4JI1E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4ji1E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji1E02
4DR6I 1UILA 1EKZA 4AQYE 4DV7E 4M30A 5IWAI 1FJGI 2UXDE 5FLXC 3J81C 2UU9I 4DV0E 2LJHA 2UXCI 1I94E 4LF4E 1Z0CA 1MG7A 2DB2A 1VISA 4JI4I 4OOGC 1KTVA 1XMOI 4KHPI 2B3TB 2UUBE 1IBKI 2JY9A 2L2KB 4LF8E 2J7KA 1NZ0A 1I94I 4LF4I 4B3RE 4DKKA 3ADGA 3B8HA 1Z5CA 4DR5E 4JI8I 1UHZA 4KHPE 2GS8A 2A2CA 4RPFA 4DV5E 4HACA 4B3TI 1IBME 4LFCE 2HFSA 2RSMA 4DR2I 4DR5I 4JI8E 1STUA 4DV1I 1MX0A 4NXMI 4M1KA 2YT4A 3J7Yp 4JI2I 1Z5BA 4WUCA 4X65I 4DR2E 1XHKA 3VYXA 3B82A 2F4VI 1HR0E 2LTRA 2DEIA 1EA6A 1N32I 2ZM6E 1PKPA 4JI5E 4DR3I 2NA2A 4UT4A 3J7AG 4X65E 2RTXA 4DUYE 2V8PA 3ZZTA 4P52A 2UXBI 5IT9C 2DIXA 1S16A 2A2DA 4DR6E 2HHHI 5BR8E 1J5EI 2LUPB 2UU9E 4DUYI 1ZM9A 4LF9E 4JV5I 3T1HE 2XEXA 2UXBE 1PIEA 3V2UC 1FWLA 4K0KI 4DR7E 4GKJE 4DV6E 4JI7I 2MDRA 1KIJA 1HNXE 4JI3I 4EMDA 1N36I 1RREA 3QT6A 4OX9I 4DR4E 4PRXA 3HULA 2RS6A 4GKKE 4GKJI 5A2QQ 2NUGA 3J80C 4JYAE 1XNQI 4OX9E 2CZ9A 4DR4I 1UEKA 3Q1QA 2UUAI 2LBSB 4I3HA 4JI6I 3ZZ0A 1PVGA 3P1XA 4FWHA 2L33A 2DMYA 2BV3A 4JYAI 4NXME 1XNQE 4DV3I 3C4BA 1B62A 3K1JA 4JI6E 3ADIA 5LMNI 4MYUA 1N0VC 4DR1E 2UUCE 1YZ9A 3C4TA 4LF5I 1FI4A 2VQEI 4YY3E 4R1FA 1RR9A 4DR3E 4WUBA 4JI5I 1HNWI 1GQEA 2KHXA 1H74A 1Z0TA 3V5RA 1D6TA 3WU3A 2V2QA 4DR1I 2UUCI 2BM1A 4YY3I 3ZM7A 2WW4A 2LJPA 1IBLE 3HTXA 3T1HI 1J26A 3ZKBA 1KKHA 1QU6A 4DR7I 1FJGE 2UXDI 4Z7YA 1WHNA 4NXNI 1T4LB 1IBLI 4DV5I 2HFUA 2AJ4A 4JI1E 1N34E 1RQ0A 2RS7A 2V34A 1XMOE 2X36A 4NXNE 2JVAA 4LF8I 1N33I 2EZ6A 2R3VA 4JI1I 4X66I 1NHIA 5CFFE 1WHQA 1MU5A 4DV2E 1YYOA 1U2RA 4LF6E 5GMEA 4Z7CA 2N3HA 4X66E 5LMUE 4LFCI 1T4NA 1EI1A 1ZXNA 4DV2I 2LRSA 1B63A 5LMNE 4URLA 3WU4A 4B3SE 5A2QC 3WU5A 3K17A 1J5EE 4JI2E 3GONA 4X62E 4ZVIA 2NUEA 2Q2EB 4JV5E 2F4VE 1QZRA 1HNZE 1N32E 4DUZI 1XNRI 4DV4I 4B3ME 2E5LI 5LL6R 3CWVA 4P7AA 4DXLA 4DU7A 2UXCE 1Z0EA 1H7SA 1XNRE 2VQFE 2NUFA 2E5LE 1YYWA 1WUUA 4HXZA 5BR8I 4JI4E 4X64I 4LF7E 2L3CA 4ED4A 4DU8A 4DPYA 2VF3A 1RC7A 3ZKDA 1ZM2A 1N34I 1BKNA 5IWAE 5FLXQ 2X7IA 3J81Q 3VYYA 1YYKA 2HKEA 1T4OA 4JI3E 4FWDA 1N36E 2ZBKB 1FKAE 4WUDA 1X49A 1FWKA 1N33E 1ZM3A 3H4LA 1IBMI 2DEJA 5IT9Q 3LPSA 2R42A 2UUBI 1XMQE 3LTOA 1X47A 4LF6I 2VQEE 1X48A 1O0WA 4B3RI 4FN5A 4PU9A 4JI0E 1FNMA 4HACB 4FW9A 3ZZUA 1HR0I 3JAMC 4LFAE 3T1YI 4HYMA 1H73A 4M2ZA 4XTJA 4B3SI 2ZITA 1ZXMA 4DV3E 4B3TE 1Z5AA 4KQVA 1K47A 3B78A 3PYDA 2L2NA 3F0NA 2LUQA 2HK3A 1Z0WA 4DV4E 1OJ4A 4B3MI 2CPNA 3OTOI 4PRVA 1N0UA 3ADLA 4LF9I 2BM0A 2NPFA 3ADJA 4WYQB 3LLHA 2VQFI 3OTOE 4X64E 4LF7I 1HNXI 1KVKA 4DV0I 4WFTA 2HHHE 2HKJA 2B7TA 5L3JA 2L2MA 1IBKE 4YHHI 1Z0BA 1ELOA 2UUAE 4K0KE 3PYGA 1ZM4A 4DPUA 4DV6I 4JI7E 2OI2A 4USMA 4YHHE 1XMQI 3QT7A 1H7UA 4HY1A 3QT5A 1Z0VA 3PYEA 2B7VA 4LFBE 4X62I 4JI0I 3LNUA 2V2ZA 4MYTA 4GKKI 2N3GA 3J80Q 4DV1E 2E1RA 5GMDA 4X8WA 3T1YE 1Z0GA 1HNZI 4LFAI 4LF5E 3JAMQ 1Z59A 4LFBI 1ZBTA 2V2VA 4FWGA 1DARA 5LMUI 1A6FA 3M6AA 1HNWE 2HK2A 2L3JA 2LTSA 3D4JA 3PYFA 2EFGA 2ZM6I 4JG4A 4DPTA 4UTGA 4USKA 4AQYI 4DV7I 1DI2A 1NHJA 3J7AM 2IHR1 1NHHA 3QT8A 4DPXA 1S4EA 4DPWA 1H72C 3WU6A 4DUZE
chains in the Genus database with same CATH superfamily
3P06A 4IZJB 4DR6I 1UILA 1DGCA 3M99B 2EN4A 4AQYE 4DV7E 4M30A 1EKZA 5DNXA 5IWAI 2EN2A 5KL4A 2EMZA 1FJGI 2EL4A 2UXDE 5FLXC 3J81C 2F8BA 2UU9I 3KWRA 5C0XD 1MEYC 4DV0E 3Q6MA 2LJHA 3TQMA 2EOIA 2O1VA 2UXCI 2JEAA 1I94E 4LF4E 1Z0CA 2F1DA 4HEIA 1MG7A 1USVA 2DB2A 1VISA 1Y4SA 5EKWA 3L7ZA 1HK7A 1UBDC 3HJCA 4JI4I 4OOGC 1KTVA 1XMOI 2EP3A 4KWYA 2RPCA 5K36E 4KHPI 2B3TB 2UUBE 1IBKI 4AM3A 2JY9A 2LE2A 2ODRD 2L2KB 4LF8E 2J7KA 3BBGA 1NZ0A 1I94I 4LF4I 3KZZA 2VRDA 4B3RE 1OYRA 3M7ND 4DKKA 4WX9A 3UK3C 3B4TA 4OO1D 2JR1A 3ADGA 3B8HA 1Z5CA 4DR5E 4JI8I 1UHZA 2EMIA 4KHPE 2GS8A 4R2DA 4R8OA 2A2CA 3FIGA 2NABA 2CGEA 4RPFA 2A25A 4DV5E 2V87A 2C39B 2PNZA 1QNTA 2G7HA 4HACA 4B3TI 2YTPA 2JE6A 1IBME 4BA1B 2O1WA 4WSPA 3VK6A 2RSMA 4LFCE 2HFSA 3HXLA 4DR2I 3Q6NA 5F3WA 4DR5I 2FV4B 4P78A 4JI8E 1STUA 2EPAA 4DV1I 1MX0A 2YRMA 4GQUA 4NXMI 5IV8B 4BHCA 4M1KA 2YT4A 3J7Yp 5DRQA 2BR2B 5AE3A 4OO1E 2YSPA 3C6KA 3JU0A 2ADRA 4JI2I 3PS3A 1Z5BA 4WUCA 4X65I 2K7IA 4DR2E 2EM5A 1XHKA 2EE8A 2YU8A 3VYXA 2JEBA 1SFEA 2Z5EA 2BA1G 2V88A 2Z5BA 4ZYEA 5AC5A 2EPUA 3B82A 1HR0E 2LTRA 2DEIA 1EA6A 5C0XA 3MHSC 2F4VI 2EM7A 2EJ4A 1N32I 2EOFA 2ZM6E 5FWKA 4WXCA 2VESA 2ELZA 1PKPA 4LCGA 2EMLA 4R03A 3C6MA 4JI5E 2PNLA 2NA2A 3J7AG 4UT4A 4X65E 2RTXA 1DQ3A 4F54A 4DR3I 2CT1A 4DUYE 2V8PA 4AIMA 3ZZTA 4P52A 4IZJD 2UXBI 5IT9C 4BMJA 2DIXA 2NN6A 1S16A 2A2DA 4DR6E 2HHHI 3M85D 5ADZA 4BBYA 2WP8B 4M0VA 5BR8E 1F2IG 1J5EI 2LUPB 1RHYA 2ELYA 2UU9E 1YFHA 4AIDA 2EN7A 4DUYI 2LJUA 1ZM9A 4LF9E 2GQ0A 1NCSA 2JXPA 4JV5I 1E3PA 4WPYA 1EH7A 3T1HE 2D9HA 2XEXA 2UXBE 1PIEA 4LCHA 3V2UC 2YTEA 3EPJA 1FWLA 1NEIA 2EN3A 2K4VA 1PDAA 4K0KI 1ZR9A 3JTZA 3HPZA 1UDNA 4DR7E 4GKJE 4NBQA 3PRYA 4DV6E 4JI7I 4O5GA 2MDRA 1HNXE 1KIJA 4JI3I 4N3OA 4EMDA 1N36I 1RREA 2LMZA 2IERA 3QT6A 4OX9I 4DR4E 4PRXA 3HULA 2RS6A 2EOSA 2MC6A 2EPOA 2DRPA 3M85G 2E72A 3LMLA 2O3ZA 4GKKE 4MU1A 5A2QQ 2FGGA 4LU9A 4GKJI 4GZNC 2NUGA 4I8OA 3J80C 2NN6F 4JYAE 5DNYA 1XNQI 4OX9E 2EOYA 3HPSA 2EN1A 3BIDA 1KJKA 4R2AA 1UEKA 1R6MA 2CZ9A 4LPFA 2EOHA 2UUAI 2DMIA 3Q1QA 2LBSB 2O1TA 4TUIA 2YRHA 4I3HA 4JI6I 3ZZ0A 1YSAC 2ENCA 2FTXB 1PVGA 3P1XA 1IQOA 4GEQB 4FWHA 2PRTA 2YTJA 1SR9A 4R2RA 2L33A 4TUGA 4IZKA 2DMYA 3MSWA 4FK5C 2PO1B 2BB8A 2BV3A 1X5WA 5C0XE 4JYAI 4NXME 1X3CA 4Q35B 4IFDD 1XNQE 2IOPA 2EOZA 4F6MA 5JEAB 4DV3I 3C4BA 4MU4A 4X9JA 1B62A 4FW3A 4MQYA 2M4IA 4JI6E 2EQ0A 3K1JA 4J8ZA 2V89A 3ADIA 1WJPA 2YTDA 2YTQA 3EPLA 5AASA 4OO1F 1WXRA 1EH8A 2EMCA 4MYUA 5LMNI 1N0VC 4DR1E 2UUCE 4OO1B 2EMKA 1YZ9A 1X6EA 3C4TA 5AE1A 4LF5I 1FI4A 5A6BA 2VQEI 2EMWA 3ECRA 4YY3E 5DNLA 4J3DA 4R1FA 1RR9A 1A1GA 2E1MA 4DR3E 1Y5YA 4WUBA 2JYAA 1L4SA 4JI5I 4BA2B 2BA1D 5T6JA 1HNWI 4ZYHA 3U1YA 1GQEA 2YWQA 2Z5CB 2KHXA 1H74A 1Z0TA 5EL9A 5JEAC 3V5RA 2MKDA 1PJSA 3EPKA 3WU3A 5K36C 1D6TA 2V2QA 3F6HA 4DR1I 2UUCI 2LO3A 3BGHA 2MC5A 2IESA 1GTKA 2BM1A 4YY3I 3ZM7A 5K36A 4O24A 2YSOA 1Y6ZA 2WW4A 5JEAF 2PO0B 2LJPA 3DD6A 1IBLE 3HTXA 3T1HI 1J26A 3L00A 3ZKBA 2JWOA 1A1IA 1KKHA 5KL5A 2N8XA 1TF3A 2EMHA 2BA0G 1QU6A 2C38A 2PO2A 1YHCA 1FJGE 4DR7I 2UXDI 1AAYA 4Z7YA 2WNRB 1WHNA 2EPZA 2YPNA 2WBSA 2WCC3 4NXNI 5K36D 1T4LB 1IBLI 4DV5I 2JOXA 2HFUA 4ZYDA 2AJ4A 4BC9A 2WBTA 4NHRA 4JI1E 1N34E 1RQ0A 2RS7A 1X6HA 3EPHA 2V34A 1XMOE 2X36A 3PS1A 2DLQA 1A1JA 3HKMA 4NXNE 2PNZB 2EM2A 2JVAA 4ZYGA 4LF8I 2V85A 2ODRC 1N33I 2EOEA 2EZ6A 4MDTA 2I9IA 2R3VA 3THOB 4LCFA 4JI1I 4X66I 1NHIA 4IFDA 5CFFE 3P3EA 1WHQA 4MLVA 1MU5A 4DV2E 1YYOA 4IS1C 1X6FA 2LCEA 4Q28A 5C0XF 1U2RA 4MU3A 2DSYA 4LF6E 1UN6B 5GMEA 1Y60A 4Z7CA 1AH5A 2N3HA 4X66E 4DR4I 5LMUE 5C0XB 2L8TA 1T4NA 1EI1A 4LFCI 1ZXNA 4DV2I 2L6MA 2LRSA 2EM4A 2RSIA 1B63A 5LMNE 4URLA 1B69A 4R2EA 1LLMC 3WU4A 4B3SE 1T39A 2DGCA 1GZ6A 2GPIA 2Q8UA 4HTGA 4KZSA 1BBGA 5A2QC 3K17A 3WU5A 1J5EE 4JI2E 3GONA 4X62E 2C37B 4BHBA 2JEAB 4ZVIA 4IFDC 3IWBA 1YUJA 2NUEA 2Q2EB 1WRJA 4JV5E 2F4VE 1QZRA 2R76A 1HNZE 1N32E 4DUZI 2V8QB 1G2DC 4DV4I 1XNRI 2EM9A 4B3ME 5C0XC 5LL6R 2E5LI 4BS9A 2O1UA 3CWVA 3GMEA 2EM3A 4FW5A 4P7AA 2EPNA 3BF2A 1A1LA 4DXLA 2EL6A 3IWDA 5DROA 5JEAD 3M7NG 4L5NC 3DJWA 4IJDA 4DU7A 1OYPA 2EN6A 2UXCE 1Z0EA 1JK2A 1H7SA 2EWLA 4DMIA 1XNRE 2VQFE 2NUFA 2E5LE 1YYWA 1WUUA 2JEBB 4HXZA 2Z5BB 5BR8I 2M7QA 4JI4E 3K85A 2C39A 4X64I 4IZJA 4F6NA 4LF7E 2EOOA 1P42A 2L3CA 4ED4A 4RHBB 4DU8A 4DPYA 2VF3A 1RMDA 1RC7A 3ZKDA 4BA1A 2EPMX 4FW7A 2EOQA 2MKNA 4WXDA 2JT2A 2YTOA 4LOMA 1ZM2A 1N34I 1BKNA 3AV0A 2EM6A 5IWAE 2X7IA 2VE7C 5FLXQ 3VYYA 1YYKA 3J81Q 1ZBQA 1Y4UA 3P76A 2EPRA 2NN6B 3L7ZB 2HKEA 1T4OA 3GCMA 4JI3E 4FWDA 5A6AA 1N36E 1UDSA 1FKAE 2ZBKB 4WUDA 1X49A 2CTDA 1N33E 1FWKA 1ZM3A 5A6JA 3H4LA 5KL6A 4IZKB 1IBMI 4R2SA 2DEJA 2PO1A 3P3CA 2EM0A 5IT9Q 2WBUA 3DF6A 2IOQA 3LPSA 2R42A 4MU0A 2UUBI 1XMQE 2EPXA 3H09A 2PNMA 3LTOA 2YTFA 1X47A 4LF6I 2VQEE 1X48A 1O0WA 4ISAA 4O43A 2JOBA 2NN6C 2L92A 4B3RI 2V86A 4FN5A 2EPPA 4PU9A 2WZOA 5KL2A 4JI0E 1N3GA 4BC7A 1MGTA 2R1FA 1FNMA 4HACB 1YUIA 2JE6B 4FW9A 2WP8A 1UDOA 3ZZUA 1HR0I 2EMBA 2CG9A 3JAMC 2GO4A 4LFAE 3T1YI 4L8NA 4WSGA 4HYMA 1H73A 4M2ZA 3PS2A 4XTJA 4B3SI 3HQ1A 1YH8A 2ZITA 1BB8A 4DV3E 1BBOA 1ZXMA 2LV2A 1KYQA 4B3TE 4QNKA 4M9VC 3AUZA 5IXMB 2Z5CA 1Z5AA 5ELWA 4OO1C 4KQVA 1K47A 3B78A 2BR2A 3PYDA 2L2NA 3F0NA 4IS9A 2HC5A 2LUQA 2HK3A 1Z0WA 5LLQA 3K6QA 2GHFA 4DV4E 2EPCA 1OJ4A 3CDIA 4OZEA 4B3MI 2CPNA 4FW4A 4MLQA 2KONA 4N4RB 2HGHA 3OTOI 4PRVA 1Z1BA 2EMFA 1N0UA 4QNJA 2NN6D 2ENAA 3ADLA 1XXEA 1TF6A 1TN9A 2NN6E 2BM0A 4LF9I 2EORA 1A1HA 2NPFA 2YU5A 4WYQB 2YTIA 3ADJA 3LLHA 2YTNA 2ENHA 2PO2B 2VQFI 2GO3A 4F9AB 2J65A 5DRPA 1PJQA 3OTOE 3OMLA 4X64E 3NZKA 4OO1A 4LF7I 2J7JA 5A6KA 2EMGA 1ZU1A 3MHHC 4R2QA 1HNXI 3U1KA 3F6GA 2BBGA 4F9BB 1KVKA 4DV0I 4OKGA 3THNA 2JPAA 2M9AA 4BA2A 1OYSA 2DLKA 1A1KA 4WFTA 3EQ1A 1ZAAC 2HHHE 4P7DA 2HKJA 2EN8A 2YTGA 5KL3A 2B7TA 5L3JA 2L2MA 2AE8A 2YRKA 1IBKE 4YHHI 1Z0BA 5DRRA 3CDJA 4RH8A 3GLLA 1ELOA 2EMAA 3ZOQB 4IFDE 2LT7A 1UDQA 2RQLA 2UUAE 2JP9A 1IMUA 4K0KE 1R6LA 3PYGA 1ZM4A 4DPUA 4F9CB 2V83A 2EMXA 4F2JC 2LVHA 2EOMA 4O4KA 2BA0D 4DV6I 4JI7E 1VI7A 2I13A 2OI2A 4USMA 4NZVA 4YHHE 5JEAE 1XMQI 3QT7A 1YPNA 1H7UA 2EOJA 1EH6A 3QT5A 1Z0VA 3IWCA 4HY1A 1IQSA 2H36X 2B7VA 2M1SA 5KL7A 4LFBE 2WNRA 3PYEA 1A1FA 3VHTB 1G2FC 3KZYA 4X62I 4JI0I 3LNUA 2V2ZA 1JK1A 4MYTA 4GKKI 2N3GA 5AC4A 3J80Q 2EL5A 2MDGA 4DV1E 1P47A 1E3HA 1USUA 2E1RA 4U3DA 1T38A 4X8WA 3T1YE 1Z0GA 5GMDA 1HNZI 4LFAI 5K36B 4LF5E 3JAMQ 2C37A 2CVEA 2EQ1A 3H1CA 2PO0A 2EMYA 2KOUA 1Z59A 3UHMA 1ZBTA 2V2VA 4LFBI 4FWGA 1DARA 4R2CA 4LTYA 5JEAA 4U3BA 5LMUI 1A6FA 2HJJA 3M6AA 1HNWE 5TSEA 2HK2A 5K36F 3P3GA 2L3JA 5A6BD 2EPKX 1PJTA 2EM8A 2LTSA 2GLIA 2C38B 2CSHA 3RMPA 3D4JA 3PYFA 2EFGA 5A69A 4IFDB 3QG5C 2ZM6I 4JG4A 4DPTA 4UTGA 4USKA 4AQYI 4DV7I 2EPLX 1DI2A 3KRNA 2VF1A 1NHJA 3J7AM 4R2PA 4FW6A 4IFDF 2IHR1 1NHHA 4BCAA 3QT8A 4DPXA 2B9DA 1S4EA 4DPWA 2YZTA 1H72C 2EQ3A 3WU6A 2EOXA 5AE2A 4DUZE
chains in the Genus database with same CATH topology
3P06A 4IZJB 4DR6I 1UILA 1EKZA 4AQYE 4DV7E 4M30A 5IWAI 1FJGI 2UXDE 5FLXC 3J81C 2F8BA 2UU9I 3KWRA 4DV0E 3Q6MA 2LJHA 2UXCI 2O1VA 1I94E 4LF4E 1Z0CA 1MG7A 1USVA 2DB2A 1VISA 1Y4SA 1HK7A 3HJCA 4JI4I 4OOGC 1KTVA 1XMOI 4KHPI 2B3TB 2UUBE 1IBKI 2JY9A 2LE2A 2ODRD 2L2KB 4LF8E 2J7KA 1NZ0A 1I94I 4LF4I 4B3RE 4DKKA 2JR1A 3ADGA 3B8HA 1Z5CA 4DR5E 4JI8I 1UHZA 4KHPE 2GS8A 4R8OA 2A2CA 3FIGA 2CGEA 4RPFA 4DV5E 2V87A 2G7HA 4HACA 4B3TI 1IBME 2O1WA 4WSPA 3VK6A 2RSMA 4LFCE 2HFSA 3HXLA 4DR2I 3Q6NA 5F3WA 4DR5I 2FV4B 4P78A 4JI8E 1STUA 4DV1I 1MX0A 4NXMI 4M1KA 2YT4A 3J7Yp 5AE3A 4JI2I 3JU0A 1Z5BA 4WUCA 4X65I 4DR2E 1XHKA 2Z5EA 3VYXA 2V88A 2Z5BA 3B82A 2F4VI 1HR0E 2LTRA 2DEIA 1EA6A 1N32I 2ZM6E 5FWKA 1PKPA 4R03A 4JI5E 2PNLA 2NA2A 3J7AG 4UT4A 4X65E 2RTXA 1DQ3A 4F54A 4DR3I 4DUYE 2V8PA 3ZZTA 4P52A 4IZJD 2UXBI 5IT9C 4BMJA 2DIXA 1S16A 2A2DA 4DR6E 2HHHI 5ADZA 4BBYA 4M0VA 5BR8E 1J5EI 2LUPB 2UU9E 4DUYI 1ZM9A 4LF9E 2GQ0A 4JV5I 4WPYA 3T1HE 2XEXA 2UXBE 1PIEA 3V2UC 1FWLA 2K4VA 4K0KI 3JTZA 3HPZA 4DR7E 4GKJE 3PRYA 4DV6E 4JI7I 1KIJA 1HNXE 2MDRA 4JI3I 4N3OA 4EMDA 1N36I 1RREA 2LMZA 3QT6A 4OX9I 4DR4E 4PRXA 3HULA 2RS6A 2MC6A 3LMLA 4GKKE 4GKJI 5A2QQ 2FGGA 4LU9A 2NUGA 4I8OA 3J80C 4JYAE 5DNYA 1XNQI 4OX9E 3HPSA 2CZ9A 4DR4I 1UEKA 3Q1QA 2UUAI 2LBSB 2O1TA 4TUIA 4I3HA 4JI6I 3ZZ0A 2FTXB 1PVGA 3P1XA 4GEQB 4FWHA 1SR9A 2L33A 4TUGA 4IZKA 2DMYA 3MSWA 2BV3A 4JYAI 4NXME 1XNQE 2IOPA 4DV3I 3C4BA 1B62A 2M4IA 4JI6E 3K1JA 4J8ZA 2V89A 3ADIA 5AASA 1WXRA 5LMNI 4MYUA 1N0VC 4DR1E 2UUCE 1YZ9A 5AE1A 3C4TA 4LF5I 1FI4A 2VQEI 4YY3E 4R1FA 1RR9A 2E1MA 4DR3E 4WUBA 4JI5I 5T6JA 1HNWI 1GQEA 2Z5CB 2KHXA 1H74A 1Z0TA 3V5RA 1D6TA 3WU3A 2V2QA 3F6HA 4DR1I 2UUCI 2MC5A 2BM1A 4YY3I 3ZM7A 1Y6ZA 2WW4A 2LJPA 1IBLE 3HTXA 3T1HI 1J26A 3ZKBA 2JWOA 1KKHA 1QU6A 4DR7I 1FJGE 2UXDI 4Z7YA 1WHNA 4NXNI 1T4LB 1IBLI 4DV5I 2JOXA 2HFUA 2AJ4A 4BC9A 4JI1E 1N34E 1RQ0A 2RS7A 2V34A 1XMOE 2X36A 4NXNE 2JVAA 4LF8I 2V85A 2ODRC 1N33I 2EZ6A 2R3VA 4JI1I 4X66I 1NHIA 5CFFE 1WHQA 1MU5A 4DV2E 1YYOA 4Q28A 1U2RA 2DSYA 4LF6E 5GMEA 4Z7CA 2N3HA 4X66E 5LMUE 2L8TA 1T4NA 1EI1A 4LFCI 1ZXNA 4DV2I 2L6MA 2LRSA 1B63A 5LMNE 4URLA 3WU4A 4B3SE 1GZ6A 4KZSA 5A2QC 3K17A 3WU5A 1J5EE 4JI2E 3GONA 4X62E 4ZVIA 3IWBA 2NUEA 2Q2EB 4JV5E 2F4VE 1QZRA 1HNZE 1N32E 4DUZI 2V8QB 1XNRI 4DV4I 4B3ME 2E5LI 5LL6R 4BS9A 2O1UA 3CWVA 4P7AA 4DXLA 3IWDA 4L5NC 3DJWA 4DU7A 2UXCE 1Z0EA 1H7SA 2EWLA 4DMIA 1XNRE 2VQFE 2NUFA 2E5LE 1YYWA 1WUUA 4HXZA 2Z5BB 5BR8I 2M7QA 4JI4E 3K85A 4X64I 4IZJA 4LF7E 2L3CA 4ED4A 4DU8A 4DPYA 2VF3A 1RC7A 3ZKDA 1ZM2A 1N34I 1BKNA 3AV0A 5IWAE 5FLXQ 2X7IA 2VE7C 3J81Q 3VYYA 1YYKA 1ZBQA 1Y4UA 2HKEA 1T4OA 4JI3E 4FWDA 1N36E 2ZBKB 1FKAE 4WUDA 1X49A 1FWKA 1N33E 1ZM3A 3H4LA 4IZKB 1IBMI 2DEJA 5IT9Q 3DF6A 2IOQA 3LPSA 2R42A 2UUBI 1XMQE 3H09A 2PNMA 3LTOA 1X47A 4LF6I 2VQEE 1X48A 1O0WA 2JOBA 4B3RI 2L92A 2V86A 4FN5A 4PU9A 2WZOA 4JI0E 4BC7A 1FNMA 4HACB 4FW9A 3ZZUA 1HR0I 2CG9A 3JAMC 4LFAE 3T1YI 4L8NA 4HYMA 1H73A 4M2ZA 4XTJA 4B3SI 3HQ1A 2ZITA 4DV3E 1ZXMA 4B3TE 2Z5CA 3AUZA 1Z5AA 4KQVA 1K47A 3B78A 3PYDA 2L2NA 3F0NA 2LUQA 2HK3A 1Z0WA 3K6QA 4DV4E 1OJ4A 4B3MI 2CPNA 2KONA 3OTOI 4PRVA 1N0UA 3ADLA 4LF9I 2BM0A 2NPFA 3ADJA 4WYQB 3LLHA 2VQFI 4F9AB 3OTOE 3OMLA 4X64E 4LF7I 1HNXI 3F6GA 4F9BB 1KVKA 4DV0I 4WFTA 2HHHE 4P7DA 2HKJA 2B7TA 5L3JA 2L2MA 1IBKE 4YHHI 1Z0BA 1ELOA 3ZOQB 2UUAE 4K0KE 3PYGA 1ZM4A 4DPUA 4F9CB 2V83A 4DV6I 4JI7E 2OI2A 4USMA 4YHHE 1XMQI 3QT7A 1H7UA 4HY1A 3QT5A 1Z0VA 3IWCA 2H36X 2B7VA 2M1SA 4LFBE 3PYEA 4X62I 4JI0I 3LNUA 2V2ZA 4MYTA 4GKKI 2N3GA 3J80Q 1USUA 4DV1E 2E1RA 5GMDA 4X8WA 3T1YE 1Z0GA 1HNZI 4LFAI 4LF5E 3JAMQ 1Z59A 2KOUA 4LFBI 1ZBTA 2V2VA 4FWGA 1DARA 4LTYA 5LMUI 1A6FA 3M6AA 1HNWE 2HK2A 2L3JA 2LTSA 3RMPA 3D4JA 3PYFA 2EFGA 2ZM6I 4JG4A 4DPTA 4UTGA 4USKA 4AQYI 4DV7I 1DI2A 2VF1A 1NHJA 3J7AM 2IHR1 1NHHA 4BCAA 3QT8A 4DPXA 2B9DA 1S4EA 4DPWA 2YZTA 1H72C 3WU6A 5AE2A 4DUZE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR6 I;  1UIL A;  1EKZ A;  4AQY E;  4DV7 E;  4M30 A;  5IWA I;  1FJG I;  2UXD E;  5FLX C;  3J81 C;  2UU9 I;  4DV0 E;  2LJH A;  2UXC I;  1I94 E;  4LF4 E;  1Z0C A;  1MG7 A;  2DB2 A;  1VIS A;  4JI4 I;  4OOG C;  1KTV A;  1XMO I;  4KHP I;  2B3T B;  2UUB E;  1IBK I;  2JY9 A;  2L2K B;  4LF8 E;  2J7K A;  1NZ0 A;  1I94 I;  4LF4 I;  4B3R E;  4DKK A;  3ADG A;  3B8H A;  1Z5C A;  4DR5 E;  4JI8 I;  1UHZ A;  4KHP E;  2GS8 A;  2A2C A;  4RPF A;  4DV5 E;  4HAC A;  4B3T I;  1IBM E;  4LFC E;  2HFS A;  2RSM A;  4DR2 I;  4DR5 I;  4JI8 E;  1STU A;  4DV1 I;  1MX0 A;  4NXM I;  4M1K A;  2YT4 A;  3J7Y p;  4JI2 I;  1Z5B A;  4WUC A;  4X65 I;  4DR2 E;  1XHK A;  3VYX A;  3B82 A;  2F4V I;  1HR0 E;  2LTR A;  2DEI A;  1EA6 A;  1N32 I;  2ZM6 E;  1PKP A;  4JI5 E;  4DR3 I;  2NA2 A;  4UT4 A;  3J7A G;  4X65 E;  2RTX A;  4DUY E;  2V8P A;  3ZZT A;  4P52 A;  2UXB I;  5IT9 C;  2DIX A;  1S16 A;  2A2D A;  4DR6 E;  2HHH I;  5BR8 E;  1J5E I;  2LUP B;  2UU9 E;  4DUY I;  1ZM9 A;  4LF9 E;  4JV5 I;  3T1H E;  2XEX A;  2UXB E;  1PIE A;  3V2U C;  1FWL A;  4K0K I;  4DR7 E;  4GKJ E;  4DV6 E;  4JI7 I;  2MDR A;  1KIJ A;  1HNX E;  4JI3 I;  4EMD A;  1N36 I;  1RRE A;  3QT6 A;  4OX9 I;  4DR4 E;  4PRX A;  3HUL A;  2RS6 A;  4GKK E;  4GKJ I;  5A2Q Q;  2NUG A;  3J80 C;  4JYA E;  1XNQ I;  4OX9 E;  2CZ9 A;  4DR4 I;  1UEK A;  3Q1Q A;  2UUA I;  2LBS B;  4I3H A;  4JI6 I;  3ZZ0 A;  1PVG A;  3P1X A;  4FWH A;  2L33 A;  2DMY A;  2BV3 A;  4JYA I;  4NXM E;  1XNQ E;  4DV3 I;  3C4B A;  1B62 A;  3K1J A;  4JI6 E;  3ADI A;  5LMN I;  4MYU A;  1N0V C;  4DR1 E;  2UUC E;  1YZ9 A;  3C4T A;  4LF5 I;  1FI4 A;  2VQE I;  4YY3 E;  4R1F A;  1RR9 A;  4DR3 E;  4WUB A;  4JI5 I;  1HNW I;  1GQE A;  2KHX A;  1H74 A;  1Z0T A;  3V5R A;  1D6T A;  3WU3 A;  2V2Q A;  4DR1 I;  2UUC I;  2BM1 A;  4YY3 I;  3ZM7 A;  2WW4 A;  2LJP A;  1IBL E;  3HTX A;  3T1H I;  1J26 A;  3ZKB A;  1KKH A;  1QU6 A;  4DR7 I;  1FJG E;  2UXD I;  4Z7Y A;  1WHN A;  4NXN I;  1T4L B;  1IBL I;  4DV5 I;  2HFU A;  2AJ4 A;  4JI1 E;  1N34 E;  1RQ0 A;  2RS7 A;  2V34 A;  1XMO E;  2X36 A;  4NXN E;  2JVA A;  4LF8 I;  1N33 I;  2EZ6 A;  2R3V A;  4JI1 I;  4X66 I;  1NHI A;  5CFF E;  1WHQ A;  1MU5 A;  4DV2 E;  1YYO A;  1U2R A;  4LF6 E;  5GME A;  4Z7C A;  2N3H A;  4X66 E;  5LMU E;  4LFC I;  1T4N A;  1EI1 A;  1ZXN A;  4DV2 I;  2LRS A;  1B63 A;  5LMN E;  4URL A;  3WU4 A;  4B3S E;  5A2Q C;  3WU5 A;  3K17 A;  1J5E E;  4JI2 E;  3GON A;  4X62 E;  4ZVI A;  2NUE A;  2Q2E B;  4JV5 E;  2F4V E;  1QZR A;  1HNZ E;  1N32 E;  4DUZ I;  1XNR I;  4DV4 I;  4B3M E;  2E5L I;  5LL6 R;  3CWV A;  4P7A A;  4DXL A;  4DU7 A;  2UXC E;  1Z0E A;  1H7S A;  1XNR E;  2VQF E;  2NUF A;  2E5L E;  1YYW A;  1WUU A;  4HXZ A;  5BR8 I;  4JI4 E;  4X64 I;  4LF7 E;  2L3C A;  4ED4 A;  4DU8 A;  4DPY A;  2VF3 A;  1RC7 A;  3ZKD A;  1ZM2 A;  1N34 I;  1BKN A;  5IWA E;  5FLX Q;  2X7I A;  3J81 Q;  3VYY A;  1YYK A;  2HKE A;  1T4O A;  4JI3 E;  4FWD A;  1N36 E;  2ZBK B;  1FKA E;  4WUD A;  1X49 A;  1FWK A;  1N33 E;  1ZM3 A;  3H4L A;  1IBM I;  2DEJ A;  5IT9 Q;  3LPS A;  2R42 A;  2UUB I;  1XMQ E;  3LTO A;  1X47 A;  4LF6 I;  2VQE E;  1X48 A;  1O0W A;  4B3R I;  4FN5 A;  4PU9 A;  4JI0 E;  1FNM A;  4HAC B;  4FW9 A;  3ZZU A;  1HR0 I;  3JAM C;  4LFA E;  3T1Y I;  4HYM A;  1H73 A;  4M2Z A;  4XTJ A;  4B3S I;  2ZIT A;  1ZXM A;  4DV3 E;  4B3T E;  1Z5A A;  4KQV A;  1K47 A;  3B78 A;  3PYD A;  2L2N A;  3F0N A;  2LUQ A;  2HK3 A;  1Z0W A;  4DV4 E;  1OJ4 A;  4B3M I;  2CPN A;  3OTO I;  4PRV A;  1N0U A;  3ADL A;  4LF9 I;  2BM0 A;  2NPF A;  3ADJ A;  4WYQ B;  3LLH A;  2VQF I;  3OTO E;  4X64 E;  4LF7 I;  1HNX I;  1KVK A;  4DV0 I;  4WFT A;  2HHH E;  2HKJ A;  2B7T A;  5L3J A;  2L2M A;  1IBK E;  4YHH I;  1Z0B A;  1ELO A;  2UUA E;  4K0K E;  3PYG A;  1ZM4 A;  4DPU A;  4DV6 I;  4JI7 E;  2OI2 A;  4USM A;  4YHH E;  1XMQ I;  3QT7 A;  1H7U A;  4HY1 A;  3QT5 A;  1Z0V A;  3PYE A;  2B7V A;  4LFB E;  4X62 I;  4JI0 I;  3LNU A;  2V2Z A;  4MYT A;  4GKK I;  2N3G A;  3J80 Q;  4DV1 E;  2E1R A;  5GMD A;  4X8W A;  3T1Y E;  1Z0G A;  1HNZ I;  4LFA I;  4LF5 E;  3JAM Q;  1Z59 A;  4LFB I;  1ZBT A;  2V2V A;  4FWG A;  1DAR A;  5LMU I;  1A6F A;  3M6A A;  1HNW E;  2HK2 A;  2L3J A;  2LTS A;  3D4J A;  3PYF A;  2EFG A;  2ZM6 I;  4JG4 A;  4DPT A;  4UTG A;  4USK A;  4AQY I;  4DV7 I;  1DI2 A;  1NHJ A;  3J7A M;  2IHR 1;  1NHH A;  3QT8 A;  4DPX A;  1S4E A;  4DPW A;  1H72 C;  3WU6 A;  4DUZ E; 
#chains in the Genus database with same CATH topology
 3P06 A;  4IZJ B;  4DR6 I;  1UIL A;  1DGC A;  3M99 B;  2EN4 A;  4AQY E;  4DV7 E;  4M30 A;  1EKZ A;  5DNX A;  5IWA I;  2EN2 A;  5KL4 A;  2EMZ A;  1FJG I;  2EL4 A;  2UXD E;  5FLX C;  3J81 C;  2F8B A;  2UU9 I;  3KWR A;  5C0X D;  1MEY C;  4DV0 E;  3Q6M A;  2LJH A;  3TQM A;  2EOI A;  2O1V A;  2UXC I;  2JEA A;  1I94 E;  4LF4 E;  1Z0C A;  2F1D A;  4HEI A;  1MG7 A;  1USV A;  2DB2 A;  1VIS A;  1Y4S A;  5EKW A;  3L7Z A;  1HK7 A;  1UBD C;  3HJC A;  4JI4 I;  4OOG C;  1KTV A;  1XMO I;  2EP3 A;  4KWY A;  2RPC A;  5K36 E;  4KHP I;  2B3T B;  2UUB E;  1IBK I;  4AM3 A;  2JY9 A;  2LE2 A;  2ODR D;  2L2K B;  4LF8 E;  2J7K A;  3BBG A;  1NZ0 A;  1I94 I;  4LF4 I;  3KZZ A;  2VRD A;  4B3R E;  1OYR A;  3M7N D;  4DKK A;  4WX9 A;  3UK3 C;  3B4T A;  4OO1 D;  2JR1 A;  3ADG A;  3B8H A;  1Z5C A;  4DR5 E;  4JI8 I;  1UHZ A;  2EMI A;  4KHP E;  2GS8 A;  4R2D A;  4R8O A;  2A2C A;  3FIG A;  2NAB A;  2CGE A;  4RPF A;  2A25 A;  4DV5 E;  2V87 A;  2C39 B;  2PNZ A;  1QNT A;  2G7H A;  4HAC A;  4B3T I;  2YTP A;  2JE6 A;  1IBM E;  4BA1 B;  2O1W A;  4WSP A;  3VK6 A;  2RSM A;  4LFC E;  2HFS A;  3HXL A;  4DR2 I;  3Q6N A;  5F3W A;  4DR5 I;  2FV4 B;  4P78 A;  4JI8 E;  1STU A;  2EPA A;  4DV1 I;  1MX0 A;  2YRM A;  4GQU A;  4NXM I;  5IV8 B;  4BHC A;  4M1K A;  2YT4 A;  3J7Y p;  5DRQ A;  2BR2 B;  5AE3 A;  4OO1 E;  2YSP A;  3C6K A;  3JU0 A;  2ADR A;  4JI2 I;  3PS3 A;  1Z5B A;  4WUC A;  4X65 I;  2K7I A;  4DR2 E;  2EM5 A;  1XHK A;  2EE8 A;  2YU8 A;  3VYX A;  2JEB A;  1SFE A;  2Z5E A;  2BA1 G;  2V88 A;  2Z5B A;  4ZYE A;  5AC5 A;  2EPU A;  3B82 A;  1HR0 E;  2LTR A;  2DEI A;  1EA6 A;  5C0X A;  3MHS C;  2F4V I;  2EM7 A;  2EJ4 A;  1N32 I;  2EOF A;  2ZM6 E;  5FWK A;  4WXC A;  2VES A;  2ELZ A;  1PKP A;  4LCG A;  2EML A;  4R03 A;  3C6M A;  4JI5 E;  2PNL A;  2NA2 A;  3J7A G;  4UT4 A;  4X65 E;  2RTX A;  1DQ3 A;  4F54 A;  4DR3 I;  2CT1 A;  4DUY E;  2V8P A;  4AIM A;  3ZZT A;  4P52 A;  4IZJ D;  2UXB I;  5IT9 C;  4BMJ A;  2DIX A;  2NN6 A;  1S16 A;  2A2D A;  4DR6 E;  2HHH I;  3M85 D;  5ADZ A;  4BBY A;  2WP8 B;  4M0V A;  5BR8 E;  1F2I G;  1J5E I;  2LUP B;  1RHY A;  2ELY A;  2UU9 E;  1YFH A;  4AID A;  2EN7 A;  4DUY I;  2LJU A;  1ZM9 A;  4LF9 E;  2GQ0 A;  1NCS A;  2JXP A;  4JV5 I;  1E3P A;  4WPY A;  1EH7 A;  3T1H E;  2D9H A;  2XEX A;  2UXB E;  1PIE A;  4LCH A;  3V2U C;  2YTE A;  3EPJ A;  1FWL A;  1NEI A;  2EN3 A;  2K4V A;  1PDA A;  4K0K I;  1ZR9 A;  3JTZ A;  3HPZ A;  1UDN A;  4DR7 E;  4GKJ E;  4NBQ A;  3PRY A;  4DV6 E;  4JI7 I;  4O5G A;  2MDR A;  1HNX E;  1KIJ A;  4JI3 I;  4N3O A;  4EMD A;  1N36 I;  1RRE A;  2LMZ A;  2IER A;  3QT6 A;  4OX9 I;  4DR4 E;  4PRX A;  3HUL A;  2RS6 A;  2EOS A;  2MC6 A;  2EPO A;  2DRP A;  3M85 G;  2E72 A;  3LML A;  2O3Z A;  4GKK E;  4MU1 A;  5A2Q Q;  2FGG A;  4LU9 A;  4GKJ I;  4GZN C;  2NUG A;  4I8O A;  3J80 C;  2NN6 F;  4JYA E;  5DNY A;  1XNQ I;  4OX9 E;  2EOY A;  3HPS A;  2EN1 A;  3BID A;  1KJK A;  4R2A A;  1UEK A;  1R6M A;  2CZ9 A;  4LPF A;  2EOH A;  2UUA I;  2DMI A;  3Q1Q A;  2LBS B;  2O1T A;  4TUI A;  2YRH A;  4I3H A;  4JI6 I;  3ZZ0 A;  1YSA C;  2ENC A;  2FTX B;  1PVG A;  3P1X A;  1IQO A;  4GEQ B;  4FWH A;  2PRT A;  2YTJ A;  1SR9 A;  4R2R A;  2L33 A;  4TUG A;  4IZK A;  2DMY A;  3MSW A;  4FK5 C;  2PO1 B;  2BB8 A;  2BV3 A;  1X5W A;  5C0X E;  4JYA I;  4NXM E;  1X3C A;  4Q35 B;  4IFD D;  1XNQ E;  2IOP A;  2EOZ A;  4F6M A;  5JEA B;  4DV3 I;  3C4B A;  4MU4 A;  4X9J A;  1B62 A;  4FW3 A;  4MQY A;  2M4I A;  4JI6 E;  2EQ0 A;  3K1J A;  4J8Z A;  2V89 A;  3ADI A;  1WJP A;  2YTD A;  2YTQ A;  3EPL A;  5AAS A;  4OO1 F;  1WXR A;  1EH8 A;  2EMC A;  4MYU A;  5LMN I;  1N0V C;  4DR1 E;  2UUC E;  4OO1 B;  2EMK A;  1YZ9 A;  1X6E A;  3C4T A;  5AE1 A;  4LF5 I;  1FI4 A;  5A6B A;  2VQE I;  2EMW A;  3ECR A;  4YY3 E;  5DNL A;  4J3D A;  4R1F A;  1RR9 A;  1A1G A;  2E1M A;  4DR3 E;  1Y5Y A;  4WUB A;  2JYA A;  1L4S A;  4JI5 I;  4BA2 B;  2BA1 D;  5T6J A;  1HNW I;  4ZYH A;  3U1Y A;  1GQE A;  2YWQ A;  2Z5C B;  2KHX A;  1H74 A;  1Z0T A;  5EL9 A;  5JEA C;  3V5R A;  2MKD A;  1PJS A;  3EPK A;  3WU3 A;  5K36 C;  1D6T A;  2V2Q A;  3F6H A;  4DR1 I;  2UUC I;  2LO3 A;  3BGH A;  2MC5 A;  2IES A;  1GTK A;  2BM1 A;  4YY3 I;  3ZM7 A;  5K36 A;  4O24 A;  2YSO A;  1Y6Z A;  2WW4 A;  5JEA F;  2PO0 B;  2LJP A;  3DD6 A;  1IBL E;  3HTX A;  3T1H I;  1J26 A;  3L00 A;  3ZKB A;  2JWO A;  1A1I A;  1KKH A;  5KL5 A;  2N8X A;  1TF3 A;  2EMH A;  2BA0 G;  1QU6 A;  2C38 A;  2PO2 A;  1YHC A;  1FJG E;  4DR7 I;  2UXD I;  1AAY A;  4Z7Y A;  2WNR B;  1WHN A;  2EPZ A;  2YPN A;  2WBS A;  2WCC 3;  4NXN I;  5K36 D;  1T4L B;  1IBL I;  4DV5 I;  2JOX A;  2HFU A;  4ZYD A;  2AJ4 A;  4BC9 A;  2WBT A;  4NHR A;  4JI1 E;  1N34 E;  1RQ0 A;  2RS7 A;  1X6H A;  3EPH A;  2V34 A;  1XMO E;  2X36 A;  3PS1 A;  2DLQ A;  1A1J A;  3HKM A;  4NXN E;  2PNZ B;  2EM2 A;  2JVA A;  4ZYG A;  4LF8 I;  2V85 A;  2ODR C;  1N33 I;  2EOE A;  2EZ6 A;  4MDT A;  2I9I A;  2R3V A;  3THO B;  4LCF A;  4JI1 I;  4X66 I;  1NHI A;  4IFD A;  5CFF E;  3P3E A;  1WHQ A;  4MLV A;  1MU5 A;  4DV2 E;  1YYO A;  4IS1 C;  1X6F A;  2LCE A;  4Q28 A;  5C0X F;  1U2R A;  4MU3 A;  2DSY A;  4LF6 E;  1UN6 B;  5GME A;  1Y60 A;  4Z7C A;  1AH5 A;  2N3H A;  4X66 E;  4DR4 I;  5LMU E;  5C0X B;  2L8T A;  1T4N A;  1EI1 A;  4LFC I;  1ZXN A;  4DV2 I;  2L6M A;  2LRS A;  2EM4 A;  2RSI A;  1B63 A;  5LMN E;  4URL A;  1B69 A;  4R2E A;  1LLM C;  3WU4 A;  4B3S E;  1T39 A;  2DGC A;  1GZ6 A;  2GPI A;  2Q8U A;  4HTG A;  4KZS A;  1BBG A;  5A2Q C;  3K17 A;  3WU5 A;  1J5E E;  4JI2 E;  3GON A;  4X62 E;  2C37 B;  4BHB A;  2JEA B;  4ZVI A;  4IFD C;  3IWB A;  1YUJ A;  2NUE A;  2Q2E B;  1WRJ A;  4JV5 E;  2F4V E;  1QZR A;  2R76 A;  1HNZ E;  1N32 E;  4DUZ I;  2V8Q B;  1G2D C;  4DV4 I;  1XNR I;  2EM9 A;  4B3M E;  5C0X C;  5LL6 R;  2E5L I;  4BS9 A;  2O1U A;  3CWV A;  3GME A;  2EM3 A;  4FW5 A;  4P7A A;  2EPN A;  3BF2 A;  1A1L A;  4DXL A;  2EL6 A;  3IWD A;  5DRO A;  5JEA D;  3M7N G;  4L5N C;  3DJW A;  4IJD A;  4DU7 A;  1OYP A;  2EN6 A;  2UXC E;  1Z0E A;  1JK2 A;  1H7S A;  2EWL A;  4DMI A;  1XNR E;  2VQF E;  2NUF A;  2E5L E;  1YYW A;  1WUU A;  2JEB B;  4HXZ A;  2Z5B B;  5BR8 I;  2M7Q A;  4JI4 E;  3K85 A;  2C39 A;  4X64 I;  4IZJ A;  4F6N A;  4LF7 E;  2EOO A;  1P42 A;  2L3C A;  4ED4 A;  4RHB B;  4DU8 A;  4DPY A;  2VF3 A;  1RMD A;  1RC7 A;  3ZKD A;  4BA1 A;  2EPM X;  4FW7 A;  2EOQ A;  2MKN A;  4WXD A;  2JT2 A;  2YTO A;  4LOM A;  1ZM2 A;  1N34 I;  1BKN A;  3AV0 A;  2EM6 A;  5IWA E;  2X7I A;  2VE7 C;  5FLX Q;  3VYY A;  1YYK A;  3J81 Q;  1ZBQ A;  1Y4U A;  3P76 A;  2EPR A;  2NN6 B;  3L7Z B;  2HKE A;  1T4O A;  3GCM A;  4JI3 E;  4FWD A;  5A6A A;  1N36 E;  1UDS A;  1FKA E;  2ZBK B;  4WUD A;  1X49 A;  2CTD A;  1N33 E;  1FWK A;  1ZM3 A;  5A6J A;  3H4L A;  5KL6 A;  4IZK B;  1IBM I;  4R2S A;  2DEJ A;  2PO1 A;  3P3C A;  2EM0 A;  5IT9 Q;  2WBU A;  3DF6 A;  2IOQ A;  3LPS A;  2R42 A;  4MU0 A;  2UUB I;  1XMQ E;  2EPX A;  3H09 A;  2PNM A;  3LTO A;  2YTF A;  1X47 A;  4LF6 I;  2VQE E;  1X48 A;  1O0W A;  4ISA A;  4O43 A;  2JOB A;  2NN6 C;  2L92 A;  4B3R I;  2V86 A;  4FN5 A;  2EPP A;  4PU9 A;  2WZO A;  5KL2 A;  4JI0 E;  1N3G A;  4BC7 A;  1MGT A;  2R1F A;  1FNM A;  4HAC B;  1YUI A;  2JE6 B;  4FW9 A;  2WP8 A;  1UDO A;  3ZZU A;  1HR0 I;  2EMB A;  2CG9 A;  3JAM C;  2GO4 A;  4LFA E;  3T1Y I;  4L8N A;  4WSG A;  4HYM A;  1H73 A;  4M2Z A;  3PS2 A;  4XTJ A;  4B3S I;  3HQ1 A;  1YH8 A;  2ZIT A;  1BB8 A;  4DV3 E;  1BBO A;  1ZXM A;  2LV2 A;  1KYQ A;  4B3T E;  4QNK A;  4M9V C;  3AUZ A;  5IXM B;  2Z5C A;  1Z5A A;  5ELW A;  4OO1 C;  4KQV A;  1K47 A;  3B78 A;  2BR2 A;  3PYD A;  2L2N A;  3F0N A;  4IS9 A;  2HC5 A;  2LUQ A;  2HK3 A;  1Z0W A;  5LLQ A;  3K6Q A;  2GHF A;  4DV4 E;  2EPC A;  1OJ4 A;  3CDI A;  4OZE A;  4B3M I;  2CPN A;  4FW4 A;  4MLQ A;  2KON A;  4N4R B;  2HGH A;  3OTO I;  4PRV A;  1Z1B A;  2EMF A;  1N0U A;  4QNJ A;  2NN6 D;  2ENA A;  3ADL A;  1XXE A;  1TF6 A;  1TN9 A;  2NN6 E;  2BM0 A;  4LF9 I;  2EOR A;  1A1H A;  2NPF A;  2YU5 A;  4WYQ B;  2YTI A;  3ADJ A;  3LLH A;  2YTN A;  2ENH A;  2PO2 B;  2VQF I;  2GO3 A;  4F9A B;  2J65 A;  5DRP A;  1PJQ A;  3OTO E;  3OML A;  4X64 E;  3NZK A;  4OO1 A;  4LF7 I;  2J7J A;  5A6K A;  2EMG A;  1ZU1 A;  3MHH C;  4R2Q A;  1HNX I;  3U1K A;  3F6G A;  2BBG A;  4F9B B;  1KVK A;  4DV0 I;  4OKG A;  3THN A;  2JPA A;  2M9A A;  4BA2 A;  1OYS A;  2DLK A;  1A1K A;  4WFT A;  3EQ1 A;  1ZAA C;  2HHH E;  4P7D A;  2HKJ A;  2EN8 A;  2YTG A;  5KL3 A;  2B7T A;  5L3J A;  2L2M A;  2AE8 A;  2YRK A;  1IBK E;  4YHH I;  1Z0B A;  5DRR A;  3CDJ A;  4RH8 A;  3GLL A;  1ELO A;  2EMA A;  3ZOQ B;  4IFD E;  2LT7 A;  1UDQ A;  2RQL A;  2UUA E;  2JP9 A;  1IMU A;  4K0K E;  1R6L A;  3PYG A;  1ZM4 A;  4DPU A;  4F9C B;  2V83 A;  2EMX A;  4F2J C;  2LVH A;  2EOM A;  4O4K A;  2BA0 D;  4DV6 I;  4JI7 E;  1VI7 A;  2I13 A;  2OI2 A;  4USM A;  4NZV A;  4YHH E;  5JEA E;  1XMQ I;  3QT7 A;  1YPN A;  1H7U A;  2EOJ A;  1EH6 A;  3QT5 A;  1Z0V A;  3IWC A;  4HY1 A;  1IQS A;  2H36 X;  2B7V A;  2M1S A;  5KL7 A;  4LFB E;  2WNR A;  3PYE A;  1A1F A;  3VHT B;  1G2F C;  3KZY A;  4X62 I;  4JI0 I;  3LNU A;  2V2Z A;  1JK1 A;  4MYT A;  4GKK I;  2N3G A;  5AC4 A;  3J80 Q;  2EL5 A;  2MDG A;  4DV1 E;  1P47 A;  1E3H A;  1USU A;  2E1R A;  4U3D A;  1T38 A;  4X8W A;  3T1Y E;  1Z0G A;  5GMD A;  1HNZ I;  4LFA I;  5K36 B;  4LF5 E;  3JAM Q;  2C37 A;  2CVE A;  2EQ1 A;  3H1C A;  2PO0 A;  2EMY A;  2KOU A;  1Z59 A;  3UHM A;  1ZBT A;  2V2V A;  4LFB I;  4FWG A;  1DAR A;  4R2C A;  4LTY A;  5JEA A;  4U3B A;  5LMU I;  1A6F A;  2HJJ A;  3M6A A;  1HNW E;  5TSE A;  2HK2 A;  5K36 F;  3P3G A;  2L3J A;  5A6B D;  2EPK X;  1PJT A;  2EM8 A;  2LTS A;  2GLI A;  2C38 B;  2CSH A;  3RMP A;  3D4J A;  3PYF A;  2EFG A;  5A69 A;  4IFD B;  3QG5 C;  2ZM6 I;  4JG4 A;  4DPT A;  4UTG A;  4USK A;  4AQY I;  4DV7 I;  2EPL X;  1DI2 A;  3KRN A;  2VF1 A;  1NHJ A;  3J7A M;  4R2P A;  4FW6 A;  4IFD F;  2IHR 1;  1NHH A;  4BCA A;  3QT8 A;  4DPX A;  2B9D A;  1S4E A;  4DPW A;  2YZT A;  1H72 C;  2EQ3 A;  3WU6 A;  2EOX A;  5AE2 A;  4DUZ E; 
#chains in the Genus database with same CATH homology
 3P06 A;  4IZJ B;  4DR6 I;  1UIL A;  1EKZ A;  4AQY E;  4DV7 E;  4M30 A;  5IWA I;  1FJG I;  2UXD E;  5FLX C;  3J81 C;  2F8B A;  2UU9 I;  3KWR A;  4DV0 E;  3Q6M A;  2LJH A;  2UXC I;  2O1V A;  1I94 E;  4LF4 E;  1Z0C A;  1MG7 A;  1USV A;  2DB2 A;  1VIS A;  1Y4S A;  1HK7 A;  3HJC A;  4JI4 I;  4OOG C;  1KTV A;  1XMO I;  4KHP I;  2B3T B;  2UUB E;  1IBK I;  2JY9 A;  2LE2 A;  2ODR D;  2L2K B;  4LF8 E;  2J7K A;  1NZ0 A;  1I94 I;  4LF4 I;  4B3R E;  4DKK A;  2JR1 A;  3ADG A;  3B8H A;  1Z5C A;  4DR5 E;  4JI8 I;  1UHZ A;  4KHP E;  2GS8 A;  4R8O A;  2A2C A;  3FIG A;  2CGE A;  4RPF A;  4DV5 E;  2V87 A;  2G7H A;  4HAC A;  4B3T I;  1IBM E;  2O1W A;  4WSP A;  3VK6 A;  2RSM A;  4LFC E;  2HFS A;  3HXL A;  4DR2 I;  3Q6N A;  5F3W A;  4DR5 I;  2FV4 B;  4P78 A;  4JI8 E;  1STU A;  4DV1 I;  1MX0 A;  4NXM I;  4M1K A;  2YT4 A;  3J7Y p;  5AE3 A;  4JI2 I;  3JU0 A;  1Z5B A;  4WUC A;  4X65 I;  4DR2 E;  1XHK A;  2Z5E A;  3VYX A;  2V88 A;  2Z5B A;  3B82 A;  2F4V I;  1HR0 E;  2LTR A;  2DEI A;  1EA6 A;  1N32 I;  2ZM6 E;  5FWK A;  1PKP A;  4R03 A;  4JI5 E;  2PNL A;  2NA2 A;  3J7A G;  4UT4 A;  4X65 E;  2RTX A;  1DQ3 A;  4F54 A;  4DR3 I;  4DUY E;  2V8P A;  3ZZT A;  4P52 A;  4IZJ D;  2UXB I;  5IT9 C;  4BMJ A;  2DIX A;  1S16 A;  2A2D A;  4DR6 E;  2HHH I;  5ADZ A;  4BBY A;  4M0V A;  5BR8 E;  1J5E I;  2LUP B;  2UU9 E;  4DUY I;  1ZM9 A;  4LF9 E;  2GQ0 A;  4JV5 I;  4WPY A;  3T1H E;  2XEX A;  2UXB E;  1PIE A;  3V2U C;  1FWL A;  2K4V A;  4K0K I;  3JTZ A;  3HPZ A;  4DR7 E;  4GKJ E;  3PRY A;  4DV6 E;  4JI7 I;  1KIJ A;  1HNX E;  2MDR A;  4JI3 I;  4N3O A;  4EMD A;  1N36 I;  1RRE A;  2LMZ A;  3QT6 A;  4OX9 I;  4DR4 E;  4PRX A;  3HUL A;  2RS6 A;  2MC6 A;  3LML A;  4GKK E;  4GKJ I;  5A2Q Q;  2FGG A;  4LU9 A;  2NUG A;  4I8O A;  3J80 C;  4JYA E;  5DNY A;  1XNQ I;  4OX9 E;  3HPS A;  2CZ9 A;  4DR4 I;  1UEK A;  3Q1Q A;  2UUA I;  2LBS B;  2O1T A;  4TUI A;  4I3H A;  4JI6 I;  3ZZ0 A;  2FTX B;  1PVG A;  3P1X A;  4GEQ B;  4FWH A;  1SR9 A;  2L33 A;  4TUG A;  4IZK A;  2DMY A;  3MSW A;  2BV3 A;  4JYA I;  4NXM E;  1XNQ E;  2IOP A;  4DV3 I;  3C4B A;  1B62 A;  2M4I A;  4JI6 E;  3K1J A;  4J8Z A;  2V89 A;  3ADI A;  5AAS A;  1WXR A;  5LMN I;  4MYU A;  1N0V C;  4DR1 E;  2UUC E;  1YZ9 A;  5AE1 A;  3C4T A;  4LF5 I;  1FI4 A;  2VQE I;  4YY3 E;  4R1F A;  1RR9 A;  2E1M A;  4DR3 E;  4WUB A;  4JI5 I;  5T6J A;  1HNW I;  1GQE A;  2Z5C B;  2KHX A;  1H74 A;  1Z0T A;  3V5R A;  1D6T A;  3WU3 A;  2V2Q A;  3F6H A;  4DR1 I;  2UUC I;  2MC5 A;  2BM1 A;  4YY3 I;  3ZM7 A;  1Y6Z A;  2WW4 A;  2LJP A;  1IBL E;  3HTX A;  3T1H I;  1J26 A;  3ZKB A;  2JWO A;  1KKH A;  1QU6 A;  4DR7 I;  1FJG E;  2UXD I;  4Z7Y A;  1WHN A;  4NXN I;  1T4L B;  1IBL I;  4DV5 I;  2JOX A;  2HFU A;  2AJ4 A;  4BC9 A;  4JI1 E;  1N34 E;  1RQ0 A;  2RS7 A;  2V34 A;  1XMO E;  2X36 A;  4NXN E;  2JVA A;  4LF8 I;  2V85 A;  2ODR C;  1N33 I;  2EZ6 A;  2R3V A;  4JI1 I;  4X66 I;  1NHI A;  5CFF E;  1WHQ A;  1MU5 A;  4DV2 E;  1YYO A;  4Q28 A;  1U2R A;  2DSY A;  4LF6 E;  5GME A;  4Z7C A;  2N3H A;  4X66 E;  5LMU E;  2L8T A;  1T4N A;  1EI1 A;  4LFC I;  1ZXN A;  4DV2 I;  2L6M A;  2LRS A;  1B63 A;  5LMN E;  4URL A;  3WU4 A;  4B3S E;  1GZ6 A;  4KZS A;  5A2Q C;  3K17 A;  3WU5 A;  1J5E E;  4JI2 E;  3GON A;  4X62 E;  4ZVI A;  3IWB A;  2NUE A;  2Q2E B;  4JV5 E;  2F4V E;  1QZR A;  1HNZ E;  1N32 E;  4DUZ I;  2V8Q B;  1XNR I;  4DV4 I;  4B3M E;  2E5L I;  5LL6 R;  4BS9 A;  2O1U A;  3CWV A;  4P7A A;  4DXL A;  3IWD A;  4L5N C;  3DJW A;  4DU7 A;  2UXC E;  1Z0E A;  1H7S A;  2EWL A;  4DMI A;  1XNR E;  2VQF E;  2NUF A;  2E5L E;  1YYW A;  1WUU A;  4HXZ A;  2Z5B B;  5BR8 I;  2M7Q A;  4JI4 E;  3K85 A;  4X64 I;  4IZJ A;  4LF7 E;  2L3C A;  4ED4 A;  4DU8 A;  4DPY A;  2VF3 A;  1RC7 A;  3ZKD A;  1ZM2 A;  1N34 I;  1BKN A;  3AV0 A;  5IWA E;  5FLX Q;  2X7I A;  2VE7 C;  3J81 Q;  3VYY A;  1YYK A;  1ZBQ A;  1Y4U A;  2HKE A;  1T4O A;  4JI3 E;  4FWD A;  1N36 E;  2ZBK B;  1FKA E;  4WUD A;  1X49 A;  1FWK A;  1N33 E;  1ZM3 A;  3H4L A;  4IZK B;  1IBM I;  2DEJ A;  5IT9 Q;  3DF6 A;  2IOQ A;  3LPS A;  2R42 A;  2UUB I;  1XMQ E;  3H09 A;  2PNM A;  3LTO A;  1X47 A;  4LF6 I;  2VQE E;  1X48 A;  1O0W A;  2JOB A;  4B3R I;  2L92 A;  2V86 A;  4FN5 A;  4PU9 A;  2WZO A;  4JI0 E;  4BC7 A;  1FNM A;  4HAC B;  4FW9 A;  3ZZU A;  1HR0 I;  2CG9 A;  3JAM C;  4LFA E;  3T1Y I;  4L8N A;  4HYM A;  1H73 A;  4M2Z A;  4XTJ A;  4B3S I;  3HQ1 A;  2ZIT A;  4DV3 E;  1ZXM A;  4B3T E;  2Z5C A;  3AUZ A;  1Z5A A;  4KQV A;  1K47 A;  3B78 A;  3PYD A;  2L2N A;  3F0N A;  2LUQ A;  2HK3 A;  1Z0W A;  3K6Q A;  4DV4 E;  1OJ4 A;  4B3M I;  2CPN A;  2KON A;  3OTO I;  4PRV A;  1N0U A;  3ADL A;  4LF9 I;  2BM0 A;  2NPF A;  3ADJ A;  4WYQ B;  3LLH A;  2VQF I;  4F9A B;  3OTO E;  3OML A;  4X64 E;  4LF7 I;  1HNX I;  3F6G A;  4F9B B;  1KVK A;  4DV0 I;  4WFT A;  2HHH E;  4P7D A;  2HKJ A;  2B7T A;  5L3J A;  2L2M A;  1IBK E;  4YHH I;  1Z0B A;  1ELO A;  3ZOQ B;  2UUA E;  4K0K E;  3PYG A;  1ZM4 A;  4DPU A;  4F9C B;  2V83 A;  4DV6 I;  4JI7 E;  2OI2 A;  4USM A;  4YHH E;  1XMQ I;  3QT7 A;  1H7U A;  4HY1 A;  3QT5 A;  1Z0V A;  3IWC A;  2H36 X;  2B7V A;  2M1S A;  4LFB E;  3PYE A;  4X62 I;  4JI0 I;  3LNU A;  2V2Z A;  4MYT A;  4GKK I;  2N3G A;  3J80 Q;  1USU A;  4DV1 E;  2E1R A;  5GMD A;  4X8W A;  3T1Y E;  1Z0G A;  1HNZ I;  4LFA I;  4LF5 E;  3JAM Q;  1Z59 A;  2KOU A;  4LFB I;  1ZBT A;  2V2V A;  4FWG A;  1DAR A;  4LTY A;  5LMU I;  1A6F A;  3M6A A;  1HNW E;  2HK2 A;  2L3J A;  2LTS A;  3RMP A;  3D4J A;  3PYF A;  2EFG A;  2ZM6 I;  4JG4 A;  4DPT A;  4UTG A;  4USK A;  4AQY I;  4DV7 I;  1DI2 A;  2VF1 A;  1NHJ A;  3J7A M;  2IHR 1;  1NHH A;  4BCA A;  3QT8 A;  4DPX A;  2B9D A;  1S4E A;  4DPW A;  2YZT A;  1H72 C;  3WU6 A;  5AE2 A;  4DUZ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...