4JI1I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 23
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji1I00
1RREA 4DPYA 4LF4E 4YY3E 5IT9C 2UXBI 2V2VA 4DXLA 3J7AG 3WU3A 4JYAE 1Z5AA 2V2ZA 1BKNA 2XEXA 1D6TA 1XHKA 1XNRE 1ZM9A 2ZBKB 5IWAI 1FJGI 4DV6I 1Z0EA 4GKJE 5GMEA 2E5LI 1HNZE 4JYAI 4MYUA 4DUZE 4KHPE 4X62I 3J81C 2CZ9A 4PU9A 1XNRI 4DR3E 1FI4A 4DV0I 4DV6E 3LPSA 3LNUA 1XMOI 2UXCI 3ZZ0A 4DUZI 4KHPI 1PIEA 4X62E 1H73A 5A2QQ 3J80Q 5GMDA 3LTOA 1EA6A 4FWHA 1N34I 4JI0E 1IBKE 3HULA 4JI8I 1Z5CA 4LF9E 3M6AA 1B63A 4ED4A 3ZKDA 4UTGA 3OTOI 2UU9I 4LFCE 2OI2A 3D4JA 1N34E 4LFBI 3ZZTA 4EMDA 1IBKI 5IT9Q 2R42A 1UEKA 4HACB 1H72C 3B82A 4JG4A 4LF9I 2Q2EB 1KTVA 4LF7I 4URLA 4HYMA 4UT4A 4JI7I 4JI5I 3ZKBA 4DV4E 4LFAE 2BM1A 2AJ4A 2ZM6E 4LFBE 4DV2E 3J80C 2V2QA 4X65E 2DEIA 4NXME 1Z0VA 4GKKI 1XNQI 4K0KI 1FKAE 4DV1E 2NPFA 4M1KA 4DV4I 4LFAI 1NHIA 1N0UA 1FWKA 3T1HE 2DEJA 4X65I 1KIJA 2X7IA 4DR1I 1XNQE 4K0KE 2BM0A 2A2CA 1ZM3A 4DV1I 1Z0GA 1EI1A 2UXDI 1ZM4A 4DUYI 5BR8I 1Z0BA 4Z7YA 3T1HI 1HNXE 4HACA 1N33E 2HFSA 4X66I 4DR6I 2F4VI 1FWLA 1N0VC 5LL6R 3T1YI 4YY3I 4ZVIA 4DR5E 4DR7I 4R1FA 2UXBE 4OX9E 4X66E 1NHJA 1ELOA 2UUCE 1ZXNA 3WU5A 1ZM2A 2HHHI 4LF8E 4DR5I 5IWAE 2R3VA 3ZZUA 4OX9I 3QT8A 4P7AA 2E5LE 4NXNI 1N36E 1ZXMA 1U2RA 1IBLE 1MG7A 2VQFI 4JI4I 4RPFA 3V5RA 1FNMA 4P52A 2EFGA 4DV0E 1HR0I 2X36A 4FWDA 2UXCE 4WUDA 4JI2E 1IBLI 2VQFE 4LF6E 4LF5E 1HR0E 5FLXQ 1I94I 4DV5E 2HKJA 2UUBI 4HXZA 1NHHA 4JI0I 4B3RE 1NZ0A 4JI8E 2HKEA 1S4EA 4DPUA 1QZRA 1PVGA 3OTOE 2UU9E 4JI6E 4LFCI 4LF5I 3K1JA 3J81Q 1XMQI 4DV5I 4XTJA 2UUBE 4B3RI 1IBME 4FW9A 3PYEA 2HK2A 4DU7A 2UUAE 3F0NA 4JI6I 4JI5E 1N32I 2ZM6I 2V8PA 3WU6A 2VQEE 3ZM7A 1IBMI 4X64E 2WW4A 2E1RA 1H7UA 2UUAI 4JI3I 1DARA 2VF3A 5LMUI 4JV5I 4HY1A 4X64I 4DPXA 4DR4I 5FLXC 3B8HA 4DV3E 1PKPA 4AQYE 2HK3A 2HFUA 2A2DA 4WUCA 4LF4I 1J5EE 3JAMC 4DV3I 4B3MI 3T1YE 1OJ4A 1J5EI 4DR7E 4Z7CA 1FJGE 4DPTA 4GKJI 4B3ME 5LMNE 3PYDA 1HNZI 2UUCI 1Z5BA 1A6FA 5L3JA 3K17A 2HHHE 4LF8I 5A2QC 4DR3I 3WU4A 5LMNI 1XMOE 1N36I 4NXNE 1WUUA 4WUBA 1H74A 4JI4E 4KQVA 1Z0TA 3JAMQ 4DU8A 4B3TE 4MYTA 3PYGA 3QT6A 4FWGA 1Z0CA 1VISA 2V34A 4YHHI 4JI2I 4FN5A 1MU5A 4LF6I 4DV7I 3PYFA 1H7SA 1MX0A 2ZITA 4B3TI 1I94E 3QT5A 4PRVA 4YHHE 4DR2I 1Z0WA 1HNWE 4LF7E 3CWVA 4DV7E 3GONA 4JI7E 4PRXA 4B3SI 1XMQE 4DV2I 4DR2E 3J7AM 1HNWI 1K47A 4NXMI 4GKKE 3QT7A 3V2UC 3Q1QA 4USKA 4B3SE 1S16A 1N32E 2VQEI 1RR9A 4I3HA 4JI1E 4DR1E 1KVKA 4JI3E 2UXDE 5LMUE 4JV5E 4DUYE 3B78A 5BR8E 1Z59A 1B62A 1KKHA 4DR4E 1HNXI 4USMA 2GS8A 1N33I 3H4LA 2LJPA 4JI1I 4AQYI 2BV3A 4DR6E 2J7KA 2F4VE 4DPWA
chains in the Genus database with same CATH superfamily
1RREA 4DPYA 2JE6A 4LF4E 4YY3E 1UDQA 4MU3A 5IT9C 2UXBI 4MQYA 2V2VA 4DXLA 4IFDC 3J7AG 3WU3A 4JYAE 4AIMA 1Z5AA 2V2ZA 1BKNA 2PO0A 2XEXA 1D6TA 2BA0G 1XHKA 4MDTA 1XNRE 2PNMA 1ZM9A 4BA1B 2ZBKB 5IWAI 1FJGI 4DV6I 1Z0EA 4GKJE 5GMEA 2E5LI 4OZEA 1HNZE 2O3ZA 4JYAI 4MYUA 4DUZE 4KHPE 2WP8B 2GQ0A 4X62I 3P3GA 2Z5BB 3PS3A 3J81C 2CZ9A 2NN6A 4PU9A 1XNRI 4DR3E 1FI4A 4DV0I 4DV6E 4OO1C 3CDJA 3LPSA 2JEBA 2O1TA 3LNUA 1XMOI 2UXCI 3ZZ0A 3B4TA 4DUZI 4KHPI 1PIEA 1Y60A 4X62E 1H73A 5A2QQ 3J80Q 5C0XC 2NN6D 5GMDA 2PO0B 4BA2B 3LTOA 1EA6A 4FWHA 1N34I 3KRNA 4JI0E 1IBKE 3HULA 2NN6E 4JI8I 1Z5CA 4LF9E 3M6AA 1B63A 4ED4A 4NBQA 3ZKDA 5K36B 4J3DA 4UTGA 3OTOI 2UU9I 4LFCE 4IFDE 2OI2A 3D4JA 1N34E 4LFBI 3ZZTA 4EMDA 1IBKI 5IT9Q 2R42A 1UEKA 4HACB 4IFDD 1H72C 3B82A 4JG4A 4LF9I 2Q2EB 1KTVA 3CDIA 4LF7I 4URLA 4HYMA 2Z5CB 4UT4A 4JI7I 2JT2A 3ZKBA 4DV4E 4JI5I 4LFAE 1Y4SA 2BM1A 2AJ4A 2ZM6E 4LFBE 4DV2E 3J80C 2V2QA 4X65E 2DEIA 1Z0VA 4NXME 4GKKI 1XNQI 4K0KI 1FKAE 2JE6B 4DV1E 1Y5YA 2NPFA 4M1KA 4DV4I 4LFAI 5C0XA 1RHYA 1NHIA 1N0UA 2BA0D 1FWKA 3T1HE 2DEJA 4X65I 1KIJA 2X7IA 4DR1I 1XNQE 4K0KE 2BM0A 2A2CA 4LCFA 1ZM3A 2GO4A 4DV1I 4OO1B 1Z0GA 1EI1A 2UXDI 1ZM4A 4N3OA 4DUYI 5BR8I 2NN6C 2C39A 1Z0BA 4Z7YA 4MU1A 3T1HI 1HNXE 4HACA 1N33E 2HFSA 1UDNA 4OO1E 4X66I 4DR6I 2F4VI 4AM3A 1FWLA 4OO1D 1N0VC 2JEBB 5LL6R 4U3DA 3T1YI 5K36F 4YY3I 1XXEA 2CVEA 4ZVIA 4DR5E 5C0XE 3L7ZA 4DR7I 2O1WA 4R1FA 2UXBE 4OX9E 1HK7A 4X66E 1NHJA 1ELOA 2UUCE 1ZXNA 3WU5A 5DRQA 1ZM2A 2HHHI 1Y6ZA 4LF8E 4DR5I 2Z5EA 5IWAE 2R3VA 2C38A 3ZZUA 2PO1A 4OX9I 3QT8A 4P7AA 2E5LE 4AIDA 4NXNI 1N36E 2PO2A 1ZXMA 5JEAC 1U2RA 1UDSA 1IBLE 1MG7A 2VQFI 3P3CA 4JI4I 4RPFA 3V5RA 1FNMA 2PNLA 4LOMA 4P52A 2EFGA 5DRPA 4DV0E 3DD6A 1HR0I 2C37B 2X36A 3M85D 3K85A 4FWDA 2UXCE 4QNJA 4WUDA 2O1UA 4IZJD 4JI2E 3M7ND 1IBLI 2VQFE 4LF6E 2WP8A 4IZKB 4LF5E 1HR0E 5FLXQ 1R6LA 1I94I 4DV5E 2HKJA 2UUBI 3U1KA 4HXZA 1NHHA 4JI0I 4B3RE 3HJCA 1NZ0A 4JI8E 2C38B 2HKEA 1S4EA 2BA1G 4DPUA 5K36E 3PS2A 1QZRA 1PVGA 3OTOE 2UU9E 4JI6E 4LFCI 4LF5I 3K1JA 3J81Q 2IESA 4DV5I 1XMQI 4XTJA 2UUBE 4B3RI 1UDOA 1IBME 4GQUA 2PO2B 5K36A 4FW9A 3PYEA 2HK2A 2CG9A 4DU7A 2J65A 2UUAE 3F0NA 4JI6I 2NN6B 4JI5E 2O1VA 1N32I 2ZM6I 3P76A 2V8PA 3WU6A 2VQEE 3ZM7A 1IBMI 4X64E 3Q6NA 5C0XD 5DRRA 2PNZB 2WW4A 4FW6A 2E1RA 1H7UA 2UUAI 3L7ZB 4JI3I 1DARA 2VF3A 3P3EA 3UHMA 5LMUI 4JV5I 3Q6MA 2PNZA 4HY1A 1OYPA 4X64I 4DPXA 4DR4I 5FLXC 3B8HA 4DV3E 1PKPA 4AQYE 5C0XB 2HK3A 2HFUA 4OKGA 2A2DA 3PS1A 4WUCA 4LF4I 2PO1B 2WNRB 1J5EE 5K36C 3JAMC 1E3HA 2F1DA 4LCGA 4DV3I 4B3MI 5DROA 5JEAD 4FW4A 4FW3A 3P06A 2BR2B 3T1YE 1OJ4A 4MU4A 1J5EI 4DR7E 4Z7CA 1FJGE 4DPTA 3M85G 4GKJI 4B3ME 5LMNE 3PYDA 2BR2A 3GMEA 1HNZI 2UUCI 1Z5BA 1A6FA 5L3JA 4IZKA 3K17A 2HHHE 4LF8I 5A2QC 4BA2A 2AE8A 5ELWA 2IOPA 4DR3I 3WU4A 5LMNI 1XMOE 2WNRA 1N36I 4NXNE 1WUUA 4IZJA 4QNKA 4WUBA 4OO1F 4IFDB 1R6MA 4IS9A 1H74A 4JI4E 4KQVA 1P42A 1Z0TA 3JAMQ 4DU8A 4B3TE 5JEAA 4MYTA 3PYGA 3QT6A 4FWGA 1YHCA 4BA1A 1Z0CA 3PRYA 1VISA 2V34A 2BA1D 4YHHI 4JI2I 4FN5A 1MU5A 5JEAE 4LF6I 4OO1A 4DV7I 3PYFA 1H7SA 1MX0A 2ZITA 4B3TI 2CGEA 1I94E 2IERA 2Z5CA 1VI7A 3H1CA 4IFDF 5JEAF 3QT5A 4PRVA 4YHHE 4DR2I 2C37A 5EKWA 1Z0WA 2JEAA 3M7NG 4U3BA 1HNWE 4LF7E 3CWVA 3GCMA 4DV7E 3GONA 4JI7E 4PRXA 4B3SI 1XMQE 4DV2I 4FW5A 1USVA 1Y4UA 4DR2E 4IZJB 3J7AM 2GO3A 1HNWI 1K47A 4NXMI 4IFDA 4MU0A 1E3PA 4GKKE 3QT7A 3V2UC 3Q1QA 5EL9A 4USKA 5DNLA 4B3SE 1OYSA 1S16A 5JEAB 5C0XF 1N32E 3U1YA 2VQEI 5FWKA 1RR9A 3HKMA 4I3HA 5K36D 2VESA 3NZKA 4JI1E 4DR1E 2C39B 1KVKA 4FW7A 4LPFA 2JEAB 4ISAA 4JI3E 2UXDE 5DNXA 5LMUE 4JV5E 4DUYE 3B78A 5BR8E 3GLLA 1Z59A 1B62A 1YH8A 1KKHA 2IOQA 4DR4E 1HNXI 4USMA 2GS8A 1N33I 3H4LA 2LJPA 4JI1I 1USUA 4AQYI 2Z5BA 2BV3A 4DR6E 2J7KA 4LCHA 2F4VE 2NN6F 4DPWA 1OYRA
chains in the Genus database with same CATH topology
1RREA 4DPYA 4LF4E 4YY3E 5IT9C 2UXBI 2V2VA 4DXLA 3J7AG 3WU3A 4JYAE 1Z5AA 2V2ZA 1BKNA 2XEXA 1D6TA 1XHKA 1XNRE 2PNMA 1ZM9A 2ZBKB 5IWAI 1FJGI 4DV6I 1Z0EA 4GKJE 5GMEA 2E5LI 1HNZE 4JYAI 4MYUA 4DUZE 4KHPE 2GQ0A 4X62I 2Z5BB 3J81C 2CZ9A 4PU9A 1XNRI 4DR3E 1FI4A 4DV0I 4DV6E 3LPSA 2O1TA 3LNUA 1XMOI 2UXCI 3ZZ0A 4DUZI 4KHPI 1PIEA 4X62E 1H73A 5A2QQ 3J80Q 5GMDA 3LTOA 1EA6A 4FWHA 1N34I 4JI0E 1IBKE 3HULA 4JI8I 1Z5CA 4LF9E 3M6AA 1B63A 4ED4A 3ZKDA 4UTGA 3OTOI 2UU9I 4LFCE 2OI2A 3D4JA 1N34E 4LFBI 3ZZTA 4EMDA 1IBKI 5IT9Q 2R42A 1UEKA 4HACB 1H72C 3B82A 4JG4A 4LF9I 2Q2EB 1KTVA 4LF7I 4URLA 4HYMA 2Z5CB 4UT4A 4JI7I 4JI5I 3ZKBA 4DV4E 4LFAE 1Y4SA 2BM1A 2AJ4A 2ZM6E 4LFBE 4DV2E 3J80C 2V2QA 4X65E 2DEIA 1Z0VA 4NXME 4GKKI 1XNQI 4K0KI 1FKAE 4DV1E 2NPFA 4M1KA 4DV4I 4LFAI 1NHIA 1N0UA 1FWKA 3T1HE 2DEJA 4X65I 1KIJA 2X7IA 4DR1I 1XNQE 4K0KE 2BM0A 2A2CA 1ZM3A 4DV1I 1Z0GA 1EI1A 2UXDI 1ZM4A 4N3OA 4DUYI 5BR8I 1Z0BA 4Z7YA 3T1HI 1HNXE 4HACA 1N33E 2HFSA 4X66I 4DR6I 2F4VI 1FWLA 1N0VC 5LL6R 3T1YI 4YY3I 4ZVIA 4DR5E 4DR7I 2O1WA 4R1FA 2UXBE 4OX9E 1HK7A 4X66E 1NHJA 1ELOA 2UUCE 1ZXNA 3WU5A 1ZM2A 2HHHI 1Y6ZA 4LF8E 4DR5I 2Z5EA 5IWAE 2R3VA 3ZZUA 4OX9I 3QT8A 4P7AA 2E5LE 4NXNI 1N36E 1ZXMA 1U2RA 1IBLE 1MG7A 2VQFI 4JI4I 4RPFA 3V5RA 1FNMA 2PNLA 4P52A 2EFGA 4DV0E 1HR0I 2X36A 3K85A 4FWDA 2UXCE 4WUDA 2O1UA 4IZJD 4JI2E 1IBLI 2VQFE 4LF6E 4IZKB 4LF5E 1HR0E 5FLXQ 1I94I 4DV5E 2HKJA 2UUBI 4HXZA 1NHHA 4JI0I 4B3RE 3HJCA 1NZ0A 4JI8E 2HKEA 1S4EA 4DPUA 1QZRA 1PVGA 3OTOE 2UU9E 4JI6E 4LFCI 4LF5I 3K1JA 3J81Q 1XMQI 4DV5I 4XTJA 2UUBE 4B3RI 1IBME 4FW9A 3PYEA 2HK2A 2CG9A 4DU7A 2UUAE 3F0NA 4JI6I 4JI5E 2O1VA 1N32I 2ZM6I 2V8PA 3WU6A 2VQEE 3ZM7A 1IBMI 4X64E 3Q6NA 2WW4A 2E1RA 1H7UA 2UUAI 4JI3I 1DARA 2VF3A 5LMUI 4JV5I 3Q6MA 4HY1A 4X64I 4DPXA 4DR4I 5FLXC 3B8HA 4DV3E 1PKPA 4AQYE 2HK3A 2HFUA 2A2DA 4WUCA 4LF4I 1J5EE 3JAMC 4DV3I 4B3MI 3P06A 3T1YE 1OJ4A 1J5EI 4DR7E 4Z7CA 1FJGE 4DPTA 4GKJI 4B3ME 5LMNE 3PYDA 1HNZI 2UUCI 1Z5BA 1A6FA 5L3JA 4IZKA 3K17A 2HHHE 4LF8I 5A2QC 2IOPA 4DR3I 3WU4A 5LMNI 1XMOE 1N36I 4NXNE 1WUUA 4IZJA 4WUBA 1H74A 4JI4E 4KQVA 1Z0TA 3JAMQ 4DU8A 4B3TE 4MYTA 3PYGA 3QT6A 4FWGA 1Z0CA 3PRYA 1VISA 2V34A 4YHHI 4JI2I 4FN5A 1MU5A 4LF6I 4DV7I 3PYFA 1H7SA 1MX0A 2ZITA 4B3TI 2CGEA 1I94E 2Z5CA 3QT5A 4PRVA 4YHHE 4DR2I 1Z0WA 1HNWE 4LF7E 3CWVA 4DV7E 3GONA 4JI7E 4PRXA 4B3SI 1XMQE 4DV2I 1USVA 1Y4UA 4DR2E 4IZJB 3J7AM 1HNWI 1K47A 4NXMI 4GKKE 3QT7A 3V2UC 3Q1QA 4USKA 4B3SE 1S16A 1N32E 2VQEI 5FWKA 1RR9A 4I3HA 4JI1E 4DR1E 1KVKA 4JI3E 2UXDE 5LMUE 4JV5E 4DUYE 3B78A 5BR8E 1Z59A 1B62A 1KKHA 2IOQA 4DR4E 1HNXI 4USMA 2GS8A 1N33I 3H4LA 2LJPA 4JI1I 1USUA 4AQYI 2Z5BA 2BV3A 4DR6E 2J7KA 2F4VE 4DPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RRE A;  4DPY A;  4LF4 E;  4YY3 E;  5IT9 C;  2UXB I;  2V2V A;  4DXL A;  3J7A G;  3WU3 A;  4JYA E;  1Z5A A;  2V2Z A;  1BKN A;  2XEX A;  1D6T A;  1XHK A;  1XNR E;  1ZM9 A;  2ZBK B;  5IWA I;  1FJG I;  4DV6 I;  1Z0E A;  4GKJ E;  5GME A;  2E5L I;  1HNZ E;  4JYA I;  4MYU A;  4DUZ E;  4KHP E;  4X62 I;  3J81 C;  2CZ9 A;  4PU9 A;  1XNR I;  4DR3 E;  1FI4 A;  4DV0 I;  4DV6 E;  3LPS A;  3LNU A;  1XMO I;  2UXC I;  3ZZ0 A;  4DUZ I;  4KHP I;  1PIE A;  4X62 E;  1H73 A;  5A2Q Q;  3J80 Q;  5GMD A;  3LTO A;  1EA6 A;  4FWH A;  1N34 I;  4JI0 E;  1IBK E;  3HUL A;  4JI8 I;  1Z5C A;  4LF9 E;  3M6A A;  1B63 A;  4ED4 A;  3ZKD A;  4UTG A;  3OTO I;  2UU9 I;  4LFC E;  2OI2 A;  3D4J A;  1N34 E;  4LFB I;  3ZZT A;  4EMD A;  1IBK I;  5IT9 Q;  2R42 A;  1UEK A;  4HAC B;  1H72 C;  3B82 A;  4JG4 A;  4LF9 I;  2Q2E B;  1KTV A;  4LF7 I;  4URL A;  4HYM A;  4UT4 A;  4JI7 I;  4JI5 I;  3ZKB A;  4DV4 E;  4LFA E;  2BM1 A;  2AJ4 A;  2ZM6 E;  4LFB E;  4DV2 E;  3J80 C;  2V2Q A;  4X65 E;  2DEI A;  4NXM E;  1Z0V A;  4GKK I;  1XNQ I;  4K0K I;  1FKA E;  4DV1 E;  2NPF A;  4M1K A;  4DV4 I;  4LFA I;  1NHI A;  1N0U A;  1FWK A;  3T1H E;  2DEJ A;  4X65 I;  1KIJ A;  2X7I A;  4DR1 I;  1XNQ E;  4K0K E;  2BM0 A;  2A2C A;  1ZM3 A;  4DV1 I;  1Z0G A;  1EI1 A;  2UXD I;  1ZM4 A;  4DUY I;  5BR8 I;  1Z0B A;  4Z7Y A;  3T1H I;  1HNX E;  4HAC A;  1N33 E;  2HFS A;  4X66 I;  4DR6 I;  2F4V I;  1FWL A;  1N0V C;  5LL6 R;  3T1Y I;  4YY3 I;  4ZVI A;  4DR5 E;  4DR7 I;  4R1F A;  2UXB E;  4OX9 E;  4X66 E;  1NHJ A;  1ELO A;  2UUC E;  1ZXN A;  3WU5 A;  1ZM2 A;  2HHH I;  4LF8 E;  4DR5 I;  5IWA E;  2R3V A;  3ZZU A;  4OX9 I;  3QT8 A;  4P7A A;  2E5L E;  4NXN I;  1N36 E;  1ZXM A;  1U2R A;  1IBL E;  1MG7 A;  2VQF I;  4JI4 I;  4RPF A;  3V5R A;  1FNM A;  4P52 A;  2EFG A;  4DV0 E;  1HR0 I;  2X36 A;  4FWD A;  2UXC E;  4WUD A;  4JI2 E;  1IBL I;  2VQF E;  4LF6 E;  4LF5 E;  1HR0 E;  5FLX Q;  1I94 I;  4DV5 E;  2HKJ A;  2UUB I;  4HXZ A;  1NHH A;  4JI0 I;  4B3R E;  1NZ0 A;  4JI8 E;  2HKE A;  1S4E A;  4DPU A;  1QZR A;  1PVG A;  3OTO E;  2UU9 E;  4JI6 E;  4LFC I;  4LF5 I;  3K1J A;  3J81 Q;  1XMQ I;  4DV5 I;  4XTJ A;  2UUB E;  4B3R I;  1IBM E;  4FW9 A;  3PYE A;  2HK2 A;  4DU7 A;  2UUA E;  3F0N A;  4JI6 I;  4JI5 E;  1N32 I;  2ZM6 I;  2V8P A;  3WU6 A;  2VQE E;  3ZM7 A;  1IBM I;  4X64 E;  2WW4 A;  2E1R A;  1H7U A;  2UUA I;  4JI3 I;  1DAR A;  2VF3 A;  5LMU I;  4JV5 I;  4HY1 A;  4X64 I;  4DPX A;  4DR4 I;  5FLX C;  3B8H A;  4DV3 E;  1PKP A;  4AQY E;  2HK3 A;  2HFU A;  2A2D A;  4WUC A;  4LF4 I;  1J5E E;  3JAM C;  4DV3 I;  4B3M I;  3T1Y E;  1OJ4 A;  1J5E I;  4DR7 E;  4Z7C A;  1FJG E;  4DPT A;  4GKJ I;  4B3M E;  5LMN E;  3PYD A;  1HNZ I;  2UUC I;  1Z5B A;  1A6F A;  5L3J A;  3K17 A;  2HHH E;  4LF8 I;  5A2Q C;  4DR3 I;  3WU4 A;  5LMN I;  1XMO E;  1N36 I;  4NXN E;  1WUU A;  4WUB A;  1H74 A;  4JI4 E;  4KQV A;  1Z0T A;  3JAM Q;  4DU8 A;  4B3T E;  4MYT A;  3PYG A;  3QT6 A;  4FWG A;  1Z0C A;  1VIS A;  2V34 A;  4YHH I;  4JI2 I;  4FN5 A;  1MU5 A;  4LF6 I;  4DV7 I;  3PYF A;  1H7S A;  1MX0 A;  2ZIT A;  4B3T I;  1I94 E;  3QT5 A;  4PRV A;  4YHH E;  4DR2 I;  1Z0W A;  1HNW E;  4LF7 E;  3CWV A;  4DV7 E;  3GON A;  4JI7 E;  4PRX A;  4B3S I;  1XMQ E;  4DV2 I;  4DR2 E;  3J7A M;  1HNW I;  1K47 A;  4NXM I;  4GKK E;  3QT7 A;  3V2U C;  3Q1Q A;  4USK A;  4B3S E;  1S16 A;  1N32 E;  2VQE I;  1RR9 A;  4I3H A;  4JI1 E;  4DR1 E;  1KVK A;  4JI3 E;  2UXD E;  5LMU E;  4JV5 E;  4DUY E;  3B78 A;  5BR8 E;  1Z59 A;  1B62 A;  1KKH A;  4DR4 E;  1HNX I;  4USM A;  2GS8 A;  1N33 I;  3H4L A;  2LJP A;  4JI1 I;  4AQY I;  2BV3 A;  4DR6 E;  2J7K A;  2F4V E;  4DPW A; 
#chains in the Genus database with same CATH topology
 1RRE A;  4DPY A;  2JE6 A;  4LF4 E;  4YY3 E;  1UDQ A;  4MU3 A;  5IT9 C;  2UXB I;  4MQY A;  2V2V A;  4DXL A;  4IFD C;  3J7A G;  3WU3 A;  4JYA E;  4AIM A;  1Z5A A;  2V2Z A;  1BKN A;  2PO0 A;  2XEX A;  1D6T A;  2BA0 G;  1XHK A;  4MDT A;  1XNR E;  2PNM A;  1ZM9 A;  4BA1 B;  2ZBK B;  5IWA I;  1FJG I;  4DV6 I;  1Z0E A;  4GKJ E;  5GME A;  2E5L I;  4OZE A;  1HNZ E;  2O3Z A;  4JYA I;  4MYU A;  4DUZ E;  4KHP E;  2WP8 B;  2GQ0 A;  4X62 I;  3P3G A;  2Z5B B;  3PS3 A;  3J81 C;  2CZ9 A;  2NN6 A;  4PU9 A;  1XNR I;  4DR3 E;  1FI4 A;  4DV0 I;  4DV6 E;  4OO1 C;  3CDJ A;  3LPS A;  2JEB A;  2O1T A;  3LNU A;  1XMO I;  2UXC I;  3ZZ0 A;  3B4T A;  4DUZ I;  4KHP I;  1PIE A;  1Y60 A;  4X62 E;  1H73 A;  5A2Q Q;  3J80 Q;  5C0X C;  2NN6 D;  5GMD A;  2PO0 B;  4BA2 B;  3LTO A;  1EA6 A;  4FWH A;  1N34 I;  3KRN A;  4JI0 E;  1IBK E;  3HUL A;  2NN6 E;  4JI8 I;  1Z5C A;  4LF9 E;  3M6A A;  1B63 A;  4ED4 A;  4NBQ A;  3ZKD A;  5K36 B;  4J3D A;  4UTG A;  3OTO I;  2UU9 I;  4LFC E;  4IFD E;  2OI2 A;  3D4J A;  1N34 E;  4LFB I;  3ZZT A;  4EMD A;  1IBK I;  5IT9 Q;  2R42 A;  1UEK A;  4HAC B;  4IFD D;  1H72 C;  3B82 A;  4JG4 A;  4LF9 I;  2Q2E B;  1KTV A;  3CDI A;  4LF7 I;  4URL A;  4HYM A;  2Z5C B;  4UT4 A;  4JI7 I;  2JT2 A;  3ZKB A;  4DV4 E;  4JI5 I;  4LFA E;  1Y4S A;  2BM1 A;  2AJ4 A;  2ZM6 E;  4LFB E;  4DV2 E;  3J80 C;  2V2Q A;  4X65 E;  2DEI A;  1Z0V A;  4NXM E;  4GKK I;  1XNQ I;  4K0K I;  1FKA E;  2JE6 B;  4DV1 E;  1Y5Y A;  2NPF A;  4M1K A;  4DV4 I;  4LFA I;  5C0X A;  1RHY A;  1NHI A;  1N0U A;  2BA0 D;  1FWK A;  3T1H E;  2DEJ A;  4X65 I;  1KIJ A;  2X7I A;  4DR1 I;  1XNQ E;  4K0K E;  2BM0 A;  2A2C A;  4LCF A;  1ZM3 A;  2GO4 A;  4DV1 I;  4OO1 B;  1Z0G A;  1EI1 A;  2UXD I;  1ZM4 A;  4N3O A;  4DUY I;  5BR8 I;  2NN6 C;  2C39 A;  1Z0B A;  4Z7Y A;  4MU1 A;  3T1H I;  1HNX E;  4HAC A;  1N33 E;  2HFS A;  1UDN A;  4OO1 E;  4X66 I;  4DR6 I;  2F4V I;  4AM3 A;  1FWL A;  4OO1 D;  1N0V C;  2JEB B;  5LL6 R;  4U3D A;  3T1Y I;  5K36 F;  4YY3 I;  1XXE A;  2CVE A;  4ZVI A;  4DR5 E;  5C0X E;  3L7Z A;  4DR7 I;  2O1W A;  4R1F A;  2UXB E;  4OX9 E;  1HK7 A;  4X66 E;  1NHJ A;  1ELO A;  2UUC E;  1ZXN A;  3WU5 A;  5DRQ A;  1ZM2 A;  2HHH I;  1Y6Z A;  4LF8 E;  4DR5 I;  2Z5E A;  5IWA E;  2R3V A;  2C38 A;  3ZZU A;  2PO1 A;  4OX9 I;  3QT8 A;  4P7A A;  2E5L E;  4AID A;  4NXN I;  1N36 E;  2PO2 A;  1ZXM A;  5JEA C;  1U2R A;  1UDS A;  1IBL E;  1MG7 A;  2VQF I;  3P3C A;  4JI4 I;  4RPF A;  3V5R A;  1FNM A;  2PNL A;  4LOM A;  4P52 A;  2EFG A;  5DRP A;  4DV0 E;  3DD6 A;  1HR0 I;  2C37 B;  2X36 A;  3M85 D;  3K85 A;  4FWD A;  2UXC E;  4QNJ A;  4WUD A;  2O1U A;  4IZJ D;  4JI2 E;  3M7N D;  1IBL I;  2VQF E;  4LF6 E;  2WP8 A;  4IZK B;  4LF5 E;  1HR0 E;  5FLX Q;  1R6L A;  1I94 I;  4DV5 E;  2HKJ A;  2UUB I;  3U1K A;  4HXZ A;  1NHH A;  4JI0 I;  4B3R E;  3HJC A;  1NZ0 A;  4JI8 E;  2C38 B;  2HKE A;  1S4E A;  2BA1 G;  4DPU A;  5K36 E;  3PS2 A;  1QZR A;  1PVG A;  3OTO E;  2UU9 E;  4JI6 E;  4LFC I;  4LF5 I;  3K1J A;  3J81 Q;  2IES A;  4DV5 I;  1XMQ I;  4XTJ A;  2UUB E;  4B3R I;  1UDO A;  1IBM E;  4GQU A;  2PO2 B;  5K36 A;  4FW9 A;  3PYE A;  2HK2 A;  2CG9 A;  4DU7 A;  2J65 A;  2UUA E;  3F0N A;  4JI6 I;  2NN6 B;  4JI5 E;  2O1V A;  1N32 I;  2ZM6 I;  3P76 A;  2V8P A;  3WU6 A;  2VQE E;  3ZM7 A;  1IBM I;  4X64 E;  3Q6N A;  5C0X D;  5DRR A;  2PNZ B;  2WW4 A;  4FW6 A;  2E1R A;  1H7U A;  2UUA I;  3L7Z B;  4JI3 I;  1DAR A;  2VF3 A;  3P3E A;  3UHM A;  5LMU I;  4JV5 I;  3Q6M A;  2PNZ A;  4HY1 A;  1OYP A;  4X64 I;  4DPX A;  4DR4 I;  5FLX C;  3B8H A;  4DV3 E;  1PKP A;  4AQY E;  5C0X B;  2HK3 A;  2HFU A;  4OKG A;  2A2D A;  3PS1 A;  4WUC A;  4LF4 I;  2PO1 B;  2WNR B;  1J5E E;  5K36 C;  3JAM C;  1E3H A;  2F1D A;  4LCG A;  4DV3 I;  4B3M I;  5DRO A;  5JEA D;  4FW4 A;  4FW3 A;  3P06 A;  2BR2 B;  3T1Y E;  1OJ4 A;  4MU4 A;  1J5E I;  4DR7 E;  4Z7C A;  1FJG E;  4DPT A;  3M85 G;  4GKJ I;  4B3M E;  5LMN E;  3PYD A;  2BR2 A;  3GME A;  1HNZ I;  2UUC I;  1Z5B A;  1A6F A;  5L3J A;  4IZK A;  3K17 A;  2HHH E;  4LF8 I;  5A2Q C;  4BA2 A;  2AE8 A;  5ELW A;  2IOP A;  4DR3 I;  3WU4 A;  5LMN I;  1XMO E;  2WNR A;  1N36 I;  4NXN E;  1WUU A;  4IZJ A;  4QNK A;  4WUB A;  4OO1 F;  4IFD B;  1R6M A;  4IS9 A;  1H74 A;  4JI4 E;  4KQV A;  1P42 A;  1Z0T A;  3JAM Q;  4DU8 A;  4B3T E;  5JEA A;  4MYT A;  3PYG A;  3QT6 A;  4FWG A;  1YHC A;  4BA1 A;  1Z0C A;  3PRY A;  1VIS A;  2V34 A;  2BA1 D;  4YHH I;  4JI2 I;  4FN5 A;  1MU5 A;  5JEA E;  4LF6 I;  4OO1 A;  4DV7 I;  3PYF A;  1H7S A;  1MX0 A;  2ZIT A;  4B3T I;  2CGE A;  1I94 E;  2IER A;  2Z5C A;  1VI7 A;  3H1C A;  4IFD F;  5JEA F;  3QT5 A;  4PRV A;  4YHH E;  4DR2 I;  2C37 A;  5EKW A;  1Z0W A;  2JEA A;  3M7N G;  4U3B A;  1HNW E;  4LF7 E;  3CWV A;  3GCM A;  4DV7 E;  3GON A;  4JI7 E;  4PRX A;  4B3S I;  1XMQ E;  4DV2 I;  4FW5 A;  1USV A;  1Y4U A;  4DR2 E;  4IZJ B;  3J7A M;  2GO3 A;  1HNW I;  1K47 A;  4NXM I;  4IFD A;  4MU0 A;  1E3P A;  4GKK E;  3QT7 A;  3V2U C;  3Q1Q A;  5EL9 A;  4USK A;  5DNL A;  4B3S E;  1OYS A;  1S16 A;  5JEA B;  5C0X F;  1N32 E;  3U1Y A;  2VQE I;  5FWK A;  1RR9 A;  3HKM A;  4I3H A;  5K36 D;  2VES A;  3NZK A;  4JI1 E;  4DR1 E;  2C39 B;  1KVK A;  4FW7 A;  4LPF A;  2JEA B;  4ISA A;  4JI3 E;  2UXD E;  5DNX A;  5LMU E;  4JV5 E;  4DUY E;  3B78 A;  5BR8 E;  3GLL A;  1Z59 A;  1B62 A;  1YH8 A;  1KKH A;  2IOQ A;  4DR4 E;  1HNX I;  4USM A;  2GS8 A;  1N33 I;  3H4L A;  2LJP A;  4JI1 I;  1USU A;  4AQY I;  2Z5B A;  2BV3 A;  4DR6 E;  2J7K A;  4LCH A;  2F4V E;  2NN6 F;  4DPW A;  1OYR A; 
#chains in the Genus database with same CATH homology
 1RRE A;  4DPY A;  4LF4 E;  4YY3 E;  5IT9 C;  2UXB I;  2V2V A;  4DXL A;  3J7A G;  3WU3 A;  4JYA E;  1Z5A A;  2V2Z A;  1BKN A;  2XEX A;  1D6T A;  1XHK A;  1XNR E;  2PNM A;  1ZM9 A;  2ZBK B;  5IWA I;  1FJG I;  4DV6 I;  1Z0E A;  4GKJ E;  5GME A;  2E5L I;  1HNZ E;  4JYA I;  4MYU A;  4DUZ E;  4KHP E;  2GQ0 A;  4X62 I;  2Z5B B;  3J81 C;  2CZ9 A;  4PU9 A;  1XNR I;  4DR3 E;  1FI4 A;  4DV0 I;  4DV6 E;  3LPS A;  2O1T A;  3LNU A;  1XMO I;  2UXC I;  3ZZ0 A;  4DUZ I;  4KHP I;  1PIE A;  4X62 E;  1H73 A;  5A2Q Q;  3J80 Q;  5GMD A;  3LTO A;  1EA6 A;  4FWH A;  1N34 I;  4JI0 E;  1IBK E;  3HUL A;  4JI8 I;  1Z5C A;  4LF9 E;  3M6A A;  1B63 A;  4ED4 A;  3ZKD A;  4UTG A;  3OTO I;  2UU9 I;  4LFC E;  2OI2 A;  3D4J A;  1N34 E;  4LFB I;  3ZZT A;  4EMD A;  1IBK I;  5IT9 Q;  2R42 A;  1UEK A;  4HAC B;  1H72 C;  3B82 A;  4JG4 A;  4LF9 I;  2Q2E B;  1KTV A;  4LF7 I;  4URL A;  4HYM A;  2Z5C B;  4UT4 A;  4JI7 I;  4JI5 I;  3ZKB A;  4DV4 E;  4LFA E;  1Y4S A;  2BM1 A;  2AJ4 A;  2ZM6 E;  4LFB E;  4DV2 E;  3J80 C;  2V2Q A;  4X65 E;  2DEI A;  1Z0V A;  4NXM E;  4GKK I;  1XNQ I;  4K0K I;  1FKA E;  4DV1 E;  2NPF A;  4M1K A;  4DV4 I;  4LFA I;  1NHI A;  1N0U A;  1FWK A;  3T1H E;  2DEJ A;  4X65 I;  1KIJ A;  2X7I A;  4DR1 I;  1XNQ E;  4K0K E;  2BM0 A;  2A2C A;  1ZM3 A;  4DV1 I;  1Z0G A;  1EI1 A;  2UXD I;  1ZM4 A;  4N3O A;  4DUY I;  5BR8 I;  1Z0B A;  4Z7Y A;  3T1H I;  1HNX E;  4HAC A;  1N33 E;  2HFS A;  4X66 I;  4DR6 I;  2F4V I;  1FWL A;  1N0V C;  5LL6 R;  3T1Y I;  4YY3 I;  4ZVI A;  4DR5 E;  4DR7 I;  2O1W A;  4R1F A;  2UXB E;  4OX9 E;  1HK7 A;  4X66 E;  1NHJ A;  1ELO A;  2UUC E;  1ZXN A;  3WU5 A;  1ZM2 A;  2HHH I;  1Y6Z A;  4LF8 E;  4DR5 I;  2Z5E A;  5IWA E;  2R3V A;  3ZZU A;  4OX9 I;  3QT8 A;  4P7A A;  2E5L E;  4NXN I;  1N36 E;  1ZXM A;  1U2R A;  1IBL E;  1MG7 A;  2VQF I;  4JI4 I;  4RPF A;  3V5R A;  1FNM A;  2PNL A;  4P52 A;  2EFG A;  4DV0 E;  1HR0 I;  2X36 A;  3K85 A;  4FWD A;  2UXC E;  4WUD A;  2O1U A;  4IZJ D;  4JI2 E;  1IBL I;  2VQF E;  4LF6 E;  4IZK B;  4LF5 E;  1HR0 E;  5FLX Q;  1I94 I;  4DV5 E;  2HKJ A;  2UUB I;  4HXZ A;  1NHH A;  4JI0 I;  4B3R E;  3HJC A;  1NZ0 A;  4JI8 E;  2HKE A;  1S4E A;  4DPU A;  1QZR A;  1PVG A;  3OTO E;  2UU9 E;  4JI6 E;  4LFC I;  4LF5 I;  3K1J A;  3J81 Q;  1XMQ I;  4DV5 I;  4XTJ A;  2UUB E;  4B3R I;  1IBM E;  4FW9 A;  3PYE A;  2HK2 A;  2CG9 A;  4DU7 A;  2UUA E;  3F0N A;  4JI6 I;  4JI5 E;  2O1V A;  1N32 I;  2ZM6 I;  2V8P A;  3WU6 A;  2VQE E;  3ZM7 A;  1IBM I;  4X64 E;  3Q6N A;  2WW4 A;  2E1R A;  1H7U A;  2UUA I;  4JI3 I;  1DAR A;  2VF3 A;  5LMU I;  4JV5 I;  3Q6M A;  4HY1 A;  4X64 I;  4DPX A;  4DR4 I;  5FLX C;  3B8H A;  4DV3 E;  1PKP A;  4AQY E;  2HK3 A;  2HFU A;  2A2D A;  4WUC A;  4LF4 I;  1J5E E;  3JAM C;  4DV3 I;  4B3M I;  3P06 A;  3T1Y E;  1OJ4 A;  1J5E I;  4DR7 E;  4Z7C A;  1FJG E;  4DPT A;  4GKJ I;  4B3M E;  5LMN E;  3PYD A;  1HNZ I;  2UUC I;  1Z5B A;  1A6F A;  5L3J A;  4IZK A;  3K17 A;  2HHH E;  4LF8 I;  5A2Q C;  2IOP A;  4DR3 I;  3WU4 A;  5LMN I;  1XMO E;  1N36 I;  4NXN E;  1WUU A;  4IZJ A;  4WUB A;  1H74 A;  4JI4 E;  4KQV A;  1Z0T A;  3JAM Q;  4DU8 A;  4B3T E;  4MYT A;  3PYG A;  3QT6 A;  4FWG A;  1Z0C A;  3PRY A;  1VIS A;  2V34 A;  4YHH I;  4JI2 I;  4FN5 A;  1MU5 A;  4LF6 I;  4DV7 I;  3PYF A;  1H7S A;  1MX0 A;  2ZIT A;  4B3T I;  2CGE A;  1I94 E;  2Z5C A;  3QT5 A;  4PRV A;  4YHH E;  4DR2 I;  1Z0W A;  1HNW E;  4LF7 E;  3CWV A;  4DV7 E;  3GON A;  4JI7 E;  4PRX A;  4B3S I;  1XMQ E;  4DV2 I;  1USV A;  1Y4U A;  4DR2 E;  4IZJ B;  3J7A M;  1HNW I;  1K47 A;  4NXM I;  4GKK E;  3QT7 A;  3V2U C;  3Q1Q A;  4USK A;  4B3S E;  1S16 A;  1N32 E;  2VQE I;  5FWK A;  1RR9 A;  4I3H A;  4JI1 E;  4DR1 E;  1KVK A;  4JI3 E;  2UXD E;  5LMU E;  4JV5 E;  4DUY E;  3B78 A;  5BR8 E;  1Z59 A;  1B62 A;  1KKH A;  2IOQ A;  4DR4 E;  1HNX I;  4USM A;  2GS8 A;  1N33 I;  3H4L A;  2LJP A;  4JI1 I;  1USU A;  4AQY I;  2Z5B A;  2BV3 A;  4DR6 E;  2J7K A;  2F4V E;  4DPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...