1N36I 2UUAE 2EOHA 2V8PA 3DF6A 1YSAC 4DV3E 4OX9E 5JEAD 1XNRE 1Y4SA 4F9BB 3JAMQ 1FI4A 1H73A 2Z5EA 2ELYA 2UXBI 1XXEA 4OO1B 1N34E 4MDTA 2DLQA 1A1FA 2EM0A 2LE2A 2FGGA 2LRSA 4DR7I 1WJPA 2DB2A 2VE7C 1X49A 2LCEA 4DV7E 2RPCA 1YUJA 2ZM6E 4EMDA 2GO3A 2JT2A 4USKA 5K36D 4R2EA 2A25A 3JU0A 4TUIA 2PO2B 1S4EA 2C39A 1EI1A 2CT1A 2JEAA 4X9JA 2EM2A 4DKKA 2E5LI 1Z1BA 1OYRA 2EOJA 1PJTA 1MU5A 4BA1A 2RS6A 2EFGA 1XMOE 4HEIA 2EPAA 4YHHI 5C0XD 1ZXMA 1XNQI 3L00A 1IMUA 1YYWA 4BC7A 3ZZTA 1N0UA 2EN7A 4DR1I 3AUZA 4BC9A 2LUPB 2YTEA 2EMIA 1A1LA 4LF6E 2GQ0A 4L8NA 1EH6A 2B7VA 3ADJA 5AE2A 2HGHA 2O1WA 2EMBA 4LFCE 3LNUA 5AC5A 1QNTA 4IS9A 3MSWA 3Q6MA 5JEAA 2NN6C 2HHHI 1N33E 2BA0G 2CSHA 2EN8A 2EPXA 4LFAI 4JI7E 1H7UA 4LF4I 2HK3A 4AM3A 1HNWI 1PJSA 1EA6A 4GZNC 5JEAC 4R1FA 4LCFA 3ADLA 4LF8I 1UDNA 2BBGA 4JI2E 4DPTA 2EOYA 2YWQA 2EM6A 2O3ZA 3M6AA 2Z5CA 1VISA 2EMXA 4FW9A 2EMYA 4X62I 2VQEI 1HR0I 4RHBB 1YFHA 1G2DC 2WBTA 1IBKI 2VF3A 2EORA 4DV4E 3KZZA 1P47A 4MYUA 5K36C 4F6MA 4JI5I 1T4OA 1ZM3A 2PO0B 3GMEA 4N3OA 4F9CB 3C6KA 3J80Q 1MGTA 5C0XA 3J7AM 3H09A 1X47A 3EPKA 3K17A 2EPRA 2O1TA 4JI6I 1T39A 4DV0I 4LTYA 2WW4A 3HULA 4BBYA 5C0XC 1MEYC 4ZVIA 2EOZA 4B3SE 4LPFA 4OO1C 1UDQA 2L3CA 2PNZA 1FKAE 5LMNE 1D6TA 2MC6A 4MLQA 2JXPA 4HY1A 1DQ3A 5LL6R 3JAMC 1FWKA 3ZZUA 2E1RA 1X48A 3T1YI 5LMUI 2EPZA 5DRRA 4MU3A 3VYXA 2ENAA 3B78A 2VF1A 4R2PA 2WCC3 2M9AA 2YPNA 4B3TE 1TF3A 2BM0A 2E72A 2EPKX 2K4VA 1QZRA 2L33A 1KTVA 3V2UC 1NEIA 2RSIA 2UXCE 2NN6A 5GMDA 4ZYHA 2HKJA 2YRKA 5IT9Q 4IZJB 3C6MA 3P06A 3D4JA 1MX0A 5A6KA 1GQEA 2MDGA 1A1IA 4DUYI 1L4SA 1T4LB 4LF7E 2EM5A 2EWLA 2LUQA 3V5RA 3EQ1A 4DV1I 1UILA 2N3GA 4GKKE 2DEIA 2J65A 1EH8A 3K1JA 3GLLA 4PRVA 1FNMA 2AJ4A 3J81C 1Z0BA 4MQYA 3IWDA 3OMLA 3IWBA 3HKMA 4MU0A 2EOQA 4JI1I 2BA1D 3F6GA 2EN4A 2G7HA 5ELWA 4WXCA 4JI3E 1X6FA 2E1MA 1JK1A 4OKGA 2A2DA 3HPSA 4R03A 4IFDF 2ENCA 3P3GA 1N32I 3MHHC 4NXNI 2YTDA 1HNXI 1RQ0A 4R2RA 1HK7A 2YTQA 3MHSC 1HNZE 3GONA 4FW7A 4IZJD 3PS3A 3BIDA 2EQ3A 1QU6A 2NUFA 3WU5A 4DR6I 4DR5E 4DPXA 3AV0A 2EMCA 2EMFA 2UUCI 1A1KA 2UU9E 4DMIA 2OI2A 4FN5A 2EMGA 3ECRA 4DV5E 2B3TB 4X64E 2M1SA 1ZXNA 2Z5BB 4MYTA 2K7IA 3HPZA 2HK2A 2LT7A 3TQMA 1EH7A 4JV5E 4WX9A 2NPFA 4JI8I 4LFBI 3CDIA 2LTRA 2VQFE 3WU3A 1OYSA 3C4BA 4DV2E 4KHPI 2PNLA 1USVA 4RPFA 2YU5A 4NBQA 2ODRD 2AE8A 3J80C 1X6HA 1Z5AA 1IBMI 4IFDB 1U2RA 1N36E 1N3GA 2V83A 1NZ0A 3L7ZB 2EPOA 1R6MA 2L6MA 4WSGA 4BHBA 2EMAA 2YTFA 1Z0GA 4ZYGA 4NXMI 4OX9I 2Q8UA 2JEBA 1E3HA 4LF5I 3B8HA 5DRPA 5KL4A 2EM9A 3PS2A 4IZJA 2BB8A 4GKJE 4BA2A 3C4TA 4NZVA 1YYKA 4WUBA 1Z0WA 2EN3A 3GCMA 5KL6A 1UDOA 1IBLE 1BBOA 1MG7A 1RREA 2IOPA 3THOB 3H1CA 5IV8B 4R8OA 3RMPA 2IESA 2V86A 4DV7I 2ZM6I 2CTDA 2YTGA 2ENHA 2O1VA 3J81Q 2E5LE 2VRDA 2WNRA 2BA1G 4OO1D 3IWCA 2ZBKB 4DV6E 1I94I 2JYAA 4F2JC 2EQ1A 5A6JA 2YZTA 4YHHE 4LCHA 4LF9I 4MLVA 1WHQA 1Z59A 2EM8A 5IT9C 1ZAAC 2EOIA 2IERA 2PO1A 2X36A 2B9DA 3WU6A 2L3JA 1OYPA 4FW4A 4JI0I 1SR9A 3ZZ0A 4M0VA 4OZEA 2EOOA 2EM7A 2LJHA 2NABA 2R76A 1Y6ZA 1LLMC 2C37B 2WP8A 2F4VI 2DGCA 2ODRC 2HHHE 1YHCA 2EOSA 2MDRA 5TSEA 4O24A 1ZR9A 1J5EI 4DUZI 1N33I 2NA2A 4LFAE 2BR2B 4J3DA 2I13A 4F6NA 2BM1A 2EE8A 2JVAA 3PYFA 4Z7YA 4K0KI 1RHYA 1YH8A 1GTKA 3BGHA 2GS8A 4LF8E 4WXDA 4JG4A 4JI7I 2FTXB 3ADIA 2YTNA 3LMLA 1B62A 5KL7A 4IFDE 5DNYA 4X62E 2VQEE 1HR0E 1FJGI 5A6AA 1WXRA 4J8ZA 4ZYDA 4QNJA 4DR3I 2C38B 3CWVA 1IBKE 3U1KA 2LJPA 4R2AA 4BS9A 4OO1A 2RSMA 2KHXA 2B7TA 4FW5A 4DPYA 3DD6A 4YY3I 2I9IA 4HTGA 4KWYA 3JTZA 5FLXC 4B3ME 1B63A 4PRXA 3WU4A 1AAYA 1A1JA 1IQOA 5FWKA 3EPLA 2PO2A 3KZYA 4DV0E 3P3EA 3VHTB 3KWRA 1KJKA 2YRMA 1DGCA 1S16A 4Z7CA 3T1HI 1A6FA 2D9HA 2LV2A 5ADZA 3ADGA 5AASA 1UEKA 4URLA 3M99B 3THNA 2V2VA 4B3SI 4IZKB 2MC5A 4R2QA 1YYOA 4HACB 1PDAA 2CPNA 3H4LA 4DXLA 3T1YE 1BB8A 5A2QC 5LMUE 3ZKDA
chains in the Genus database with same CATH topology
1ZBQA 3F6HA 3OTOI 3J7Yp 4X8WA 1NHHA 4KZSA 4JYAI 2YT4A 2CGEA 4FWDA 4F54A 2HFSA 4DR2I 2HFUA 4B3RI 4JI4E 2L2NA 2RTXA 3ZOQB 4BCAA 4WPYA 1H7SA 3PRYA 3ZM7A 4KQVA 4DV1E 4M2ZA 1STUA 4ED4A 4JI1E 4HYMA 2JWOA 4TUGA 2O1UA 4P7DA 2DIXA 3LLHA 1Z0TA 1FWLA 2M4IA 1XHKA 1N32E 3QT6A 1USUA 4X65I 4DR4I 1O0WA 1XMQI 4DR6E 2DSYA 5FLXQ 2UUCE 5AE1A 2UXDE 4DR5I 5L3JA 3HJCA 1YZ9A 4I8OA 1DARA 1Y4UA 2UU9I 5BR8I 2H36X 3K85A 1ZM2A 3LTOA 5IWAI 3ZKBA 3LPSA 2KONA 2EZ6A 4X64I 4DV5I 1OJ4A 4LFBE 4JI8E 4X66I 2V88A 1Z0EA 2UUBI 4JV5I 2DEJA 4AQYI 3VK6A 2UUAI 4DPWA 2Z5CB 3F0NA 2VQFI 5A2QQ 4DV3I 1XNRI 2L8TA 1IBME 2NUGA 2UXBE 4P7AA 4DU8A 2F8BA 1H72C 1Z5BA 4L5NC 1N34I 1GZ6A 1N0VC 4DR7E 2CG9A 2BV3A 4NXME 4LF5E 2Q2EB 5GMEA 2LMZA 2JY9A 2R42A 2KOUA 1KVKA 2V34A 4FWGA 4GKJI 2CZ9A 4WSPA 1XNQE 1ZM4A 4UT4A 1IBLI 3HXLA 4DR1E 1XMOI 2V8QB 2V2ZA 2RS7A 5CFFE 1I94E 4M1KA 3B82A 4LF6I 2J7KA 4LF9E 4DV6I 3FIGA 4LFCI 1NHJA 2V2QA 5F3WA 5AE3A 2LBSB 4JI0E 4LF4E 1WUUA 1HNWE 2XEXA 2Z5BA 2F4VE 1PVGA 4PU9A 1J5EE 4DUZE 4JI2I 4K0KE 1Z0CA 4GEQB 1T4NA 4P52A 2JOBA 4JI5E 1NHIA 1DI2A 3P1XA 4DU7A 1FJGE 4DV4I 4DR3E 3DJWA 4XTJA 2DMYA 1BKNA 2IOQA 4JI6E 4M30A 4YY3E 3PYGA 4WFTA 5T6JA 2L92A 4B3MI 3VYYA 5LMNI 1KIJA 3T1HE 4WUCA 4P78A 2M7QA 2LTSA 1K47A 2L2MA 3PYDA 4B3TI 3PYEA 3QT8A 3K6QA 4LU9A 1Z5CA 3Q6NA 3OTOE 2UXCI 4JYAE 2PNMA 2A2CA 4DUYE 2L2KB 2JOXA 4WYQB 4BMJA 1RC7A 2JR1A 2FV4B 4I3HA 1PKPA 2V85A 4DR2E 2V87A 4LF7I 4UTGA 4B3RE 2IHR1 3Q1QA 4GKKI 3QT5A 2V89A 1ELOA 4JI4I 2R3VA 4USMA 2ZITA 3HQ1A 4F9AB 1J26A 1WHNA 1KKHA 4JI3I 4NXNE 1HNXE 4DPUA 1Z0VA 1HNZI 1ZBTA 1PIEA 4X65E 4HXZA 4DR4E 1EKZA 1XMQE 1H74A 2NUEA 1ZM9A 1RR9A 3J7AG 2HKEA 2N3HA 3HTXA 2UXDI 1UHZA 4KHPE 3QT7A 5BR8E 2X7IA 4WUDA 4IZKA 5IWAE 4HACA 4OOGC 4DV2I 4Q28A 4X66E 2WZOA 2UUBE 4AQYE 4FWHA 1N36I 2UUAE 2V8PA 3DF6A 4DV3E 4OX9E 1XNRE 1Y4SA 4F9BB 3JAMQ 1FI4A 1H73A 2Z5EA 2UXBI 1N34E 2LE2A 2FGGA 2LRSA 4DR7I 2DB2A 1X49A 2VE7C 4DV7E 4EMDA 2ZM6E 4USKA 3JU0A 4TUIA 1S4EA 1EI1A 4DKKA 2E5LI 1MU5A 2RS6A 2EFGA 1XMOE 4YHHI 1XNQI 1ZXMA 1YYWA 4BC7A 3ZZTA 1N0UA 4DR1I 3AUZA 4BC9A 2LUPB 4LF6E 2GQ0A 4L8NA 3ADJA 2B7VA 5AE2A 2O1WA 4LFCE 3LNUA 3MSWA 3Q6MA 2HHHI 1N33E 4LFAI 4JI7E 1H7UA 4LF4I 2HK3A 1HNWI 1EA6A 4R1FA 3ADLA 4LF8I 4JI2E 4DPTA 3M6AA 2Z5CA 1VISA 4FW9A 4X62I 2VQEI 1HR0I 1IBKI 2VF3A 4DV4E 4MYUA 4JI5I 1T4OA 1ZM3A 4N3OA 4F9CB 3J80Q 3J7AM 3H09A 1X47A 3K17A 2O1TA 4JI6I 4DV0I 4LTYA 2WW4A 3HULA 4BBYA 4ZVIA 4B3SE 2L3CA 1FKAE 5LMNE 1D6TA 2MC6A 4HY1A 1DQ3A 5LL6R 3JAMC 1FWKA 3ZZUA 2E1RA 1X48A 3T1YI 5LMUI 3VYXA 3B78A 2VF1A 4B3TE 2BM0A 2K4VA 1QZRA 2L33A 1KTVA 3V2UC 2UXCE 5GMDA 2HKJA 5IT9Q 4IZJB 3P06A 3D4JA 1MX0A 1GQEA 4DUYI 1T4LB 4LF7E 2EWLA 2LUQA 3V5RA 4DV1I 1UILA 2N3GA 4GKKE 2DEIA 4PRVA 3K1JA 1FNMA 2AJ4A 3J81C 1Z0BA 3IWDA 3OMLA 3IWBA 4JI1I 3F6GA 2G7HA 4JI3E 2E1MA 2A2DA 3HPSA 4R03A 1N32I 4NXNI 1HNXI 1RQ0A 1HK7A 1HNZE 3GONA 4IZJD 2NUFA 3WU5A 1QU6A 4DR6I 4DR5E 4DPXA 3AV0A 2UUCI 2UU9E 4DMIA 2OI2A 4FN5A 4DV5E 2B3TB 4X64E 2M1SA 1ZXNA 2Z5BB 4MYTA 3HPZA 2HK2A 4JV5E 2NPFA 4JI8I 4LFBI 2LTRA 2VQFE 3WU3A 3C4BA 4DV2E 4KHPI 2PNLA 1USVA 4RPFA 2ODRD 3J80C 1Z5AA 1IBMI 1U2RA 1N36E 2V83A 1NZ0A 2L6MA 1Z0GA 4NXMI 4OX9I 4LF5I 3B8HA 4IZJA 4GKJE 3C4TA 1YYKA 4WUBA 1Z0WA 1IBLE 1MG7A 1RREA 2IOPA 4R8OA 3RMPA 4DV7I 2V86A 2ZM6I 2O1VA 3J81Q 2E5LE 3IWCA 2ZBKB 4DV6E 1I94I 2YZTA 4YHHE 4LF9I 1WHQA 1Z59A 5IT9C 2X36A 2B9DA 3WU6A 2L3JA 4JI0I 1SR9A 3ZZ0A 4M0VA 2LJHA 1Y6ZA 2F4VI 2ODRC 2HHHE 2MDRA 1J5EI 4DUZI 1N33I 2NA2A 4LFAE 4Z7YA 4K0KI 2BM1A 2JVAA 3PYFA 2GS8A 4LF8E 4JG4A 4JI7I 2FTXB 3ADIA 3LMLA 1B62A 5DNYA 4X62E 2VQEE 1HR0E 1FJGI 1WXRA 4J8ZA 4DR3I 3CWVA 1IBKE 2LJPA 4BS9A 2RSMA 2KHXA 2B7TA 4DPYA 4YY3I 5FLXC 3JTZA 1B63A 4B3ME 4PRXA 3WU4A 5FWKA 4DV0E 3KWRA 1S16A 4Z7CA 3T1HI 1A6FA 1UEKA 5ADZA 3ADGA 5AASA 4URLA 2V2VA 4B3SI 4IZKB 2MC5A 1YYOA 4HACB 2CPNA 3H4LA 4DXLA 3T1YE 5A2QC 5LMUE 3ZKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OTO I;  3J7Y p;  4X8W A;  1NHH A;  4JYA I;  2YT4 A;  4FWD A;  2HFS A;  4DR2 I;  2HFU A;  4B3R I;  4JI4 E;  2L2N A;  2RTX A;  1H7S A;  3ZM7 A;  4KQV A;  4DV1 E;  4M2Z A;  1STU A;  4ED4 A;  4JI1 E;  4HYM A;  2DIX A;  3LLH A;  1Z0T A;  1FWL A;  1XHK A;  1N32 E;  3QT6 A;  4X65 I;  4DR4 I;  1O0W A;  1XMQ I;  4DR6 E;  5FLX Q;  2UUC E;  2UXD E;  4DR5 I;  5L3J A;  1YZ9 A;  1DAR A;  2UU9 I;  5BR8 I;  1ZM2 A;  3LTO A;  5IWA I;  3ZKB A;  3LPS A;  2EZ6 A;  4DV5 I;  4X64 I;  1OJ4 A;  4LFB E;  4JI8 E;  4X66 I;  1Z0E A;  2UUB I;  4JV5 I;  2DEJ A;  4AQY I;  2UUA I;  4DPW A;  2VQF I;  3F0N A;  5A2Q Q;  4DV3 I;  1XNR I;  2UXB E;  1IBM E;  2NUG A;  4P7A A;  4DU8 A;  1H72 C;  1Z5B A;  1N34 I;  1N0V C;  4DR7 E;  2BV3 A;  4NXM E;  4LF5 E;  2Q2E B;  5GME A;  2JY9 A;  2R42 A;  2V34 A;  4FWG A;  1KVK A;  4GKJ I;  2CZ9 A;  1XNQ E;  1ZM4 A;  4UT4 A;  1IBL I;  4DR1 E;  1XMO I;  2V2Z A;  2RS7 A;  5CFF E;  1I94 E;  4M1K A;  3B82 A;  4LF6 I;  2J7K A;  4LF9 E;  4DV6 I;  4LFC I;  1NHJ A;  2V2Q A;  4JI0 E;  2LBS B;  1WUU A;  4LF4 E;  1HNW E;  2XEX A;  2F4V E;  1PVG A;  4PU9 A;  1J5E E;  4DUZ E;  4JI2 I;  4K0K E;  1Z0C A;  1T4N A;  4P52 A;  4JI5 E;  1NHI A;  1DI2 A;  3P1X A;  4DU7 A;  1FJG E;  4DV4 I;  4DR3 E;  4XTJ A;  2DMY A;  1BKN A;  4JI6 E;  4M30 A;  4YY3 E;  3PYG A;  4WFT A;  4B3M I;  3VYY A;  5LMN I;  1KIJ A;  3T1H E;  4WUC A;  2LTS A;  1K47 A;  2L2M A;  3PYD A;  4B3T I;  3PYE A;  3QT8 A;  1Z5C A;  3OTO E;  2UXC I;  4JYA E;  2A2C A;  4DUY E;  2L2K B;  1RC7 A;  4WYQ B;  4I3H A;  1PKP A;  4DR2 E;  4LF7 I;  4UTG A;  4B3R E;  2IHR 1;  3Q1Q A;  4GKK I;  3QT5 A;  1ELO A;  4JI4 I;  2R3V A;  4USM A;  2ZIT A;  1J26 A;  1WHN A;  1KKH A;  4JI3 I;  4NXN E;  1HNX E;  4DPU A;  1Z0V A;  1HNZ I;  1ZBT A;  1PIE A;  4X65 E;  4HXZ A;  4DR4 E;  1EKZ A;  1XMQ E;  1H74 A;  2NUE A;  1ZM9 A;  1RR9 A;  3J7A G;  2HKE A;  2N3H A;  3HTX A;  2UXD I;  1UHZ A;  4KHP E;  3QT7 A;  5BR8 E;  2X7I A;  4WUD A;  5IWA E;  4HAC A;  4OOG C;  4DV2 I;  4X66 E;  2UUB E;  4AQY E;  4FWH A;  1N36 I;  2UUA E;  2V8P A;  4DV3 E;  4OX9 E;  1XNR E;  3JAM Q;  1FI4 A;  1H73 A;  2UXB I;  1N34 E;  2LRS A;  4DR7 I;  2DB2 A;  1X49 A;  4DV7 E;  4EMD A;  2ZM6 E;  4USK A;  1S4E A;  1EI1 A;  4DKK A;  2E5L I;  1MU5 A;  2RS6 A;  2EFG A;  1XMO E;  4YHH I;  1XNQ I;  1ZXM A;  1YYW A;  3ZZT A;  1N0U A;  4DR1 I;  2LUP B;  4LF6 E;  3ADJ A;  2B7V A;  4LFC E;  3LNU A;  2HHH I;  1N33 E;  4LFA I;  4JI7 E;  1H7U A;  4LF4 I;  2HK3 A;  1HNW I;  1EA6 A;  4R1F A;  3ADL A;  4LF8 I;  4JI2 E;  4DPT A;  3M6A A;  1VIS A;  4FW9 A;  4X62 I;  2VQE I;  1HR0 I;  1IBK I;  2VF3 A;  4DV4 E;  4MYU A;  4JI5 I;  1T4O A;  1ZM3 A;  3J80 Q;  3J7A M;  1X47 A;  3K17 A;  4JI6 I;  4DV0 I;  2WW4 A;  3HUL A;  4ZVI A;  4B3S E;  2L3C A;  1FKA E;  5LMN E;  1D6T A;  4HY1 A;  5LL6 R;  1FWK A;  3JAM C;  3ZZU A;  2E1R A;  1X48 A;  3T1Y I;  5LMU I;  3VYX A;  3B78 A;  4B3T E;  2BM0 A;  1QZR A;  2L33 A;  1KTV A;  3V2U C;  2UXC E;  5GMD A;  2HKJ A;  5IT9 Q;  3D4J A;  1MX0 A;  1GQE A;  4DUY I;  1T4L B;  4LF7 E;  2LUQ A;  3V5R A;  4DV1 I;  1UIL A;  2N3G A;  4GKK E;  2DEI A;  4PRV A;  3K1J A;  1FNM A;  2AJ4 A;  3J81 C;  1Z0B A;  4JI1 I;  4JI3 E;  2A2D A;  1N32 I;  4NXN I;  1HNX I;  1RQ0 A;  1HNZ E;  3GON A;  2NUF A;  3WU5 A;  1QU6 A;  4DR6 I;  4DR5 E;  4DPX A;  2UUC I;  2UU9 E;  2OI2 A;  4FN5 A;  4DV5 E;  2B3T B;  4X64 E;  1ZXN A;  4MYT A;  2HK2 A;  4JV5 E;  2NPF A;  4JI8 I;  4LFB I;  2LTR A;  2VQF E;  3WU3 A;  3C4B A;  4DV2 E;  4KHP I;  4RPF A;  3J80 C;  1Z5A A;  1IBM I;  1U2R A;  1N36 E;  1NZ0 A;  1Z0G A;  4NXM I;  4OX9 I;  4LF5 I;  3B8H A;  4GKJ E;  3C4T A;  1YYK A;  4WUB A;  1Z0W A;  1IBL E;  1MG7 A;  1RRE A;  4DV7 I;  2ZM6 I;  3J81 Q;  2E5L E;  2ZBK B;  4DV6 E;  1I94 I;  4YHH E;  4LF9 I;  1WHQ A;  1Z59 A;  5IT9 C;  2X36 A;  3WU6 A;  2L3J A;  4JI0 I;  3ZZ0 A;  2LJH A;  2F4V I;  2HHH E;  2MDR A;  1J5E I;  4DUZ I;  1N33 I;  2NA2 A;  4LFA E;  4Z7Y A;  4K0K I;  2BM1 A;  2JVA A;  3PYF A;  2GS8 A;  4LF8 E;  4JG4 A;  4JI7 I;  3ADI A;  1B62 A;  4X62 E;  2VQE E;  1HR0 E;  1FJG I;  4DR3 I;  3CWV A;  1IBK E;  2LJP A;  2RSM A;  2KHX A;  2B7T A;  4DPY A;  4YY3 I;  5FLX C;  1B63 A;  4PRX A;  4B3M E;  3WU4 A;  4DV0 E;  1S16 A;  4Z7C A;  3T1H I;  1A6F A;  1UEK A;  4URL A;  3ADG A;  2V2V A;  4B3S I;  1YYO A;  4HAC B;  2CPN A;  3H4L A;  4DXL A;  3T1Y E;  5A2Q C;  5LMU E;  3ZKD A; 
#chains in the Genus database with same CATH topology
 1F2I G;  1ZBQ A;  2JE6 B;  3F6H A;  3CDJ A;  3OTO I;  3J7Y p;  4X8W A;  4N4R B;  4KZS A;  2GLI A;  2YT4 A;  4Q35 B;  1NHH A;  2CGE A;  4FWD A;  4JYA I;  2LVH A;  2EN2 A;  2MKN A;  4F54 A;  3M7N D;  2PRT A;  2NN6 F;  5EKW A;  2HFS A;  2R1F A;  2JPA A;  4DR2 I;  2EOX A;  2HFU A;  1YUI A;  3P76 A;  4B3R I;  4JI4 E;  5JEA F;  2L2N A;  2RTX A;  1G2F C;  3ZOQ B;  4BCA A;  4WPY A;  1H7S A;  1NCS A;  3PRY A;  3ZM7 A;  4KQV A;  2EMZ A;  4DV1 E;  1KYQ A;  2N8X A;  4M2Z A;  1STU A;  4ED4 A;  1WRJ A;  2J7J A;  2JEA B;  4JI1 E;  4HYM A;  2JWO A;  4TUG A;  2O1U A;  4P7D A;  2DIX A;  3LLH A;  2PO0 A;  1Z0T A;  4BA1 B;  1FWL A;  2M4I A;  1XHK A;  3BBG A;  1N32 E;  1USU A;  3QT6 A;  4X65 I;  4DR4 I;  1O0W A;  1XMQ I;  2NN6 B;  4DR6 E;  2DSY A;  2ELZ A;  5FLX Q;  2UUC E;  2EPN A;  5AE1 A;  2UXD E;  5C0X F;  4DR5 I;  2MKD A;  5L3J A;  4R2D A;  3HJC A;  2HJJ A;  1YZ9 A;  4I8O A;  2VES A;  1A1H A;  1DAR A;  1Y4U A;  5JEA B;  2UU9 I;  5BR8 I;  2H36 X;  3K85 A;  1ZM2 A;  2BA0 D;  3LTO A;  5IWA I;  2EMH A;  2GPI A;  3ZKB A;  3LPS A;  2KON A;  2EZ6 A;  4X64 I;  4DV5 I;  1OJ4 A;  4LFB E;  4JI8 E;  1YPN A;  4X66 I;  2V88 A;  1Z0E A;  2UUB I;  4JV5 I;  2DEJ A;  4AQY I;  3U1Y A;  2HC5 A;  3VK6 A;  2UUA I;  4DPW A;  2GO4 A;  2Z5C B;  3F0N A;  2VQF I;  5A2Q Q;  4DV3 I;  2EOF A;  1XNR I;  2L8T A;  5KL2 A;  1IBM E;  2NUG A;  2UXB E;  4P7A A;  1RMD A;  4DU8 A;  3BF2 A;  2F8B A;  1TN9 A;  1H72 C;  2EL6 A;  4O5G A;  4L5N C;  1Z5B A;  1N34 I;  1GZ6 A;  1N0V C;  4DR7 E;  3M7N G;  2CG9 A;  2BV3 A;  3M85 D;  2YTJ A;  4NXM E;  4LF5 E;  5C0X B;  2Q2E B;  2YSP A;  3EPJ A;  5GME A;  2EL5 A;  2LMZ A;  2JY9 A;  1PJQ A;  2R42 A;  4IFD D;  3B4T A;  4R2C A;  2EMW A;  2KOU A;  1KVK A;  2V34 A;  4FWG A;  4GKJ I;  4MU1 A;  2CZ9 A;  4WSP A;  4ZYE A;  1XNQ E;  1ZM4 A;  2EN6 A;  1T38 A;  2PNZ B;  4UT4 A;  1IBL I;  3HXL A;  4DR1 E;  1XMO I;  4LOM A;  2V8Q B;  1UN6 B;  2JP9 A;  2V2Z A;  2RS7 A;  5CFF E;  2EPM X;  1I94 E;  2RQL A;  2WBU A;  3B82 A;  4FW3 A;  4M1K A;  4LF6 I;  2J7K A;  5DRO A;  2EL4 A;  4LF9 E;  4DV6 I;  3FIG A;  2NN6 E;  4LFC I;  1NHJ A;  2V2Q A;  5F3W A;  5AE3 A;  2LBS B;  4JI0 E;  4LF4 E;  1WUU A;  1HNW E;  2EJ4 A;  2XEX A;  5JEA E;  2ADR A;  2F4V E;  2Z5B A;  1PVG A;  4PU9 A;  2EML A;  1X6E A;  5IXM B;  2YTO A;  4DUZ E;  1J5E E;  4JI2 I;  4K0K E;  5EL9 A;  1Z0C A;  4GEQ B;  1T4N A;  2EPC A;  4FK5 C;  4IFD A;  4P52 A;  2YTI A;  3EPH A;  5K36 E;  2JOB A;  4JI5 E;  1NHI A;  1DI2 A;  3P1X A;  2EM4 A;  3L7Z A;  4DU7 A;  1FJG E;  2CVE A;  4DV4 I;  2EM3 A;  1VI7 A;  4DR3 E;  4QNK A;  4IFD C;  3DJW A;  4XTJ A;  1R6L A;  2DMY A;  4U3B A;  1BKN A;  4RH8 A;  2IOQ A;  4JI6 E;  4M30 A;  3M85 G;  3UHM A;  2LJU A;  2YU8 A;  2EPP A;  5KL5 A;  5C0X E;  4IS1 C;  4YY3 E;  2EP3 A;  3PYG A;  4ISA A;  4WFT A;  5T6J A;  4OO1 E;  5A6B D;  4BHC A;  5A69 A;  2L92 A;  4B3M I;  3VYY A;  2EPU A;  5LMN I;  1KIJ A;  3T1H E;  3NZK A;  2GHF A;  4WUC A;  2LO3 A;  1Y60 A;  1X3C A;  4P78 A;  2M7Q A;  4O43 A;  5DRQ A;  2LTS A;  1K47 A;  2L2M A;  3PYD A;  3KRN A;  4NHR A;  4B3T I;  3PYE A;  1JK2 A;  3QT8 A;  3K6Q A;  4GQU A;  4LU9 A;  1Z5C A;  3QG5 C;  3Q6N A;  3OTO E;  5DNL A;  2UXC I;  2C37 A;  4JYA E;  1E3P A;  2PNM A;  2A2C A;  4DUY E;  3UK3 C;  2L2K B;  2JOX A;  4WYQ B;  4BMJ A;  1RC7 A;  1BBG A;  2JR1 A;  2FV4 B;  4I3H A;  1B69 A;  2BR2 A;  2EOM A;  2JEB B;  1PKP A;  2V85 A;  4DR2 E;  2V87 A;  3PS1 A;  4UTG A;  4LF7 I;  2C39 B;  4B3R E;  2IHR 1;  3Q1Q A;  4GKK I;  2WBS A;  3QT5 A;  2V89 A;  4MU4 A;  4BA2 B;  4R2S A;  5A6B A;  1ELO A;  2EN1 A;  2R3V A;  4USM A;  1P42 A;  2ZIT A;  3HQ1 A;  4F9A B;  4JI4 I;  5K36 F;  1J26 A;  1WHN A;  2YTP A;  1TF6 A;  1KKH A;  4JI3 I;  4NXN E;  2C38 A;  1HNX E;  4DPU A;  1IQS A;  1Z0V A;  2YRH A;  2WNR B;  2EMK A;  4AID A;  4IJD A;  2EOE A;  2DLK A;  1ZU1 A;  2DMI A;  1HNZ I;  1ZBT A;  1PIE A;  4X65 E;  4HXZ A;  4DR4 E;  4LCG A;  4U3D A;  2PO1 B;  4OO1 F;  5K36 A;  1EKZ A;  1XMQ E;  1H74 A;  2NUE A;  1ZM9 A;  2DRP A;  1RR9 A;  3J7A G;  2HKE A;  2N3H A;  3P3C A;  3HTX A;  4O4K A;  2WP8 B;  1SFE A;  1Y5Y A;  2UXD I;  1UHZ A;  4KHP E;  3QT7 A;  5AC4 A;  1UBD C;  5BR8 E;  2X7I A;  2EQ0 A;  4WUD A;  4IZK A;  5K36 B;  5IWA E;  5KL3 A;  2F1D A;  4OOG C;  4HAC A;  5DNX A;  2EPL X;  4FW6 A;  4DV2 I;  4Q28 A;  2NN6 D;  4AIM A;  4M9V C;  1UDS A;  1A1G A;  2YSO A;  2JE6 A;  1X5W A;  4X66 E;  2WZO A;  2UUB E;  1AH5 A;  4AQY E;  5LLQ A;  4FWH A;  1N36 I;  2UUA E;  2EOH A;  2V8P A;  3DF6 A;  1YSA C;  4DV3 E;  4OX9 E;  5JEA D;  1XNR E;  1Y4S A;  4F9B B;  3JAM Q;  1FI4 A;  1H73 A;  2Z5E A;  2ELY A;  2UXB I;  1XXE A;  4OO1 B;  1N34 E;  4MDT A;  2DLQ A;  1A1F A;  2EM0 A;  2LE2 A;  2FGG A;  2LRS A;  4DR7 I;  1WJP A;  2DB2 A;  2VE7 C;  1X49 A;  2LCE A;  4DV7 E;  2RPC A;  1YUJ A;  2ZM6 E;  4EMD A;  2GO3 A;  2JT2 A;  4USK A;  5K36 D;  4R2E A;  2A25 A;  3JU0 A;  4TUI A;  2PO2 B;  1S4E A;  2C39 A;  1EI1 A;  2CT1 A;  2JEA A;  4X9J A;  2EM2 A;  4DKK A;  2E5L I;  1Z1B A;  1OYR A;  2EOJ A;  1PJT A;  1MU5 A;  4BA1 A;  2RS6 A;  2EFG A;  1XMO E;  4HEI A;  2EPA A;  4YHH I;  5C0X D;  1ZXM A;  1XNQ I;  3L00 A;  1IMU A;  1YYW A;  4BC7 A;  3ZZT A;  1N0U A;  2EN7 A;  4DR1 I;  3AUZ A;  4BC9 A;  2LUP B;  2YTE A;  2EMI A;  1A1L A;  4LF6 E;  2GQ0 A;  4L8N A;  1EH6 A;  2B7V A;  3ADJ A;  5AE2 A;  2HGH A;  2O1W A;  2EMB A;  4LFC E;  3LNU A;  5AC5 A;  1QNT A;  4IS9 A;  3MSW A;  3Q6M A;  5JEA A;  2NN6 C;  2HHH I;  1N33 E;  2BA0 G;  2CSH A;  2EN8 A;  2EPX A;  4LFA I;  4JI7 E;  1H7U A;  4LF4 I;  2HK3 A;  4AM3 A;  1HNW I;  1PJS A;  1EA6 A;  4GZN C;  5JEA C;  4R1F A;  4LCF A;  3ADL A;  4LF8 I;  1UDN A;  2BBG A;  4JI2 E;  4DPT A;  2EOY A;  2YWQ A;  2EM6 A;  2O3Z A;  3M6A A;  2Z5C A;  1VIS A;  2EMX A;  4FW9 A;  2EMY A;  4X62 I;  2VQE I;  1HR0 I;  4RHB B;  1YFH A;  1G2D C;  2WBT A;  1IBK I;  2VF3 A;  2EOR A;  4DV4 E;  3KZZ A;  1P47 A;  4MYU A;  5K36 C;  4F6M A;  4JI5 I;  1T4O A;  1ZM3 A;  2PO0 B;  3GME A;  4N3O A;  4F9C B;  3C6K A;  3J80 Q;  1MGT A;  5C0X A;  3J7A M;  3H09 A;  1X47 A;  3EPK A;  3K17 A;  2EPR A;  2O1T A;  4JI6 I;  1T39 A;  4DV0 I;  4LTY A;  2WW4 A;  3HUL A;  4BBY A;  5C0X C;  1MEY C;  4ZVI A;  2EOZ A;  4B3S E;  4LPF A;  4OO1 C;  1UDQ A;  2L3C A;  2PNZ A;  1FKA E;  5LMN E;  1D6T A;  2MC6 A;  4MLQ A;  2JXP A;  4HY1 A;  1DQ3 A;  5LL6 R;  3JAM C;  1FWK A;  3ZZU A;  2E1R A;  1X48 A;  3T1Y I;  5LMU I;  2EPZ A;  5DRR A;  4MU3 A;  3VYX A;  2ENA A;  3B78 A;  2VF1 A;  4R2P A;  2WCC 3;  2M9A A;  2YPN A;  4B3T E;  1TF3 A;  2BM0 A;  2E72 A;  2EPK X;  2K4V A;  1QZR A;  2L33 A;  1KTV A;  3V2U C;  1NEI A;  2RSI A;  2UXC E;  2NN6 A;  5GMD A;  4ZYH A;  2HKJ A;  2YRK A;  5IT9 Q;  4IZJ B;  3C6M A;  3P06 A;  3D4J A;  1MX0 A;  5A6K A;  1GQE A;  2MDG A;  1A1I A;  4DUY I;  1L4S A;  1T4L B;  4LF7 E;  2EM5 A;  2EWL A;  2LUQ A;  3V5R A;  3EQ1 A;  4DV1 I;  1UIL A;  2N3G A;  4GKK E;  2DEI A;  2J65 A;  1EH8 A;  3K1J A;  3GLL A;  4PRV A;  1FNM A;  2AJ4 A;  3J81 C;  1Z0B A;  4MQY A;  3IWD A;  3OML A;  3IWB A;  3HKM A;  4MU0 A;  2EOQ A;  4JI1 I;  2BA1 D;  3F6G A;  2EN4 A;  2G7H A;  5ELW A;  4WXC A;  4JI3 E;  1X6F A;  2E1M A;  1JK1 A;  4OKG A;  2A2D A;  3HPS A;  4R03 A;  4IFD F;  2ENC A;  3P3G A;  1N32 I;  3MHH C;  4NXN I;  2YTD A;  1HNX I;  1RQ0 A;  4R2R A;  1HK7 A;  2YTQ A;  3MHS C;  1HNZ E;  3GON A;  4FW7 A;  4IZJ D;  3PS3 A;  3BID A;  2EQ3 A;  1QU6 A;  2NUF A;  3WU5 A;  4DR6 I;  4DR5 E;  4DPX A;  3AV0 A;  2EMC A;  2EMF A;  2UUC I;  1A1K A;  2UU9 E;  4DMI A;  2OI2 A;  4FN5 A;  2EMG A;  3ECR A;  4DV5 E;  2B3T B;  4X64 E;  2M1S A;  1ZXN A;  2Z5B B;  4MYT A;  2K7I A;  3HPZ A;  2HK2 A;  2LT7 A;  3TQM A;  1EH7 A;  4JV5 E;  4WX9 A;  2NPF A;  4JI8 I;  4LFB I;  3CDI A;  2LTR A;  2VQF E;  3WU3 A;  1OYS A;  3C4B A;  4DV2 E;  4KHP I;  2PNL A;  1USV A;  4RPF A;  2YU5 A;  4NBQ A;  2ODR D;  2AE8 A;  3J80 C;  1X6H A;  1Z5A A;  1IBM I;  4IFD B;  1U2R A;  1N36 E;  1N3G A;  2V83 A;  1NZ0 A;  3L7Z B;  2EPO A;  1R6M A;  2L6M A;  4WSG A;  4BHB A;  2EMA A;  2YTF A;  1Z0G A;  4ZYG A;  4NXM I;  4OX9 I;  2Q8U A;  2JEB A;  1E3H A;  4LF5 I;  3B8H A;  5DRP A;  5KL4 A;  2EM9 A;  3PS2 A;  4IZJ A;  2BB8 A;  4GKJ E;  4BA2 A;  3C4T A;  4NZV A;  1YYK A;  4WUB A;  1Z0W A;  2EN3 A;  3GCM A;  5KL6 A;  1UDO A;  1IBL E;  1BBO A;  1MG7 A;  1RRE A;  2IOP A;  3THO B;  3H1C A;  5IV8 B;  4R8O A;  3RMP A;  2IES A;  2V86 A;  4DV7 I;  2ZM6 I;  2CTD A;  2YTG A;  2ENH A;  2O1V A;  3J81 Q;  2E5L E;  2VRD A;  2WNR A;  2BA1 G;  4OO1 D;  3IWC A;  2ZBK B;  4DV6 E;  1I94 I;  2JYA A;  4F2J C;  2EQ1 A;  5A6J A;  2YZT A;  4YHH E;  4LCH A;  4LF9 I;  4MLV A;  1WHQ A;  1Z59 A;  2EM8 A;  5IT9 C;  1ZAA C;  2EOI A;  2IER A;  2PO1 A;  2X36 A;  2B9D A;  3WU6 A;  2L3J A;  1OYP A;  4FW4 A;  4JI0 I;  1SR9 A;  3ZZ0 A;  4M0V A;  4OZE A;  2EOO A;  2EM7 A;  2LJH A;  2NAB A;  2R76 A;  1Y6Z A;  1LLM C;  2C37 B;  2WP8 A;  2F4V I;  2DGC A;  2ODR C;  2HHH E;  1YHC A;  2EOS A;  2MDR A;  5TSE A;  4O24 A;  1ZR9 A;  1J5E I;  4DUZ I;  1N33 I;  2NA2 A;  4LFA E;  2BR2 B;  4J3D A;  2I13 A;  4F6N A;  2BM1 A;  2EE8 A;  2JVA A;  3PYF A;  4Z7Y A;  4K0K I;  1RHY A;  1YH8 A;  1GTK A;  3BGH A;  2GS8 A;  4LF8 E;  4WXD A;  4JG4 A;  4JI7 I;  2FTX B;  3ADI A;  2YTN A;  3LML A;  1B62 A;  5KL7 A;  4IFD E;  5DNY A;  4X62 E;  2VQE E;  1HR0 E;  1FJG I;  5A6A A;  1WXR A;  4J8Z A;  4ZYD A;  4QNJ A;  4DR3 I;  2C38 B;  3CWV A;  1IBK E;  3U1K A;  2LJP A;  4R2A A;  4BS9 A;  4OO1 A;  2RSM A;  2KHX A;  2B7T A;  4FW5 A;  4DPY A;  3DD6 A;  4YY3 I;  2I9I A;  4HTG A;  4KWY A;  3JTZ A;  5FLX C;  4B3M E;  1B63 A;  4PRX A;  3WU4 A;  1AAY A;  1A1J A;  1IQO A;  5FWK A;  3EPL A;  2PO2 A;  3KZY A;  4DV0 E;  3P3E A;  3VHT B;  3KWR A;  1KJK A;  2YRM A;  1DGC A;  1S16 A;  4Z7C A;  3T1H I;  1A6F A;  2D9H A;  2LV2 A;  5ADZ A;  3ADG A;  5AAS A;  1UEK A;  4URL A;  3M99 B;  3THN A;  2V2V A;  4B3S I;  4IZK B;  2MC5 A;  4R2Q A;  1YYO A;  4HAC B;  1PDA A;  2CPN A;  3H4L A;  4DXL A;  3T1Y E;  1BB8 A;  5A2Q C;  5LMU E;  3ZKD A; 
#chains in the Genus database with same CATH homology
 1ZBQ A;  3F6H A;  3OTO I;  3J7Y p;  4X8W A;  1NHH A;  4KZS A;  4JYA I;  2YT4 A;  2CGE A;  4FWD A;  4F54 A;  2HFS A;  4DR2 I;  2HFU A;  4B3R I;  4JI4 E;  2L2N A;  2RTX A;  3ZOQ B;  4BCA A;  4WPY A;  1H7S A;  3PRY A;  3ZM7 A;  4KQV A;  4DV1 E;  4M2Z A;  1STU A;  4ED4 A;  4JI1 E;  4HYM A;  2JWO A;  4TUG A;  2O1U A;  4P7D A;  2DIX A;  3LLH A;  1Z0T A;  1FWL A;  2M4I A;  1XHK A;  1N32 E;  3QT6 A;  1USU A;  4X65 I;  4DR4 I;  1O0W A;  1XMQ I;  4DR6 E;  2DSY A;  5FLX Q;  2UUC E;  5AE1 A;  2UXD E;  4DR5 I;  5L3J A;  3HJC A;  1YZ9 A;  4I8O A;  1DAR A;  1Y4U A;  2UU9 I;  5BR8 I;  2H36 X;  3K85 A;  1ZM2 A;  3LTO A;  5IWA I;  3ZKB A;  3LPS A;  2KON A;  2EZ6 A;  4X64 I;  4DV5 I;  1OJ4 A;  4LFB E;  4JI8 E;  4X66 I;  2V88 A;  1Z0E A;  2UUB I;  4JV5 I;  2DEJ A;  4AQY I;  3VK6 A;  2UUA I;  4DPW A;  2Z5C B;  3F0N A;  2VQF I;  5A2Q Q;  4DV3 I;  1XNR I;  2L8T A;  1IBM E;  2NUG A;  2UXB E;  4P7A A;  4DU8 A;  2F8B A;  1H72 C;  1Z5B A;  4L5N C;  1N34 I;  1GZ6 A;  1N0V C;  4DR7 E;  2CG9 A;  2BV3 A;  4NXM E;  4LF5 E;  2Q2E B;  5GME A;  2LMZ A;  2JY9 A;  2R42 A;  2KOU A;  1KVK A;  2V34 A;  4FWG A;  4GKJ I;  2CZ9 A;  4WSP A;  1XNQ E;  1ZM4 A;  4UT4 A;  1IBL I;  3HXL A;  4DR1 E;  1XMO I;  2V8Q B;  2V2Z A;  2RS7 A;  5CFF E;  1I94 E;  4M1K A;  3B82 A;  4LF6 I;  2J7K A;  4LF9 E;  4DV6 I;  3FIG A;  4LFC I;  1NHJ A;  2V2Q A;  5F3W A;  5AE3 A;  2LBS B;  4JI0 E;  4LF4 E;  1WUU A;  1HNW E;  2XEX A;  2Z5B A;  2F4V E;  1PVG A;  4PU9 A;  1J5E E;  4DUZ E;  4JI2 I;  4K0K E;  1Z0C A;  4GEQ B;  1T4N A;  4P52 A;  2JOB A;  4JI5 E;  1NHI A;  1DI2 A;  3P1X A;  4DU7 A;  1FJG E;  4DV4 I;  4DR3 E;  3DJW A;  4XTJ A;  2DMY A;  1BKN A;  2IOQ A;  4JI6 E;  4M30 A;  4YY3 E;  3PYG A;  4WFT A;  5T6J A;  2L92 A;  4B3M I;  3VYY A;  5LMN I;  1KIJ A;  3T1H E;  4WUC A;  4P78 A;  2M7Q A;  2LTS A;  1K47 A;  2L2M A;  3PYD A;  4B3T I;  3PYE A;  3QT8 A;  3K6Q A;  4LU9 A;  1Z5C A;  3Q6N A;  3OTO E;  2UXC I;  4JYA E;  2PNM A;  2A2C A;  4DUY E;  2L2K B;  2JOX A;  4WYQ B;  4BMJ A;  1RC7 A;  2JR1 A;  2FV4 B;  4I3H A;  1PKP A;  2V85 A;  4DR2 E;  2V87 A;  4LF7 I;  4UTG A;  4B3R E;  2IHR 1;  3Q1Q A;  4GKK I;  3QT5 A;  2V89 A;  1ELO A;  4JI4 I;  2R3V A;  4USM A;  2ZIT A;  3HQ1 A;  4F9A B;  1J26 A;  1WHN A;  1KKH A;  4JI3 I;  4NXN E;  1HNX E;  4DPU A;  1Z0V A;  1HNZ I;  1ZBT A;  1PIE A;  4X65 E;  4HXZ A;  4DR4 E;  1EKZ A;  1XMQ E;  1H74 A;  2NUE A;  1ZM9 A;  1RR9 A;  3J7A G;  2HKE A;  2N3H A;  3HTX A;  2UXD I;  1UHZ A;  4KHP E;  3QT7 A;  5BR8 E;  2X7I A;  4WUD A;  4IZK A;  5IWA E;  4HAC A;  4OOG C;  4DV2 I;  4Q28 A;  4X66 E;  2WZO A;  2UUB E;  4AQY E;  4FWH A;  1N36 I;  2UUA E;  2V8P A;  3DF6 A;  4DV3 E;  4OX9 E;  1XNR E;  1Y4S A;  4F9B B;  3JAM Q;  1FI4 A;  1H73 A;  2Z5E A;  2UXB I;  1N34 E;  2LE2 A;  2FGG A;  2LRS A;  4DR7 I;  2DB2 A;  1X49 A;  2VE7 C;  4DV7 E;  4EMD A;  2ZM6 E;  4USK A;  3JU0 A;  4TUI A;  1S4E A;  1EI1 A;  4DKK A;  2E5L I;  1MU5 A;  2RS6 A;  2EFG A;  1XMO E;  4YHH I;  1XNQ I;  1ZXM A;  1YYW A;  4BC7 A;  3ZZT A;  1N0U A;  4DR1 I;  3AUZ A;  4BC9 A;  2LUP B;  4LF6 E;  2GQ0 A;  4L8N A;  3ADJ A;  2B7V A;  5AE2 A;  2O1W A;  4LFC E;  3LNU A;  3MSW A;  3Q6M A;  2HHH I;  1N33 E;  4LFA I;  4JI7 E;  1H7U A;  4LF4 I;  2HK3 A;  1HNW I;  1EA6 A;  4R1F A;  3ADL A;  4LF8 I;  4JI2 E;  4DPT A;  3M6A A;  2Z5C A;  1VIS A;  4FW9 A;  4X62 I;  2VQE I;  1HR0 I;  1IBK I;  2VF3 A;  4DV4 E;  4MYU A;  4JI5 I;  1T4O A;  1ZM3 A;  4N3O A;  4F9C B;  3J80 Q;  3J7A M;  3H09 A;  1X47 A;  3K17 A;  2O1T A;  4JI6 I;  4DV0 I;  4LTY A;  2WW4 A;  3HUL A;  4BBY A;  4ZVI A;  4B3S E;  2L3C A;  1FKA E;  5LMN E;  1D6T A;  2MC6 A;  4HY1 A;  1DQ3 A;  5LL6 R;  3JAM C;  1FWK A;  3ZZU A;  2E1R A;  1X48 A;  3T1Y I;  5LMU I;  3VYX A;  3B78 A;  2VF1 A;  4B3T E;  2BM0 A;  2K4V A;  1QZR A;  2L33 A;  1KTV A;  3V2U C;  2UXC E;  5GMD A;  2HKJ A;  5IT9 Q;  4IZJ B;  3P06 A;  3D4J A;  1MX0 A;  1GQE A;  4DUY I;  1T4L B;  4LF7 E;  2EWL A;  2LUQ A;  3V5R A;  4DV1 I;  1UIL A;  2N3G A;  4GKK E;  2DEI A;  4PRV A;  3K1J A;  1FNM A;  2AJ4 A;  3J81 C;  1Z0B A;  3IWD A;  3OML A;  3IWB A;  4JI1 I;  3F6G A;  2G7H A;  4JI3 E;  2E1M A;  2A2D A;  3HPS A;  4R03 A;  1N32 I;  4NXN I;  1HNX I;  1RQ0 A;  1HK7 A;  1HNZ E;  3GON A;  4IZJ D;  2NUF A;  3WU5 A;  1QU6 A;  4DR6 I;  4DR5 E;  4DPX A;  3AV0 A;  2UUC I;  2UU9 E;  4DMI A;  2OI2 A;  4FN5 A;  4DV5 E;  2B3T B;  4X64 E;  2M1S A;  1ZXN A;  2Z5B B;  4MYT A;  3HPZ A;  2HK2 A;  4JV5 E;  2NPF A;  4JI8 I;  4LFB I;  2LTR A;  2VQF E;  3WU3 A;  3C4B A;  4DV2 E;  4KHP I;  2PNL A;  1USV A;  4RPF A;  2ODR D;  3J80 C;  1Z5A A;  1IBM I;  1U2R A;  1N36 E;  2V83 A;  1NZ0 A;  2L6M A;  1Z0G A;  4NXM I;  4OX9 I;  4LF5 I;  3B8H A;  4IZJ A;  4GKJ E;  3C4T A;  1YYK A;  4WUB A;  1Z0W A;  1IBL E;  1MG7 A;  1RRE A;  2IOP A;  4R8O A;  3RMP A;  4DV7 I;  2V86 A;  2ZM6 I;  2O1V A;  3J81 Q;  2E5L E;  3IWC A;  2ZBK B;  4DV6 E;  1I94 I;  2YZT A;  4YHH E;  4LF9 I;  1WHQ A;  1Z59 A;  5IT9 C;  2X36 A;  2B9D A;  3WU6 A;  2L3J A;  4JI0 I;  1SR9 A;  3ZZ0 A;  4M0V A;  2LJH A;  1Y6Z A;  2F4V I;  2ODR C;  2HHH E;  2MDR A;  1J5E I;  4DUZ I;  1N33 I;  2NA2 A;  4LFA E;  4Z7Y A;  4K0K I;  2BM1 A;  2JVA A;  3PYF A;  2GS8 A;  4LF8 E;  4JG4 A;  4JI7 I;  2FTX B;  3ADI A;  3LML A;  1B62 A;  5DNY A;  4X62 E;  2VQE E;  1HR0 E;  1FJG I;  1WXR A;  4J8Z A;  4DR3 I;  3CWV A;  1IBK E;  2LJP A;  4BS9 A;  2RSM A;  2KHX A;  2B7T A;  4DPY A;  4YY3 I;  5FLX C;  3JTZ A;  1B63 A;  4B3M E;  4PRX A;  3WU4 A;  5FWK A;  4DV0 E;  3KWR A;  1S16 A;  4Z7C A;  3T1H I;  1A6F A;  1UEK A;  5ADZ A;  3ADG A;  5AAS A;  4URL A;  2V2V A;  4B3S I;  4IZK B;  2MC5 A;  1YYO A;  4HAC B;  2CPN A;  3H4L A;  4DXL A;  3T1Y E;  5A2Q C;  5LMU E;  3ZKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...