4JI1E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4ji1E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji1E02
4DV0E 1IBKE 4WUBA 4DV6E 1EI1A 2RS7A 2NUFA 2UXBE 4JI6E 2V2QA 3J7AG 4B3SE 2UXDI 2X36A 2L2MA 1VISA 3B8HA 2V34A 4DV4I 3J80C 2HFUA 2BM1A 4B3RE 3WU4A 1FWLA 4LF6E 2UXCI 1RC7A 1N32I 1Z5BA 2UU9I 4JI4I 4LFBE 3WU5A 1HNWI 4YHHI 2N3GA 4JYAE 1HR0E 1ZM9A 4DR2E 4JI7E 1Z0BA 4JI1I 1S16A 4P7AA 1Z0GA 4JI8I 1NHJA 4FWGA 4B3TE 2V2ZA 4DV0I 3C4BA 3T1YE 4OX9E 2A2CA 2V8PA 1IBKI 1Z0EA 2UXBI 4JI6I 1K47A 5IT9C 2YT4A 4NXME 2RS6A 4B3SI 4X8WA 4M2ZA 5A2QC 1UHZA 1UEKA 3Q1QA 4B3RI 3ADLA 3J81C 4X62E 1PIEA 4DXLA 4LF6I 4LF7E 2EFGA 3LPSA 4LFBI 1FI4A 1B63A 4JYAI 1U2RA 1PKPA 1HR0I 2GS8A 4DR2I 3ADJA 3GONA 1B62A 4JI7I 4X64E 1YYWA 4DUZE 3LLHA 4HY1A 1O0WA 4B3TI 1WHQA 3T1YI 4OX9I 2JVAA 2B7TA 1S4EA 2LJPA 5LMNE 3ZZUA 1X49A 2F4VE 2Q2EB 4NXMI 2LJHA 4JV5E 3JAMQ 4DU8A 1ELOA 2HKJA 4LF8E 4LF4E 3T1HE 4DV5E 1WHNA 1FNMA 3F0NA 2N3HA 2L33A 4X62I 2KHXA 1MU5A 3B78A 4LF7I 4DR6E 1QU6A 2L2NA 1YYKA 1HNZE 2HHHE 2BM0A 1XNQE 3PYGA 4I3HA 4DV2E 1UILA 5FLXQ 3OTOI 2NUGA 4LF5E 4X64I 2NUEA 2UUCE 1DI2A 4DUYE 4DUZI 1XMQE 1ZM4A 4UTGA 1EKZA 2HK2A 4DPWA 1J26A 4KHPE 5LMNI 2F4VI 3ZZTA 5LMUE 1Z5CA 2R42A 4DR5E 2RTXA 4JV5I 4DV1E 4DKKA 4LF8I 4WYQB 4LF4I 3T1HI 2LRSA 4DV5I 4URLA 4HYMA 1PVGA 3V2UC 2VQEE 1A6FA 1STUA 4HACA 4NXNE 3VYYA 2DEIA 5BR8E 4WUDA 5GMEA 2DMYA 1KKHA 4DR6I 2E1RA 2ZM6E 1Z59A 2X7IA 2JY9A 4X65E 4DV6I 1HNZI 2HHHI 5LL6R 3M6AA 1Z0WA 4DR1E 3J81Q 3D4JA 1XNQI 4XTJA 1MG7A 1GQEA 4DV2I 4LF5I 1BKNA 4UT4A 2B7VA 2UUCI 1IBME 4DUYI 4DV3E 1XMQI 3HTXA 4USKA 4DU7A 1KIJA 4KHPI 5IWAE 3PYEA 1XNRE 1N33E 5LMUI 4FWHA 1H7SA 2J7KA 1NZ0A 4DR5I 1RQ0A 4DV1I 4YY3E 1YYOA 2E5LE 1ZM3A 1N34E 1KVKA 4LF9E 2VQEI 4NXNI 3WU3A 2UUBE 3CWVA 3B82A 3QT5A 5BR8I 2EZ6A 1HNXE 2LTSA 2V2VA 3P1XA 3ZKDA 2ZM6I 4X65I 4JI3E 2B3TB 4DR1I 1DARA 4LFCE 1N36E 2CZ9A 2UUAE 4HACB 2VQFE 1IBMI 4DV3I 2LBSB 4DR3E 1Z0TA 1QZRA 1Z0VA 4PRXA 3J7AM 5IWAI 2L3CA 4GKKE 1XNRI 1N33I 1ZXMA 2RSMA 4USMA 4JI0E 4LFAE 4P52A 2DIXA 4K0KE 3J80Q 4DV7E 4YY3I 2E5LI 1N34I 3H4LA 4LF9I 4X66E 2LTRA 1H72C 2BV3A 2HFSA 1N0VC 2UUBI 4ED4A 1OJ4A 5CFFE 1Z5AA 4M1KA 1D6TA 3VYXA 2ZBKB 4PRVA 3J7Yp 4JI3I 1FKAE 1I94E 3C4TA 3QT6A 3ZZ0A 2LUPB 1Z0CA 4LFCI 1N36I 1IBLE 1T4OA 2UUAI 2L3JA 4JG4A 2HK3A 4HXZA 4MYUA 2VQFI 4MYTA 2DB2A 4Z7YA 4DR3I 3ZM7A 3V5RA 5FLXC 5GMDA 1ZBTA 5IT9Q 3QT8A 4GKKI 4JI2E 4DPUA 5A2QQ 4AQYE 4JI0I 4LFAI 4K0KI 1H7UA 1X47A 4DV7I 3QT7A 2AJ4A 4DR4E 4FN5A 1ZXNA 4X66I 1T4LB 4JI5E 2R3VA 4DPTA 4ZVIA 4FW9A 4DR7E 1NHHA 1YZ9A 4DPXA 1XHKA 4EMDA 4RPFA 1MX0A 1FJGE 3ADGA 1ZM2A 1I94I 1J5EE 2MDRA 3K1JA 4WUCA 2NPFA 2DEJA 2L2KB 1H74A 1T4NA 2VF3A 4B3ME 1RREA 3LTOA 1IBLI 2NA2A 1KTVA 4DPYA 4WFTA 4GKJE 1RR9A 2CPNA 1X48A 1XMOE 4JI2I 4AQYI 2LUQA 1H73A 1WUUA 1EA6A 1NHIA 4M30A 4DR4I 3LNUA 4R1FA 2UXDE 3PYFA 2XEXA 4JI5I 3OTOE 1N0UA 4DV4E 1FWKA 4FWDA 2A2DA 4KQVA 4DR7I 4OOGC 2HKEA 1FJGI 1J5EI 2ZITA 2WW4A 2UXCE 2IHR1 1N32E 3ZKBA 2UU9E 4JI4E 5L3JA 3WU6A 4B3MI 1HNWE 4YHHE 4GKJI 4Z7CA 3HULA 4JI1E 3ADIA 3PYDA 3JAMC 4PU9A 1XMOI 2OI2A 3K17A 4JI8E 1HNXI
chains in the Genus database with same CATH superfamily
5JEAA 2EOJA 4DV0E 1IBKE 4WUBA 4DV6E 2LVHA 1EI1A 2EN1A 2RS7A 5A6AA 5DRQA 2NUFA 2UXBE 1IQOA 2WCC3 1WRJA 4JI6E 3J7AG 2V2QA 2UXCI 2YU8A 5ADZA 2Q8UA 2BR2A 4MU0A 4B3SE 2UXDI 2LE2A 2X36A 2L2MA 1VISA 3B8HA 2YU5A 2V34A 4DV4I 3J80C 5A6BD 2JPAA 2HFUA 2Z5CB 2YZTA 2BM1A 4B3RE 1LLMC 1EH8A 3WU4A 2FGGA 4NHRA 2JEBB 2EM6A 1FWLA 2EPZA 4MU4A 1G2DC 2V86A 4LF6E 1QNTA 5AE2A 1RC7A 5C0XF 2EM9A 2Z5EA 1N32I 5DRRA 1Z5BA 2UU9I 4JI4I 5IV8B 1RMDA 5C0XA 4LFBE 4FW6A 3WU5A 1HNWI 4YHHI 2L6MA 2EOXA 2N3GA 4JYAE 1AH5A 5LLQA 3KZZA 4R03A 2EPKX 3TQMA 1HR0E 1ZM9A 2EN3A 4DR2E 1JK1A 2KOUA 3P06A 4JI7E 2YTDA 1Z0BA 4JI1I 1S16A 3MHSC 5AE1A 4O24A 1DGCA 4P7AA 1Z0GA 2E1MA 1UDSA 3PS3A 4JI8I 3PS2A 5KL4A 3VK6A 1MEYC 1NHJA 4B3TE 2V2ZA 3DD6A 4FWGA 4BA2B 4OO1F 4DV0I 3C4BA 3T1YE 4OX9E 2A2CA 2V8PA 2EMIA 1JK2A 1IBKI 2EOHA 1Z0EA 2CT1A 1BB8A 4OO1A 2BB8A 3EPLA 1TF6A 1ZAAC 2BA0G 2MKNA 1F2IG 2UXBI 4JI6I 3M7NG 2EPOA 1K47A 5IT9C 1SR9A 2YT4A 4NXME 2RS6A 5AE3A 4X8WA 2C38A 4B3SI 4N4RB 4M2ZA 5A2QC 4AIMA 1UHZA 3BIDA 1KYQA 2EMCA 4ZYGA 1UEKA 2YTJA 4IFDE 3GMEA 2PRTA 1R6MA 3Q1QA 4B3RI 2LCEA 3J81C 3ADLA 2GO4A 2EOIA 4IFDF 4X62E 2R1FA 4LCGA 5T6JA 4R2EA 4BMJA 1PIEA 4DXLA 2JP9A 4BBYA 4IFDD 2HJJA 2EMXA 2M4IA 2EMGA 4LF7E 2RPCA 5ELWA 4LF6I 3BGHA 2GPIA 2EFGA 3F6GA 1UN6B 3LPSA 2PO0B 4LFBI 2EM8A 1B63A 1FI4A 2C37A 2EOOA 4BHCA 2EOFA 4JYAI 3MHHC 2IESA 2L92A 3QG5C 1PKPA 1U2RA 2GS8A 3B4TA 4DR2I 1HR0I 1TF3A 3ADJA 3GONA 2DLKA 3AUZA 1B62A 4JI7I 4X64E 2EQ3A 1YYWA 4BA1A 2JR1A 4MU1A 4IZJA 5AC4A 4FK5C 1DQ3A 4R2AA 4U3DA 4DUZE 3LLHA 4HY1A 1O0WA 2WBTA 2NN6F 2RQLA 1WHQA 4GZNC 4B3TI 2EN7A 3T1YI 4OX9I 2JVAA 1BBGA 1X3CA 1USVA 3THOB 2NN6A 2B7TA 1S4EA 3K85A 2LJPA 5LMNE 4MU3A 1X49A 2F4VE 3ZZUA 2Q2EB 4HTGA 2B9DA 3DF6A 2YSOA 3P3GA 4NXMI 2V83A 1A1HA 3P3EA 2WBUA 4LF4I 4ZYDA 2LJHA 4JV5E 3JAMQ 4P7DA 1KJKA 4DU8A 1ELOA 2HKJA 4LF8E 4LF4E 4BC7A 5DROA 3T1HE 4DV5E 5F3WA 1WHNA 4F2JC 1FNMA 3F0NA 2N3HA 2L33A 2N8XA 2ODRC 2JE6A 4X62I 4RHBB 2RSIA 4IZKB 2KHXA 1MU5A 3B78A 3L7ZB 4LF7I 4DR6E 1QU6A 2L2NA 1YYKA 1NCSA 5K36C 2J65A 1HNZE 3H1CA 2WP8A 3EPKA 2HHHE 2EPMX 2BM0A 2V8QB 4ZYEA 4N3OA 1XNQE 3PYGA 4I3HA 1MGTA 4DV2E 4LOMA 1UILA 5FLXQ 1G2FC 2NUGA 3OTOI 4LF5E 5DNLA 4X64I 3P3CA 2NUEA 5A6BA 2UUCE 2O1WA 2F1DA 4MDTA 1DI2A 4DUYE 5EKWA 4DUZI 4IS9A 1XMQE 5TSEA 1ZM4A 4UTGA 1EKZA 2V85A 4GKJI 2HK2A 2YTGA 5JEAC 1X5WA 4DPWA 2M9AA 1J26A 4KHPE 3CDIA 5AASA 5LMNI 2F4VI 2EMFA 3ZZTA 2JXPA 3ECRA 5LMUE 2PO1B 4NBQA 1Z5CA 2FV4B 2VESA 2R42A 2EQ1A 5IXMB 4WSPA 4DR5E 4BHBA 2O1TA 2RTXA 4JV5I 2EM5A 4DV1E 4DKKA 1E3HA 4WYQB 4BA1B 4MLVA 4IZJB 4MQYA 4FW4A 2YRHA 2LRSA 4DV5I 3T1HI 4URLA 4HYMA 1BBOA 2WNRA 1PVGA 3LMLA 1A1FA 1XXEA 2VQEE 3V2UC 1X6FA 3ZOQB 3K6QA 1A6FA 2EE8A 1STUA 4KZSA 4HACA 4NXNE 1PJTA 2EMHA 3VYYA 3MSWA 2DEIA 2YWQA 5BR8E 2ADRA 4WUDA 2DLQA 5GMEA 2DMYA 1KKHA 2BA0D 4DR6I 3GLLA 1PDAA 1EH7A 2ZM6E 1Z59A 2E1RA 2IERA 2JY9A 2X7IA 4X65E 1Y60A 3M7ND 5K36B 2IOPA 5C0XC 4DV6I 1Z1BA 1HNZI 4L5NC 2HHHI 5LL6R 4NZVA 1Z0WA 2DMIA 4R2CA 3M6AA 2EN2A 2C39A 1USUA 4QNJA 5KL3A 4DR1E 3J81Q 3D4JA 3L00A 1XNQI 4XTJA 4F9CB 1MG7A 2EMLA 4WSGA 2JWOA 1GQEA 2CGEA 3PRYA 4DV2I 4AM3A 2EL5A 4LF5I 1BKNA 4UT4A 2B7VA 2EM2A 2L8TA 2UUCI 2YTOA 1VI7A 1IBME 4DUYI 2EN4A 4DV3E 1XMQI 3U1KA 1AAYA 3HTXA 4USKA 1PJQA 5KL5A 4DU7A 1A1JA 5JEAB 4ISAA 1KIJA 2PNLA 3Q6MA 2JEAA 4KHPI 4IFDA 2WP8B 4OO1C 4R2PA 5IWAE 2G7HA 2ELZA 2MC6A 2NABA 1YFHA 1XNRE 1N33E 3PYEA 4FWHA 5LMUI 1H7SA 2J7KA 2BR2B 2EMKA 1NZ0A 5AC5A 2WZOA 4DR5I 2Z5BA 3C6MA 4P78A 1RQ0A 4DV1I 3HQ1A 2J7JA 4YY3E 1YYOA 1B69A 2E5LE 1N34E 2EMYA 1ZM3A 2ENCA 2EOYA 2ENAA 4LF9E 1KVKA 5FWKA 2K7IA 4R2SA 2AE8A 2VQEI 3IWDA 4LCHA 1ZR9A 4NXNI 3WU3A 2UUBE 3CWVA 3B82A 3QT5A 5BR8I 2EMAA 2Z5CA 4M0VA 2EZ6A 1HNXE 2E72A 2LTSA 2V2VA 2YTPA 3P1XA 3ZKDA 2ZM6I 4X65I 5C0XB 3M85G 1TN9A 2EJ4A 4JI3E 4RH8A 2CVEA 4FW3A 2MKDA 3M99B 2B3TB 2EPXA 3RMPA 4DR1I 1DARA 3U1YA 2YSPA 2JOBA 4L8NA 2GLIA 4LFCE 2CG9A 1N36E 2WNRB 2EWLA 3HXLA 2M1SA 2CZ9A 2EN6A 2EL4A 3EQ1A 2UUAE 4R2DA 4HACB 2LV2A 1IMUA 2VQFE 1IBMI 4DV3I 2LBSB 4DR3E 2EPNA 1Z0TA 1QZRA 1Z0VA 2ODRD 4PRXA 3J7AM 4FW7A 1E3PA 2KONA 2NN6C 4OO1B 2VF1A 5IWAI 2L3CA 2EPCA 1R6LA 1GTKA 4GKKE 1IQSA 3HPSA 2C39B 1XNRI 4BA2A 1N33I 4O43A 2BA1G 1ZXMA 4R2QA 2C38B 2RSMA 4O4KA 4USMA 4JI0E 4LFAE 4P52A 2DIXA 4BC9A 4K0KE 3J80Q 3NZKA 4DV7E 2DRPA 4YY3I 2E5LI 4O5GA 1N34I 3H4LA 1SFEA 4U3BA 3HKMA 4LF9I 2BBGA 4X66E 2VRDA 1NEIA 2EOZA 4TUGA 2PNZA 2LJUA 1YHCA 2H36X 2LTRA 5JEAE 1H72C 2BV3A 2HFSA 4FW5A 1N0VC 2UUBI 4GQUA 2EMWA 2YTFA 4IFDB 4WXDA 1OYRA 2I9IA 2EOEA 4ED4A 4LF8I 1OJ4A 4I8OA 1YSAC 5CFFE 1Z5AA 2O1UA 4M1KA 1D6TA 3VYXA 2ZBKB 1YPNA 2LO3A 4PRVA 5A69A 1UDOA 2Z5BB 5JEAD 3J7Yp 4JI3I 1FKAE 2C37B 2HC5A 1I94E 3C4TA 3QT6A 1OYPA 3ZZ0A 5A6JA 2LUPB 1Z0CA 2A25A 4LFCI 1N36I 3CDJA 4BS9A 2VE7C 2EMZA 2PO0A 1IBLE 1T4OA 2UUAI 2D9HA 2L3JA 4WX9A 2V88A 5KL6A 4JG4A 2HK3A 3Q6NA 4HXZA 4MYUA 2VQFI 3KZYA 4X9JA 2CTDA 4MYTA 1Y5YA 2DB2A 4Z7YA 1GZ6A 3IWCA 4DR3I 3ZM7A 3VHTB 4J3DA 3V5RA 5C0XE 5FLXC 2NN6B 3FIGA 5GMDA 1ZBTA 5IT9Q 3P76A 3QT8A 4GKKI 4R8OA 3KWRA 4JI2E 3BF2A 4DPUA 5A2QQ 1T38A 4AQYE 2YTNA 2ENHA 2EPLX 4JI0I 4LFAI 5C0XD 2YTEA 4K0KI 1H7UA 1X47A 1Y4SA 2YRKA 2O3ZA 4DV7I 2EN8A 4KWYA 3QT7A 3JTZA 2AJ4A 4DR4E 4IS1C 4FN5A 1ZXNA 2YPNA 2ELYA 4X66I 2PNMA 1A1KA 2YTIA 2LT7A 1A1GA 1T4LB 4JI5E 2JE6B 2DGCA 1N3GA 2R3VA 4DPTA 5A6KA 4ZVIA 2EM7A 2EOSA 4F6NA 3GCMA 4OO1E 5DNXA 1P42A 2EQ0A 2EPAA 3HJCA 4FW9A 1EH6A 4DR7E 1NHHA 2PO2A 1YZ9A 4DPXA 4ZYHA 1XHKA 4EMDA 4IJDA 4RPFA 4WPYA 5KL7A 1MX0A 3C6KA 2IOQA 3UHMA 3KRNA 1FJGE 3ADGA 1UDQA 1ZM2A 4R2RA 4IZKA 1I94I 3F6HA 1J5EE 4OO1D 4F9BB 2MDRA 3K1JA 4WUCA 1PJSA 3L7ZA 2NPFA 2DEJA 2L2KB 3AV0A 4GEQB 5DNYA 1H74A 1T4NA 1ZU1A 2EM0A 2O1VA 4B3ME 1RREA 2VF3A 3LTOA 2LMZA 2PNZB 1IBLI 2EORA 2GQ0A 2NA2A 1KTVA 1RHYA 4DPYA 4WFTA 1HK7A 1X6EA 2EL6A 2YTQA 4WXCA 2EMBA 4GKJE 4OKGA 1RR9A 2CPNA 3EPJA 1X48A 3PS1A 4IFDC 1XMOE 4Q35B 3M85D 2DSYA 4BCAA 1WXRA 2YRMA 4J8ZA 5DRPA 2K4VA 4HEIA 2EPUA 4JI2I 4TUIA 1X6HA 4OZEA 2JEBA 4AQYI 5KL2A 4LCFA 2LUQA 1H73A 4LU9A 1WUUA 4AIDA 1EA6A 3THNA 4QNKA 1NHIA 4M30A 4DR4I 2PO1A 3LNUA 4LPFA 2FTXB 2JOXA 4R1FA 2UXDE 3PYFA 2EPPA 1A1IA 2XEXA 4JI5I 3OTOE 1N0UA 2NN6E 4DV4E 1YH8A 1FWKA 4FWDA 2A2DA 4IZJD 1OYSA 4KQVA 5EL9A 4DR7I 2HGHA 1Y6ZA 1A1LA 2EPRA 5K36E 4MLQA 3IWBA 4OOGC 2BA1D 2HKEA 2MC5A 1FJGI 3BBGA 1UBDC 3OMLA 2NN6D 1J5EI 2ZITA 2WW4A 5K36F 2UXCE 2IHR1 3HPZA 1N32E 3ZKBA 4LTYA 2UU9E 2EM3A 1T39A 2R76A 4JI4E 1WJPA 5L3JA 3WU6A 5K36A 3H09A 1YUIA 4B3MI 5K36D 1HNWE 4YHHE 4DMIA 2JT2A 4F6MA 3EPHA 3UK3C 1Y4UA 2V89A 2PO2B 2JYAA 4Q28A 4F54A 4Z7CA 2EM4A 2CSHA 2V87A 1L4SA 3HULA 2EOQA 4JI1E 3ADIA 4M9VC 1ZBQA 3JAMC 2WBSA 1UDNA 2GHFA 3PYDA 4PU9A 2M7QA 2F8BA 2I13A 1XMOI 3DJWA 2JEAB 2OI2A 3K17A 4JI8E 5JEAF 1YUJA 4F9AB 2EOMA 1P47A 2GO3A 1HNXI 3JU0A 2MDGA 2EP3A
chains in the Genus database with same CATH topology
4DV0E 1IBKE 4WUBA 4DV6E 1EI1A 2RS7A 2NUFA 2UXBE 4JI6E 3J7AG 2V2QA 5ADZA 4B3SE 2UXDI 2LE2A 2X36A 2L2MA 1VISA 3B8HA 2V34A 4DV4I 3J80C 2HFUA 2Z5CB 2YZTA 2BM1A 4B3RE 3WU4A 2FGGA 1FWLA 2V86A 4LF6E 2UXCI 5AE2A 1RC7A 2Z5EA 1N32I 1Z5BA 2UU9I 4JI4I 4LFBE 3WU5A 1HNWI 4YHHI 2L6MA 2N3GA 4JYAE 4R03A 1HR0E 1ZM9A 4DR2E 2KOUA 3P06A 4JI7E 1Z0BA 4JI1I 1S16A 5AE1A 4P7AA 1Z0GA 2E1MA 4JI8I 1NHJA 3VK6A 4FWGA 4B3TE 2V2ZA 4DV0I 3C4BA 3T1YE 4OX9E 2A2CA 2V8PA 1IBKI 1Z0EA 2UXBI 4JI6I 1K47A 5IT9C 1SR9A 4NXME 2YT4A 2RS6A 5AE3A 4X8WA 4B3SI 4M2ZA 5A2QC 1UHZA 1UEKA 3Q1QA 4B3RI 3ADLA 3J81C 4X62E 5T6JA 4BMJA 1PIEA 4DXLA 4BBYA 4LF6I 2M4IA 4LF7E 2EFGA 3F6GA 3LPSA 4LFBI 1FI4A 1B63A 4JYAI 2L92A 1U2RA 1PKPA 1HR0I 2GS8A 4DR2I 3ADJA 3GONA 3AUZA 1B62A 4JI7I 4X64E 1YYWA 2JR1A 4IZJA 1DQ3A 4DUZE 3LLHA 4HY1A 1O0WA 4B3TI 1WHQA 3T1YI 4OX9I 2JVAA 1USVA 2B7TA 1S4EA 3K85A 2LJPA 5LMNE 3ZZUA 1X49A 2F4VE 2Q2EB 2B9DA 3DF6A 4NXMI 2V83A 2LJHA 4JV5E 3JAMQ 4P7DA 4DU8A 1ELOA 2HKJA 4LF8E 4LF4E 4BC7A 3T1HE 4DV5E 5F3WA 1WHNA 1FNMA 3F0NA 2N3HA 2L33A 2ODRC 4X62I 4IZKB 2KHXA 1MU5A 3B78A 4LF7I 4DR6E 1QU6A 2L2NA 1YYKA 1HNZE 2HHHE 2BM0A 2V8QB 4N3OA 1XNQE 3PYGA 4I3HA 4DV2E 1UILA 5FLXQ 3OTOI 2NUGA 4LF5E 4X64I 2NUEA 2UUCE 2O1WA 1DI2A 4DUYE 4DUZI 1XMQE 1ZM4A 4UTGA 1EKZA 2V85A 2HK2A 4DPWA 1J26A 4KHPE 5AASA 5LMNI 2F4VI 3ZZTA 5LMUE 1Z5CA 2FV4B 2R42A 4WSPA 4DR5E 2O1TA 2RTXA 4JV5I 4DV1E 4DKKA 4LF8I 4WYQB 4LF4I 4IZJB 3T1HI 2LRSA 4DV5I 4URLA 4HYMA 1PVGA 3LMLA 3V2UC 2VQEE 3ZOQB 3K6QA 1A6FA 1STUA 4KZSA 4HACA 4NXNE 3VYYA 3MSWA 2DEIA 5BR8E 4WUDA 5GMEA 2DMYA 1KKHA 4DR6I 2E1RA 2ZM6E 1Z59A 2X7IA 2JY9A 4X65E 2IOPA 4DV6I 1HNZI 4L5NC 2HHHI 5LL6R 3M6AA 1Z0WA 1USUA 4DR1E 3J81Q 3D4JA 1XNQI 4XTJA 4F9CB 1MG7A 2JWOA 1GQEA 2CGEA 3PRYA 4DV2I 4LF5I 1BKNA 4UT4A 2B7VA 2L8TA 2UUCI 1IBME 4DUYI 4DV3E 1XMQI 3HTXA 4USKA 4DU7A 1KIJA 2PNLA 3Q6MA 4KHPI 5IWAE 2G7HA 3PYEA 2MC6A 1XNRE 1N33E 5LMUI 4FWHA 1H7SA 2J7KA 1NZ0A 2WZOA 4DR5I 2Z5BA 4P78A 1RQ0A 4DV1I 3HQ1A 4YY3E 1YYOA 2E5LE 1ZM3A 1N34E 1KVKA 4LF9E 5FWKA 2VQEI 3IWDA 4NXNI 3WU3A 2UUBE 3CWVA 3B82A 3QT5A 5BR8I 2Z5CA 4M0VA 2EZ6A 1HNXE 2LTSA 2V2VA 3P1XA 3ZKDA 2ZM6I 4X65I 4JI3E 2B3TB 3RMPA 4DR1I 1DARA 2JOBA 4L8NA 4LFCE 2CG9A 1N36E 2EWLA 3HXLA 2M1SA 2CZ9A 2UUAE 4HACB 2VQFE 1IBMI 4DV3I 2LBSB 4DR3E 1Z0TA 1QZRA 1Z0VA 2ODRD 4PRXA 3J7AM 2KONA 2VF1A 5IWAI 2L3CA 4GKKE 1XNRI 3HPSA 1N33I 1ZXMA 2RSMA 4USMA 4JI0E 4LFAE 4P52A 2DIXA 4K0KE 4BC9A 3J80Q 4DV7E 4YY3I 2E5LI 1N34I 3H4LA 4LF9I 4X66E 4TUGA 2H36X 2LTRA 1H72C 2BV3A 2HFSA 1N0VC 2UUBI 4ED4A 1OJ4A 4I8OA 5CFFE 1Z5AA 2O1UA 4M1KA 1D6TA 3VYXA 2ZBKB 4PRVA 2Z5BB 3J7Yp 4JI3I 1FKAE 1I94E 3C4TA 3QT6A 3ZZ0A 2LUPB 1Z0CA 4LFCI 1N36I 4BS9A 2VE7C 1IBLE 1T4OA 2UUAI 2L3JA 4JG4A 2V88A 2HK3A 3Q6NA 4HXZA 4MYUA 2VQFI 4MYTA 2DB2A 4Z7YA 1GZ6A 3IWCA 4DR3I 3ZM7A 3V5RA 5FLXC 3FIGA 5GMDA 1ZBTA 5IT9Q 3QT8A 4GKKI 4R8OA 3KWRA 4JI2E 4DPUA 5A2QQ 4AQYE 4JI0I 4LFAI 4K0KI 1H7UA 1X47A 1Y4SA 4DV7I 3QT7A 3JTZA 2AJ4A 4DR4E 4FN5A 1ZXNA 4X66I 2PNMA 1T4LB 4JI5E 2R3VA 4DPTA 4ZVIA 3HJCA 4FW9A 4DR7E 1NHHA 1YZ9A 4DPXA 1XHKA 4EMDA 4RPFA 4WPYA 1MX0A 2IOQA 1FJGE 3ADGA 1ZM2A 4IZKA 1I94I 3F6HA 1J5EE 4F9BB 2MDRA 3K1JA 4WUCA 2NPFA 2DEJA 2L2KB 3AV0A 4GEQB 5DNYA 1H74A 1T4NA 2O1VA 4B3ME 1RREA 2VF3A 3LTOA 2LMZA 1IBLI 2GQ0A 2NA2A 1KTVA 4DPYA 4WFTA 1HK7A 4GKJE 1RR9A 2CPNA 1X48A 1XMOE 2DSYA 4BCAA 1WXRA 4J8ZA 2K4VA 4JI2I 4TUIA 4AQYI 2LUQA 1H73A 4LU9A 1WUUA 1EA6A 1NHIA 4M30A 4DR4I 3LNUA 2FTXB 2JOXA 4R1FA 2UXDE 3PYFA 2XEXA 4JI5I 3OTOE 1N0UA 4DV4E 1FWKA 4FWDA 2A2DA 4IZJD 4KQVA 4DR7I 1Y6ZA 3IWBA 4OOGC 2HKEA 2MC5A 1FJGI 3OMLA 1J5EI 2ZITA 2WW4A 2UXCE 2IHR1 3HPZA 1N32E 3ZKBA 4LTYA 2UU9E 4JI4E 5L3JA 3WU6A 3H09A 4B3MI 1HNWE 4YHHE 4DMIA 1Y4UA 2V89A 4GKJI 4Q28A 4F54A 4Z7CA 2V87A 3HULA 4JI1E 3ADIA 1ZBQA 3JAMC 3PYDA 4PU9A 2M7QA 2F8BA 1XMOI 3DJWA 2OI2A 3K17A 4JI8E 4F9AB 1HNXI 3JU0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV0 E;  1IBK E;  4WUB A;  4DV6 E;  1EI1 A;  2RS7 A;  2NUF A;  2UXB E;  4JI6 E;  2V2Q A;  3J7A G;  4B3S E;  2UXD I;  2X36 A;  2L2M A;  1VIS A;  3B8H A;  2V34 A;  4DV4 I;  3J80 C;  2HFU A;  2BM1 A;  4B3R E;  3WU4 A;  1FWL A;  4LF6 E;  2UXC I;  1RC7 A;  1N32 I;  1Z5B A;  2UU9 I;  4JI4 I;  4LFB E;  3WU5 A;  1HNW I;  4YHH I;  2N3G A;  4JYA E;  1HR0 E;  1ZM9 A;  4DR2 E;  4JI7 E;  1Z0B A;  4JI1 I;  1S16 A;  4P7A A;  1Z0G A;  4JI8 I;  1NHJ A;  4FWG A;  4B3T E;  2V2Z A;  4DV0 I;  3C4B A;  3T1Y E;  4OX9 E;  2A2C A;  2V8P A;  1IBK I;  1Z0E A;  2UXB I;  4JI6 I;  1K47 A;  5IT9 C;  2YT4 A;  4NXM E;  2RS6 A;  4B3S I;  4X8W A;  4M2Z A;  5A2Q C;  1UHZ A;  1UEK A;  3Q1Q A;  4B3R I;  3ADL A;  3J81 C;  4X62 E;  1PIE A;  4DXL A;  4LF6 I;  4LF7 E;  2EFG A;  3LPS A;  4LFB I;  1FI4 A;  1B63 A;  4JYA I;  1U2R A;  1PKP A;  1HR0 I;  2GS8 A;  4DR2 I;  3ADJ A;  3GON A;  1B62 A;  4JI7 I;  4X64 E;  1YYW A;  4DUZ E;  3LLH A;  4HY1 A;  1O0W A;  4B3T I;  1WHQ A;  3T1Y I;  4OX9 I;  2JVA A;  2B7T A;  1S4E A;  2LJP A;  5LMN E;  3ZZU A;  1X49 A;  2F4V E;  2Q2E B;  4NXM I;  2LJH A;  4JV5 E;  3JAM Q;  4DU8 A;  1ELO A;  2HKJ A;  4LF8 E;  4LF4 E;  3T1H E;  4DV5 E;  1WHN A;  1FNM A;  3F0N A;  2N3H A;  2L33 A;  4X62 I;  2KHX A;  1MU5 A;  3B78 A;  4LF7 I;  4DR6 E;  1QU6 A;  2L2N A;  1YYK A;  1HNZ E;  2HHH E;  2BM0 A;  1XNQ E;  3PYG A;  4I3H A;  4DV2 E;  1UIL A;  5FLX Q;  3OTO I;  2NUG A;  4LF5 E;  4X64 I;  2NUE A;  2UUC E;  1DI2 A;  4DUY E;  4DUZ I;  1XMQ E;  1ZM4 A;  4UTG A;  1EKZ A;  2HK2 A;  4DPW A;  1J26 A;  4KHP E;  5LMN I;  2F4V I;  3ZZT A;  5LMU E;  1Z5C A;  2R42 A;  4DR5 E;  2RTX A;  4JV5 I;  4DV1 E;  4DKK A;  4LF8 I;  4WYQ B;  4LF4 I;  3T1H I;  2LRS A;  4DV5 I;  4URL A;  4HYM A;  1PVG A;  3V2U C;  2VQE E;  1A6F A;  1STU A;  4HAC A;  4NXN E;  3VYY A;  2DEI A;  5BR8 E;  4WUD A;  5GME A;  2DMY A;  1KKH A;  4DR6 I;  2E1R A;  2ZM6 E;  1Z59 A;  2X7I A;  2JY9 A;  4X65 E;  4DV6 I;  1HNZ I;  2HHH I;  5LL6 R;  3M6A A;  1Z0W A;  4DR1 E;  3J81 Q;  3D4J A;  1XNQ I;  4XTJ A;  1MG7 A;  1GQE A;  4DV2 I;  4LF5 I;  1BKN A;  4UT4 A;  2B7V A;  2UUC I;  1IBM E;  4DUY I;  4DV3 E;  1XMQ I;  3HTX A;  4USK A;  4DU7 A;  1KIJ A;  4KHP I;  5IWA E;  3PYE A;  1XNR E;  1N33 E;  5LMU I;  4FWH A;  1H7S A;  2J7K A;  1NZ0 A;  4DR5 I;  1RQ0 A;  4DV1 I;  4YY3 E;  1YYO A;  2E5L E;  1ZM3 A;  1N34 E;  1KVK A;  4LF9 E;  2VQE I;  4NXN I;  3WU3 A;  2UUB E;  3CWV A;  3B82 A;  3QT5 A;  5BR8 I;  2EZ6 A;  1HNX E;  2LTS A;  2V2V A;  3P1X A;  3ZKD A;  2ZM6 I;  4X65 I;  4JI3 E;  2B3T B;  4DR1 I;  1DAR A;  4LFC E;  1N36 E;  2CZ9 A;  2UUA E;  4HAC B;  2VQF E;  1IBM I;  4DV3 I;  2LBS B;  4DR3 E;  1Z0T A;  1QZR A;  1Z0V A;  4PRX A;  3J7A M;  5IWA I;  2L3C A;  4GKK E;  1XNR I;  1N33 I;  1ZXM A;  2RSM A;  4USM A;  4JI0 E;  4LFA E;  4P52 A;  2DIX A;  4K0K E;  3J80 Q;  4DV7 E;  4YY3 I;  2E5L I;  1N34 I;  3H4L A;  4LF9 I;  4X66 E;  2LTR A;  1H72 C;  2BV3 A;  2HFS A;  1N0V C;  2UUB I;  4ED4 A;  1OJ4 A;  5CFF E;  1Z5A A;  4M1K A;  1D6T A;  3VYX A;  2ZBK B;  4PRV A;  3J7Y p;  4JI3 I;  1FKA E;  1I94 E;  3C4T A;  3QT6 A;  3ZZ0 A;  2LUP B;  1Z0C A;  4LFC I;  1N36 I;  1IBL E;  1T4O A;  2UUA I;  2L3J A;  4JG4 A;  2HK3 A;  4HXZ A;  4MYU A;  2VQF I;  4MYT A;  2DB2 A;  4Z7Y A;  4DR3 I;  3ZM7 A;  3V5R A;  5FLX C;  5GMD A;  1ZBT A;  5IT9 Q;  3QT8 A;  4GKK I;  4JI2 E;  4DPU A;  5A2Q Q;  4AQY E;  4JI0 I;  4LFA I;  4K0K I;  1H7U A;  1X47 A;  4DV7 I;  3QT7 A;  2AJ4 A;  4DR4 E;  4FN5 A;  1ZXN A;  4X66 I;  1T4L B;  4JI5 E;  2R3V A;  4DPT A;  4ZVI A;  4FW9 A;  4DR7 E;  1NHH A;  1YZ9 A;  4DPX A;  1XHK A;  4EMD A;  4RPF A;  1MX0 A;  1FJG E;  3ADG A;  1ZM2 A;  1I94 I;  1J5E E;  2MDR A;  3K1J A;  4WUC A;  2NPF A;  2DEJ A;  2L2K B;  1H74 A;  1T4N A;  2VF3 A;  4B3M E;  1RRE A;  3LTO A;  1IBL I;  2NA2 A;  1KTV A;  4DPY A;  4WFT A;  4GKJ E;  1RR9 A;  2CPN A;  1X48 A;  1XMO E;  4JI2 I;  4AQY I;  2LUQ A;  1H73 A;  1WUU A;  1EA6 A;  1NHI A;  4M30 A;  4DR4 I;  3LNU A;  4R1F A;  2UXD E;  3PYF A;  2XEX A;  4JI5 I;  3OTO E;  1N0U A;  4DV4 E;  1FWK A;  4FWD A;  2A2D A;  4KQV A;  4DR7 I;  4OOG C;  2HKE A;  1FJG I;  1J5E I;  2ZIT A;  2WW4 A;  2UXC E;  2IHR 1;  1N32 E;  3ZKB A;  2UU9 E;  4JI4 E;  5L3J A;  3WU6 A;  4B3M I;  1HNW E;  4YHH E;  4GKJ I;  4Z7C A;  3HUL A;  4JI1 E;  3ADI A;  3PYD A;  3JAM C;  4PU9 A;  1XMO I;  2OI2 A;  3K17 A;  4JI8 E;  1HNX I; 
#chains in the Genus database with same CATH topology
 5JEA A;  2EOJ A;  4DV0 E;  1IBK E;  4WUB A;  4DV6 E;  2LVH A;  1EI1 A;  2EN1 A;  2RS7 A;  5A6A A;  5DRQ A;  2NUF A;  2UXB E;  1IQO A;  2WCC 3;  1WRJ A;  4JI6 E;  3J7A G;  2V2Q A;  2UXC I;  2YU8 A;  5ADZ A;  2Q8U A;  2BR2 A;  4MU0 A;  4B3S E;  2UXD I;  2LE2 A;  2X36 A;  2L2M A;  1VIS A;  3B8H A;  2YU5 A;  2V34 A;  4DV4 I;  3J80 C;  5A6B D;  2JPA A;  2HFU A;  2Z5C B;  2YZT A;  2BM1 A;  4B3R E;  1LLM C;  1EH8 A;  3WU4 A;  2FGG A;  4NHR A;  2JEB B;  2EM6 A;  1FWL A;  2EPZ A;  4MU4 A;  1G2D C;  2V86 A;  4LF6 E;  1QNT A;  5AE2 A;  1RC7 A;  5C0X F;  2EM9 A;  2Z5E A;  1N32 I;  5DRR A;  1Z5B A;  2UU9 I;  4JI4 I;  5IV8 B;  1RMD A;  5C0X A;  4LFB E;  4FW6 A;  3WU5 A;  1HNW I;  4YHH I;  2L6M A;  2EOX A;  2N3G A;  4JYA E;  1AH5 A;  5LLQ A;  3KZZ A;  4R03 A;  2EPK X;  3TQM A;  1HR0 E;  1ZM9 A;  2EN3 A;  4DR2 E;  1JK1 A;  2KOU A;  3P06 A;  4JI7 E;  2YTD A;  1Z0B A;  4JI1 I;  1S16 A;  3MHS C;  5AE1 A;  4O24 A;  1DGC A;  4P7A A;  1Z0G A;  2E1M A;  1UDS A;  3PS3 A;  4JI8 I;  3PS2 A;  5KL4 A;  3VK6 A;  1MEY C;  1NHJ A;  4B3T E;  2V2Z A;  3DD6 A;  4FWG A;  4BA2 B;  4OO1 F;  4DV0 I;  3C4B A;  3T1Y E;  4OX9 E;  2A2C A;  2V8P A;  2EMI A;  1JK2 A;  1IBK I;  2EOH A;  1Z0E A;  2CT1 A;  1BB8 A;  4OO1 A;  2BB8 A;  3EPL A;  1TF6 A;  1ZAA C;  2BA0 G;  2MKN A;  1F2I G;  2UXB I;  4JI6 I;  3M7N G;  2EPO A;  1K47 A;  5IT9 C;  1SR9 A;  2YT4 A;  4NXM E;  2RS6 A;  5AE3 A;  4X8W A;  2C38 A;  4B3S I;  4N4R B;  4M2Z A;  5A2Q C;  4AIM A;  1UHZ A;  3BID A;  1KYQ A;  2EMC A;  4ZYG A;  1UEK A;  2YTJ A;  4IFD E;  3GME A;  2PRT A;  1R6M A;  3Q1Q A;  4B3R I;  2LCE A;  3J81 C;  3ADL A;  2GO4 A;  2EOI A;  4IFD F;  4X62 E;  2R1F A;  4LCG A;  5T6J A;  4R2E A;  4BMJ A;  1PIE A;  4DXL A;  2JP9 A;  4BBY A;  4IFD D;  2HJJ A;  2EMX A;  2M4I A;  2EMG A;  4LF7 E;  2RPC A;  5ELW A;  4LF6 I;  3BGH A;  2GPI A;  2EFG A;  3F6G A;  1UN6 B;  3LPS A;  2PO0 B;  4LFB I;  2EM8 A;  1B63 A;  1FI4 A;  2C37 A;  2EOO A;  4BHC A;  2EOF A;  4JYA I;  3MHH C;  2IES A;  2L92 A;  3QG5 C;  1PKP A;  1U2R A;  2GS8 A;  3B4T A;  4DR2 I;  1HR0 I;  1TF3 A;  3ADJ A;  3GON A;  2DLK A;  3AUZ A;  1B62 A;  4JI7 I;  4X64 E;  2EQ3 A;  1YYW A;  4BA1 A;  2JR1 A;  4MU1 A;  4IZJ A;  5AC4 A;  4FK5 C;  1DQ3 A;  4R2A A;  4U3D A;  4DUZ E;  3LLH A;  4HY1 A;  1O0W A;  2WBT A;  2NN6 F;  2RQL A;  1WHQ A;  4GZN C;  4B3T I;  2EN7 A;  3T1Y I;  4OX9 I;  2JVA A;  1BBG A;  1X3C A;  1USV A;  3THO B;  2NN6 A;  2B7T A;  1S4E A;  3K85 A;  2LJP A;  5LMN E;  4MU3 A;  1X49 A;  2F4V E;  3ZZU A;  2Q2E B;  4HTG A;  2B9D A;  3DF6 A;  2YSO A;  3P3G A;  4NXM I;  2V83 A;  1A1H A;  3P3E A;  2WBU A;  4LF4 I;  4ZYD A;  2LJH A;  4JV5 E;  3JAM Q;  4P7D A;  1KJK A;  4DU8 A;  1ELO A;  2HKJ A;  4LF8 E;  4LF4 E;  4BC7 A;  5DRO A;  3T1H E;  4DV5 E;  5F3W A;  1WHN A;  4F2J C;  1FNM A;  3F0N A;  2N3H A;  2L33 A;  2N8X A;  2ODR C;  2JE6 A;  4X62 I;  4RHB B;  2RSI A;  4IZK B;  2KHX A;  1MU5 A;  3B78 A;  3L7Z B;  4LF7 I;  4DR6 E;  1QU6 A;  2L2N A;  1YYK A;  1NCS A;  5K36 C;  2J65 A;  1HNZ E;  3H1C A;  2WP8 A;  3EPK A;  2HHH E;  2EPM X;  2BM0 A;  2V8Q B;  4ZYE A;  4N3O A;  1XNQ E;  3PYG A;  4I3H A;  1MGT A;  4DV2 E;  4LOM A;  1UIL A;  5FLX Q;  1G2F C;  2NUG A;  3OTO I;  4LF5 E;  5DNL A;  4X64 I;  3P3C A;  2NUE A;  5A6B A;  2UUC E;  2O1W A;  2F1D A;  4MDT A;  1DI2 A;  4DUY E;  5EKW A;  4DUZ I;  4IS9 A;  1XMQ E;  5TSE A;  1ZM4 A;  4UTG A;  1EKZ A;  2V85 A;  4GKJ I;  2HK2 A;  2YTG A;  5JEA C;  1X5W A;  4DPW A;  2M9A A;  1J26 A;  4KHP E;  3CDI A;  5AAS A;  5LMN I;  2F4V I;  2EMF A;  3ZZT A;  2JXP A;  3ECR A;  5LMU E;  2PO1 B;  4NBQ A;  1Z5C A;  2FV4 B;  2VES A;  2R42 A;  2EQ1 A;  5IXM B;  4WSP A;  4DR5 E;  4BHB A;  2O1T A;  2RTX A;  4JV5 I;  2EM5 A;  4DV1 E;  4DKK A;  1E3H A;  4WYQ B;  4BA1 B;  4MLV A;  4IZJ B;  4MQY A;  4FW4 A;  2YRH A;  2LRS A;  4DV5 I;  3T1H I;  4URL A;  4HYM A;  1BBO A;  2WNR A;  1PVG A;  3LML A;  1A1F A;  1XXE A;  2VQE E;  3V2U C;  1X6F A;  3ZOQ B;  3K6Q A;  1A6F A;  2EE8 A;  1STU A;  4KZS A;  4HAC A;  4NXN E;  1PJT A;  2EMH A;  3VYY A;  3MSW A;  2DEI A;  2YWQ A;  5BR8 E;  2ADR A;  4WUD A;  2DLQ A;  5GME A;  2DMY A;  1KKH A;  2BA0 D;  4DR6 I;  3GLL A;  1PDA A;  1EH7 A;  2ZM6 E;  1Z59 A;  2E1R A;  2IER A;  2JY9 A;  2X7I A;  4X65 E;  1Y60 A;  3M7N D;  5K36 B;  2IOP A;  5C0X C;  4DV6 I;  1Z1B A;  1HNZ I;  4L5N C;  2HHH I;  5LL6 R;  4NZV A;  1Z0W A;  2DMI A;  4R2C A;  3M6A A;  2EN2 A;  2C39 A;  1USU A;  4QNJ A;  5KL3 A;  4DR1 E;  3J81 Q;  3D4J A;  3L00 A;  1XNQ I;  4XTJ A;  4F9C B;  1MG7 A;  2EML A;  4WSG A;  2JWO A;  1GQE A;  2CGE A;  3PRY A;  4DV2 I;  4AM3 A;  2EL5 A;  4LF5 I;  1BKN A;  4UT4 A;  2B7V A;  2EM2 A;  2L8T A;  2UUC I;  2YTO A;  1VI7 A;  1IBM E;  4DUY I;  2EN4 A;  4DV3 E;  1XMQ I;  3U1K A;  1AAY A;  3HTX A;  4USK A;  1PJQ A;  5KL5 A;  4DU7 A;  1A1J A;  5JEA B;  4ISA A;  1KIJ A;  2PNL A;  3Q6M A;  2JEA A;  4KHP I;  4IFD A;  2WP8 B;  4OO1 C;  4R2P A;  5IWA E;  2G7H A;  2ELZ A;  2MC6 A;  2NAB A;  1YFH A;  1XNR E;  1N33 E;  3PYE A;  4FWH A;  5LMU I;  1H7S A;  2J7K A;  2BR2 B;  2EMK A;  1NZ0 A;  5AC5 A;  2WZO A;  4DR5 I;  2Z5B A;  3C6M A;  4P78 A;  1RQ0 A;  4DV1 I;  3HQ1 A;  2J7J A;  4YY3 E;  1YYO A;  1B69 A;  2E5L E;  1N34 E;  2EMY A;  1ZM3 A;  2ENC A;  2EOY A;  2ENA A;  4LF9 E;  1KVK A;  5FWK A;  2K7I A;  4R2S A;  2AE8 A;  2VQE I;  3IWD A;  4LCH A;  1ZR9 A;  4NXN I;  3WU3 A;  2UUB E;  3CWV A;  3B82 A;  3QT5 A;  5BR8 I;  2EMA A;  2Z5C A;  4M0V A;  2EZ6 A;  1HNX E;  2E72 A;  2LTS A;  2V2V A;  2YTP A;  3P1X A;  3ZKD A;  2ZM6 I;  4X65 I;  5C0X B;  3M85 G;  1TN9 A;  2EJ4 A;  4JI3 E;  4RH8 A;  2CVE A;  4FW3 A;  2MKD A;  3M99 B;  2B3T B;  2EPX A;  3RMP A;  4DR1 I;  1DAR A;  3U1Y A;  2YSP A;  2JOB A;  4L8N A;  2GLI A;  4LFC E;  2CG9 A;  1N36 E;  2WNR B;  2EWL A;  3HXL A;  2M1S A;  2CZ9 A;  2EN6 A;  2EL4 A;  3EQ1 A;  2UUA E;  4R2D A;  4HAC B;  2LV2 A;  1IMU A;  2VQF E;  1IBM I;  4DV3 I;  2LBS B;  4DR3 E;  2EPN A;  1Z0T A;  1QZR A;  1Z0V A;  2ODR D;  4PRX A;  3J7A M;  4FW7 A;  1E3P A;  2KON A;  2NN6 C;  4OO1 B;  2VF1 A;  5IWA I;  2L3C A;  2EPC A;  1R6L A;  1GTK A;  4GKK E;  1IQS A;  3HPS A;  2C39 B;  1XNR I;  4BA2 A;  1N33 I;  4O43 A;  2BA1 G;  1ZXM A;  4R2Q A;  2C38 B;  2RSM A;  4O4K A;  4USM A;  4JI0 E;  4LFA E;  4P52 A;  2DIX A;  4BC9 A;  4K0K E;  3J80 Q;  3NZK A;  4DV7 E;  2DRP A;  4YY3 I;  2E5L I;  4O5G A;  1N34 I;  3H4L A;  1SFE A;  4U3B A;  3HKM A;  4LF9 I;  2BBG A;  4X66 E;  2VRD A;  1NEI A;  2EOZ A;  4TUG A;  2PNZ A;  2LJU A;  1YHC A;  2H36 X;  2LTR A;  5JEA E;  1H72 C;  2BV3 A;  2HFS A;  4FW5 A;  1N0V C;  2UUB I;  4GQU A;  2EMW A;  2YTF A;  4IFD B;  4WXD A;  1OYR A;  2I9I A;  2EOE A;  4ED4 A;  4LF8 I;  1OJ4 A;  4I8O A;  1YSA C;  5CFF E;  1Z5A A;  2O1U A;  4M1K A;  1D6T A;  3VYX A;  2ZBK B;  1YPN A;  2LO3 A;  4PRV A;  5A69 A;  1UDO A;  2Z5B B;  5JEA D;  3J7Y p;  4JI3 I;  1FKA E;  2C37 B;  2HC5 A;  1I94 E;  3C4T A;  3QT6 A;  1OYP A;  3ZZ0 A;  5A6J A;  2LUP B;  1Z0C A;  2A25 A;  4LFC I;  1N36 I;  3CDJ A;  4BS9 A;  2VE7 C;  2EMZ A;  2PO0 A;  1IBL E;  1T4O A;  2UUA I;  2D9H A;  2L3J A;  4WX9 A;  2V88 A;  5KL6 A;  4JG4 A;  2HK3 A;  3Q6N A;  4HXZ A;  4MYU A;  2VQF I;  3KZY A;  4X9J A;  2CTD A;  4MYT A;  1Y5Y A;  2DB2 A;  4Z7Y A;  1GZ6 A;  3IWC A;  4DR3 I;  3ZM7 A;  3VHT B;  4J3D A;  3V5R A;  5C0X E;  5FLX C;  2NN6 B;  3FIG A;  5GMD A;  1ZBT A;  5IT9 Q;  3P76 A;  3QT8 A;  4GKK I;  4R8O A;  3KWR A;  4JI2 E;  3BF2 A;  4DPU A;  5A2Q Q;  1T38 A;  4AQY E;  2YTN A;  2ENH A;  2EPL X;  4JI0 I;  4LFA I;  5C0X D;  2YTE A;  4K0K I;  1H7U A;  1X47 A;  1Y4S A;  2YRK A;  2O3Z A;  4DV7 I;  2EN8 A;  4KWY A;  3QT7 A;  3JTZ A;  2AJ4 A;  4DR4 E;  4IS1 C;  4FN5 A;  1ZXN A;  2YPN A;  2ELY A;  4X66 I;  2PNM A;  1A1K A;  2YTI A;  2LT7 A;  1A1G A;  1T4L B;  4JI5 E;  2JE6 B;  2DGC A;  1N3G A;  2R3V A;  4DPT A;  5A6K A;  4ZVI A;  2EM7 A;  2EOS A;  4F6N A;  3GCM A;  4OO1 E;  5DNX A;  1P42 A;  2EQ0 A;  2EPA A;  3HJC A;  4FW9 A;  1EH6 A;  4DR7 E;  1NHH A;  2PO2 A;  1YZ9 A;  4DPX A;  4ZYH A;  1XHK A;  4EMD A;  4IJD A;  4RPF A;  4WPY A;  5KL7 A;  1MX0 A;  3C6K A;  2IOQ A;  3UHM A;  3KRN A;  1FJG E;  3ADG A;  1UDQ A;  1ZM2 A;  4R2R A;  4IZK A;  1I94 I;  3F6H A;  1J5E E;  4OO1 D;  4F9B B;  2MDR A;  3K1J A;  4WUC A;  1PJS A;  3L7Z A;  2NPF A;  2DEJ A;  2L2K B;  3AV0 A;  4GEQ B;  5DNY A;  1H74 A;  1T4N A;  1ZU1 A;  2EM0 A;  2O1V A;  4B3M E;  1RRE A;  2VF3 A;  3LTO A;  2LMZ A;  2PNZ B;  1IBL I;  2EOR A;  2GQ0 A;  2NA2 A;  1KTV A;  1RHY A;  4DPY A;  4WFT A;  1HK7 A;  1X6E A;  2EL6 A;  2YTQ A;  4WXC A;  2EMB A;  4GKJ E;  4OKG A;  1RR9 A;  2CPN A;  3EPJ A;  1X48 A;  3PS1 A;  4IFD C;  1XMO E;  4Q35 B;  3M85 D;  2DSY A;  4BCA A;  1WXR A;  2YRM A;  4J8Z A;  5DRP A;  2K4V A;  4HEI A;  2EPU A;  4JI2 I;  4TUI A;  1X6H A;  4OZE A;  2JEB A;  4AQY I;  5KL2 A;  4LCF A;  2LUQ A;  1H73 A;  4LU9 A;  1WUU A;  4AID A;  1EA6 A;  3THN A;  4QNK A;  1NHI A;  4M30 A;  4DR4 I;  2PO1 A;  3LNU A;  4LPF A;  2FTX B;  2JOX A;  4R1F A;  2UXD E;  3PYF A;  2EPP A;  1A1I A;  2XEX A;  4JI5 I;  3OTO E;  1N0U A;  2NN6 E;  4DV4 E;  1YH8 A;  1FWK A;  4FWD A;  2A2D A;  4IZJ D;  1OYS A;  4KQV A;  5EL9 A;  4DR7 I;  2HGH A;  1Y6Z A;  1A1L A;  2EPR A;  5K36 E;  4MLQ A;  3IWB A;  4OOG C;  2BA1 D;  2HKE A;  2MC5 A;  1FJG I;  3BBG A;  1UBD C;  3OML A;  2NN6 D;  1J5E I;  2ZIT A;  2WW4 A;  5K36 F;  2UXC E;  2IHR 1;  3HPZ A;  1N32 E;  3ZKB A;  4LTY A;  2UU9 E;  2EM3 A;  1T39 A;  2R76 A;  4JI4 E;  1WJP A;  5L3J A;  3WU6 A;  5K36 A;  3H09 A;  1YUI A;  4B3M I;  5K36 D;  1HNW E;  4YHH E;  4DMI A;  2JT2 A;  4F6M A;  3EPH A;  3UK3 C;  1Y4U A;  2V89 A;  2PO2 B;  2JYA A;  4Q28 A;  4F54 A;  4Z7C A;  2EM4 A;  2CSH A;  2V87 A;  1L4S A;  3HUL A;  2EOQ A;  4JI1 E;  3ADI A;  4M9V C;  1ZBQ A;  3JAM C;  2WBS A;  1UDN A;  2GHF A;  3PYD A;  4PU9 A;  2M7Q A;  2F8B A;  2I13 A;  1XMO I;  3DJW A;  2JEA B;  2OI2 A;  3K17 A;  4JI8 E;  5JEA F;  1YUJ A;  4F9A B;  2EOM A;  1P47 A;  2GO3 A;  1HNX I;  3JU0 A;  2MDG A;  2EP3 A; 
#chains in the Genus database with same CATH homology
 4DV0 E;  1IBK E;  4WUB A;  4DV6 E;  1EI1 A;  2RS7 A;  2NUF A;  2UXB E;  4JI6 E;  3J7A G;  2V2Q A;  5ADZ A;  4B3S E;  2UXD I;  2LE2 A;  2X36 A;  2L2M A;  1VIS A;  3B8H A;  2V34 A;  4DV4 I;  3J80 C;  2HFU A;  2Z5C B;  2YZT A;  2BM1 A;  4B3R E;  3WU4 A;  2FGG A;  1FWL A;  2V86 A;  4LF6 E;  2UXC I;  5AE2 A;  1RC7 A;  2Z5E A;  1N32 I;  1Z5B A;  2UU9 I;  4JI4 I;  4LFB E;  3WU5 A;  1HNW I;  4YHH I;  2L6M A;  2N3G A;  4JYA E;  4R03 A;  1HR0 E;  1ZM9 A;  4DR2 E;  2KOU A;  3P06 A;  4JI7 E;  1Z0B A;  4JI1 I;  1S16 A;  5AE1 A;  4P7A A;  1Z0G A;  2E1M A;  4JI8 I;  1NHJ A;  3VK6 A;  4FWG A;  4B3T E;  2V2Z A;  4DV0 I;  3C4B A;  3T1Y E;  4OX9 E;  2A2C A;  2V8P A;  1IBK I;  1Z0E A;  2UXB I;  4JI6 I;  1K47 A;  5IT9 C;  1SR9 A;  4NXM E;  2YT4 A;  2RS6 A;  5AE3 A;  4X8W A;  4B3S I;  4M2Z A;  5A2Q C;  1UHZ A;  1UEK A;  3Q1Q A;  4B3R I;  3ADL A;  3J81 C;  4X62 E;  5T6J A;  4BMJ A;  1PIE A;  4DXL A;  4BBY A;  4LF6 I;  2M4I A;  4LF7 E;  2EFG A;  3F6G A;  3LPS A;  4LFB I;  1FI4 A;  1B63 A;  4JYA I;  2L92 A;  1U2R A;  1PKP A;  1HR0 I;  2GS8 A;  4DR2 I;  3ADJ A;  3GON A;  3AUZ A;  1B62 A;  4JI7 I;  4X64 E;  1YYW A;  2JR1 A;  4IZJ A;  1DQ3 A;  4DUZ E;  3LLH A;  4HY1 A;  1O0W A;  4B3T I;  1WHQ A;  3T1Y I;  4OX9 I;  2JVA A;  1USV A;  2B7T A;  1S4E A;  3K85 A;  2LJP A;  5LMN E;  3ZZU A;  1X49 A;  2F4V E;  2Q2E B;  2B9D A;  3DF6 A;  4NXM I;  2V83 A;  2LJH A;  4JV5 E;  3JAM Q;  4P7D A;  4DU8 A;  1ELO A;  2HKJ A;  4LF8 E;  4LF4 E;  4BC7 A;  3T1H E;  4DV5 E;  5F3W A;  1WHN A;  1FNM A;  3F0N A;  2N3H A;  2L33 A;  2ODR C;  4X62 I;  4IZK B;  2KHX A;  1MU5 A;  3B78 A;  4LF7 I;  4DR6 E;  1QU6 A;  2L2N A;  1YYK A;  1HNZ E;  2HHH E;  2BM0 A;  2V8Q B;  4N3O A;  1XNQ E;  3PYG A;  4I3H A;  4DV2 E;  1UIL A;  5FLX Q;  3OTO I;  2NUG A;  4LF5 E;  4X64 I;  2NUE A;  2UUC E;  2O1W A;  1DI2 A;  4DUY E;  4DUZ I;  1XMQ E;  1ZM4 A;  4UTG A;  1EKZ A;  2V85 A;  2HK2 A;  4DPW A;  1J26 A;  4KHP E;  5AAS A;  5LMN I;  2F4V I;  3ZZT A;  5LMU E;  1Z5C A;  2FV4 B;  2R42 A;  4WSP A;  4DR5 E;  2O1T A;  2RTX A;  4JV5 I;  4DV1 E;  4DKK A;  4LF8 I;  4WYQ B;  4LF4 I;  4IZJ B;  3T1H I;  2LRS A;  4DV5 I;  4URL A;  4HYM A;  1PVG A;  3LML A;  3V2U C;  2VQE E;  3ZOQ B;  3K6Q A;  1A6F A;  1STU A;  4KZS A;  4HAC A;  4NXN E;  3VYY A;  3MSW A;  2DEI A;  5BR8 E;  4WUD A;  5GME A;  2DMY A;  1KKH A;  4DR6 I;  2E1R A;  2ZM6 E;  1Z59 A;  2X7I A;  2JY9 A;  4X65 E;  2IOP A;  4DV6 I;  1HNZ I;  4L5N C;  2HHH I;  5LL6 R;  3M6A A;  1Z0W A;  1USU A;  4DR1 E;  3J81 Q;  3D4J A;  1XNQ I;  4XTJ A;  4F9C B;  1MG7 A;  2JWO A;  1GQE A;  2CGE A;  3PRY A;  4DV2 I;  4LF5 I;  1BKN A;  4UT4 A;  2B7V A;  2L8T A;  2UUC I;  1IBM E;  4DUY I;  4DV3 E;  1XMQ I;  3HTX A;  4USK A;  4DU7 A;  1KIJ A;  2PNL A;  3Q6M A;  4KHP I;  5IWA E;  2G7H A;  3PYE A;  2MC6 A;  1XNR E;  1N33 E;  5LMU I;  4FWH A;  1H7S A;  2J7K A;  1NZ0 A;  2WZO A;  4DR5 I;  2Z5B A;  4P78 A;  1RQ0 A;  4DV1 I;  3HQ1 A;  4YY3 E;  1YYO A;  2E5L E;  1ZM3 A;  1N34 E;  1KVK A;  4LF9 E;  5FWK A;  2VQE I;  3IWD A;  4NXN I;  3WU3 A;  2UUB E;  3CWV A;  3B82 A;  3QT5 A;  5BR8 I;  2Z5C A;  4M0V A;  2EZ6 A;  1HNX E;  2LTS A;  2V2V A;  3P1X A;  3ZKD A;  2ZM6 I;  4X65 I;  4JI3 E;  2B3T B;  3RMP A;  4DR1 I;  1DAR A;  2JOB A;  4L8N A;  4LFC E;  2CG9 A;  1N36 E;  2EWL A;  3HXL A;  2M1S A;  2CZ9 A;  2UUA E;  4HAC B;  2VQF E;  1IBM I;  4DV3 I;  2LBS B;  4DR3 E;  1Z0T A;  1QZR A;  1Z0V A;  2ODR D;  4PRX A;  3J7A M;  2KON A;  2VF1 A;  5IWA I;  2L3C A;  4GKK E;  1XNR I;  3HPS A;  1N33 I;  1ZXM A;  2RSM A;  4USM A;  4JI0 E;  4LFA E;  4P52 A;  2DIX A;  4K0K E;  4BC9 A;  3J80 Q;  4DV7 E;  4YY3 I;  2E5L I;  1N34 I;  3H4L A;  4LF9 I;  4X66 E;  4TUG A;  2H36 X;  2LTR A;  1H72 C;  2BV3 A;  2HFS A;  1N0V C;  2UUB I;  4ED4 A;  1OJ4 A;  4I8O A;  5CFF E;  1Z5A A;  2O1U A;  4M1K A;  1D6T A;  3VYX A;  2ZBK B;  4PRV A;  2Z5B B;  3J7Y p;  4JI3 I;  1FKA E;  1I94 E;  3C4T A;  3QT6 A;  3ZZ0 A;  2LUP B;  1Z0C A;  4LFC I;  1N36 I;  4BS9 A;  2VE7 C;  1IBL E;  1T4O A;  2UUA I;  2L3J A;  4JG4 A;  2V88 A;  2HK3 A;  3Q6N A;  4HXZ A;  4MYU A;  2VQF I;  4MYT A;  2DB2 A;  4Z7Y A;  1GZ6 A;  3IWC A;  4DR3 I;  3ZM7 A;  3V5R A;  5FLX C;  3FIG A;  5GMD A;  1ZBT A;  5IT9 Q;  3QT8 A;  4GKK I;  4R8O A;  3KWR A;  4JI2 E;  4DPU A;  5A2Q Q;  4AQY E;  4JI0 I;  4LFA I;  4K0K I;  1H7U A;  1X47 A;  1Y4S A;  4DV7 I;  3QT7 A;  3JTZ A;  2AJ4 A;  4DR4 E;  4FN5 A;  1ZXN A;  4X66 I;  2PNM A;  1T4L B;  4JI5 E;  2R3V A;  4DPT A;  4ZVI A;  3HJC A;  4FW9 A;  4DR7 E;  1NHH A;  1YZ9 A;  4DPX A;  1XHK A;  4EMD A;  4RPF A;  4WPY A;  1MX0 A;  2IOQ A;  1FJG E;  3ADG A;  1ZM2 A;  4IZK A;  1I94 I;  3F6H A;  1J5E E;  4F9B B;  2MDR A;  3K1J A;  4WUC A;  2NPF A;  2DEJ A;  2L2K B;  3AV0 A;  4GEQ B;  5DNY A;  1H74 A;  1T4N A;  2O1V A;  4B3M E;  1RRE A;  2VF3 A;  3LTO A;  2LMZ A;  1IBL I;  2GQ0 A;  2NA2 A;  1KTV A;  4DPY A;  4WFT A;  1HK7 A;  4GKJ E;  1RR9 A;  2CPN A;  1X48 A;  1XMO E;  2DSY A;  4BCA A;  1WXR A;  4J8Z A;  2K4V A;  4JI2 I;  4TUI A;  4AQY I;  2LUQ A;  1H73 A;  4LU9 A;  1WUU A;  1EA6 A;  1NHI A;  4M30 A;  4DR4 I;  3LNU A;  2FTX B;  2JOX A;  4R1F A;  2UXD E;  3PYF A;  2XEX A;  4JI5 I;  3OTO E;  1N0U A;  4DV4 E;  1FWK A;  4FWD A;  2A2D A;  4IZJ D;  4KQV A;  4DR7 I;  1Y6Z A;  3IWB A;  4OOG C;  2HKE A;  2MC5 A;  1FJG I;  3OML A;  1J5E I;  2ZIT A;  2WW4 A;  2UXC E;  2IHR 1;  3HPZ A;  1N32 E;  3ZKB A;  4LTY A;  2UU9 E;  4JI4 E;  5L3J A;  3WU6 A;  3H09 A;  4B3M I;  1HNW E;  4YHH E;  4DMI A;  1Y4U A;  2V89 A;  4GKJ I;  4Q28 A;  4F54 A;  4Z7C A;  2V87 A;  3HUL A;  4JI1 E;  3ADI A;  1ZBQ A;  3JAM C;  3PYD A;  4PU9 A;  2M7Q A;  2F8B A;  1XMO I;  3DJW A;  2OI2 A;  3K17 A;  4JI8 E;  4F9A B;  1HNX I;  3JU0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...