4JI1I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 23
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji1I00
5BR8E 1FNMA 4USMA 4GKJE 4DUYI 3JAMQ 4X65I 4DV6I 1N34E 1Z5AA 5LL6R 3T1YI 3V2UC 1NHJA 5A2QQ 1HNZE 3V5RA 1XHKA 4B3TI 4LF6I 2BV3A 4X64I 1IBLI 2HFUA 5LMNI 1NHIA 4DV4I 1FKAE 4JI3I 4NXME 2ZBKB 1D6TA 3CWVA 4DUZE 1Z0GA 3QT8A 4JV5E 4B3RE 4FWHA 1HNXI 4DR7I 3ZZTA 1I94E 5GMDA 3Q1QA 1N36E 1H7UA 4LFAI 1EI1A 4Z7CA 4URLA 2E1RA 3ZKDA 4AQYE 4JI1E 4KQVA 4JI2I 5IWAI 4JYAI 1B62A 4B3MI 2E5LE 2ZM6I 4DV3I 4PRXA 4LF9E 4P52A 2UUCI 4K0KE 2A2DA 2HFSA 2V2VA 4DR2I 4X66E 1N32I 3PYDA 1Z0BA 1Z0CA 1PVGA 1VISA 4KHPI 3J80C 3B82A 1U2RA 5BR8I 4OX9E 1Z5BA 2AJ4A 3H4LA 1Z0TA 2GS8A 3ZZUA 5IT9Q 4P7AA 4JI8E 5L3JA 4GKKI 2UXCE 4B3SE 4YY3I 4JI4I 4LFCI 4MYUA 4EMDA 3J81Q 1DARA 4DR3E 1HNWE 2VQFE 4YHHI 1RR9A 4DR1E 1IBMI 4DUZI 4JI5E 4DV7E 5FLXQ 4HACB 4JV5I 4DV5E 4X62I 1N0UA 2EFGA 2VF3A 1N36I 4LFBE 1ELOA 1ZM4A 3WU5A 1XNQE 5FLXC 1IBKE 2X36A 1XNRI 4LF5I 1ZM2A 5GMEA 1KTVA 3PYGA 2VQEI 1FWKA 1S4EA 4DV1I 2UUBE 3JAMC 2R3VA 3M6AA 4LF9I 2F4VE 4K0KI 1KKHA 5A2QC 4FWDA 4X66I 2V8PA 4I3HA 3QT7A 4ZVIA 4RPFA 2HHHI 4LF7I 1J5EI 1FJGI 3QT6A 2LJPA 3HULA 4DR5E 1Z0WA 3T1HE 2V2ZA 3OTOI 3LPSA 1B63A 4DV0E 4DV2E 1ZXMA 3K17A 3WU4A 1HR0E 4NXNE 1H73A 4JI0I 4JG4A 4UTGA 4DR6I 4X65E 1RREA 1XMQE 2UXDI 4DR3I 1HNWI 4JI6E 4DR4E 2VQFI 4LF6E 3WU3A 4B3TE 2X7IA 4DR1I 2ZITA 1H72C 5LMUI 3ZM7A 2XEXA 4LF4I 4DV4E 4GKJI 4USKA 4LFBI 1HNXE 1N34I 4DR7E 1XNQI 1WUUA 1IBKI 3B78A 1HNZI 1FWLA 4M1KA 4LFAE 2UUAE 4DPWA 3ZKBA 1BKNA 5IT9C 1S16A 2Q2EB 4NXMI 1ZXNA 2F4VI 3PYFA 4JI2E 1N33E 4HXZA 4B3RI 5IWAE 1MX0A 1NZ0A 3LNUA 2V34A 1I94I 1KIJA 2ZM6E 2UXBE 3J81C 2UUCE 4DU8A 2CZ9A 4DR2E 1H7SA 4JI7E 2R42A 4DV0I 4DV2I 4AQYI 4JI1I 4FWGA 4KHPE 3ZZ0A 4NXNI 2HK2A 1UEKA 2E5LI 1XMQI 4Z7YA 3J7AM 4FN5A 3WU6A 4GKKE 2DEIA 1XMOE 3B8HA 4JI6I 4DR4I 4YY3E 2NPFA 4JI4E 4LF8E 4LFCE 1Z0VA 2DEJA 4DPTA 1Z59A 3LTOA 3PYEA 1MG7A 2A2CA 1H74A 4HY1A 4YHHE 2BM0A 1IBME 4OX9I 3QT5A 2UU9E 3F0NA 1A6FA 4X62E 4UT4A 4JI8I 2UXCI 2J7KA 4B3SI 4PU9A 2WW4A 2BM1A 1Z5CA 4DUYE 2OI2A 2UUAI 1N0VC 3GONA 3K1JA 4DV6E 2V2QA 4DPYA 3T1YE 1KVKA 1XNRE 4DPXA 4JI5I 4LF5E 4DV7I 1N33I 4X64E 1IBLE 4DV5I 2VQEE 5LMNE 3J7AG 1EA6A 4DV1E 3J80Q 2UXBI 4WUCA 4JI3E 4DPUA 4XTJA 1Z0EA 4JI7I 1PKPA 2HHHE 4LF7E 1FI4A 1J5EE 4MYTA 1FJGE 3D4JA 4DU7A 3OTOE 2HKEA 2UUBI 4DXLA 4FW9A 1XMOI 2HKJA 4PRVA 4JYAE 4B3ME 4R1FA 4JI0E 1ZM3A 4LF8I 4DR6E 4WUDA 4DV3E 1PIEA 4HYMA 2UXDE 4DR5I 1QZRA 3T1HI 1N32E 2HK3A 1ZM9A 5LMUE 1K47A 1MU5A 4ED4A 2UU9I 1OJ4A 1NHHA 4WUBA 1HR0I 4LF4E 4HACA
chains in the Genus database with same CATH superfamily
2PO2A 5BR8E 1FNMA 4USMA 4GKJE 2PO0A 4DUYI 3JAMQ 4X65I 2AE8A 4DV6I 5C0XE 1Z5AA 1N34E 5LL6R 3T1YI 3V2UC 2JEBB 5C0XC 3DD6A 1NHJA 5A2QQ 1HNZE 3V5RA 1XHKA 4B3TI 4LF6I 2BV3A 4BA1A 4FW5A 5C0XB 4X64I 4IZJD 1IBLI 4BA2B 2HFUA 5LMNI 3M7ND 4LCFA 1NHIA 4LPFA 4DV4I 1FKAE 5DRQA 4JI3I 4NXME 2ZBKB 2Z5BA 3CWVA 1D6TA 4DUZE 4IZJA 2IERA 2CG9A 1Z0GA 3QT8A 4JV5E 4B3RE 1RHYA 4FWHA 1HNXI 4DR7I 3ZZTA 5C0XD 1I94E 5GMDA 3Q1QA 1N36E 1H7UA 3P3EA 4LFAI 1EI1A 4Z7CA 4URLA 4FW4A 1XXEA 2E1RA 3ZKDA 4AQYE 1HK7A 2NN6E 4JI1E 2WP8A 4KQVA 4JI2I 2NN6C 5DNLA 5IWAI 4JYAI 1B62A 4B3MI 2E5LE 2NN6B 2ZM6I 4DV3I 4FW6A 4PRXA 4P52A 4LF9E 2UUCI 2JEAB 4IFDE 4K0KE 4IFDC 2A2DA 2HFSA 4U3BA 2V2VA 4DR2I 4X66E 1N32I 3PYDA 3CDJA 1USVA 1USUA 1PVGA 1VISA 1Z0BA 1Z0CA 4IFDB 3P76A 4KHPI 2C37B 3J80C 3B82A 1U2RA 2IOQA 5BR8I 4OX9E 1Z5BA 2AJ4A 3H4LA 2BA1G 1Z0TA 2GS8A 3ZZUA 2PNLA 5IT9Q 2BR2A 4P7AA 3PRYA 4JI8E 4QNKA 5L3JA 4GKKI 2UXCE 4B3SE 5DNXA 4YY3I 3HKMA 4JI4I 4LFCI 4FW3A 4MYUA 4EMDA 3J81Q 1DARA 4MQYA 2PNMA 4DR3E 1HNWE 4OO1F 2VQFE 4YHHI 1RR9A 4DR1E 1IBMI 4DUZI 5JEAF 5JEAA 4JI5E 4DV7E 5FLXQ 4HACB 4JV5I 4DV5E 1OYRA 4X62I 1N0UA 2EFGA 2VF3A 1N36I 4OKGA 4LFBE 1ELOA 1Y6ZA 1UDSA 1ZM4A 3P3CA 5K36A 5K36F 3WU5A 1XNQE 2F1DA 5FLXC 4IZKB 1IBKE 2X36A 1XNRI 3B4TA 3K85A 4J3DA 4LF5I 1ZM2A 2PO1A 1P42A 2C39A 1KTVA 3PYGA 5GMEA 2Z5CB 2Z5BB 3U1KA 2VQEI 1FWKA 1S4EA 4DV1I 2UUBE 2WNRA 3P06A 3JAMC 2R3VA 3M6AA 2PNZB 4LF9I 2F4VE 4K0KI 1KKHA 5A2QC 4FWDA 4X66I 2V8PA 4I3HA 3Q6MA 3QT7A 4ZVIA 1Y60A 4RPFA 2HHHI 4LF7I 1J5EI 1FJGI 3QT6A 2LJPA 3HULA 4DR5E 1Z0WA 3T1HE 5C0XA 2BA0D 2V2ZA 3OTOI 3LPSA 4BA2A 3M85D 1B63A 4DV0E 4LCHA 2GQ0A 3UHMA 4DV2E 1ZXMA 3K17A 3WU4A 3GLLA 4NBQA 4LCGA 1HR0E 3Q6NA 4NXNE 3HJCA 1R6LA 1H73A 3GMEA 4JG4A 4JI0I 4UTGA 3M7NG 1Y4SA 4DR6I 2IOPA 1UDOA 4X65E 1RREA 4QNJA 1XMQE 2UXDI 1YH8A 4DR3I 1HNWI 2O1TA 4JI6E 4DR4E 2VQFI 4LF6E 3WU3A 4B3TE 2X7IA 4DR1I 2ZITA 1H72C 5LMUI 3ZM7A 2XEXA 5EKWA 4LF4I 2NN6D 2BR2B 3KRNA 4AM3A 4DV4E 4GKJI 2O1UA 4USKA 4AIDA 2J65A 4LFBI 4OO1E 1HNXE 1N34I 3PS2A 4OO1C 4DR7E 1XNQI 4IFDD 2JEAA 5JEAE 1WUUA 1IBKI 3B78A 5JEAC 1HNZI 1FWLA 1OYPA 4M1KA 4OO1B 4LFAE 2UUAE 1E3HA 4IFDA 3H1CA 5JEAB 4DPWA 1YHCA 3CDIA 3ZKBA 1BKNA 5IT9C 1S16A 2JE6B 5K36E 2Q2EB 4NXMI 1ZXNA 2F4VI 5K36C 3PYFA 4JI2E 1N33E 2PO2B 4HXZA 4B3RI 5IWAE 1MX0A 2PO0B 4OO1D 1NZ0A 1E3PA 3LNUA 2V34A 1I94I 5K36B 1KIJA 2CVEA 4N3OA 5DRRA 3J81C 2ZM6E 3PS3A 2UXBE 2UUCE 1UDNA 4DU8A 5FWKA 2CZ9A 4DR2E 1H7SA 4BA1B 4JI7E 2IESA 2PO1B 2R42A 4DV0I 4DV2I 4AQYI 2WNRB 4MU3A 4JI1I 4FWGA 4KHPE 5DRPA 3ZZ0A 2C38A 4IZJB 4NXNI 3L7ZA 4MDTA 2HK2A 1UEKA 2GO3A 2E5LI 1XMQI 2Z5EA 4Z7YA 3PS1A 4MU4A 3J7AM 4FN5A 3WU6A 5DROA 4GKKE 2O3ZA 2DEIA 1XMOE 3B8HA 4JI6I 4DR4I 4YY3E 2NPFA 4JI4E 4LF8E 1R6MA 4LFCE 2JEBA 1Z0VA 2DEJA 4IZKA 4DPTA 1Z59A 3LTOA 3PYEA 1MG7A 2A2CA 1H74A 4HY1A 5C0XF 4YHHE 2WP8B 2BM0A 2Z5CA 1IBME 4OX9I 3QT5A 3NZKA 2UU9E 3F0NA 1A6FA 2PNZA 4X62E 4UT4A 4JI8I 2UXCI 2J7KA 4PU9A 4B3SI 2GO4A 2WW4A 4AIMA 2BM1A 4MU0A 1Z5CA 1Y4UA 4DUYE 2OI2A 2UUAI 1N0VC 3GONA 3K1JA 4DV6E 2V2QA 4DPYA 3T1YE 1VI7A 2BA1D 1KVKA 4U3DA 1XNRE 4DPXA 4JI5I 4GQUA 4LF5E 4DV7I 1N33I 4X64E 1IBLE 4DV5I 2VQEE 5ELWA 5LMNE 3J7AG 1EA6A 4DV1E 3J80Q 2UXBI 4WUCA 4JI3E 2BA0G 4DPUA 3M85G 4XTJA 3P3GA 4MU1A 1Z0EA 4JI7I 2NN6F 2NN6A 1Y5YA 1PKPA 4LOMA 2O1WA 4IS9A 2HHHE 4LF7E 1FI4A 4FW7A 2O1VA 1J5EE 4MYTA 1FJGE 3D4JA 4DU7A 4IFDF 4ISAA 3OTOE 2HKEA 2UUBI 4OZEA 2C37A 4DXLA 3GCMA 4FW9A 1UDQA 2HKJA 1XMOI 4PRVA 4JYAE 4B3ME 4R1FA 2CGEA 4JI0E 1ZM3A 4LF8I 4DR6E 4WUDA 4DV3E 1PIEA 1OYSA 5JEAD 4HYMA 2UXDE 4DR5I 2VESA 1QZRA 4OO1A 3T1HI 1N32E 2HK3A 1ZM9A 5EL9A 5LMUE 2C39B 1K47A 1MU5A 2JT2A 3U1YA 2C38B 3L7ZB 4ED4A 2UU9I 1OJ4A 1NHHA 4WUBA 2JE6A 5K36D 1HR0I 4LF4E 4HACA
chains in the Genus database with same CATH topology
5BR8E 1FNMA 4USMA 4GKJE 4DUYI 3JAMQ 4X65I 4DV6I 1N34E 1Z5AA 5LL6R 3T1YI 3V2UC 1NHJA 5A2QQ 1HNZE 3V5RA 1XHKA 4B3TI 4LF6I 2BV3A 4X64I 4IZJD 1IBLI 2HFUA 5LMNI 1NHIA 4DV4I 1FKAE 4JI3I 4NXME 2ZBKB 2Z5BA 3CWVA 1D6TA 4DUZE 4IZJA 2CG9A 1Z0GA 3QT8A 4JV5E 4B3RE 4FWHA 1HNXI 4DR7I 3ZZTA 1I94E 5GMDA 3Q1QA 1N36E 1H7UA 4LFAI 1EI1A 4Z7CA 4URLA 2E1RA 3ZKDA 4AQYE 1HK7A 4JI1E 4KQVA 4JI2I 5IWAI 4JYAI 1B62A 4B3MI 2E5LE 2ZM6I 4DV3I 4PRXA 4LF9E 4P52A 2UUCI 4K0KE 2A2DA 2HFSA 2V2VA 4DR2I 4X66E 1N32I 3PYDA 1USVA 1USUA 1PVGA 1VISA 1Z0BA 1Z0CA 4KHPI 3J80C 3B82A 1U2RA 2IOQA 5BR8I 4OX9E 1Z5BA 2AJ4A 3H4LA 1Z0TA 2GS8A 3ZZUA 2PNLA 5IT9Q 4P7AA 3PRYA 4JI8E 5L3JA 4GKKI 2UXCE 4B3SE 4YY3I 4JI4I 4LFCI 4MYUA 4EMDA 3J81Q 1DARA 2PNMA 4DR3E 1HNWE 2VQFE 4YHHI 1RR9A 4DR1E 1IBMI 4DUZI 4JI5E 4DV7E 5FLXQ 4HACB 4JV5I 4DV5E 4X62I 1N0UA 2EFGA 2VF3A 1N36I 4LFBE 1ELOA 1Y6ZA 1ZM4A 3WU5A 1XNQE 5FLXC 4IZKB 1IBKE 2X36A 1XNRI 3K85A 4LF5I 1ZM2A 5GMEA 1KTVA 3PYGA 2Z5CB 2Z5BB 2VQEI 1FWKA 1S4EA 4DV1I 2UUBE 3P06A 3JAMC 2R3VA 3M6AA 4LF9I 2F4VE 4K0KI 1KKHA 5A2QC 4FWDA 4X66I 2V8PA 4I3HA 3Q6MA 3QT7A 4ZVIA 4RPFA 2HHHI 4LF7I 1J5EI 1FJGI 3QT6A 2LJPA 3HULA 4DR5E 1Z0WA 3T1HE 2V2ZA 3OTOI 3LPSA 1B63A 4DV0E 2GQ0A 4DV2E 1ZXMA 3K17A 3WU4A 1HR0E 3Q6NA 4NXNE 3HJCA 1H73A 4JI0I 4JG4A 4UTGA 1Y4SA 4DR6I 2IOPA 4X65E 1RREA 1XMQE 2UXDI 4DR3I 1HNWI 2O1TA 4JI6E 4DR4E 2VQFI 4LF6E 3WU3A 4B3TE 2X7IA 4DR1I 2ZITA 1H72C 5LMUI 3ZM7A 2XEXA 4LF4I 4DV4E 4GKJI 2O1UA 4USKA 4LFBI 1HNXE 1N34I 4DR7E 1XNQI 1WUUA 1IBKI 3B78A 1HNZI 1FWLA 4M1KA 4LFAE 2UUAE 4DPWA 3ZKBA 1BKNA 5IT9C 1S16A 2Q2EB 4NXMI 1ZXNA 2F4VI 3PYFA 4JI2E 1N33E 4HXZA 4B3RI 5IWAE 1MX0A 1NZ0A 3LNUA 2V34A 1I94I 1KIJA 4N3OA 2ZM6E 3J81C 2UXBE 2UUCE 5FWKA 4DU8A 2CZ9A 4DR2E 1H7SA 4JI7E 2R42A 4DV0I 4DV2I 4AQYI 4JI1I 4FWGA 4KHPE 3ZZ0A 4IZJB 4NXNI 2HK2A 1UEKA 2E5LI 1XMQI 2Z5EA 4Z7YA 3J7AM 4FN5A 3WU6A 4GKKE 2DEIA 1XMOE 3B8HA 4JI6I 4DR4I 4YY3E 2NPFA 4JI4E 4LF8E 4LFCE 1Z0VA 2DEJA 4IZKA 4DPTA 1Z59A 3LTOA 3PYEA 1MG7A 2A2CA 1H74A 4HY1A 4YHHE 2BM0A 2Z5CA 1IBME 4OX9I 3QT5A 2UU9E 3F0NA 1A6FA 4X62E 4UT4A 4JI8I 2UXCI 2J7KA 4PU9A 4B3SI 2WW4A 2BM1A 1Z5CA 1Y4UA 4DUYE 2OI2A 2UUAI 1N0VC 3GONA 3K1JA 4DV6E 2V2QA 4DPYA 3T1YE 1KVKA 1XNRE 4DPXA 4JI5I 4LF5E 4DV7I 1N33I 4X64E 1IBLE 4DV5I 2VQEE 5LMNE 3J7AG 1EA6A 4DV1E 3J80Q 2UXBI 4WUCA 4JI3E 4DPUA 4XTJA 1Z0EA 4JI7I 1PKPA 2O1WA 2HHHE 4LF7E 1FI4A 2O1VA 1J5EE 4MYTA 1FJGE 3D4JA 4DU7A 3OTOE 2HKEA 2UUBI 4DXLA 4FW9A 1XMOI 2HKJA 4PRVA 4JYAE 4B3ME 4R1FA 2CGEA 4JI0E 1ZM3A 4LF8I 4DR6E 4WUDA 4DV3E 1PIEA 4HYMA 2UXDE 4DR5I 1QZRA 3T1HI 1N32E 2HK3A 1ZM9A 5LMUE 1K47A 1MU5A 4ED4A 2UU9I 1OJ4A 1NHHA 4WUBA 1HR0I 4LF4E 4HACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BR8 E;  1FNM A;  4USM A;  4GKJ E;  4DUY I;  3JAM Q;  4X65 I;  4DV6 I;  1N34 E;  1Z5A A;  5LL6 R;  3T1Y I;  3V2U C;  1NHJ A;  5A2Q Q;  1HNZ E;  3V5R A;  1XHK A;  4B3T I;  4LF6 I;  2BV3 A;  4X64 I;  1IBL I;  2HFU A;  5LMN I;  1NHI A;  4DV4 I;  1FKA E;  4JI3 I;  4NXM E;  2ZBK B;  1D6T A;  3CWV A;  4DUZ E;  1Z0G A;  3QT8 A;  4JV5 E;  4B3R E;  4FWH A;  1HNX I;  4DR7 I;  3ZZT A;  1I94 E;  5GMD A;  3Q1Q A;  1N36 E;  1H7U A;  4LFA I;  1EI1 A;  4Z7C A;  4URL A;  2E1R A;  3ZKD A;  4AQY E;  4JI1 E;  4KQV A;  4JI2 I;  5IWA I;  4JYA I;  1B62 A;  4B3M I;  2E5L E;  2ZM6 I;  4DV3 I;  4PRX A;  4LF9 E;  4P52 A;  2UUC I;  4K0K E;  2A2D A;  2HFS A;  2V2V A;  4DR2 I;  4X66 E;  1N32 I;  3PYD A;  1Z0B A;  1Z0C A;  1PVG A;  1VIS A;  4KHP I;  3J80 C;  3B82 A;  1U2R A;  5BR8 I;  4OX9 E;  1Z5B A;  2AJ4 A;  3H4L A;  1Z0T A;  2GS8 A;  3ZZU A;  5IT9 Q;  4P7A A;  4JI8 E;  5L3J A;  4GKK I;  2UXC E;  4B3S E;  4YY3 I;  4JI4 I;  4LFC I;  4MYU A;  4EMD A;  3J81 Q;  1DAR A;  4DR3 E;  1HNW E;  2VQF E;  4YHH I;  1RR9 A;  4DR1 E;  1IBM I;  4DUZ I;  4JI5 E;  4DV7 E;  5FLX Q;  4HAC B;  4JV5 I;  4DV5 E;  4X62 I;  1N0U A;  2EFG A;  2VF3 A;  1N36 I;  4LFB E;  1ELO A;  1ZM4 A;  3WU5 A;  1XNQ E;  5FLX C;  1IBK E;  2X36 A;  1XNR I;  4LF5 I;  1ZM2 A;  5GME A;  1KTV A;  3PYG A;  2VQE I;  1FWK A;  1S4E A;  4DV1 I;  2UUB E;  3JAM C;  2R3V A;  3M6A A;  4LF9 I;  2F4V E;  4K0K I;  1KKH A;  5A2Q C;  4FWD A;  4X66 I;  2V8P A;  4I3H A;  3QT7 A;  4ZVI A;  4RPF A;  2HHH I;  4LF7 I;  1J5E I;  1FJG I;  3QT6 A;  2LJP A;  3HUL A;  4DR5 E;  1Z0W A;  3T1H E;  2V2Z A;  3OTO I;  3LPS A;  1B63 A;  4DV0 E;  4DV2 E;  1ZXM A;  3K17 A;  3WU4 A;  1HR0 E;  4NXN E;  1H73 A;  4JI0 I;  4JG4 A;  4UTG A;  4DR6 I;  4X65 E;  1RRE A;  1XMQ E;  2UXD I;  4DR3 I;  1HNW I;  4JI6 E;  4DR4 E;  2VQF I;  4LF6 E;  3WU3 A;  4B3T E;  2X7I A;  4DR1 I;  2ZIT A;  1H72 C;  5LMU I;  3ZM7 A;  2XEX A;  4LF4 I;  4DV4 E;  4GKJ I;  4USK A;  4LFB I;  1HNX E;  1N34 I;  4DR7 E;  1XNQ I;  1WUU A;  1IBK I;  3B78 A;  1HNZ I;  1FWL A;  4M1K A;  4LFA E;  2UUA E;  4DPW A;  3ZKB A;  1BKN A;  5IT9 C;  1S16 A;  2Q2E B;  4NXM I;  1ZXN A;  2F4V I;  3PYF A;  4JI2 E;  1N33 E;  4HXZ A;  4B3R I;  5IWA E;  1MX0 A;  1NZ0 A;  3LNU A;  2V34 A;  1I94 I;  1KIJ A;  2ZM6 E;  2UXB E;  3J81 C;  2UUC E;  4DU8 A;  2CZ9 A;  4DR2 E;  1H7S A;  4JI7 E;  2R42 A;  4DV0 I;  4DV2 I;  4AQY I;  4JI1 I;  4FWG A;  4KHP E;  3ZZ0 A;  4NXN I;  2HK2 A;  1UEK A;  2E5L I;  1XMQ I;  4Z7Y A;  3J7A M;  4FN5 A;  3WU6 A;  4GKK E;  2DEI A;  1XMO E;  3B8H A;  4JI6 I;  4DR4 I;  4YY3 E;  2NPF A;  4JI4 E;  4LF8 E;  4LFC E;  1Z0V A;  2DEJ A;  4DPT A;  1Z59 A;  3LTO A;  3PYE A;  1MG7 A;  2A2C A;  1H74 A;  4HY1 A;  4YHH E;  2BM0 A;  1IBM E;  4OX9 I;  3QT5 A;  2UU9 E;  3F0N A;  1A6F A;  4X62 E;  4UT4 A;  4JI8 I;  2UXC I;  2J7K A;  4B3S I;  4PU9 A;  2WW4 A;  2BM1 A;  1Z5C A;  4DUY E;  2OI2 A;  2UUA I;  1N0V C;  3GON A;  3K1J A;  4DV6 E;  2V2Q A;  4DPY A;  3T1Y E;  1KVK A;  1XNR E;  4DPX A;  4JI5 I;  4LF5 E;  4DV7 I;  1N33 I;  4X64 E;  1IBL E;  4DV5 I;  2VQE E;  5LMN E;  3J7A G;  1EA6 A;  4DV1 E;  3J80 Q;  2UXB I;  4WUC A;  4JI3 E;  4DPU A;  4XTJ A;  1Z0E A;  4JI7 I;  1PKP A;  2HHH E;  4LF7 E;  1FI4 A;  1J5E E;  4MYT A;  1FJG E;  3D4J A;  4DU7 A;  3OTO E;  2HKE A;  2UUB I;  4DXL A;  4FW9 A;  1XMO I;  2HKJ A;  4PRV A;  4JYA E;  4B3M E;  4R1F A;  4JI0 E;  1ZM3 A;  4LF8 I;  4DR6 E;  4WUD A;  4DV3 E;  1PIE A;  4HYM A;  2UXD E;  4DR5 I;  1QZR A;  3T1H I;  1N32 E;  2HK3 A;  1ZM9 A;  5LMU E;  1K47 A;  1MU5 A;  4ED4 A;  2UU9 I;  1OJ4 A;  1NHH A;  4WUB A;  1HR0 I;  4LF4 E;  4HAC A; 
#chains in the Genus database with same CATH topology
 2PO2 A;  5BR8 E;  1FNM A;  4USM A;  4GKJ E;  2PO0 A;  4DUY I;  3JAM Q;  4X65 I;  2AE8 A;  4DV6 I;  5C0X E;  1Z5A A;  1N34 E;  5LL6 R;  3T1Y I;  3V2U C;  2JEB B;  5C0X C;  3DD6 A;  1NHJ A;  5A2Q Q;  1HNZ E;  3V5R A;  1XHK A;  4B3T I;  4LF6 I;  2BV3 A;  4BA1 A;  4FW5 A;  5C0X B;  4X64 I;  4IZJ D;  1IBL I;  4BA2 B;  2HFU A;  5LMN I;  3M7N D;  4LCF A;  1NHI A;  4LPF A;  4DV4 I;  1FKA E;  5DRQ A;  4JI3 I;  4NXM E;  2ZBK B;  2Z5B A;  3CWV A;  1D6T A;  4DUZ E;  4IZJ A;  2IER A;  2CG9 A;  1Z0G A;  3QT8 A;  4JV5 E;  4B3R E;  1RHY A;  4FWH A;  1HNX I;  4DR7 I;  3ZZT A;  5C0X D;  1I94 E;  5GMD A;  3Q1Q A;  1N36 E;  1H7U A;  3P3E A;  4LFA I;  1EI1 A;  4Z7C A;  4URL A;  4FW4 A;  1XXE A;  2E1R A;  3ZKD A;  4AQY E;  1HK7 A;  2NN6 E;  4JI1 E;  2WP8 A;  4KQV A;  4JI2 I;  2NN6 C;  5DNL A;  5IWA I;  4JYA I;  1B62 A;  4B3M I;  2E5L E;  2NN6 B;  2ZM6 I;  4DV3 I;  4FW6 A;  4PRX A;  4P52 A;  4LF9 E;  2UUC I;  2JEA B;  4IFD E;  4K0K E;  4IFD C;  2A2D A;  2HFS A;  4U3B A;  2V2V A;  4DR2 I;  4X66 E;  1N32 I;  3PYD A;  3CDJ A;  1USV A;  1USU A;  1PVG A;  1VIS A;  1Z0B A;  1Z0C A;  4IFD B;  3P76 A;  4KHP I;  2C37 B;  3J80 C;  3B82 A;  1U2R A;  2IOQ A;  5BR8 I;  4OX9 E;  1Z5B A;  2AJ4 A;  3H4L A;  2BA1 G;  1Z0T A;  2GS8 A;  3ZZU A;  2PNL A;  5IT9 Q;  2BR2 A;  4P7A A;  3PRY A;  4JI8 E;  4QNK A;  5L3J A;  4GKK I;  2UXC E;  4B3S E;  5DNX A;  4YY3 I;  3HKM A;  4JI4 I;  4LFC I;  4FW3 A;  4MYU A;  4EMD A;  3J81 Q;  1DAR A;  4MQY A;  2PNM A;  4DR3 E;  1HNW E;  4OO1 F;  2VQF E;  4YHH I;  1RR9 A;  4DR1 E;  1IBM I;  4DUZ I;  5JEA F;  5JEA A;  4JI5 E;  4DV7 E;  5FLX Q;  4HAC B;  4JV5 I;  4DV5 E;  1OYR A;  4X62 I;  1N0U A;  2EFG A;  2VF3 A;  1N36 I;  4OKG A;  4LFB E;  1ELO A;  1Y6Z A;  1UDS A;  1ZM4 A;  3P3C A;  5K36 A;  5K36 F;  3WU5 A;  1XNQ E;  2F1D A;  5FLX C;  4IZK B;  1IBK E;  2X36 A;  1XNR I;  3B4T A;  3K85 A;  4J3D A;  4LF5 I;  1ZM2 A;  2PO1 A;  1P42 A;  2C39 A;  1KTV A;  3PYG A;  5GME A;  2Z5C B;  2Z5B B;  3U1K A;  2VQE I;  1FWK A;  1S4E A;  4DV1 I;  2UUB E;  2WNR A;  3P06 A;  3JAM C;  2R3V A;  3M6A A;  2PNZ B;  4LF9 I;  2F4V E;  4K0K I;  1KKH A;  5A2Q C;  4FWD A;  4X66 I;  2V8P A;  4I3H A;  3Q6M A;  3QT7 A;  4ZVI A;  1Y60 A;  4RPF A;  2HHH I;  4LF7 I;  1J5E I;  1FJG I;  3QT6 A;  2LJP A;  3HUL A;  4DR5 E;  1Z0W A;  3T1H E;  5C0X A;  2BA0 D;  2V2Z A;  3OTO I;  3LPS A;  4BA2 A;  3M85 D;  1B63 A;  4DV0 E;  4LCH A;  2GQ0 A;  3UHM A;  4DV2 E;  1ZXM A;  3K17 A;  3WU4 A;  3GLL A;  4NBQ A;  4LCG A;  1HR0 E;  3Q6N A;  4NXN E;  3HJC A;  1R6L A;  1H73 A;  3GME A;  4JG4 A;  4JI0 I;  4UTG A;  3M7N G;  1Y4S A;  4DR6 I;  2IOP A;  1UDO A;  4X65 E;  1RRE A;  4QNJ A;  1XMQ E;  2UXD I;  1YH8 A;  4DR3 I;  1HNW I;  2O1T A;  4JI6 E;  4DR4 E;  2VQF I;  4LF6 E;  3WU3 A;  4B3T E;  2X7I A;  4DR1 I;  2ZIT A;  1H72 C;  5LMU I;  3ZM7 A;  2XEX A;  5EKW A;  4LF4 I;  2NN6 D;  2BR2 B;  3KRN A;  4AM3 A;  4DV4 E;  4GKJ I;  2O1U A;  4USK A;  4AID A;  2J65 A;  4LFB I;  4OO1 E;  1HNX E;  1N34 I;  3PS2 A;  4OO1 C;  4DR7 E;  1XNQ I;  4IFD D;  2JEA A;  5JEA E;  1WUU A;  1IBK I;  3B78 A;  5JEA C;  1HNZ I;  1FWL A;  1OYP A;  4M1K A;  4OO1 B;  4LFA E;  2UUA E;  1E3H A;  4IFD A;  3H1C A;  5JEA B;  4DPW A;  1YHC A;  3CDI A;  3ZKB A;  1BKN A;  5IT9 C;  1S16 A;  2JE6 B;  5K36 E;  2Q2E B;  4NXM I;  1ZXN A;  2F4V I;  5K36 C;  3PYF A;  4JI2 E;  1N33 E;  2PO2 B;  4HXZ A;  4B3R I;  5IWA E;  1MX0 A;  2PO0 B;  4OO1 D;  1NZ0 A;  1E3P A;  3LNU A;  2V34 A;  1I94 I;  5K36 B;  1KIJ A;  2CVE A;  4N3O A;  5DRR A;  3J81 C;  2ZM6 E;  3PS3 A;  2UXB E;  2UUC E;  1UDN A;  4DU8 A;  5FWK A;  2CZ9 A;  4DR2 E;  1H7S A;  4BA1 B;  4JI7 E;  2IES A;  2PO1 B;  2R42 A;  4DV0 I;  4DV2 I;  4AQY I;  2WNR B;  4MU3 A;  4JI1 I;  4FWG A;  4KHP E;  5DRP A;  3ZZ0 A;  2C38 A;  4IZJ B;  4NXN I;  3L7Z A;  4MDT A;  2HK2 A;  1UEK A;  2GO3 A;  2E5L I;  1XMQ I;  2Z5E A;  4Z7Y A;  3PS1 A;  4MU4 A;  3J7A M;  4FN5 A;  3WU6 A;  5DRO A;  4GKK E;  2O3Z A;  2DEI A;  1XMO E;  3B8H A;  4JI6 I;  4DR4 I;  4YY3 E;  2NPF A;  4JI4 E;  4LF8 E;  1R6M A;  4LFC E;  2JEB A;  1Z0V A;  2DEJ A;  4IZK A;  4DPT A;  1Z59 A;  3LTO A;  3PYE A;  1MG7 A;  2A2C A;  1H74 A;  4HY1 A;  5C0X F;  4YHH E;  2WP8 B;  2BM0 A;  2Z5C A;  1IBM E;  4OX9 I;  3QT5 A;  3NZK A;  2UU9 E;  3F0N A;  1A6F A;  2PNZ A;  4X62 E;  4UT4 A;  4JI8 I;  2UXC I;  2J7K A;  4PU9 A;  4B3S I;  2GO4 A;  2WW4 A;  4AIM A;  2BM1 A;  4MU0 A;  1Z5C A;  1Y4U A;  4DUY E;  2OI2 A;  2UUA I;  1N0V C;  3GON A;  3K1J A;  4DV6 E;  2V2Q A;  4DPY A;  3T1Y E;  1VI7 A;  2BA1 D;  1KVK A;  4U3D A;  1XNR E;  4DPX A;  4JI5 I;  4GQU A;  4LF5 E;  4DV7 I;  1N33 I;  4X64 E;  1IBL E;  4DV5 I;  2VQE E;  5ELW A;  5LMN E;  3J7A G;  1EA6 A;  4DV1 E;  3J80 Q;  2UXB I;  4WUC A;  4JI3 E;  2BA0 G;  4DPU A;  3M85 G;  4XTJ A;  3P3G A;  4MU1 A;  1Z0E A;  4JI7 I;  2NN6 F;  2NN6 A;  1Y5Y A;  1PKP A;  4LOM A;  2O1W A;  4IS9 A;  2HHH E;  4LF7 E;  1FI4 A;  4FW7 A;  2O1V A;  1J5E E;  4MYT A;  1FJG E;  3D4J A;  4DU7 A;  4IFD F;  4ISA A;  3OTO E;  2HKE A;  2UUB I;  4OZE A;  2C37 A;  4DXL A;  3GCM A;  4FW9 A;  1UDQ A;  2HKJ A;  1XMO I;  4PRV A;  4JYA E;  4B3M E;  4R1F A;  2CGE A;  4JI0 E;  1ZM3 A;  4LF8 I;  4DR6 E;  4WUD A;  4DV3 E;  1PIE A;  1OYS A;  5JEA D;  4HYM A;  2UXD E;  4DR5 I;  2VES A;  1QZR A;  4OO1 A;  3T1H I;  1N32 E;  2HK3 A;  1ZM9 A;  5EL9 A;  5LMU E;  2C39 B;  1K47 A;  1MU5 A;  2JT2 A;  3U1Y A;  2C38 B;  3L7Z B;  4ED4 A;  2UU9 I;  1OJ4 A;  1NHH A;  4WUB A;  2JE6 A;  5K36 D;  1HR0 I;  4LF4 E;  4HAC A; 
#chains in the Genus database with same CATH homology
 5BR8 E;  1FNM A;  4USM A;  4GKJ E;  4DUY I;  3JAM Q;  4X65 I;  4DV6 I;  1N34 E;  1Z5A A;  5LL6 R;  3T1Y I;  3V2U C;  1NHJ A;  5A2Q Q;  1HNZ E;  3V5R A;  1XHK A;  4B3T I;  4LF6 I;  2BV3 A;  4X64 I;  4IZJ D;  1IBL I;  2HFU A;  5LMN I;  1NHI A;  4DV4 I;  1FKA E;  4JI3 I;  4NXM E;  2ZBK B;  2Z5B A;  3CWV A;  1D6T A;  4DUZ E;  4IZJ A;  2CG9 A;  1Z0G A;  3QT8 A;  4JV5 E;  4B3R E;  4FWH A;  1HNX I;  4DR7 I;  3ZZT A;  1I94 E;  5GMD A;  3Q1Q A;  1N36 E;  1H7U A;  4LFA I;  1EI1 A;  4Z7C A;  4URL A;  2E1R A;  3ZKD A;  4AQY E;  1HK7 A;  4JI1 E;  4KQV A;  4JI2 I;  5IWA I;  4JYA I;  1B62 A;  4B3M I;  2E5L E;  2ZM6 I;  4DV3 I;  4PRX A;  4LF9 E;  4P52 A;  2UUC I;  4K0K E;  2A2D A;  2HFS A;  2V2V A;  4DR2 I;  4X66 E;  1N32 I;  3PYD A;  1USV A;  1USU A;  1PVG A;  1VIS A;  1Z0B A;  1Z0C A;  4KHP I;  3J80 C;  3B82 A;  1U2R A;  2IOQ A;  5BR8 I;  4OX9 E;  1Z5B A;  2AJ4 A;  3H4L A;  1Z0T A;  2GS8 A;  3ZZU A;  2PNL A;  5IT9 Q;  4P7A A;  3PRY A;  4JI8 E;  5L3J A;  4GKK I;  2UXC E;  4B3S E;  4YY3 I;  4JI4 I;  4LFC I;  4MYU A;  4EMD A;  3J81 Q;  1DAR A;  2PNM A;  4DR3 E;  1HNW E;  2VQF E;  4YHH I;  1RR9 A;  4DR1 E;  1IBM I;  4DUZ I;  4JI5 E;  4DV7 E;  5FLX Q;  4HAC B;  4JV5 I;  4DV5 E;  4X62 I;  1N0U A;  2EFG A;  2VF3 A;  1N36 I;  4LFB E;  1ELO A;  1Y6Z A;  1ZM4 A;  3WU5 A;  1XNQ E;  5FLX C;  4IZK B;  1IBK E;  2X36 A;  1XNR I;  3K85 A;  4LF5 I;  1ZM2 A;  5GME A;  1KTV A;  3PYG A;  2Z5C B;  2Z5B B;  2VQE I;  1FWK A;  1S4E A;  4DV1 I;  2UUB E;  3P06 A;  3JAM C;  2R3V A;  3M6A A;  4LF9 I;  2F4V E;  4K0K I;  1KKH A;  5A2Q C;  4FWD A;  4X66 I;  2V8P A;  4I3H A;  3Q6M A;  3QT7 A;  4ZVI A;  4RPF A;  2HHH I;  4LF7 I;  1J5E I;  1FJG I;  3QT6 A;  2LJP A;  3HUL A;  4DR5 E;  1Z0W A;  3T1H E;  2V2Z A;  3OTO I;  3LPS A;  1B63 A;  4DV0 E;  2GQ0 A;  4DV2 E;  1ZXM A;  3K17 A;  3WU4 A;  1HR0 E;  3Q6N A;  4NXN E;  3HJC A;  1H73 A;  4JI0 I;  4JG4 A;  4UTG A;  1Y4S A;  4DR6 I;  2IOP A;  4X65 E;  1RRE A;  1XMQ E;  2UXD I;  4DR3 I;  1HNW I;  2O1T A;  4JI6 E;  4DR4 E;  2VQF I;  4LF6 E;  3WU3 A;  4B3T E;  2X7I A;  4DR1 I;  2ZIT A;  1H72 C;  5LMU I;  3ZM7 A;  2XEX A;  4LF4 I;  4DV4 E;  4GKJ I;  2O1U A;  4USK A;  4LFB I;  1HNX E;  1N34 I;  4DR7 E;  1XNQ I;  1WUU A;  1IBK I;  3B78 A;  1HNZ I;  1FWL A;  4M1K A;  4LFA E;  2UUA E;  4DPW A;  3ZKB A;  1BKN A;  5IT9 C;  1S16 A;  2Q2E B;  4NXM I;  1ZXN A;  2F4V I;  3PYF A;  4JI2 E;  1N33 E;  4HXZ A;  4B3R I;  5IWA E;  1MX0 A;  1NZ0 A;  3LNU A;  2V34 A;  1I94 I;  1KIJ A;  4N3O A;  2ZM6 E;  3J81 C;  2UXB E;  2UUC E;  5FWK A;  4DU8 A;  2CZ9 A;  4DR2 E;  1H7S A;  4JI7 E;  2R42 A;  4DV0 I;  4DV2 I;  4AQY I;  4JI1 I;  4FWG A;  4KHP E;  3ZZ0 A;  4IZJ B;  4NXN I;  2HK2 A;  1UEK A;  2E5L I;  1XMQ I;  2Z5E A;  4Z7Y A;  3J7A M;  4FN5 A;  3WU6 A;  4GKK E;  2DEI A;  1XMO E;  3B8H A;  4JI6 I;  4DR4 I;  4YY3 E;  2NPF A;  4JI4 E;  4LF8 E;  4LFC E;  1Z0V A;  2DEJ A;  4IZK A;  4DPT A;  1Z59 A;  3LTO A;  3PYE A;  1MG7 A;  2A2C A;  1H74 A;  4HY1 A;  4YHH E;  2BM0 A;  2Z5C A;  1IBM E;  4OX9 I;  3QT5 A;  2UU9 E;  3F0N A;  1A6F A;  4X62 E;  4UT4 A;  4JI8 I;  2UXC I;  2J7K A;  4PU9 A;  4B3S I;  2WW4 A;  2BM1 A;  1Z5C A;  1Y4U A;  4DUY E;  2OI2 A;  2UUA I;  1N0V C;  3GON A;  3K1J A;  4DV6 E;  2V2Q A;  4DPY A;  3T1Y E;  1KVK A;  1XNR E;  4DPX A;  4JI5 I;  4LF5 E;  4DV7 I;  1N33 I;  4X64 E;  1IBL E;  4DV5 I;  2VQE E;  5LMN E;  3J7A G;  1EA6 A;  4DV1 E;  3J80 Q;  2UXB I;  4WUC A;  4JI3 E;  4DPU A;  4XTJ A;  1Z0E A;  4JI7 I;  1PKP A;  2O1W A;  2HHH E;  4LF7 E;  1FI4 A;  2O1V A;  1J5E E;  4MYT A;  1FJG E;  3D4J A;  4DU7 A;  3OTO E;  2HKE A;  2UUB I;  4DXL A;  4FW9 A;  1XMO I;  2HKJ A;  4PRV A;  4JYA E;  4B3M E;  4R1F A;  2CGE A;  4JI0 E;  1ZM3 A;  4LF8 I;  4DR6 E;  4WUD A;  4DV3 E;  1PIE A;  4HYM A;  2UXD E;  4DR5 I;  1QZR A;  3T1H I;  1N32 E;  2HK3 A;  1ZM9 A;  5LMU E;  1K47 A;  1MU5 A;  4ED4 A;  2UU9 I;  1OJ4 A;  1NHH A;  4WUB A;  1HR0 I;  4LF4 E;  4HAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...