4JI1I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 23
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji1I00
1IBKE 1HNXE 1A6FA 1Z0VA 2R3VA 4UT4A 4XTJA 1XNQI 1I94I 4DUYI 4LFCI 1N33E 4B3SI 4ED4A 3J80Q 4JI1E 3PYFA 3WU3A 3JAMC 2E5LI 4FN5A 4DV3I 5IT9C 4PRXA 1N0UA 2UXBE 4K0KI 3F0NA 1N0VC 2UUAI 2BM0A 1S4EA 4YHHE 4HYMA 4OX9E 5IWAE 1HNWI 3QT5A 4LFBE 1HR0E 4DPTA 3B78A 4ZVIA 4JI6E 5LL6R 4DU8A 4DV5E 3J7AG 1IBLI 4P52A 2HK2A 1Z0BA 2UXCI 1KVKA 4DR2E 4YY3I 3B8HA 4X64I 1EA6A 3J81C 2V8PA 3LNUA 1FWKA 4LF4I 3PYEA 4UTGA 4DPWA 4LF6E 4DR5I 4B3RE 4LF4E 4DV0E 4LFAE 4B3TE 4DV6E 5LMNI 4LF9I 4GKKI 2ZM6I 2ZITA 1I94E 4DUYE 1FJGI 1S16A 4AQYI 1N36E 4NXMI 4FWHA 3ZM7A 4LFCE 4PU9A 1XMQI 2VF3A 4DR1I 1XMOE 1IBLE 4B3SE 2LJPA 3D4JA 5IWAI 1D6TA 4DXLA 3GONA 3LPSA 3J80C 2DEJA 1Z5CA 4JI3I 4DR3I 1HNZI 1FNMA 4OX9I 4NXNI 3OTOE 4YY3E 4JI5E 4DR6E 1NHJA 2VQEE 4HXZA 2UXDI 2X36A 3QT8A 1Z0EA 1PVGA 3PYGA 4GKJE 4KHPI 2V34A 5LMNE 1IBME 1FI4A 4LF6I 4B3RI 5FLXQ 1XHKA 4JI4I 1PKPA 4DR7E 3ZZTA 1FKAE 1PIEA 4Z7CA 1NHHA 1ZXMA 3M6AA 2HK3A 3ZZ0A 4WUDA 4HACB 2VQFI 3B82A 4JYAE 1XMQE 1B63A 2J7KA 4EMDA 4LF8E 4USMA 1H73A 1FWLA 5L3JA 1BKNA 1ZM4A 3QT7A 3ZKBA 4YHHI 4DV7E 4X66I 1EI1A 4DR3E 1HNZE 1H7SA 4DV3E 2HKJA 2DEIA 2UUBE 4JG4A 2UUAE 2HHHE 3ZKDA 4LF7E 4DUZE 2OI2A 4X65E 2UU9E 3T1YI 1NZ0A 1Z5AA 1ZM3A 4DV5I 4JI0I 1Z0WA 4B3ME 1IBMI 3LTOA 2ZBKB 1N34E 5A2QQ 5LMUI 4DV2E 4DR5E 4DR4E 3WU4A 1Z0GA 4JI7I 5BR8E 2A2CA 2GS8A 4FWDA 2EFGA 1IBKI 1HNXI 4DPUA 2UXDE 2E5LE 3ZZUA 1XNRE 2A2DA 4DPXA 2XEXA 4WUBA 1H72C 4LF5E 4JYAI 5FLXC 1Z0TA 4USKA 3T1HI 4KQVA 4JI2I 4K0KE 4LF5I 4X62I 2HFUA 1N36I 1MU5A 4DV4I 2F4VI 1MX0A 3PYDA 4JI1I 1KKHA 1HR0I 1WUUA 3WU6A 4X62E 1QZRA 3JAMQ 5IT9Q 4JI6I 4DUZI 2NPFA 1ZM2A 4PRVA 4DV1E 3K1JA 3QT6A 4MYTA 4DR2I 1RR9A 1K47A 4DV7I 1ELOA 2CZ9A 1N34I 4DV1I 4B3TI 3J7AM 3OTOI 3CWVA 4JV5E 2UUBI 4DV6I 1H7UA 2R42A 4X64E 2UUCE 4JV5I 4DPYA 2BM1A 3J81Q 2HFSA 4R1FA 4JI5I 4JI4E 4MYUA 1N33I 4JI7E 4DU7A 4HY1A 3V5RA 1FJGE 2AJ4A 1N32I 3V2UC 2WW4A 4NXME 4JI2E 4GKKE 1Z59A 1XNQE 2V2VA 1N32E 2F4VE 1H74A 4WUCA 4HACA 4LF8I 1OJ4A 3H4LA 5GMDA 3K17A 3T1HE 2VQFE 3HULA 1XMOI 1XNRI 1UEKA 2V2QA 4DR1E 4LFBI 4LF7I 2UXBI 1Z5BA 2X7IA 1MG7A 1DARA 4X65I 4X66E 1ZM9A 3WU5A 2BV3A 4JI3E 1KIJA 1ZXNA 4P7AA 1KTVA 4URLA 1HNWE 4B3MI 1J5EI 2V2ZA 5A2QC 3Q1QA 1U2RA 4FWGA 4NXNE 4DV4E 1VISA 2Q2EB 2E1RA 4FW9A 1J5EE 3T1YE 4DR6I 2UU9I 2HHHI 4JI8E 2UXCE 4JI0E 4LF9E 4RPFA 1RREA 4M1KA 4GKJI 4KHPE 5GMEA 1NHIA 5LMUE 4Z7YA 4JI8I 2HKEA 4AQYE 4DV2I 2UUCI 4DR7I 4I3HA 5BR8I 4DR4I 2VQEI 1Z0CA 2ZM6E 4DV0I 4LFAI 1B62A
chains in the Genus database with same CATH superfamily
5FWKA 1IBKE 1HNXE 1A6FA 1Z0VA 2R3VA 4LOMA 4UT4A 4XTJA 1XNQI 3K85A 2C38A 4MU4A 1I94I 4DUYI 4LFCI 3NZKA 4B3SI 1N33E 4MU1A 4ED4A 3J80Q 3PYFA 3WU3A 4JI1E 4MU3A 3JAMC 2E5LI 5K36A 5DRPA 4FN5A 4DV3I 5IT9C 4OZEA 1N0UA 4PRXA 2UXBE 4K0KI 3F0NA 1N0VC 2UUAI 2BM0A 2PO0B 3P3CA 1S4EA 4U3BA 4HYMA 4YHHE 4OX9E 5IWAE 1HNWI 3QT5A 4IFDF 4LFBE 1HR0E 2JEAA 4DPTA 3B78A 4NBQA 4ZVIA 2Z5EA 4JI6E 5LL6R 4DU8A 4DV5E 2GO4A 1IBLI 3J7AG 4P52A 2WNRB 2HK2A 1Z0BA 4FW6A 4BA2B 2UXCI 1KVKA 4DR2E 4YY3I 3B8HA 5DNXA 4X64I 1EA6A 1OYSA 3J81C 2V8PA 3LNUA 1FWKA 1Y4SA 4LF4I 4OO1A 3PYEA 4OKGA 4UTGA 4DPWA 2JEAB 2WP8B 2PNZB 2PNZA 4LF6E 4DR5I 4B3RE 4LF4E 1OYRA 1Y5YA 4DV0E 4LFAE 4B3TE 4DV6E 3Q6MA 5C0XF 2IOPA 5LMNI 4LF9I 4GKKI 4LPFA 4IFDB 3GMEA 2ZM6I 2BA1G 2ZITA 1I94E 4BA2A 4DUYE 3HKMA 2NN6F 4U3DA 5JEAA 1FJGI 1S16A 2C39B 4AQYI 1N36E 4NXMI 3L7ZA 4FWHA 1VI7A 2O1UA 3ZM7A 4LFCE 4PU9A 3PRYA 1YH8A 1XMQI 2VF3A 2PNLA 2Z5BB 3CDIA 4DR1I 1XMOE 1IBLE 4B3SE 2LJPA 3M85G 3D4JA 5IWAI 1D6TA 2VESA 4DXLA 3GONA 3LPSA 3J80C 2DEJA 1Z5CA 2NN6E 2O3ZA 2BA0D 1HK7A 4JI3I 4DR3I 1HNZI 4QNJA 1FNMA 4IZJB 4OX9I 3U1YA 4NXNI 5C0XE 3OTOE 4AIDA 4YY3E 3P06A 4JI5E 4QNKA 3PS3A 4DR6E 1NHJA 2VQEE 4IZKB 4HXZA 2UXDI 5EL9A 2X36A 3QT8A 1Z0EA 1PVGA 3PYGA 4GKJE 4KHPI 2V34A 5LMNE 1IBME 1FI4A 2AE8A 4LF6I 4B3RI 5FLXQ 1XHKA 4JI4I 1PKPA 4DR7E 3ZZTA 3GCMA 1FKAE 1PIEA 2Z5CA 4Z7CA 1NHHA 1ZXMA 3M6AA 4IFDD 2HK3A 3UHMA 3ZZ0A 1XXEA 4WUDA 2JEBA 1Y4UA 4HACB 5JEAD 2VQFI 3B82A 4JYAE 1XMQE 1B63A 2J7KA 4EMDA 4LF8E 4USMA 1H73A 1FWLA 2NN6C 5L3JA 1BKNA 1ZM4A 3QT7A 4IFDA 3ZKBA 2BR2A 1Y60A 5C0XC 5C0XB 4YHHI 4DV7E 4X66I 2JE6B 1EI1A 4DR3E 2JE6A 1HNZE 1H7SA 4DV3E 2CVEA 2C37B 2HKJA 2NN6D 2DEIA 2UUBE 4JG4A 2UUAE 4BA1A 2C39A 2HHHE 2PNMA 3ZKDA 2IESA 4LF7E 4FW3A 1UDSA 4DUZE 2OI2A 3U1KA 4X65E 2UU9E 3T1YI 1NZ0A 1Z5AA 1ZM3A 4DV5I 4FW4A 4JI0I 1Z0WA 4B3ME 1IBMI 3LTOA 2ZBKB 1N34E 5A2QQ 1P42A 5LMUI 2CGEA 4GQUA 2GO3A 5C0XA 2WP8A 4DV2E 4DR5E 5EKWA 4LCFA 4DR4E 3WU4A 1Z0GA 4JI7I 5BR8E 2A2CA 3M85D 2F1DA 3GLLA 2O1VA 2GS8A 4FWDA 2EFGA 3PS1A 1IBKI 1HNXI 4DPUA 2UXDE 2E5LE 3ZZUA 4IFDC 4FW7A 1XNRE 4OO1F 1R6MA 2A2DA 2O1WA 4DPXA 2XEXA 3H1CA 4WUBA 1UDQA 1H72C 4LF5E 2Z5CB 4MU0A 4JYAI 5FLXC 1YHCA 1Z0TA 4USKA 3T1HI 4KQVA 4JI2I 4K0KE 4LF5I 4X62I 2HFUA 4IFDE 1N36I 1MU5A 5DRRA 3PS2A 5DROA 4DV4I 2BA1D 2F4VI 1MX0A 3PYDA 4JI1I 4ISAA 1KKHA 1HR0I 1WUUA 3WU6A 4X62E 4LCGA 1QZRA 3JAMQ 1E3PA 5IT9Q 4JI6I 4DUZI 2NPFA 1UDOA 4PRVA 1ZM2A 2CG9A 3L7ZB 4DV1E 4OO1D 3K1JA 3QT6A 2BR2B 4MYTA 4DR2I 5DRQA 1RR9A 5DNLA 1K47A 4DV7I 2JT2A 2PO0A 1ELOA 2CZ9A 1N34I 4DV1I 3M7NG 4LCHA 2PO1B 2Z5BA 2NN6A 5JEAF 2GQ0A 3OTOI 4B3TI 3J7AM 3CWVA 4AIMA 2NN6B 4JV5E 2UUBI 3M7ND 3B4TA 4DV6I 1H7UA 4BA1B 1Y6ZA 2R42A 1RHYA 4X64E 3P3GA 2UUCE 2C38B 1USUA 5K36F 4JV5I 4DPYA 2BM1A 3J81Q 2HFSA 4R1FA 4JI5I 4JI4E 4MYUA 1N33I 4JI7E 4DU7A 1USVA 4IS9A 4HY1A 3Q6NA 3V5RA 3P3EA 4MQYA 1FJGE 2AJ4A 1N32I 4IZKA 3V2UC 2WW4A 4NXME 4JI2E 2C37A 4GKKE 1Z59A 1XNQE 3P76A 5K36E 2V2VA 1N32E 5ELWA 2F4VE 1H74A 4WUCA 4HACA 4LF8I 4OO1C 1OJ4A 3H4LA 5GMDA 3K17A 1E3HA 3T1HE 2VQFE 2IOQA 3HULA 2O1TA 1XMOI 1XNRI 1UEKA 2V2QA 4DR1E 5JEAE 5JEAB 4IZJD 1OYPA 2BA0G 4LFBI 4LF7I 2UXBI 2J65A 1Z5BA 2X7IA 1MG7A 1DARA 4X65I 4X66E 3KRNA 1ZM9A 3WU5A 5K36C 2WNRA 4AM3A 2BV3A 4JI3E 2PO1A 1KIJA 4OO1E 2PO2A 1ZXNA 4P7AA 1KTVA 4URLA 2PO2B 1HNWE 4B3MI 1J5EI 2V2ZA 3HJCA 5A2QC 3Q1QA 1U2RA 4FWGA 5JEAC 5C0XD 4DV4E 1VISA 4NXNE 2Q2EB 2E1RA 4FW9A 4MDTA 1J5EE 3T1YE 4DR6I 2UU9I 2HHHI 3DD6A 2IERA 4JI8E 2UXCE 4JI0E 4LF9E 4RPFA 4FW5A 4J3DA 5K36D 1RREA 4M1KA 4GKJI 4KHPE 5GMEA 5K36B 1NHIA 5LMUE 4Z7YA 4OO1B 4JI8I 2HKEA 4N3OA 4AQYE 4DV2I 2UUCI 4DR7I 4I3HA 5BR8I 4DR4I 2VQEI 1R6LA 1Z0CA 1UDNA 2ZM6E 4DV0I 4LFAI 1B62A 4IZJA 3CDJA 2JEBB
chains in the Genus database with same CATH topology
5FWKA 1IBKE 1HNXE 1A6FA 1Z0VA 2R3VA 4UT4A 4XTJA 1XNQI 3K85A 1I94I 4DUYI 4LFCI 1N33E 4B3SI 4ED4A 3J80Q 4JI1E 3PYFA 3WU3A 3JAMC 2E5LI 4FN5A 4DV3I 5IT9C 4PRXA 1N0UA 2UXBE 4K0KI 3F0NA 1N0VC 2UUAI 2BM0A 1S4EA 4YHHE 4HYMA 4OX9E 5IWAE 1HNWI 3QT5A 4LFBE 1HR0E 4DPTA 3B78A 4ZVIA 2Z5EA 4JI6E 5LL6R 4DU8A 4DV5E 3J7AG 1IBLI 4P52A 2HK2A 1Z0BA 2UXCI 1KVKA 4DR2E 4YY3I 3B8HA 4X64I 1EA6A 3J81C 2V8PA 3LNUA 1FWKA 1Y4SA 4LF4I 3PYEA 4UTGA 4DPWA 4LF6E 4DR5I 4B3RE 4LF4E 4DV0E 4LFAE 4B3TE 4DV6E 3Q6MA 2IOPA 5LMNI 4LF9I 4GKKI 2ZM6I 2ZITA 1I94E 4DUYE 1FJGI 1S16A 4AQYI 1N36E 4NXMI 4FWHA 2O1UA 3ZM7A 4LFCE 4PU9A 3PRYA 1XMQI 2VF3A 2PNLA 2Z5BB 4DR1I 1XMOE 1IBLE 4B3SE 2LJPA 3D4JA 5IWAI 1D6TA 4DXLA 3GONA 3LPSA 3J80C 2DEJA 1Z5CA 4JI3I 1HK7A 4DR3I 1HNZI 1FNMA 4IZJB 4OX9I 4NXNI 3OTOE 4YY3E 3P06A 4JI5E 4DR6E 1NHJA 2VQEE 4IZKB 4HXZA 2UXDI 2X36A 3QT8A 1Z0EA 1PVGA 3PYGA 4GKJE 4KHPI 2V34A 5LMNE 1IBME 1FI4A 4LF6I 4B3RI 5FLXQ 1XHKA 4JI4I 1PKPA 4DR7E 3ZZTA 1FKAE 1PIEA 2Z5CA 4Z7CA 1NHHA 1ZXMA 3M6AA 2HK3A 3ZZ0A 4WUDA 1Y4UA 4HACB 2VQFI 3B82A 4JYAE 1XMQE 1B63A 2J7KA 4EMDA 4LF8E 4USMA 1H73A 1FWLA 5L3JA 1BKNA 1ZM4A 3QT7A 3ZKBA 4YHHI 4DV7E 4X66I 1EI1A 4DR3E 1HNZE 1H7SA 4DV3E 2HKJA 2DEIA 2UUBE 4JG4A 2UUAE 2HHHE 2PNMA 3ZKDA 4LF7E 4DUZE 2OI2A 4X65E 2UU9E 3T1YI 1NZ0A 1Z5AA 1ZM3A 4DV5I 4JI0I 1Z0WA 4B3ME 1IBMI 3LTOA 2ZBKB 1N34E 5A2QQ 5LMUI 2CGEA 4DV2E 4DR5E 4DR4E 3WU4A 1Z0GA 4JI7I 5BR8E 2A2CA 2O1VA 2GS8A 4FWDA 2EFGA 1IBKI 1HNXI 4DPUA 2UXDE 2E5LE 3ZZUA 1XNRE 2A2DA 2O1WA 4DPXA 2XEXA 4WUBA 1H72C 4LF5E 2Z5CB 4JYAI 5FLXC 1Z0TA 4USKA 3T1HI 4KQVA 4JI2I 4K0KE 4LF5I 4X62I 2HFUA 1N36I 1MU5A 4DV4I 2F4VI 1MX0A 3PYDA 4JI1I 1KKHA 1HR0I 1WUUA 3WU6A 4X62E 1QZRA 3JAMQ 5IT9Q 4JI6I 4DUZI 2NPFA 1ZM2A 2CG9A 4PRVA 4DV1E 3K1JA 3QT6A 4MYTA 4DR2I 1RR9A 1K47A 4DV7I 1ELOA 2CZ9A 1N34I 4DV1I 2Z5BA 4B3TI 3J7AM 2GQ0A 3OTOI 3CWVA 4JV5E 2UUBI 4DV6I 1H7UA 1Y6ZA 2R42A 4X64E 2UUCE 1USUA 4JV5I 4DPYA 2BM1A 3J81Q 2HFSA 4R1FA 4JI5I 4JI4E 4MYUA 1N33I 4JI7E 4DU7A 1USVA 4HY1A 3Q6NA 3V5RA 1FJGE 2AJ4A 1N32I 4IZKA 3V2UC 2WW4A 4NXME 4JI2E 4GKKE 1Z59A 1XNQE 2V2VA 1N32E 2F4VE 1H74A 4WUCA 4HACA 4LF8I 1OJ4A 3H4LA 5GMDA 3K17A 3T1HE 2VQFE 2IOQA 3HULA 2O1TA 1XMOI 1XNRI 1UEKA 2V2QA 4DR1E 4IZJD 4LFBI 4LF7I 2UXBI 1Z5BA 2X7IA 1MG7A 1DARA 4X65I 4X66E 1ZM9A 3WU5A 2BV3A 4JI3E 1KIJA 1ZXNA 4P7AA 1KTVA 4URLA 1HNWE 4B3MI 1J5EI 2V2ZA 3HJCA 5A2QC 3Q1QA 1U2RA 4FWGA 4NXNE 4DV4E 1VISA 2Q2EB 2E1RA 4FW9A 1J5EE 3T1YE 4DR6I 2UU9I 2HHHI 4JI8E 2UXCE 4JI0E 4LF9E 4RPFA 1RREA 4M1KA 4GKJI 4KHPE 5GMEA 1NHIA 5LMUE 4Z7YA 4JI8I 2HKEA 4N3OA 4AQYE 4DV2I 2UUCI 4DR7I 4I3HA 5BR8I 4DR4I 2VQEI 1Z0CA 2ZM6E 4DV0I 4LFAI 1B62A 4IZJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBK E;  1HNX E;  1A6F A;  1Z0V A;  2R3V A;  4UT4 A;  4XTJ A;  1XNQ I;  1I94 I;  4DUY I;  4LFC I;  1N33 E;  4B3S I;  4ED4 A;  3J80 Q;  4JI1 E;  3PYF A;  3WU3 A;  3JAM C;  2E5L I;  4FN5 A;  4DV3 I;  5IT9 C;  4PRX A;  1N0U A;  2UXB E;  4K0K I;  3F0N A;  1N0V C;  2UUA I;  2BM0 A;  1S4E A;  4YHH E;  4HYM A;  4OX9 E;  5IWA E;  1HNW I;  3QT5 A;  4LFB E;  1HR0 E;  4DPT A;  3B78 A;  4ZVI A;  4JI6 E;  5LL6 R;  4DU8 A;  4DV5 E;  3J7A G;  1IBL I;  4P52 A;  2HK2 A;  1Z0B A;  2UXC I;  1KVK A;  4DR2 E;  4YY3 I;  3B8H A;  4X64 I;  1EA6 A;  3J81 C;  2V8P A;  3LNU A;  1FWK A;  4LF4 I;  3PYE A;  4UTG A;  4DPW A;  4LF6 E;  4DR5 I;  4B3R E;  4LF4 E;  4DV0 E;  4LFA E;  4B3T E;  4DV6 E;  5LMN I;  4LF9 I;  4GKK I;  2ZM6 I;  2ZIT A;  1I94 E;  4DUY E;  1FJG I;  1S16 A;  4AQY I;  1N36 E;  4NXM I;  4FWH A;  3ZM7 A;  4LFC E;  4PU9 A;  1XMQ I;  2VF3 A;  4DR1 I;  1XMO E;  1IBL E;  4B3S E;  2LJP A;  3D4J A;  5IWA I;  1D6T A;  4DXL A;  3GON A;  3LPS A;  3J80 C;  2DEJ A;  1Z5C A;  4JI3 I;  4DR3 I;  1HNZ I;  1FNM A;  4OX9 I;  4NXN I;  3OTO E;  4YY3 E;  4JI5 E;  4DR6 E;  1NHJ A;  2VQE E;  4HXZ A;  2UXD I;  2X36 A;  3QT8 A;  1Z0E A;  1PVG A;  3PYG A;  4GKJ E;  4KHP I;  2V34 A;  5LMN E;  1IBM E;  1FI4 A;  4LF6 I;  4B3R I;  5FLX Q;  1XHK A;  4JI4 I;  1PKP A;  4DR7 E;  3ZZT A;  1FKA E;  1PIE A;  4Z7C A;  1NHH A;  1ZXM A;  3M6A A;  2HK3 A;  3ZZ0 A;  4WUD A;  4HAC B;  2VQF I;  3B82 A;  4JYA E;  1XMQ E;  1B63 A;  2J7K A;  4EMD A;  4LF8 E;  4USM A;  1H73 A;  1FWL A;  5L3J A;  1BKN A;  1ZM4 A;  3QT7 A;  3ZKB A;  4YHH I;  4DV7 E;  4X66 I;  1EI1 A;  4DR3 E;  1HNZ E;  1H7S A;  4DV3 E;  2HKJ A;  2DEI A;  2UUB E;  4JG4 A;  2UUA E;  2HHH E;  3ZKD A;  4LF7 E;  4DUZ E;  2OI2 A;  4X65 E;  2UU9 E;  3T1Y I;  1NZ0 A;  1Z5A A;  1ZM3 A;  4DV5 I;  4JI0 I;  1Z0W A;  4B3M E;  1IBM I;  3LTO A;  2ZBK B;  1N34 E;  5A2Q Q;  5LMU I;  4DV2 E;  4DR5 E;  4DR4 E;  3WU4 A;  1Z0G A;  4JI7 I;  5BR8 E;  2A2C A;  2GS8 A;  4FWD A;  2EFG A;  1IBK I;  1HNX I;  4DPU A;  2UXD E;  2E5L E;  3ZZU A;  1XNR E;  2A2D A;  4DPX A;  2XEX A;  4WUB A;  1H72 C;  4LF5 E;  4JYA I;  5FLX C;  1Z0T A;  4USK A;  3T1H I;  4KQV A;  4JI2 I;  4K0K E;  4LF5 I;  4X62 I;  2HFU A;  1N36 I;  1MU5 A;  4DV4 I;  2F4V I;  1MX0 A;  3PYD A;  4JI1 I;  1KKH A;  1HR0 I;  1WUU A;  3WU6 A;  4X62 E;  1QZR A;  3JAM Q;  5IT9 Q;  4JI6 I;  4DUZ I;  2NPF A;  1ZM2 A;  4PRV A;  4DV1 E;  3K1J A;  3QT6 A;  4MYT A;  4DR2 I;  1RR9 A;  1K47 A;  4DV7 I;  1ELO A;  2CZ9 A;  1N34 I;  4DV1 I;  4B3T I;  3J7A M;  3OTO I;  3CWV A;  4JV5 E;  2UUB I;  4DV6 I;  1H7U A;  2R42 A;  4X64 E;  2UUC E;  4JV5 I;  4DPY A;  2BM1 A;  3J81 Q;  2HFS A;  4R1F A;  4JI5 I;  4JI4 E;  4MYU A;  1N33 I;  4JI7 E;  4DU7 A;  4HY1 A;  3V5R A;  1FJG E;  2AJ4 A;  1N32 I;  3V2U C;  2WW4 A;  4NXM E;  4JI2 E;  4GKK E;  1Z59 A;  1XNQ E;  2V2V A;  1N32 E;  2F4V E;  1H74 A;  4WUC A;  4HAC A;  4LF8 I;  1OJ4 A;  3H4L A;  5GMD A;  3K17 A;  3T1H E;  2VQF E;  3HUL A;  1XMO I;  1XNR I;  1UEK A;  2V2Q A;  4DR1 E;  4LFB I;  4LF7 I;  2UXB I;  1Z5B A;  2X7I A;  1MG7 A;  1DAR A;  4X65 I;  4X66 E;  1ZM9 A;  3WU5 A;  2BV3 A;  4JI3 E;  1KIJ A;  1ZXN A;  4P7A A;  1KTV A;  4URL A;  1HNW E;  4B3M I;  1J5E I;  2V2Z A;  5A2Q C;  3Q1Q A;  1U2R A;  4FWG A;  4NXN E;  4DV4 E;  1VIS A;  2Q2E B;  2E1R A;  4FW9 A;  1J5E E;  3T1Y E;  4DR6 I;  2UU9 I;  2HHH I;  4JI8 E;  2UXC E;  4JI0 E;  4LF9 E;  4RPF A;  1RRE A;  4M1K A;  4GKJ I;  4KHP E;  5GME A;  1NHI A;  5LMU E;  4Z7Y A;  4JI8 I;  2HKE A;  4AQY E;  4DV2 I;  2UUC I;  4DR7 I;  4I3H A;  5BR8 I;  4DR4 I;  2VQE I;  1Z0C A;  2ZM6 E;  4DV0 I;  4LFA I;  1B62 A; 
#chains in the Genus database with same CATH topology
 5FWK A;  1IBK E;  1HNX E;  1A6F A;  1Z0V A;  2R3V A;  4LOM A;  4UT4 A;  4XTJ A;  1XNQ I;  3K85 A;  2C38 A;  4MU4 A;  1I94 I;  4DUY I;  4LFC I;  3NZK A;  4B3S I;  1N33 E;  4MU1 A;  4ED4 A;  3J80 Q;  3PYF A;  3WU3 A;  4JI1 E;  4MU3 A;  3JAM C;  2E5L I;  5K36 A;  5DRP A;  4FN5 A;  4DV3 I;  5IT9 C;  4OZE A;  1N0U A;  4PRX A;  2UXB E;  4K0K I;  3F0N A;  1N0V C;  2UUA I;  2BM0 A;  2PO0 B;  3P3C A;  1S4E A;  4U3B A;  4HYM A;  4YHH E;  4OX9 E;  5IWA E;  1HNW I;  3QT5 A;  4IFD F;  4LFB E;  1HR0 E;  2JEA A;  4DPT A;  3B78 A;  4NBQ A;  4ZVI A;  2Z5E A;  4JI6 E;  5LL6 R;  4DU8 A;  4DV5 E;  2GO4 A;  1IBL I;  3J7A G;  4P52 A;  2WNR B;  2HK2 A;  1Z0B A;  4FW6 A;  4BA2 B;  2UXC I;  1KVK A;  4DR2 E;  4YY3 I;  3B8H A;  5DNX A;  4X64 I;  1EA6 A;  1OYS A;  3J81 C;  2V8P A;  3LNU A;  1FWK A;  1Y4S A;  4LF4 I;  4OO1 A;  3PYE A;  4OKG A;  4UTG A;  4DPW A;  2JEA B;  2WP8 B;  2PNZ B;  2PNZ A;  4LF6 E;  4DR5 I;  4B3R E;  4LF4 E;  1OYR A;  1Y5Y A;  4DV0 E;  4LFA E;  4B3T E;  4DV6 E;  3Q6M A;  5C0X F;  2IOP A;  5LMN I;  4LF9 I;  4GKK I;  4LPF A;  4IFD B;  3GME A;  2ZM6 I;  2BA1 G;  2ZIT A;  1I94 E;  4BA2 A;  4DUY E;  3HKM A;  2NN6 F;  4U3D A;  5JEA A;  1FJG I;  1S16 A;  2C39 B;  4AQY I;  1N36 E;  4NXM I;  3L7Z A;  4FWH A;  1VI7 A;  2O1U A;  3ZM7 A;  4LFC E;  4PU9 A;  3PRY A;  1YH8 A;  1XMQ I;  2VF3 A;  2PNL A;  2Z5B B;  3CDI A;  4DR1 I;  1XMO E;  1IBL E;  4B3S E;  2LJP A;  3M85 G;  3D4J A;  5IWA I;  1D6T A;  2VES A;  4DXL A;  3GON A;  3LPS A;  3J80 C;  2DEJ A;  1Z5C A;  2NN6 E;  2O3Z A;  2BA0 D;  1HK7 A;  4JI3 I;  4DR3 I;  1HNZ I;  4QNJ A;  1FNM A;  4IZJ B;  4OX9 I;  3U1Y A;  4NXN I;  5C0X E;  3OTO E;  4AID A;  4YY3 E;  3P06 A;  4JI5 E;  4QNK A;  3PS3 A;  4DR6 E;  1NHJ A;  2VQE E;  4IZK B;  4HXZ A;  2UXD I;  5EL9 A;  2X36 A;  3QT8 A;  1Z0E A;  1PVG A;  3PYG A;  4GKJ E;  4KHP I;  2V34 A;  5LMN E;  1IBM E;  1FI4 A;  2AE8 A;  4LF6 I;  4B3R I;  5FLX Q;  1XHK A;  4JI4 I;  1PKP A;  4DR7 E;  3ZZT A;  3GCM A;  1FKA E;  1PIE A;  2Z5C A;  4Z7C A;  1NHH A;  1ZXM A;  3M6A A;  4IFD D;  2HK3 A;  3UHM A;  3ZZ0 A;  1XXE A;  4WUD A;  2JEB A;  1Y4U A;  4HAC B;  5JEA D;  2VQF I;  3B82 A;  4JYA E;  1XMQ E;  1B63 A;  2J7K A;  4EMD A;  4LF8 E;  4USM A;  1H73 A;  1FWL A;  2NN6 C;  5L3J A;  1BKN A;  1ZM4 A;  3QT7 A;  4IFD A;  3ZKB A;  2BR2 A;  1Y60 A;  5C0X C;  5C0X B;  4YHH I;  4DV7 E;  4X66 I;  2JE6 B;  1EI1 A;  4DR3 E;  2JE6 A;  1HNZ E;  1H7S A;  4DV3 E;  2CVE A;  2C37 B;  2HKJ A;  2NN6 D;  2DEI A;  2UUB E;  4JG4 A;  2UUA E;  4BA1 A;  2C39 A;  2HHH E;  2PNM A;  3ZKD A;  2IES A;  4LF7 E;  4FW3 A;  1UDS A;  4DUZ E;  2OI2 A;  3U1K A;  4X65 E;  2UU9 E;  3T1Y I;  1NZ0 A;  1Z5A A;  1ZM3 A;  4DV5 I;  4FW4 A;  4JI0 I;  1Z0W A;  4B3M E;  1IBM I;  3LTO A;  2ZBK B;  1N34 E;  5A2Q Q;  1P42 A;  5LMU I;  2CGE A;  4GQU A;  2GO3 A;  5C0X A;  2WP8 A;  4DV2 E;  4DR5 E;  5EKW A;  4LCF A;  4DR4 E;  3WU4 A;  1Z0G A;  4JI7 I;  5BR8 E;  2A2C A;  3M85 D;  2F1D A;  3GLL A;  2O1V A;  2GS8 A;  4FWD A;  2EFG A;  3PS1 A;  1IBK I;  1HNX I;  4DPU A;  2UXD E;  2E5L E;  3ZZU A;  4IFD C;  4FW7 A;  1XNR E;  4OO1 F;  1R6M A;  2A2D A;  2O1W A;  4DPX A;  2XEX A;  3H1C A;  4WUB A;  1UDQ A;  1H72 C;  4LF5 E;  2Z5C B;  4MU0 A;  4JYA I;  5FLX C;  1YHC A;  1Z0T A;  4USK A;  3T1H I;  4KQV A;  4JI2 I;  4K0K E;  4LF5 I;  4X62 I;  2HFU A;  4IFD E;  1N36 I;  1MU5 A;  5DRR A;  3PS2 A;  5DRO A;  4DV4 I;  2BA1 D;  2F4V I;  1MX0 A;  3PYD A;  4JI1 I;  4ISA A;  1KKH A;  1HR0 I;  1WUU A;  3WU6 A;  4X62 E;  4LCG A;  1QZR A;  3JAM Q;  1E3P A;  5IT9 Q;  4JI6 I;  4DUZ I;  2NPF A;  1UDO A;  4PRV A;  1ZM2 A;  2CG9 A;  3L7Z B;  4DV1 E;  4OO1 D;  3K1J A;  3QT6 A;  2BR2 B;  4MYT A;  4DR2 I;  5DRQ A;  1RR9 A;  5DNL A;  1K47 A;  4DV7 I;  2JT2 A;  2PO0 A;  1ELO A;  2CZ9 A;  1N34 I;  4DV1 I;  3M7N G;  4LCH A;  2PO1 B;  2Z5B A;  2NN6 A;  5JEA F;  2GQ0 A;  3OTO I;  4B3T I;  3J7A M;  3CWV A;  4AIM A;  2NN6 B;  4JV5 E;  2UUB I;  3M7N D;  3B4T A;  4DV6 I;  1H7U A;  4BA1 B;  1Y6Z A;  2R42 A;  1RHY A;  4X64 E;  3P3G A;  2UUC E;  2C38 B;  1USU A;  5K36 F;  4JV5 I;  4DPY A;  2BM1 A;  3J81 Q;  2HFS A;  4R1F A;  4JI5 I;  4JI4 E;  4MYU A;  1N33 I;  4JI7 E;  4DU7 A;  1USV A;  4IS9 A;  4HY1 A;  3Q6N A;  3V5R A;  3P3E A;  4MQY A;  1FJG E;  2AJ4 A;  1N32 I;  4IZK A;  3V2U C;  2WW4 A;  4NXM E;  4JI2 E;  2C37 A;  4GKK E;  1Z59 A;  1XNQ E;  3P76 A;  5K36 E;  2V2V A;  1N32 E;  5ELW A;  2F4V E;  1H74 A;  4WUC A;  4HAC A;  4LF8 I;  4OO1 C;  1OJ4 A;  3H4L A;  5GMD A;  3K17 A;  1E3H A;  3T1H E;  2VQF E;  2IOQ A;  3HUL A;  2O1T A;  1XMO I;  1XNR I;  1UEK A;  2V2Q A;  4DR1 E;  5JEA E;  5JEA B;  4IZJ D;  1OYP A;  2BA0 G;  4LFB I;  4LF7 I;  2UXB I;  2J65 A;  1Z5B A;  2X7I A;  1MG7 A;  1DAR A;  4X65 I;  4X66 E;  3KRN A;  1ZM9 A;  3WU5 A;  5K36 C;  2WNR A;  4AM3 A;  2BV3 A;  4JI3 E;  2PO1 A;  1KIJ A;  4OO1 E;  2PO2 A;  1ZXN A;  4P7A A;  1KTV A;  4URL A;  2PO2 B;  1HNW E;  4B3M I;  1J5E I;  2V2Z A;  3HJC A;  5A2Q C;  3Q1Q A;  1U2R A;  4FWG A;  5JEA C;  5C0X D;  4DV4 E;  1VIS A;  4NXN E;  2Q2E B;  2E1R A;  4FW9 A;  4MDT A;  1J5E E;  3T1Y E;  4DR6 I;  2UU9 I;  2HHH I;  3DD6 A;  2IER A;  4JI8 E;  2UXC E;  4JI0 E;  4LF9 E;  4RPF A;  4FW5 A;  4J3D A;  5K36 D;  1RRE A;  4M1K A;  4GKJ I;  4KHP E;  5GME A;  5K36 B;  1NHI A;  5LMU E;  4Z7Y A;  4OO1 B;  4JI8 I;  2HKE A;  4N3O A;  4AQY E;  4DV2 I;  2UUC I;  4DR7 I;  4I3H A;  5BR8 I;  4DR4 I;  2VQE I;  1R6L A;  1Z0C A;  1UDN A;  2ZM6 E;  4DV0 I;  4LFA I;  1B62 A;  4IZJ A;  3CDJ A;  2JEB B; 
#chains in the Genus database with same CATH homology
 5FWK A;  1IBK E;  1HNX E;  1A6F A;  1Z0V A;  2R3V A;  4UT4 A;  4XTJ A;  1XNQ I;  3K85 A;  1I94 I;  4DUY I;  4LFC I;  1N33 E;  4B3S I;  4ED4 A;  3J80 Q;  4JI1 E;  3PYF A;  3WU3 A;  3JAM C;  2E5L I;  4FN5 A;  4DV3 I;  5IT9 C;  4PRX A;  1N0U A;  2UXB E;  4K0K I;  3F0N A;  1N0V C;  2UUA I;  2BM0 A;  1S4E A;  4YHH E;  4HYM A;  4OX9 E;  5IWA E;  1HNW I;  3QT5 A;  4LFB E;  1HR0 E;  4DPT A;  3B78 A;  4ZVI A;  2Z5E A;  4JI6 E;  5LL6 R;  4DU8 A;  4DV5 E;  3J7A G;  1IBL I;  4P52 A;  2HK2 A;  1Z0B A;  2UXC I;  1KVK A;  4DR2 E;  4YY3 I;  3B8H A;  4X64 I;  1EA6 A;  3J81 C;  2V8P A;  3LNU A;  1FWK A;  1Y4S A;  4LF4 I;  3PYE A;  4UTG A;  4DPW A;  4LF6 E;  4DR5 I;  4B3R E;  4LF4 E;  4DV0 E;  4LFA E;  4B3T E;  4DV6 E;  3Q6M A;  2IOP A;  5LMN I;  4LF9 I;  4GKK I;  2ZM6 I;  2ZIT A;  1I94 E;  4DUY E;  1FJG I;  1S16 A;  4AQY I;  1N36 E;  4NXM I;  4FWH A;  2O1U A;  3ZM7 A;  4LFC E;  4PU9 A;  3PRY A;  1XMQ I;  2VF3 A;  2PNL A;  2Z5B B;  4DR1 I;  1XMO E;  1IBL E;  4B3S E;  2LJP A;  3D4J A;  5IWA I;  1D6T A;  4DXL A;  3GON A;  3LPS A;  3J80 C;  2DEJ A;  1Z5C A;  4JI3 I;  1HK7 A;  4DR3 I;  1HNZ I;  1FNM A;  4IZJ B;  4OX9 I;  4NXN I;  3OTO E;  4YY3 E;  3P06 A;  4JI5 E;  4DR6 E;  1NHJ A;  2VQE E;  4IZK B;  4HXZ A;  2UXD I;  2X36 A;  3QT8 A;  1Z0E A;  1PVG A;  3PYG A;  4GKJ E;  4KHP I;  2V34 A;  5LMN E;  1IBM E;  1FI4 A;  4LF6 I;  4B3R I;  5FLX Q;  1XHK A;  4JI4 I;  1PKP A;  4DR7 E;  3ZZT A;  1FKA E;  1PIE A;  2Z5C A;  4Z7C A;  1NHH A;  1ZXM A;  3M6A A;  2HK3 A;  3ZZ0 A;  4WUD A;  1Y4U A;  4HAC B;  2VQF I;  3B82 A;  4JYA E;  1XMQ E;  1B63 A;  2J7K A;  4EMD A;  4LF8 E;  4USM A;  1H73 A;  1FWL A;  5L3J A;  1BKN A;  1ZM4 A;  3QT7 A;  3ZKB A;  4YHH I;  4DV7 E;  4X66 I;  1EI1 A;  4DR3 E;  1HNZ E;  1H7S A;  4DV3 E;  2HKJ A;  2DEI A;  2UUB E;  4JG4 A;  2UUA E;  2HHH E;  2PNM A;  3ZKD A;  4LF7 E;  4DUZ E;  2OI2 A;  4X65 E;  2UU9 E;  3T1Y I;  1NZ0 A;  1Z5A A;  1ZM3 A;  4DV5 I;  4JI0 I;  1Z0W A;  4B3M E;  1IBM I;  3LTO A;  2ZBK B;  1N34 E;  5A2Q Q;  5LMU I;  2CGE A;  4DV2 E;  4DR5 E;  4DR4 E;  3WU4 A;  1Z0G A;  4JI7 I;  5BR8 E;  2A2C A;  2O1V A;  2GS8 A;  4FWD A;  2EFG A;  1IBK I;  1HNX I;  4DPU A;  2UXD E;  2E5L E;  3ZZU A;  1XNR E;  2A2D A;  2O1W A;  4DPX A;  2XEX A;  4WUB A;  1H72 C;  4LF5 E;  2Z5C B;  4JYA I;  5FLX C;  1Z0T A;  4USK A;  3T1H I;  4KQV A;  4JI2 I;  4K0K E;  4LF5 I;  4X62 I;  2HFU A;  1N36 I;  1MU5 A;  4DV4 I;  2F4V I;  1MX0 A;  3PYD A;  4JI1 I;  1KKH A;  1HR0 I;  1WUU A;  3WU6 A;  4X62 E;  1QZR A;  3JAM Q;  5IT9 Q;  4JI6 I;  4DUZ I;  2NPF A;  1ZM2 A;  2CG9 A;  4PRV A;  4DV1 E;  3K1J A;  3QT6 A;  4MYT A;  4DR2 I;  1RR9 A;  1K47 A;  4DV7 I;  1ELO A;  2CZ9 A;  1N34 I;  4DV1 I;  2Z5B A;  4B3T I;  3J7A M;  2GQ0 A;  3OTO I;  3CWV A;  4JV5 E;  2UUB I;  4DV6 I;  1H7U A;  1Y6Z A;  2R42 A;  4X64 E;  2UUC E;  1USU A;  4JV5 I;  4DPY A;  2BM1 A;  3J81 Q;  2HFS A;  4R1F A;  4JI5 I;  4JI4 E;  4MYU A;  1N33 I;  4JI7 E;  4DU7 A;  1USV A;  4HY1 A;  3Q6N A;  3V5R A;  1FJG E;  2AJ4 A;  1N32 I;  4IZK A;  3V2U C;  2WW4 A;  4NXM E;  4JI2 E;  4GKK E;  1Z59 A;  1XNQ E;  2V2V A;  1N32 E;  2F4V E;  1H74 A;  4WUC A;  4HAC A;  4LF8 I;  1OJ4 A;  3H4L A;  5GMD A;  3K17 A;  3T1H E;  2VQF E;  2IOQ A;  3HUL A;  2O1T A;  1XMO I;  1XNR I;  1UEK A;  2V2Q A;  4DR1 E;  4IZJ D;  4LFB I;  4LF7 I;  2UXB I;  1Z5B A;  2X7I A;  1MG7 A;  1DAR A;  4X65 I;  4X66 E;  1ZM9 A;  3WU5 A;  2BV3 A;  4JI3 E;  1KIJ A;  1ZXN A;  4P7A A;  1KTV A;  4URL A;  1HNW E;  4B3M I;  1J5E I;  2V2Z A;  3HJC A;  5A2Q C;  3Q1Q A;  1U2R A;  4FWG A;  4NXN E;  4DV4 E;  1VIS A;  2Q2E B;  2E1R A;  4FW9 A;  1J5E E;  3T1Y E;  4DR6 I;  2UU9 I;  2HHH I;  4JI8 E;  2UXC E;  4JI0 E;  4LF9 E;  4RPF A;  1RRE A;  4M1K A;  4GKJ I;  4KHP E;  5GME A;  1NHI A;  5LMU E;  4Z7Y A;  4JI8 I;  2HKE A;  4N3O A;  4AQY E;  4DV2 I;  2UUC I;  4DR7 I;  4I3H A;  5BR8 I;  4DR4 I;  2VQE I;  1Z0C A;  2ZM6 E;  4DV0 I;  4LFA I;  1B62 A;  4IZJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...