4JI1E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome/antibiotic
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4ji1E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji1E02
3QT8A 3ADIA 4JI1I 1N0VC 4PRXA 3WU6A 1EI1A 1WHNA 2R3VA 1WHQA 1MU5A 1ELOA 3F0NA 4OX9E 5LMUI 3T1YE 5LMUE 4OX9I 2UUCI 1S4EA 2BV3A 2V2VA 4DU8A 4X66I 1NHJA 1N33E 1UILA 4KQVA 3D4JA 4X65E 1J5EI 1HNXI 4DR7I 1N34I 3ADGA 1MG7A 4GKKI 2JVAA 1B63A 3PYDA 3J81Q 3OTOI 3CWVA 1N36E 4LF5E 4DR1I 4DUYE 2VQFI 4DV7I 4DV4I 1FKAE 1YYOA 4DR3E 2A2CA 3LPSA 1O0WA 1D6TA 1I94I 4DPTA 4DV5E 2VQEE 3M6AA 2X7IA 4LFBI 4LF4I 3K1JA 2E5LI 4PU9A 4B3SI 4K0KI 4P7AA 2NUFA 4K0KE 1XMOE 1Z0GA 4DV2I 3T1HE 4JI8E 3ZKBA 5GMDA 4HXZA 4M2ZA 1ZM3A 4KHPI 1XMQE 3HTXA 4DKKA 2LBSB 2N3GA 4WUCA 2L3CA 2V2ZA 2HFSA 1ZBTA 4UT4A 2J7KA 3LTOA 1XNQE 5IWAE 2UXCI 1Z0BA 4DV0I 2KHXA 4GKKE 4I3HA 2NUGA 2EZ6A 4NXNE 3ZKDA 4JI5I 4LF6I 3WU5A 4DR3I 3PYEA 3ZZUA 2LRSA 2RTXA 1H73A 4X64E 2HHHI 4JI3I 4LFBE 4DV4E 4DPYA 4B3RI 4LFAI 4DV3I 2Q2EB 3GONA 3ZZTA 4LF9E 1H72C 1YZ9A 1XMQI 4LF8I 4EMDA 4JI8I 3ADJA 4DR7E 4RPFA 4R1FA 1KIJA 2HK3A 4YHHE 1VISA 1WUUA 2HK2A 1Z0VA 2LJHA 4JI4E 4PRVA 4LF5I 3J81C 4USMA 3OTOE 5IWAI 4DR5I 5LL6R 3JAMC 4DU7A 1KVKA 4UTGA 2BM1A 4WYQB 2F4VI 1B62A 2LUPB 1FJGE 4HYMA 4JI0E 5BR8E 1U2RA 1UHZA 2V2QA 2HHHE 1OJ4A 3K17A 2CPNA 3LLHA 2V34A 3J7AG 2LTSA 4LFAE 5L3JA 5A2QC 1QU6A 2UXBE 2VF3A 3Q1QA 1N33I 1Z0WA 4X64I 5IT9Q 2IHR1 4MYUA 4HY1A 4B3TI 1IBKE 2GS8A 4DR6I 4JI4I 1QZRA 4DUZI 1N36I 2LTRA 2UU9I 4DV1E 2NUEA 1DI2A 4DV6I 2EFGA 2ZM6E 1ZXNA 2L2KB 1XNRE 2E1RA 1Z0TA 1XNRI 1FJGI 4JI2E 2ZBKB 4DUZE 1FWLA 1YYWA 2VQEI 1X47A 4JI6I 2UXDI 2RS6A 4B3MI 4B3ME 4DR4E 4AQYI 2DB2A 4JI7E 3PYGA 3PYFA 4DR2E 2B7VA 1EA6A 1T4NA 5FLXQ 4Z7YA 3VYYA 1UEKA 1HNWE 3J7AM 1HNZE 2L2NA 1N34E 1NZ0A 4YY3E 4FWDA 4LF7I 3P1XA 4DV1I 1IBME 1X48A 4KHPE 3C4TA 4GKJE 1MX0A 4XTJA 3QT5A 4FWHA 2CZ9A 1K47A 4FW9A 2RS7A 4X62E 4WUDA 3B82A 4HACB 2ZITA 4DV0E 2VQFE 3V5RA 4JYAI 2UUAE 4JYAE 3WU4A 4JI5E 4LF6E 4M1KA 3B8HA 2HKJA 5CFFE 1STUA 1I94E 3T1YI 2L3JA 2B3TB 2NPFA 4DR2I 3J7Yp 2LJPA 4DV3E 4ED4A 1BKNA 1XMOI 4AQYE 4DR4I 4GKJI 2B7TA 4B3TE 3HULA 1ZM2A 1HNXE 1HNZI 1XHKA 4B3SE 3JAMQ 1RR9A 1IBKI 2HFUA 1Z5AA 3QT7A 1EKZA 3T1HI 2DEJA 2V8PA 1J5EE 2XEXA 5LMNI 1IBMI 1FNMA 2X36A 1H7SA 4DPUA 4DV7E 2ZM6I 1ZM9A 3J80Q 2MDRA 2UXDE 1NHIA 4DUYI 1IBLI 1GQEA 1IBLE 1Z5CA 2F4VE 4M30A 1H74A 1YYKA 1Z59A 3QT6A 4URLA 4WUBA 2OI2A 2UXCE 2A2DA 4DR1E 2BM0A 4FN5A 3H4LA 1RC7A 5A2QQ 4MYTA 4LF4E 4DXLA 4LFCE 4JV5E 1ZM4A 4LFCI 4JV5I 1PIEA 1FWKA 1Z0CA 3WU3A 4LF8E 1PKPA 2L2MA 2WW4A 4JI7I 3ZZ0A 4ZVIA 1Z5BA 1T4LB 1N32E 1N32I 2RSMA 2JY9A 2R42A 1KTVA 1Z0EA 1HNWI 3VYXA 1RQ0A 1A6FA 4LF7E 4DV6E 2YT4A 1HR0I 4X62I 2L33A 2NA2A 4WFTA 4X65I 5BR8I 5LMNE 2N3HA 4FWGA 4JI3E 2UUAI 3C4BA 3LNUA 4JI6E 4JG4A 1DARA 2UXBI 4NXME 1KKHA 1PVGA 4DPWA 4LF9I 4DV5I 4X8WA 1ZXMA 4NXNI 3J80C 2DMYA 1S16A 4JI1E 2AJ4A 4B3RE 4P52A 4X66E 4DPXA 2LUQA 4OOGC 4YHHI 4DV2E 4HACA 2UUCE 2HKEA 1H7UA 4YY3I 2E5LE 3V2UC 1HR0E 4DR6E 2DIXA 1X49A 2DEIA 1XNQI 5IT9C 3ADLA 2UU9E 1T4OA 4Z7CA 1J26A 1FI4A 4DR5E 1N0UA 5GMEA 2UUBE 5FLXC 2UUBI 4NXMI 1RREA 4USKA 4JI0I 4JI2I 1NHHA 3B78A 3ZM7A
chains in the Genus database with same CATH superfamily
3QT8A 3ADIA 3L00A 3U1YA 4JI1I 2DRPA 2DSYA 5IV8B 4JV5I 1AH5A 1N0VC 4PRXA 3WU6A 3L7ZB 2BB8A 1EI1A 5A6AA 2DGCA 3P76A 1WHNA 2R3VA 1WHQA 3P3CA 4IS9A 4IFDD 2EQ0A 1MU5A 2BA0D 1ELOA 2EM0A 3F0NA 5K36E 4OX9E 5LMUI 2EMGA 3T1YE 5LMUE 5AE1A 3CDJA 4OX9I 1L4SA 5K36B 2UUCI 3ZOQB 1S4EA 5DNXA 2JPAA 2BV3A 2V2VA 4DU8A 1WRJA 2LVHA 2HGHA 4X66I 1NHJA 1T38A 4N3OA 2EOIA 4M0VA 1N33E 1UDNA 2JE6A 2WNRB 1UILA 4KQVA 2CGEA 1PDAA 3D4JA 2EPNA 2V88A 5KL2A 4X65E 2PRTA 1MEYC 1J5EI 4WXCA 1HNXI 1N34I 5ADZA 2L8TA 4DR7I 4M9VC 3ADGA 1MG7A 4LOMA 4GKKI 2EMLA 2YTIA 2JVAA 2CT1A 1IMUA 2GO3A 1B63A 4FW4A 3PYDA 3J81Q 3OTOI 1DQ3A 2EPZA 2JEBA 3CWVA 1LLMC 1N36E 4LF5E 4DR1I 4DUYE 2VQFI 2EM2A 4DV7I 1UBDC 4F9CB 4DV4I 4BA1B 2C39B 1T39A 1FKAE 1YYOA 4BHBA 4DR3E 3TQMA 4U3BA 5AE3A 1GZ6A 5IXMB 2A2CA 3LPSA 1O0WA 4IZJD 1D6TA 2C38B 1I94I 2K4VA 4DPTA 4DV5E 2EPRA 2VQEE 3HPZA 3H09A 3LMLA 2RQLA 3EQ1A 2BR2A 3M6AA 2X7IA 3M85G 4LFBI 4LF4I 1RHYA 3K1JA 2E5LI 4TUGA 2GPIA 2MC5A 4DMIA 1R6MA 4PU9A 4B3SI 4K0KI 2EPXA 2NUFA 4K0KE 4P7AA 4GQUA 1XMOE 1Z0GA 4DV2I 3FIGA 4ZYDA 4R2PA 1QNTA 3T1HE 3HKMA 4JI8E 4KWYA 3ZKBA 5GMDA 5ELWA 3Q6MA 2ELYA 4HXZA 2O1UA 4M2ZA 3UK3C 1Y4UA 4OO1F 1ZM3A 2EMKA 4KHPI 2L92A 1XMQE 3HTXA 4DKKA 5EKWA 1EH6A 3M7NG 2LBSB 1IQOA 1X6FA 5JEAC 2N3GA 4WUCA 2EPUA 2EN2A 2LV2A 2L3CA 2V2ZA 2HFSA 4R8OA 4F6MA 4WXDA 2YTJA 2JEAB 2EJ4A 1ZBTA 3KZZA 2PNMA 3ZM7A 4UT4A 2J65A 2J7KA 3LTOA 2PO1B 1XNQE 5IWAE 2EMHA 4X9JA 2UXCI 2YTOA 1JK2A 1Z0BA 4DV0I 2LO3A 5AASA 1TN9A 2KHXA 3PS1A 4GKKE 3H1CA 4I3HA 2NUGA 2EM9A 2EZ6A 2FTXB 4NXNE 2BR2B 1OYPA 1B69A 3ZKDA 2EOHA 2Q8UA 4JI5I 4LF6I 4LCGA 3WU5A 1PJTA 4DR3I 4BC9A 3MHHC 2WZOA 3PYEA 3ZZUA 1KYQA 4OO1A 2LRSA 2RTXA 1H73A 4IZJB 4X64E 4KZSA 5DNLA 3KRNA 2HHHI 4JI3I 4LFBE 4DV4E 4DPYA 4B3RI 2DMIA 4LFAI 2WBSA 2VRDA 4DV3I 2Q2EB 2RPCA 3GONA 3ZZTA 4LF9E 1H72C 1YZ9A 5JEAB 1Y60A 1XMQI 4LF8I 4EMDA 1BBGA 4JI8I 3ADJA 2ENAA 4DR7E 4IJDA 4R2EA 4RPFA 4IFDE 2Z5EA 4R1FA 1KIJA 3THNA 4R2DA 1EH8A 2HK3A 2PNZA 2EN4A 2LT7A 4YHHE 1VISA 2JYAA 1WUUA 4ZYHA 5K36C 2C39A 1Z0VA 2LJHA 2HK2A 5A6BD 5AC4A 4JI4E 2EM4A 2FGGA 3M85D 1HK7A 4PRVA 2EMFA 4LF5I 3J81C 1ZU1A 1Y5YA 4USMA 3OTOE 5DROA 2YSOA 2C37B 2IOQA 2EMXA 3C6MA 2BA1D 1MGTA 5LL6R 5IWAI 4DR5I 3JAMC 4DU7A 3VHTB 3M7ND 3L7ZA 2IOPA 2YTNA 4WSPA 1KVKA 2EMZA 2FV4B 2CTDA 1BBOA 2PO2B 4MLVA 4UTGA 2BM1A 2NN6A 4WYQB 2F4VI 1B62A 2LUPB 3QG5C 1FJGE 2O1VA 4HYMA 3KWRA 4JI0E 2CG9A 2O3ZA 2WNRA 4GZNC 2MC6A 4MLQA 1UHZA 5BR8E 1U2RA 4IZKB 1TF6A 2V2QA 2GHFA 1EH7A 2K7IA 3AUZA 4ZYGA 2C38A 2HHHE 1OJ4A 2BA0G 2O1WA 2EPAA 3K17A 2CPNA 3LLHA 5K36A 5EL9A 2V34A 5T6JA 3J7AG 2LTSA 4LFAE 1A1JA 5L3JA 5A2QC 4P7DA 1QU6A 4RH8A 2UXBE 2VF3A 1X6EA 4F9AB 3GLLA 3Q1QA 2JEAA 1Z0WA 4X64I 1N33I 5IT9Q 3RMPA 2EMIA 2EPCA 2GQ0A 2EN3A 2KONA 2IHR1 1YUJA 2C37A 2E1MA 2YZTA 3UHMA 5A6BA 1XXEA 4MYUA 2JOXA 2O1TA 1Y4SA 3DD6A 4HY1A 4HTGA 2WCC3 4B3TI 1P42A 1IBKE 2GS8A 3GMEA 4DR6I 2LMZA 4FW7A 1OYSA 5DNYA 4JI4I 1VI7A 3P06A 1QZRA 4DUZI 1N36I 2LTRA 4F9BB 2UU9I 4FK5C 4DV1E 2NUEA 2F8BA 1DI2A 4DV6I 2EFGA 2ZM6E 5JEAF 3C6KA 2L2KB 1ZXNA 1XNRE 2E1RA 1Z0TA 1XNRI 1FJGI 3BF2A 3K85A 3AV0A 2D9HA 3HXLA 4WPYA 4JI2E 2ZBKB 2JXPA 4DUZE 1FWLA 5JEAA 2EOXA 2YRKA 5JEAE 1YH8A 1YYWA 2VQEI 2DLKA 2YTQA 5KL7A 2EM7A 4MU1A 4OZEA 1X47A 1ZBQA 2EN7A 4JI6I 4J8ZA 2EPOA 4R2AA 2RS6A 2UXDI 4B3MI 4B3ME 1E3PA 2PO0A 4N4RB 4MU0A 4DR4E 4AQYI 2NN6B 2EWLA 1UDOA 2DB2A 4JI7E 1ZAAC 2EOJA 5KL3A 4DR2E 3PYGA 3PYFA 2L6MA 3NZKA 2B7VA 1EA6A 1T4NA 1F2IG 4BC7A 4LCFA 1Y6ZA 3U1KA 1G2DC 4Z7YA 5FLXQ 2I13A 4FW6A 3VYYA 4Q28A 5AC5A 1UEKA 5DRQA 1WXRA 4BBYA 1HNWE 3J7AM 1HNZE 2L2NA 1N34E 1NZ0A 5DRRA 4HEIA 4YY3E 4FWDA 4LF7I 3P1XA 4DV1I 2JP9A 1IBME 1X48A 1A1KA 4KHPE 2Z5CB 3PS2A 3C4TA 4GKJE 1MX0A 4BS9A 2NN6E 2M7QA 4XTJA 2B9DA 3QT5A 4FWHA 2CZ9A 1K47A 3JTZA 4LCHA 1TF3A 4AIDA 2EM8A 4FW9A 5KL5A 5DRPA 2EMYA 2RS7A 2WP8B 3Q6NA 4MQYA 1SFEA 4X62E 4WUDA 3KZYA 5F3WA 3F6GA 4O43A 2R1FA 2NN6C 3B82A 4IFDF 4HACB 2ZITA 2ELZA 5A6JA 2VQFE 2VE7C 2YU8A 4Q35B 4DV0E 3V5RA 2YRMA 4JYAI 2UUAE 4JYAE 4NHRA 3WU4A 1YPNA 4OO1E 4GEQB 2YTPA 4JI5E 4LF6E 1USUA 2JR1A 2M4IA 2VF1A 3HQ1A 4M1KA 4WSGA 3B4TA 3B8HA 2HKJA 2EP3A 3BBGA 5CFFE 2EMCA 2JWOA 5KL6A 2CVEA 2CSHA 1STUA 2VESA 1I94E 3T1YI 2L3JA 2V85A 2EN1A 2JOBA 2B3TB 1YUIA 2NN6D 2EORA 2NPFA 2A25A 1YHCA 4DR2I 3F6HA 3J7Yp 2EPPA 3DF6A 2LJPA 4OO1C 4DV3E 4ED4A 4O5GA 4O24A 5JEAD 5KL4A 1BKNA 1RMDA 5C0XB 4AQYE 1XMOI 4DR4I 4GKJI 2B7TA 2R76A 4B3TE 2EOEA 1GTKA 2ODRD 3IWDA 1ZM2A 2JEBB 5A69A 3HULA 1HNXE 5K36D 2EE8A 1HNZI 5TSEA 2ADRA 1XHKA 4B3SE 3JAMQ 3BGHA 1A1GA 1A1IA 1A1HA 1RR9A 3BIDA 1IBKI 2HFUA 3EPHA 1Z5AA 3QT7A 3HPSA 4IZJA 1EKZA 3T1HI 1SR9A 2YRHA 2DEJA 2V8PA 2HC5A 3ECRA 2EMWA 1J5EE 2XEXA 2BA1G 5LMNI 1AAYA 1UN6B 2Z5CA 1Z1BA 3CDIA 3M99B 1IBMI 2EN8A 1FNMA 2MDGA 1H7SA 2X36A 4DV7E 4DPUA 2ZM6I 4IS1C 1G2FC 2PO2A 3EPKA 4F6NA 1E3HA 2GLIA 1ZM9A 2EOSA 3J80Q 2MDRA 2GO4A 2UXDE 1NHIA 2EM3A 4OKGA 4DUYI 1IBLI 4LTYA 1GQEA 4QNJA 2V89A 1IBLE 1WJPA 1X6HA 1Z5CA 2EM5A 4RHBB 3DJWA 4M30A 4TUIA 2YPNA 1YYKA 2F4VE 1H74A 1Z59A 4MU3A 2EMBA 3QT6A 2EOQA 2EOOA 3IWBA 5C0XC 4BA2B 2YTDA 4URLA 4OO1D 4WUBA 2OI2A 2UXCE 1ZR9A 2PO0B 2M9AA 2A2DA 3THOB 4DR1E 2BM0A 4FN5A 2BBGA 3H4LA 1RC7A 5A2QQ 4MYTA 4R03A 4LF4E 4DXLA 2WBUA 4NBQA 4IFDB 4LFCE 4JV5E 2V86A 1PJSA 1ZM4A 2EQ1A 2JT2A 1PIEA 5AE2A 1YSAC 1USVA 4LFCI 1FWKA 1Z0CA 2EL5A 3OMLA 3WU3A 4LF8E 1PKPA 5C0XD 2PO1A 2MKNA 2L2MA 2WP8A 2IERA 3P3GA 2WW4A 4JI7I 4LU9A 4ZVIA 3ZZ0A 3VK6A 1Z5BA 3JU0A 1T4LB 3HJCA 3IWCA 1N32E 2HJJA 2JE6B 1UDQA 2LCEA 1N32I 2F1DA 2RSMA 3PRYA 5LLQA 4F2JC 2JY9A 2EL6A 1KTVA 2KOUA 2R42A 1KJKA 1Z0EA 1HNWI 3P3EA 3VYXA 1RQ0A 1A6FA 3GCMA 4LF7E 1OYRA 4DV6E 4R2RA 2I9IA 2YT4A 4AIMA 1HR0I 2NN6F 4I8OA 4BA1A 2E72A 4X62I 2L33A 2NA2A 4WFTA 2ENHA 3MHSC 4X65I 3K6QA 2EL4A 2EN6A 4NZVA 1JK1A 5BR8I 2PNLA 4IFDA 2YTEA 5LMNE 3EPJA 4O4KA 2N3HA 4FWGA 2Z5BB 2MKDA 4JI3E 2UUAI 1PJQA 1A1LA 3C4BA 1NCSA 2EOMA 3LNUA 4ISAA 5K36F 2G7HA 2NABA 2ODRC 4JI6E 1P47A 4JG4A 4U3DA 1DARA 4BA2A 2H36X 2UXBI 4NXME 1KKHA 1PVGA 4LPFA 4DPWA 4LF9I 4R2CA 2EPMX 4DV5I 4X8WA 1ZXMA 3J80C 4NXNI 1N3GA 2DMYA 1A1FA 1S16A 4JI1E 2AJ4A 1DGCA 4B3RE 4P52A 2YU5A 2EOZA 4AM3A 4QNKA 1R6LA 4X66E 4J3DA 2RSIA 4DPXA 2EPKX 2LUQA 4OOGC 4BCAA 4YHHI 4DV2E 4HACA 4MU4A 1X3CA 2UUCE 4WX9A 2HKEA 2V87A 2ENCA 1H7UA 2EOYA 4FW5A 2IESA 2EM6A 4YY3I 2M1SA 2E5LE 2AE8A 2YSPA 4BMJA 4R2SA 3V2UC 2YTGA 4R2QA 4FW3A 2WBTA 1HR0E 4DR6E 2YTFA 2EPLX 3PS3A 2EQ3A 4IZKA 2DIXA 1X49A 2LJUA 2DEIA 1XNQI 4L5NC 4BHCA 5IT9C 3ADLA 5FWKA 2UU9E 1NEIA 2PNZB 4IFDC 2Z5BA 4L8NA 1T4OA 4Z7CA 1UDSA 4P78A 1J26A 1FI4A 5C0XE 5C0XA 3MSWA 4DR5E 2V8QB 5A6KA 1X5WA 2DLQA 4MDTA 1N0UA 5GMEA 2UUBE 5FLXC 2UUBI 4NXMI 2N8XA 1YFHA 5C0XF 4F54A 1RREA 4USKA 4JI0I 1IQSA 2V83A 2LE2A 4JI2I 2EMAA 1NHHA 4ZYEA 4OO1B 1BB8A 2YWQA 2J7JA 3B78A 3EPLA 2EOFA
chains in the Genus database with same CATH topology
3QT8A 3ADIA 4JI1I 2DSYA 1N0VC 4PRXA 3WU6A 1EI1A 1WHNA 2R3VA 1WHQA 1MU5A 1ELOA 3F0NA 4OX9E 5LMUI 3T1YE 5LMUE 5AE1A 4OX9I 2UUCI 3ZOQB 1S4EA 2BV3A 2V2VA 4DU8A 4X66I 1NHJA 4N3OA 4M0VA 1N33E 1UILA 4KQVA 2CGEA 3D4JA 4X65E 2V88A 1J5EI 1HNXI 4DR7I 1N34I 5ADZA 2L8TA 3ADGA 1MG7A 4GKKI 2JVAA 1B63A 3PYDA 3J81Q 3OTOI 1DQ3A 3CWVA 1N36E 4LF5E 4DR1I 4DUYE 2VQFI 4DV7I 4F9CB 4DV4I 1FKAE 1YYOA 4DR3E 5AE3A 1GZ6A 2A2CA 3LPSA 1O0WA 4IZJD 1D6TA 1I94I 2K4VA 4DPTA 4DV5E 2VQEE 3HPZA 3H09A 3LMLA 3M6AA 2X7IA 4LFBI 4LF4I 3K1JA 2E5LI 4TUGA 2MC5A 4DMIA 4PU9A 4B3SI 4K0KI 4P7AA 2NUFA 4K0KE 1XMOE 1Z0GA 4DV2I 3FIGA 3T1HE 4JI8E 3ZKBA 5GMDA 3Q6MA 4HXZA 2O1UA 4M2ZA 1Y4UA 1ZM3A 4KHPI 2L92A 1XMQE 3HTXA 4DKKA 2LBSB 2N3GA 4WUCA 2L3CA 2V2ZA 2HFSA 4R8OA 1ZBTA 2PNMA 4UT4A 2J7KA 3LTOA 1XNQE 5IWAE 2UXCI 1Z0BA 4DV0I 5AASA 2KHXA 4GKKE 4I3HA 2NUGA 2EZ6A 2FTXB 4NXNE 3ZKDA 4JI5I 4LF6I 3WU5A 4DR3I 4BC9A 3PYEA 2WZOA 3ZZUA 2LRSA 2RTXA 1H73A 4IZJB 4X64E 4KZSA 2HHHI 4JI3I 4LFBE 4DV4E 4DPYA 4B3RI 4LFAI 4DV3I 2Q2EB 3GONA 3ZZTA 4LF9E 1H72C 1YZ9A 1XMQI 4LF8I 4EMDA 4JI8I 3ADJA 4DR7E 4RPFA 2Z5EA 4R1FA 1KIJA 2HK3A 4YHHE 1VISA 1WUUA 2HK2A 1Z0VA 2LJHA 4JI4E 2FGGA 1HK7A 4PRVA 4LF5I 3J81C 4USMA 3OTOE 2IOQA 5IWAI 4DR5I 5LL6R 3JAMC 4DU7A 2IOPA 4WSPA 1KVKA 2FV4B 4UTGA 2BM1A 4WYQB 2F4VI 1B62A 2LUPB 1FJGE 2O1VA 4HYMA 3KWRA 4JI0E 2CG9A 2MC6A 5BR8E 1UHZA 1U2RA 4IZKB 2V2QA 3AUZA 2HHHE 1OJ4A 2O1WA 3K17A 2CPNA 3LLHA 2V34A 5T6JA 3J7AG 2LTSA 4LFAE 5L3JA 5A2QC 4P7DA 1QU6A 2UXBE 2VF3A 4F9AB 3Q1QA 1N33I 1Z0WA 4X64I 5IT9Q 3RMPA 2GQ0A 2KONA 2IHR1 2E1MA 2YZTA 4MYUA 2JOXA 2O1TA 1Y4SA 4HY1A 4B3TI 1IBKE 2GS8A 4DR6I 2LMZA 5DNYA 4JI4I 3P06A 1QZRA 4DUZI 1N36I 2LTRA 4F9BB 2UU9I 4DV1E 2NUEA 1DI2A 2F8BA 4DV6I 2EFGA 2ZM6E 1ZXNA 2L2KB 1XNRE 2E1RA 1Z0TA 1XNRI 1FJGI 3K85A 3AV0A 3HXLA 4WPYA 4JI2E 2ZBKB 4DUZE 1FWLA 1YYWA 2VQEI 1X47A 1ZBQA 4JI6I 4J8ZA 2UXDI 2RS6A 4B3MI 4B3ME 4DR4E 4AQYI 2EWLA 2DB2A 4JI7E 3PYGA 3PYFA 4DR2E 2L6MA 2B7VA 1EA6A 1T4NA 4BC7A 1Y6ZA 5FLXQ 4Z7YA 3VYYA 4Q28A 1UEKA 1WXRA 4BBYA 1HNWE 3J7AM 1HNZE 2L2NA 1N34E 1NZ0A 4YY3E 4FWDA 4LF7I 3P1XA 4DV1I 1IBME 1X48A 4KHPE 2Z5CB 3C4TA 4GKJE 1MX0A 4BS9A 2M7QA 4XTJA 2B9DA 3QT5A 4FWHA 2CZ9A 1K47A 3JTZA 4FW9A 2RS7A 3Q6NA 4X62E 4WUDA 5F3WA 3F6GA 3B82A 4HACB 2ZITA 4DV0E 2VQFE 3V5RA 2VE7C 4JYAI 2UUAE 4JYAE 3WU4A 4GEQB 4JI5E 4LF6E 1USUA 2JR1A 2VF1A 2M4IA 3HQ1A 4M1KA 3B8HA 2HKJA 5CFFE 2JWOA 1STUA 1I94E 3T1YI 2L3JA 2V85A 2JOBA 2B3TB 2NPFA 4DR2I 3F6HA 3J7Yp 3DF6A 2LJPA 4DV3E 4ED4A 1BKNA 1XMOI 4AQYE 4DR4I 4GKJI 2B7TA 4B3TE 3HULA 2ODRD 3IWDA 1ZM2A 1HNXE 1HNZI 1XHKA 4B3SE 3JAMQ 1RR9A 1IBKI 2HFUA 1Z5AA 3QT7A 3HPSA 4IZJA 1EKZA 3T1HI 1SR9A 2DEJA 2V8PA 1J5EE 2XEXA 5LMNI 2Z5CA 1IBMI 1FNMA 2X36A 1H7SA 4DPUA 4DV7E 2ZM6I 1ZM9A 3J80Q 2MDRA 2UXDE 1NHIA 4DUYI 1IBLI 4LTYA 1GQEA 2V89A 1IBLE 1Z5CA 4TUIA 3DJWA 4M30A 2F4VE 1YYKA 1H74A 1Z59A 3QT6A 3IWBA 4URLA 4WUBA 2OI2A 2UXCE 2A2DA 4DR1E 2BM0A 4FN5A 3H4LA 1RC7A 5A2QQ 4MYTA 4R03A 4LF4E 4DXLA 4LFCE 4JV5E 2V86A 1ZM4A 4LFCI 4JV5I 1PIEA 5AE2A 1USVA 1FWKA 1Z0CA 3OMLA 3WU3A 4LF8E 1PKPA 2L2MA 2WW4A 4JI7I 4LU9A 4ZVIA 3ZZ0A 3VK6A 1Z5BA 3JU0A 1T4LB 3HJCA 3IWCA 1N32E 1N32I 2RSMA 3PRYA 2JY9A 2R42A 1KTVA 2KOUA 1Z0EA 1HNWI 3VYXA 1RQ0A 1A6FA 4LF7E 4DV6E 2YT4A 1HR0I 4I8OA 4X62I 2L33A 2NA2A 4WFTA 4X65I 3K6QA 5BR8I 2PNLA 5LMNE 2N3HA 4FWGA 2Z5BB 4JI3E 2UUAI 3C4BA 3LNUA 2G7HA 2ODRC 4JI6E 4JG4A 1DARA 2H36X 2UXBI 4NXME 1KKHA 1PVGA 4DPWA 4LF9I 4DV5I 4X8WA 1ZXMA 3J80C 4NXNI 2DMYA 1S16A 4JI1E 2AJ4A 4B3RE 4P52A 4X66E 4DPXA 2LUQA 4OOGC 4BCAA 4YHHI 4DV2E 4HACA 2UUCE 2HKEA 2V87A 1H7UA 4YY3I 2M1SA 2E5LE 3V2UC 4BMJA 1HR0E 4DR6E 4IZKA 2DIXA 1X49A 2DEIA 1XNQI 4L5NC 5IT9C 3ADLA 5FWKA 2UU9E 2Z5BA 4L8NA 1T4OA 4Z7CA 4P78A 1J26A 1FI4A 3MSWA 4DR5E 2V8QB 1N0UA 5GMEA 2UUBE 5FLXC 2UUBI 4NXMI 4F54A 1RREA 4USKA 4JI0I 2V83A 2LE2A 4JI2I 1NHHA 3B78A 3ZM7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QT8 A;  3ADI A;  4JI1 I;  1N0V C;  4PRX A;  3WU6 A;  1EI1 A;  1WHN A;  2R3V A;  1WHQ A;  1MU5 A;  1ELO A;  3F0N A;  4OX9 E;  5LMU I;  3T1Y E;  5LMU E;  4OX9 I;  2UUC I;  1S4E A;  2BV3 A;  2V2V A;  4DU8 A;  4X66 I;  1NHJ A;  1N33 E;  1UIL A;  4KQV A;  3D4J A;  4X65 E;  1J5E I;  1HNX I;  4DR7 I;  1N34 I;  3ADG A;  1MG7 A;  4GKK I;  2JVA A;  1B63 A;  3PYD A;  3J81 Q;  3OTO I;  3CWV A;  1N36 E;  4LF5 E;  4DR1 I;  4DUY E;  2VQF I;  4DV7 I;  4DV4 I;  1FKA E;  1YYO A;  4DR3 E;  2A2C A;  3LPS A;  1O0W A;  1D6T A;  1I94 I;  4DPT A;  4DV5 E;  2VQE E;  3M6A A;  2X7I A;  4LFB I;  4LF4 I;  3K1J A;  2E5L I;  4PU9 A;  4B3S I;  4K0K I;  4P7A A;  2NUF A;  4K0K E;  1XMO E;  1Z0G A;  4DV2 I;  3T1H E;  4JI8 E;  3ZKB A;  5GMD A;  4HXZ A;  4M2Z A;  1ZM3 A;  4KHP I;  1XMQ E;  3HTX A;  4DKK A;  2LBS B;  2N3G A;  4WUC A;  2L3C A;  2V2Z A;  2HFS A;  1ZBT A;  4UT4 A;  2J7K A;  3LTO A;  1XNQ E;  5IWA E;  2UXC I;  1Z0B A;  4DV0 I;  2KHX A;  4GKK E;  4I3H A;  2NUG A;  2EZ6 A;  4NXN E;  3ZKD A;  4JI5 I;  4LF6 I;  3WU5 A;  4DR3 I;  3PYE A;  3ZZU A;  2LRS A;  2RTX A;  1H73 A;  4X64 E;  2HHH I;  4JI3 I;  4LFB E;  4DV4 E;  4DPY A;  4B3R I;  4LFA I;  4DV3 I;  2Q2E B;  3GON A;  3ZZT A;  4LF9 E;  1H72 C;  1YZ9 A;  1XMQ I;  4LF8 I;  4EMD A;  4JI8 I;  3ADJ A;  4DR7 E;  4RPF A;  4R1F A;  1KIJ A;  2HK3 A;  4YHH E;  1VIS A;  1WUU A;  2HK2 A;  1Z0V A;  2LJH A;  4JI4 E;  4PRV A;  4LF5 I;  3J81 C;  4USM A;  3OTO E;  5IWA I;  4DR5 I;  5LL6 R;  3JAM C;  4DU7 A;  1KVK A;  4UTG A;  2BM1 A;  4WYQ B;  2F4V I;  1B62 A;  2LUP B;  1FJG E;  4HYM A;  4JI0 E;  5BR8 E;  1U2R A;  1UHZ A;  2V2Q A;  2HHH E;  1OJ4 A;  3K17 A;  2CPN A;  3LLH A;  2V34 A;  3J7A G;  2LTS A;  4LFA E;  5L3J A;  5A2Q C;  1QU6 A;  2UXB E;  2VF3 A;  3Q1Q A;  1N33 I;  1Z0W A;  4X64 I;  5IT9 Q;  2IHR 1;  4MYU A;  4HY1 A;  4B3T I;  1IBK E;  2GS8 A;  4DR6 I;  4JI4 I;  1QZR A;  4DUZ I;  1N36 I;  2LTR A;  2UU9 I;  4DV1 E;  2NUE A;  1DI2 A;  4DV6 I;  2EFG A;  2ZM6 E;  1ZXN A;  2L2K B;  1XNR E;  2E1R A;  1Z0T A;  1XNR I;  1FJG I;  4JI2 E;  2ZBK B;  4DUZ E;  1FWL A;  1YYW A;  2VQE I;  1X47 A;  4JI6 I;  2UXD I;  2RS6 A;  4B3M I;  4B3M E;  4DR4 E;  4AQY I;  2DB2 A;  4JI7 E;  3PYG A;  3PYF A;  4DR2 E;  2B7V A;  1EA6 A;  1T4N A;  5FLX Q;  4Z7Y A;  3VYY A;  1UEK A;  1HNW E;  3J7A M;  1HNZ E;  2L2N A;  1N34 E;  1NZ0 A;  4YY3 E;  4FWD A;  4LF7 I;  3P1X A;  4DV1 I;  1IBM E;  1X48 A;  4KHP E;  3C4T A;  4GKJ E;  1MX0 A;  4XTJ A;  3QT5 A;  4FWH A;  2CZ9 A;  1K47 A;  4FW9 A;  2RS7 A;  4X62 E;  4WUD A;  3B82 A;  4HAC B;  2ZIT A;  4DV0 E;  2VQF E;  3V5R A;  4JYA I;  2UUA E;  4JYA E;  3WU4 A;  4JI5 E;  4LF6 E;  4M1K A;  3B8H A;  2HKJ A;  5CFF E;  1STU A;  1I94 E;  3T1Y I;  2L3J A;  2B3T B;  2NPF A;  4DR2 I;  3J7Y p;  2LJP A;  4DV3 E;  4ED4 A;  1BKN A;  1XMO I;  4AQY E;  4DR4 I;  4GKJ I;  2B7T A;  4B3T E;  3HUL A;  1ZM2 A;  1HNX E;  1HNZ I;  1XHK A;  4B3S E;  3JAM Q;  1RR9 A;  1IBK I;  2HFU A;  1Z5A A;  3QT7 A;  1EKZ A;  3T1H I;  2DEJ A;  2V8P A;  1J5E E;  2XEX A;  5LMN I;  1IBM I;  1FNM A;  2X36 A;  1H7S A;  4DPU A;  4DV7 E;  2ZM6 I;  1ZM9 A;  3J80 Q;  2MDR A;  2UXD E;  1NHI A;  4DUY I;  1IBL I;  1GQE A;  1IBL E;  1Z5C A;  2F4V E;  4M30 A;  1H74 A;  1YYK A;  1Z59 A;  3QT6 A;  4URL A;  4WUB A;  2OI2 A;  2UXC E;  2A2D A;  4DR1 E;  2BM0 A;  4FN5 A;  3H4L A;  1RC7 A;  5A2Q Q;  4MYT A;  4LF4 E;  4DXL A;  4LFC E;  4JV5 E;  1ZM4 A;  4LFC I;  4JV5 I;  1PIE A;  1FWK A;  1Z0C A;  3WU3 A;  4LF8 E;  1PKP A;  2L2M A;  2WW4 A;  4JI7 I;  3ZZ0 A;  4ZVI A;  1Z5B A;  1T4L B;  1N32 E;  1N32 I;  2RSM A;  2JY9 A;  2R42 A;  1KTV A;  1Z0E A;  1HNW I;  3VYX A;  1RQ0 A;  1A6F A;  4LF7 E;  4DV6 E;  2YT4 A;  1HR0 I;  4X62 I;  2L33 A;  2NA2 A;  4WFT A;  4X65 I;  5BR8 I;  5LMN E;  2N3H A;  4FWG A;  4JI3 E;  2UUA I;  3C4B A;  3LNU A;  4JI6 E;  4JG4 A;  1DAR A;  2UXB I;  4NXM E;  1KKH A;  1PVG A;  4DPW A;  4LF9 I;  4DV5 I;  4X8W A;  1ZXM A;  4NXN I;  3J80 C;  2DMY A;  1S16 A;  4JI1 E;  2AJ4 A;  4B3R E;  4P52 A;  4X66 E;  4DPX A;  2LUQ A;  4OOG C;  4YHH I;  4DV2 E;  4HAC A;  2UUC E;  2HKE A;  1H7U A;  4YY3 I;  2E5L E;  3V2U C;  1HR0 E;  4DR6 E;  2DIX A;  1X49 A;  2DEI A;  1XNQ I;  5IT9 C;  3ADL A;  2UU9 E;  1T4O A;  4Z7C A;  1J26 A;  1FI4 A;  4DR5 E;  1N0U A;  5GME A;  2UUB E;  5FLX C;  2UUB I;  4NXM I;  1RRE A;  4USK A;  4JI0 I;  4JI2 I;  1NHH A;  3B78 A;  3ZM7 A; 
#chains in the Genus database with same CATH topology
 3QT8 A;  3ADI A;  3L00 A;  3U1Y A;  4JI1 I;  2DRP A;  2DSY A;  5IV8 B;  4JV5 I;  1AH5 A;  1N0V C;  4PRX A;  3WU6 A;  3L7Z B;  2BB8 A;  1EI1 A;  5A6A A;  2DGC A;  3P76 A;  1WHN A;  2R3V A;  1WHQ A;  3P3C A;  4IS9 A;  4IFD D;  2EQ0 A;  1MU5 A;  2BA0 D;  1ELO A;  2EM0 A;  3F0N A;  5K36 E;  4OX9 E;  5LMU I;  2EMG A;  3T1Y E;  5LMU E;  5AE1 A;  3CDJ A;  4OX9 I;  1L4S A;  5K36 B;  2UUC I;  3ZOQ B;  1S4E A;  5DNX A;  2JPA A;  2BV3 A;  2V2V A;  4DU8 A;  1WRJ A;  2LVH A;  2HGH A;  4X66 I;  1NHJ A;  1T38 A;  4N3O A;  2EOI A;  4M0V A;  1N33 E;  1UDN A;  2JE6 A;  2WNR B;  1UIL A;  4KQV A;  2CGE A;  1PDA A;  3D4J A;  2EPN A;  2V88 A;  5KL2 A;  4X65 E;  2PRT A;  1MEY C;  1J5E I;  4WXC A;  1HNX I;  1N34 I;  5ADZ A;  2L8T A;  4DR7 I;  4M9V C;  3ADG A;  1MG7 A;  4LOM A;  4GKK I;  2EML A;  2YTI A;  2JVA A;  2CT1 A;  1IMU A;  2GO3 A;  1B63 A;  4FW4 A;  3PYD A;  3J81 Q;  3OTO I;  1DQ3 A;  2EPZ A;  2JEB A;  3CWV A;  1LLM C;  1N36 E;  4LF5 E;  4DR1 I;  4DUY E;  2VQF I;  2EM2 A;  4DV7 I;  1UBD C;  4F9C B;  4DV4 I;  4BA1 B;  2C39 B;  1T39 A;  1FKA E;  1YYO A;  4BHB A;  4DR3 E;  3TQM A;  4U3B A;  5AE3 A;  1GZ6 A;  5IXM B;  2A2C A;  3LPS A;  1O0W A;  4IZJ D;  1D6T A;  2C38 B;  1I94 I;  2K4V A;  4DPT A;  4DV5 E;  2EPR A;  2VQE E;  3HPZ A;  3H09 A;  3LML A;  2RQL A;  3EQ1 A;  2BR2 A;  3M6A A;  2X7I A;  3M85 G;  4LFB I;  4LF4 I;  1RHY A;  3K1J A;  2E5L I;  4TUG A;  2GPI A;  2MC5 A;  4DMI A;  1R6M A;  4PU9 A;  4B3S I;  4K0K I;  2EPX A;  2NUF A;  4K0K E;  4P7A A;  4GQU A;  1XMO E;  1Z0G A;  4DV2 I;  3FIG A;  4ZYD A;  4R2P A;  1QNT A;  3T1H E;  3HKM A;  4JI8 E;  4KWY A;  3ZKB A;  5GMD A;  5ELW A;  3Q6M A;  2ELY A;  4HXZ A;  2O1U A;  4M2Z A;  3UK3 C;  1Y4U A;  4OO1 F;  1ZM3 A;  2EMK A;  4KHP I;  2L92 A;  1XMQ E;  3HTX A;  4DKK A;  5EKW A;  1EH6 A;  3M7N G;  2LBS B;  1IQO A;  1X6F A;  5JEA C;  2N3G A;  4WUC A;  2EPU A;  2EN2 A;  2LV2 A;  2L3C A;  2V2Z A;  2HFS A;  4R8O A;  4F6M A;  4WXD A;  2YTJ A;  2JEA B;  2EJ4 A;  1ZBT A;  3KZZ A;  2PNM A;  3ZM7 A;  4UT4 A;  2J65 A;  2J7K A;  3LTO A;  2PO1 B;  1XNQ E;  5IWA E;  2EMH A;  4X9J A;  2UXC I;  2YTO A;  1JK2 A;  1Z0B A;  4DV0 I;  2LO3 A;  5AAS A;  1TN9 A;  2KHX A;  3PS1 A;  4GKK E;  3H1C A;  4I3H A;  2NUG A;  2EM9 A;  2EZ6 A;  2FTX B;  4NXN E;  2BR2 B;  1OYP A;  1B69 A;  3ZKD A;  2EOH A;  2Q8U A;  4JI5 I;  4LF6 I;  4LCG A;  3WU5 A;  1PJT A;  4DR3 I;  4BC9 A;  3MHH C;  2WZO A;  3PYE A;  3ZZU A;  1KYQ A;  4OO1 A;  2LRS A;  2RTX A;  1H73 A;  4IZJ B;  4X64 E;  4KZS A;  5DNL A;  3KRN A;  2HHH I;  4JI3 I;  4LFB E;  4DV4 E;  4DPY A;  4B3R I;  2DMI A;  4LFA I;  2WBS A;  2VRD A;  4DV3 I;  2Q2E B;  2RPC A;  3GON A;  3ZZT A;  4LF9 E;  1H72 C;  1YZ9 A;  5JEA B;  1Y60 A;  1XMQ I;  4LF8 I;  4EMD A;  1BBG A;  4JI8 I;  3ADJ A;  2ENA A;  4DR7 E;  4IJD A;  4R2E A;  4RPF A;  4IFD E;  2Z5E A;  4R1F A;  1KIJ A;  3THN A;  4R2D A;  1EH8 A;  2HK3 A;  2PNZ A;  2EN4 A;  2LT7 A;  4YHH E;  1VIS A;  2JYA A;  1WUU A;  4ZYH A;  5K36 C;  2C39 A;  1Z0V A;  2LJH A;  2HK2 A;  5A6B D;  5AC4 A;  4JI4 E;  2EM4 A;  2FGG A;  3M85 D;  1HK7 A;  4PRV A;  2EMF A;  4LF5 I;  3J81 C;  1ZU1 A;  1Y5Y A;  4USM A;  3OTO E;  5DRO A;  2YSO A;  2C37 B;  2IOQ A;  2EMX A;  3C6M A;  2BA1 D;  1MGT A;  5LL6 R;  5IWA I;  4DR5 I;  3JAM C;  4DU7 A;  3VHT B;  3M7N D;  3L7Z A;  2IOP A;  2YTN A;  4WSP A;  1KVK A;  2EMZ A;  2FV4 B;  2CTD A;  1BBO A;  2PO2 B;  4MLV A;  4UTG A;  2BM1 A;  2NN6 A;  4WYQ B;  2F4V I;  1B62 A;  2LUP B;  3QG5 C;  1FJG E;  2O1V A;  4HYM A;  3KWR A;  4JI0 E;  2CG9 A;  2O3Z A;  2WNR A;  4GZN C;  2MC6 A;  4MLQ A;  1UHZ A;  5BR8 E;  1U2R A;  4IZK B;  1TF6 A;  2V2Q A;  2GHF A;  1EH7 A;  2K7I A;  3AUZ A;  4ZYG A;  2C38 A;  2HHH E;  1OJ4 A;  2BA0 G;  2O1W A;  2EPA A;  3K17 A;  2CPN A;  3LLH A;  5K36 A;  5EL9 A;  2V34 A;  5T6J A;  3J7A G;  2LTS A;  4LFA E;  1A1J A;  5L3J A;  5A2Q C;  4P7D A;  1QU6 A;  4RH8 A;  2UXB E;  2VF3 A;  1X6E A;  4F9A B;  3GLL A;  3Q1Q A;  2JEA A;  1Z0W A;  4X64 I;  1N33 I;  5IT9 Q;  3RMP A;  2EMI A;  2EPC A;  2GQ0 A;  2EN3 A;  2KON A;  2IHR 1;  1YUJ A;  2C37 A;  2E1M A;  2YZT A;  3UHM A;  5A6B A;  1XXE A;  4MYU A;  2JOX A;  2O1T A;  1Y4S A;  3DD6 A;  4HY1 A;  4HTG A;  2WCC 3;  4B3T I;  1P42 A;  1IBK E;  2GS8 A;  3GME A;  4DR6 I;  2LMZ A;  4FW7 A;  1OYS A;  5DNY A;  4JI4 I;  1VI7 A;  3P06 A;  1QZR A;  4DUZ I;  1N36 I;  2LTR A;  4F9B B;  2UU9 I;  4FK5 C;  4DV1 E;  2NUE A;  2F8B A;  1DI2 A;  4DV6 I;  2EFG A;  2ZM6 E;  5JEA F;  3C6K A;  2L2K B;  1ZXN A;  1XNR E;  2E1R A;  1Z0T A;  1XNR I;  1FJG I;  3BF2 A;  3K85 A;  3AV0 A;  2D9H A;  3HXL A;  4WPY A;  4JI2 E;  2ZBK B;  2JXP A;  4DUZ E;  1FWL A;  5JEA A;  2EOX A;  2YRK A;  5JEA E;  1YH8 A;  1YYW A;  2VQE I;  2DLK A;  2YTQ A;  5KL7 A;  2EM7 A;  4MU1 A;  4OZE A;  1X47 A;  1ZBQ A;  2EN7 A;  4JI6 I;  4J8Z A;  2EPO A;  4R2A A;  2RS6 A;  2UXD I;  4B3M I;  4B3M E;  1E3P A;  2PO0 A;  4N4R B;  4MU0 A;  4DR4 E;  4AQY I;  2NN6 B;  2EWL A;  1UDO A;  2DB2 A;  4JI7 E;  1ZAA C;  2EOJ A;  5KL3 A;  4DR2 E;  3PYG A;  3PYF A;  2L6M A;  3NZK A;  2B7V A;  1EA6 A;  1T4N A;  1F2I G;  4BC7 A;  4LCF A;  1Y6Z A;  3U1K A;  1G2D C;  4Z7Y A;  5FLX Q;  2I13 A;  4FW6 A;  3VYY A;  4Q28 A;  5AC5 A;  1UEK A;  5DRQ A;  1WXR A;  4BBY A;  1HNW E;  3J7A M;  1HNZ E;  2L2N A;  1N34 E;  1NZ0 A;  5DRR A;  4HEI A;  4YY3 E;  4FWD A;  4LF7 I;  3P1X A;  4DV1 I;  2JP9 A;  1IBM E;  1X48 A;  1A1K A;  4KHP E;  2Z5C B;  3PS2 A;  3C4T A;  4GKJ E;  1MX0 A;  4BS9 A;  2NN6 E;  2M7Q A;  4XTJ A;  2B9D A;  3QT5 A;  4FWH A;  2CZ9 A;  1K47 A;  3JTZ A;  4LCH A;  1TF3 A;  4AID A;  2EM8 A;  4FW9 A;  5KL5 A;  5DRP A;  2EMY A;  2RS7 A;  2WP8 B;  3Q6N A;  4MQY A;  1SFE A;  4X62 E;  4WUD A;  3KZY A;  5F3W A;  3F6G A;  4O43 A;  2R1F A;  2NN6 C;  3B82 A;  4IFD F;  4HAC B;  2ZIT A;  2ELZ A;  5A6J A;  2VQF E;  2VE7 C;  2YU8 A;  4Q35 B;  4DV0 E;  3V5R A;  2YRM A;  4JYA I;  2UUA E;  4JYA E;  4NHR A;  3WU4 A;  1YPN A;  4OO1 E;  4GEQ B;  2YTP A;  4JI5 E;  4LF6 E;  1USU A;  2JR1 A;  2M4I A;  2VF1 A;  3HQ1 A;  4M1K A;  4WSG A;  3B4T A;  3B8H A;  2HKJ A;  2EP3 A;  3BBG A;  5CFF E;  2EMC A;  2JWO A;  5KL6 A;  2CVE A;  2CSH A;  1STU A;  2VES A;  1I94 E;  3T1Y I;  2L3J A;  2V85 A;  2EN1 A;  2JOB A;  2B3T B;  1YUI A;  2NN6 D;  2EOR A;  2NPF A;  2A25 A;  1YHC A;  4DR2 I;  3F6H A;  3J7Y p;  2EPP A;  3DF6 A;  2LJP A;  4OO1 C;  4DV3 E;  4ED4 A;  4O5G A;  4O24 A;  5JEA D;  5KL4 A;  1BKN A;  1RMD A;  5C0X B;  4AQY E;  1XMO I;  4DR4 I;  4GKJ I;  2B7T A;  2R76 A;  4B3T E;  2EOE A;  1GTK A;  2ODR D;  3IWD A;  1ZM2 A;  2JEB B;  5A69 A;  3HUL A;  1HNX E;  5K36 D;  2EE8 A;  1HNZ I;  5TSE A;  2ADR A;  1XHK A;  4B3S E;  3JAM Q;  3BGH A;  1A1G A;  1A1I A;  1A1H A;  1RR9 A;  3BID A;  1IBK I;  2HFU A;  3EPH A;  1Z5A A;  3QT7 A;  3HPS A;  4IZJ A;  1EKZ A;  3T1H I;  1SR9 A;  2YRH A;  2DEJ A;  2V8P A;  2HC5 A;  3ECR A;  2EMW A;  1J5E E;  2XEX A;  2BA1 G;  5LMN I;  1AAY A;  1UN6 B;  2Z5C A;  1Z1B A;  3CDI A;  3M99 B;  1IBM I;  2EN8 A;  1FNM A;  2MDG A;  1H7S A;  2X36 A;  4DV7 E;  4DPU A;  2ZM6 I;  4IS1 C;  1G2F C;  2PO2 A;  3EPK A;  4F6N A;  1E3H A;  2GLI A;  1ZM9 A;  2EOS A;  3J80 Q;  2MDR A;  2GO4 A;  2UXD E;  1NHI A;  2EM3 A;  4OKG A;  4DUY I;  1IBL I;  4LTY A;  1GQE A;  4QNJ A;  2V89 A;  1IBL E;  1WJP A;  1X6H A;  1Z5C A;  2EM5 A;  4RHB B;  3DJW A;  4M30 A;  4TUI A;  2YPN A;  1YYK A;  2F4V E;  1H74 A;  1Z59 A;  4MU3 A;  2EMB A;  3QT6 A;  2EOQ A;  2EOO A;  3IWB A;  5C0X C;  4BA2 B;  2YTD A;  4URL A;  4OO1 D;  4WUB A;  2OI2 A;  2UXC E;  1ZR9 A;  2PO0 B;  2M9A A;  2A2D A;  3THO B;  4DR1 E;  2BM0 A;  4FN5 A;  2BBG A;  3H4L A;  1RC7 A;  5A2Q Q;  4MYT A;  4R03 A;  4LF4 E;  4DXL A;  2WBU A;  4NBQ A;  4IFD B;  4LFC E;  4JV5 E;  2V86 A;  1PJS A;  1ZM4 A;  2EQ1 A;  2JT2 A;  1PIE A;  5AE2 A;  1YSA C;  1USV A;  4LFC I;  1FWK A;  1Z0C A;  2EL5 A;  3OML A;  3WU3 A;  4LF8 E;  1PKP A;  5C0X D;  2PO1 A;  2MKN A;  2L2M A;  2WP8 A;  2IER A;  3P3G A;  2WW4 A;  4JI7 I;  4LU9 A;  4ZVI A;  3ZZ0 A;  3VK6 A;  1Z5B A;  3JU0 A;  1T4L B;  3HJC A;  3IWC A;  1N32 E;  2HJJ A;  2JE6 B;  1UDQ A;  2LCE A;  1N32 I;  2F1D A;  2RSM A;  3PRY A;  5LLQ A;  4F2J C;  2JY9 A;  2EL6 A;  1KTV A;  2KOU A;  2R42 A;  1KJK A;  1Z0E A;  1HNW I;  3P3E A;  3VYX A;  1RQ0 A;  1A6F A;  3GCM A;  4LF7 E;  1OYR A;  4DV6 E;  4R2R A;  2I9I A;  2YT4 A;  4AIM A;  1HR0 I;  2NN6 F;  4I8O A;  4BA1 A;  2E72 A;  4X62 I;  2L33 A;  2NA2 A;  4WFT A;  2ENH A;  3MHS C;  4X65 I;  3K6Q A;  2EL4 A;  2EN6 A;  4NZV A;  1JK1 A;  5BR8 I;  2PNL A;  4IFD A;  2YTE A;  5LMN E;  3EPJ A;  4O4K A;  2N3H A;  4FWG A;  2Z5B B;  2MKD A;  4JI3 E;  2UUA I;  1PJQ A;  1A1L A;  3C4B A;  1NCS A;  2EOM A;  3LNU A;  4ISA A;  5K36 F;  2G7H A;  2NAB A;  2ODR C;  4JI6 E;  1P47 A;  4JG4 A;  4U3D A;  1DAR A;  4BA2 A;  2H36 X;  2UXB I;  4NXM E;  1KKH A;  1PVG A;  4LPF A;  4DPW A;  4LF9 I;  4R2C A;  2EPM X;  4DV5 I;  4X8W A;  1ZXM A;  3J80 C;  4NXN I;  1N3G A;  2DMY A;  1A1F A;  1S16 A;  4JI1 E;  2AJ4 A;  1DGC A;  4B3R E;  4P52 A;  2YU5 A;  2EOZ A;  4AM3 A;  4QNK A;  1R6L A;  4X66 E;  4J3D A;  2RSI A;  4DPX A;  2EPK X;  2LUQ A;  4OOG C;  4BCA A;  4YHH I;  4DV2 E;  4HAC A;  4MU4 A;  1X3C A;  2UUC E;  4WX9 A;  2HKE A;  2V87 A;  2ENC A;  1H7U A;  2EOY A;  4FW5 A;  2IES A;  2EM6 A;  4YY3 I;  2M1S A;  2E5L E;  2AE8 A;  2YSP A;  4BMJ A;  4R2S A;  3V2U C;  2YTG A;  4R2Q A;  4FW3 A;  2WBT A;  1HR0 E;  4DR6 E;  2YTF A;  2EPL X;  3PS3 A;  2EQ3 A;  4IZK A;  2DIX A;  1X49 A;  2LJU A;  2DEI A;  1XNQ I;  4L5N C;  4BHC A;  5IT9 C;  3ADL A;  5FWK A;  2UU9 E;  1NEI A;  2PNZ B;  4IFD C;  2Z5B A;  4L8N A;  1T4O A;  4Z7C A;  1UDS A;  4P78 A;  1J26 A;  1FI4 A;  5C0X E;  5C0X A;  3MSW A;  4DR5 E;  2V8Q B;  5A6K A;  1X5W A;  2DLQ A;  4MDT A;  1N0U A;  5GME A;  2UUB E;  5FLX C;  2UUB I;  4NXM I;  2N8X A;  1YFH A;  5C0X F;  4F54 A;  1RRE A;  4USK A;  4JI0 I;  1IQS A;  2V83 A;  2LE2 A;  4JI2 I;  2EMA A;  1NHH A;  4ZYE A;  4OO1 B;  1BB8 A;  2YWQ A;  2J7J A;  3B78 A;  3EPL A;  2EOF A; 
#chains in the Genus database with same CATH homology
 3QT8 A;  3ADI A;  4JI1 I;  2DSY A;  1N0V C;  4PRX A;  3WU6 A;  1EI1 A;  1WHN A;  2R3V A;  1WHQ A;  1MU5 A;  1ELO A;  3F0N A;  4OX9 E;  5LMU I;  3T1Y E;  5LMU E;  5AE1 A;  4OX9 I;  2UUC I;  3ZOQ B;  1S4E A;  2BV3 A;  2V2V A;  4DU8 A;  4X66 I;  1NHJ A;  4N3O A;  4M0V A;  1N33 E;  1UIL A;  4KQV A;  2CGE A;  3D4J A;  4X65 E;  2V88 A;  1J5E I;  1HNX I;  4DR7 I;  1N34 I;  5ADZ A;  2L8T A;  3ADG A;  1MG7 A;  4GKK I;  2JVA A;  1B63 A;  3PYD A;  3J81 Q;  3OTO I;  1DQ3 A;  3CWV A;  1N36 E;  4LF5 E;  4DR1 I;  4DUY E;  2VQF I;  4DV7 I;  4F9C B;  4DV4 I;  1FKA E;  1YYO A;  4DR3 E;  5AE3 A;  1GZ6 A;  2A2C A;  3LPS A;  1O0W A;  4IZJ D;  1D6T A;  1I94 I;  2K4V A;  4DPT A;  4DV5 E;  2VQE E;  3HPZ A;  3H09 A;  3LML A;  3M6A A;  2X7I A;  4LFB I;  4LF4 I;  3K1J A;  2E5L I;  4TUG A;  2MC5 A;  4DMI A;  4PU9 A;  4B3S I;  4K0K I;  4P7A A;  2NUF A;  4K0K E;  1XMO E;  1Z0G A;  4DV2 I;  3FIG A;  3T1H E;  4JI8 E;  3ZKB A;  5GMD A;  3Q6M A;  4HXZ A;  2O1U A;  4M2Z A;  1Y4U A;  1ZM3 A;  4KHP I;  2L92 A;  1XMQ E;  3HTX A;  4DKK A;  2LBS B;  2N3G A;  4WUC A;  2L3C A;  2V2Z A;  2HFS A;  4R8O A;  1ZBT A;  2PNM A;  4UT4 A;  2J7K A;  3LTO A;  1XNQ E;  5IWA E;  2UXC I;  1Z0B A;  4DV0 I;  5AAS A;  2KHX A;  4GKK E;  4I3H A;  2NUG A;  2EZ6 A;  2FTX B;  4NXN E;  3ZKD A;  4JI5 I;  4LF6 I;  3WU5 A;  4DR3 I;  4BC9 A;  3PYE A;  2WZO A;  3ZZU A;  2LRS A;  2RTX A;  1H73 A;  4IZJ B;  4X64 E;  4KZS A;  2HHH I;  4JI3 I;  4LFB E;  4DV4 E;  4DPY A;  4B3R I;  4LFA I;  4DV3 I;  2Q2E B;  3GON A;  3ZZT A;  4LF9 E;  1H72 C;  1YZ9 A;  1XMQ I;  4LF8 I;  4EMD A;  4JI8 I;  3ADJ A;  4DR7 E;  4RPF A;  2Z5E A;  4R1F A;  1KIJ A;  2HK3 A;  4YHH E;  1VIS A;  1WUU A;  2HK2 A;  1Z0V A;  2LJH A;  4JI4 E;  2FGG A;  1HK7 A;  4PRV A;  4LF5 I;  3J81 C;  4USM A;  3OTO E;  2IOQ A;  5IWA I;  4DR5 I;  5LL6 R;  3JAM C;  4DU7 A;  2IOP A;  4WSP A;  1KVK A;  2FV4 B;  4UTG A;  2BM1 A;  4WYQ B;  2F4V I;  1B62 A;  2LUP B;  1FJG E;  2O1V A;  4HYM A;  3KWR A;  4JI0 E;  2CG9 A;  2MC6 A;  5BR8 E;  1UHZ A;  1U2R A;  4IZK B;  2V2Q A;  3AUZ A;  2HHH E;  1OJ4 A;  2O1W A;  3K17 A;  2CPN A;  3LLH A;  2V34 A;  5T6J A;  3J7A G;  2LTS A;  4LFA E;  5L3J A;  5A2Q C;  4P7D A;  1QU6 A;  2UXB E;  2VF3 A;  4F9A B;  3Q1Q A;  1N33 I;  1Z0W A;  4X64 I;  5IT9 Q;  3RMP A;  2GQ0 A;  2KON A;  2IHR 1;  2E1M A;  2YZT A;  4MYU A;  2JOX A;  2O1T A;  1Y4S A;  4HY1 A;  4B3T I;  1IBK E;  2GS8 A;  4DR6 I;  2LMZ A;  5DNY A;  4JI4 I;  3P06 A;  1QZR A;  4DUZ I;  1N36 I;  2LTR A;  4F9B B;  2UU9 I;  4DV1 E;  2NUE A;  1DI2 A;  2F8B A;  4DV6 I;  2EFG A;  2ZM6 E;  1ZXN A;  2L2K B;  1XNR E;  2E1R A;  1Z0T A;  1XNR I;  1FJG I;  3K85 A;  3AV0 A;  3HXL A;  4WPY A;  4JI2 E;  2ZBK B;  4DUZ E;  1FWL A;  1YYW A;  2VQE I;  1X47 A;  1ZBQ A;  4JI6 I;  4J8Z A;  2UXD I;  2RS6 A;  4B3M I;  4B3M E;  4DR4 E;  4AQY I;  2EWL A;  2DB2 A;  4JI7 E;  3PYG A;  3PYF A;  4DR2 E;  2L6M A;  2B7V A;  1EA6 A;  1T4N A;  4BC7 A;  1Y6Z A;  5FLX Q;  4Z7Y A;  3VYY A;  4Q28 A;  1UEK A;  1WXR A;  4BBY A;  1HNW E;  3J7A M;  1HNZ E;  2L2N A;  1N34 E;  1NZ0 A;  4YY3 E;  4FWD A;  4LF7 I;  3P1X A;  4DV1 I;  1IBM E;  1X48 A;  4KHP E;  2Z5C B;  3C4T A;  4GKJ E;  1MX0 A;  4BS9 A;  2M7Q A;  4XTJ A;  2B9D A;  3QT5 A;  4FWH A;  2CZ9 A;  1K47 A;  3JTZ A;  4FW9 A;  2RS7 A;  3Q6N A;  4X62 E;  4WUD A;  5F3W A;  3F6G A;  3B82 A;  4HAC B;  2ZIT A;  4DV0 E;  2VQF E;  3V5R A;  2VE7 C;  4JYA I;  2UUA E;  4JYA E;  3WU4 A;  4GEQ B;  4JI5 E;  4LF6 E;  1USU A;  2JR1 A;  2VF1 A;  2M4I A;  3HQ1 A;  4M1K A;  3B8H A;  2HKJ A;  5CFF E;  2JWO A;  1STU A;  1I94 E;  3T1Y I;  2L3J A;  2V85 A;  2JOB A;  2B3T B;  2NPF A;  4DR2 I;  3F6H A;  3J7Y p;  3DF6 A;  2LJP A;  4DV3 E;  4ED4 A;  1BKN A;  1XMO I;  4AQY E;  4DR4 I;  4GKJ I;  2B7T A;  4B3T E;  3HUL A;  2ODR D;  3IWD A;  1ZM2 A;  1HNX E;  1HNZ I;  1XHK A;  4B3S E;  3JAM Q;  1RR9 A;  1IBK I;  2HFU A;  1Z5A A;  3QT7 A;  3HPS A;  4IZJ A;  1EKZ A;  3T1H I;  1SR9 A;  2DEJ A;  2V8P A;  1J5E E;  2XEX A;  5LMN I;  2Z5C A;  1IBM I;  1FNM A;  2X36 A;  1H7S A;  4DPU A;  4DV7 E;  2ZM6 I;  1ZM9 A;  3J80 Q;  2MDR A;  2UXD E;  1NHI A;  4DUY I;  1IBL I;  4LTY A;  1GQE A;  2V89 A;  1IBL E;  1Z5C A;  4TUI A;  3DJW A;  4M30 A;  2F4V E;  1YYK A;  1H74 A;  1Z59 A;  3QT6 A;  3IWB A;  4URL A;  4WUB A;  2OI2 A;  2UXC E;  2A2D A;  4DR1 E;  2BM0 A;  4FN5 A;  3H4L A;  1RC7 A;  5A2Q Q;  4MYT A;  4R03 A;  4LF4 E;  4DXL A;  4LFC E;  4JV5 E;  2V86 A;  1ZM4 A;  4LFC I;  4JV5 I;  1PIE A;  5AE2 A;  1USV A;  1FWK A;  1Z0C A;  3OML A;  3WU3 A;  4LF8 E;  1PKP A;  2L2M A;  2WW4 A;  4JI7 I;  4LU9 A;  4ZVI A;  3ZZ0 A;  3VK6 A;  1Z5B A;  3JU0 A;  1T4L B;  3HJC A;  3IWC A;  1N32 E;  1N32 I;  2RSM A;  3PRY A;  2JY9 A;  2R42 A;  1KTV A;  2KOU A;  1Z0E A;  1HNW I;  3VYX A;  1RQ0 A;  1A6F A;  4LF7 E;  4DV6 E;  2YT4 A;  1HR0 I;  4I8O A;  4X62 I;  2L33 A;  2NA2 A;  4WFT A;  4X65 I;  3K6Q A;  5BR8 I;  2PNL A;  5LMN E;  2N3H A;  4FWG A;  2Z5B B;  4JI3 E;  2UUA I;  3C4B A;  3LNU A;  2G7H A;  2ODR C;  4JI6 E;  4JG4 A;  1DAR A;  2H36 X;  2UXB I;  4NXM E;  1KKH A;  1PVG A;  4DPW A;  4LF9 I;  4DV5 I;  4X8W A;  1ZXM A;  3J80 C;  4NXN I;  2DMY A;  1S16 A;  4JI1 E;  2AJ4 A;  4B3R E;  4P52 A;  4X66 E;  4DPX A;  2LUQ A;  4OOG C;  4BCA A;  4YHH I;  4DV2 E;  4HAC A;  2UUC E;  2HKE A;  2V87 A;  1H7U A;  4YY3 I;  2M1S A;  2E5L E;  3V2U C;  4BMJ A;  1HR0 E;  4DR6 E;  4IZK A;  2DIX A;  1X49 A;  2DEI A;  1XNQ I;  4L5N C;  5IT9 C;  3ADL A;  5FWK A;  2UU9 E;  2Z5B A;  4L8N A;  1T4O A;  4Z7C A;  4P78 A;  1J26 A;  1FI4 A;  3MSW A;  4DR5 E;  2V8Q B;  1N0U A;  5GME A;  2UUB E;  5FLX C;  2UUB I;  4NXM I;  4F54 A;  1RRE A;  4USK A;  4JI0 I;  2V83 A;  2LE2 A;  4JI2 I;  1NHH A;  3B78 A;  3ZM7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...