4JI1M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
117
structure length
117
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome/antibiotic
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 32
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ji1M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4ji1M02
2VQEM 4DR1M 3U6OA 4LF8M 2OQ4A 3SATA 4DV5M 3SAUA 4DR4M 4YHHM 3J80S 1L1ZA 3GQ3A 1HNXM 2ZM6M 4CISA 3U6PA 1K3WA 4KHPM 1XNRM 4G4NA 3W0FA 5ITTA 4JI3M 3JR5A 4X65M 4GKJM 4GKKM 2VQFM 3TWLA 4G4RA 1PM5A 1N36M 5ITRA 2HKJA 4DV7M 3GPUA 3U6DA 1MU5A 2UUBM 3A45A 3A46A 3SARA 1L2DA 4YY3M 4DV0M 2UUCM 4DV2M 4NRWA 3SAWA 1IBLM 4JI0M 4PDGA 1FJGM 2UXBM 5ITYA 4MB7A 1PJIA 4OX9M 3U6LA 1XC8A 3U6CA 2XZFA 1EE8A 4DR3M 1I94M 1IBMM 1MX0A 1IBKM 3VK7A 4JV5M 3C58A 4JI4M 3U6QA 3TWKA 5IWAM 1XMQM 3VK8A 4DR6M 1K3XA 4PD2A 3DOAA 2F5PA 4NXMM 4X64M 4DV1M 5ITUA 1TDZA 3TWMA 1J5EM 3J81S 5ITQA 3A42A 4B3RM 2ZBKB 3T1YM 4LF5M 3GQ5A 5IT9S 4DR2M 2F5OA 1Q3CA 1Q39A 4JYAM 3GP1A 2OPFA 3U6SA 5ITXE 4B3TM 4G4QA 4X66M 4JI7M 4ITQA 1NNJA 1KFVA 4JI8M 2UU9M 1L2CA 2UXCM 4JI2M 2UUAM 3GPXA 2F5QA 4G4OA 4DUYM 4LF9M 4DV4M 1XNQM 3SAVA 1L2BA 1PJJA 4B3MM 4DUZM 3JAMS 1R2ZA 4B3SM 2XZUA 5FLXS 1Z5BA 4PDIA 2F5SA 4X62M 2HHHM 3GO8A 1K82A 1N33M 3SBJA 2F5NA 4NXNM 2F4VM 3GPYA 4LF4M 5A2QS 3GQ4A 3U6EA 4LF6M 3JR4A 4AQYM 1HNZM 4PCZA 1Q3BA 4NRVA 5ITXA 4DV3M 3GPPA 4LFCM 1Z5AA 4DR7M 1R2YA 1XMOM 1L1TA 2Q2EB 1HR0M 5BR8M 5LMNM 1Z59A 3T1HM 3U6MA 4LF7M 4DV6M 3OTOM 2UXDM 4JI6M 1N32M 3SASA 1Z5CA 1N34M 1TDHA 4DR5M 4LFAM 4JI1M 2E5LM 3J7AS 4LFBM 2EA0A 1HNWM 4JI5M 4K0KM 5LMUM
chains in the Genus database with same CATH superfamily
3U6OA 4LF8M 4UN2B 2HL7A 2OOAA 3SHGB 4DV5M 2ZAOA 3HHWA 3L26A 2Z7JA 2K47A 4YHHM 3GQ3A 2QCUA 2DAMA 2ZM6M 2VF8A 4FCWA 2X49A 4KHPM 5C1BA 4AG5A 5DNYA 5ITTA 3Q8XA 3GLIB 2CHVA 2O01F 2L7IA 4JI3M 4X65M 2DWMA 3H4MA 4NL4H 1TGUA 2D7EA 2JP7A 1OFIA 4G4RA 1PM5A 1QVRA 1I4WA 2L4EA 2Z8YM 2DXIA 2HKJA 3HZJA 1DGHA 3TPZA 1D0MA 1V34A 3LMMA 8CATA 3AJIB 1QDRA 2CHQA 3NBXX 4G3OA 4I81A 3A46A 3KXEC 2J7OA 1L2DA 3DFZA 2RKOA 3KOYE 2CE7A 4YY3M 4DV2M 2BWEA 1IBLM 1WIVA 4BB9A 4GMQA 3UMMA 1G59A 1FJGM 4MB7A 1ZMUA 1TH3A 2LBCA 1PJIA 1IXSB 3CF6E 2BWBA 1XC8A 1MN3A 3U5ZA 1I94M 3KVWA 1DGFA 2QSFX 2V1UA 3NBIA 1MX0A 1QAOA 3U60A 1L8QA 3SMSA 3U6QA 2FH0A 1IXZA 2FOIC 5IWAM 4GITA 2LTUA 3B9PA 3SMPA 4DR6M 5JI2E 1K3XA 1OIPA 2R6FA 2R44A 2JZ0A 2L7HA 2DHYA 2LXEA 2EJSA 3A42A 3K9PA 4M0WA 2Z3XA 3T1YM 2RRUA 2HCBA 1Y8GA 3FTCA 4LY6A 4OW0A 2YNMD 5DFLA 5L8RF 2K9DA 1OTRA 1NY6A 1E9RA 4LRSA 3AOGA 3GP1A 3LQQA 2OPFA 2M60A 2XSZD 3U5ZB 2R45A 4I8OA 2DWNA 2BJWA 1SXJA 4G4QA 4ITQA 1NHWC 3T6PA 5EQTA 4JI8M 1T3TA 4TUWA 1QUSA 1PJQA 3B7QA 3FE3A 4JI2M 3B89A 4DUYM 4KODA 1NV9A 1OKSA 2Y21A 3THGA 2QHOB 3GLHA 2JY7A 4Y28F 3SFZA 3JAMS 2KZSA 4F2LA 4D81A 1R2ZA 4B3SM 3BBZA 2DAGA 2XZUA 2X4AA 2Z4SA 3SC3A 5FLXS 2F5SA 4MM3B 1D0KA 1NVMA 3KDSE 2EKKA 4LGMA 1VEJA 4GRIA 4NXNM 4B7GA 3K8ZA 2LH0A 7CATA 4LF6M 3LCUA 4AQYM 4QNMA 1Q3BA 4PCZA 2MGWA 2LNHC 3AL0C 3UGJA 4AI6A 1R2YA 1OFHA 1L1TA 4F1IA 4GEWA 5LMNM 1GABA 1Z59A 2N35A 2XSZA 1WR1B 4GC5A 3W67A 3SYLA 2CV2A 1C7YA 1GL7A 3M7GA 3HHYA 1BVSA 2C9OA 5JI3E 4DR5M 1QZEA 4L4UA 4LJ9A 4LG2A 1T43A 2WSEF 1QDTA 3J7AS 3NWLA 2EA0A 3ILKA 2JY6B 4JI5M 2G3QA 1UM8A 4IJEA 3HKPA 1JB0F 2VQEM 2K6BA 1RU3A 1XWIA 3UZUA 2OQ4A 3SATA 3FTFA 5BPVA 4XGIA 3WHLA 4HLQA 1IN4A 2KEBA 3LW5F 2OO9A 4Q7JA 1S3SA 1VG5A 1HJPA 1NJGA 1XNRM 4LJ7A 4D80A 5H37D 4NC6A 1SXJD 3W0FA 1SG9A 4XK8F 4FCTA 3D8LA 1YUBA 4L15A 3DA1A 1ZMVA 1N36M 1G3IA 2CFOA 5KPZA 5C18A 4DV7M 2LHGA 2VF7A 3U6DA 2OOBA 3VKGA 1MU5A 1ZQ9A 4P17A 2X8AA 2QQ8A 2UUBM 5FSWA 4OVZA 4R3DA 2C9CA 1GVNA 4NSOB 2UUCM 4MH0E 3SAWA 1GJTA 4JI0M 4XBOA 4PDGA 2L6OA 3KSXA 4MGZE 1LTMA 5ITYA 1SXJE 4S12A 3GLGB 3Q8GA 4AZFA 4ZPXA 4L8RC 2CEAA 1JR3D 2K0BX 1JR3A 2YR0A 2BJVA 2EKFA 4QNRA 3AV0A 4EIWA 2D7HA 1NHGC 1QAMA 3AKZA 1GL6A 1IBKM 4JV5M 3V76A 4RNAA 1YE9A 2YFQA 2KRKA 5EXPA 3HJQA 4CGYB 1ZMWA 3GRUA 2KZUA 2DHRA 4I5SA 4AW4A 3KFUG 2JY5A 4X64M 4DV1M 3TWMA 2CRUA 4LJAA 4NSRA 3J81S 1TTEA 3HU1A 2RGHA 1EFUB 2L09A 3R8FA 3GQ5A 2R4JA 2F5OA 2CHGA 3GLFE 1Q39A 4JYAM 3GRYA 3FTDA 2R4EA 3KP1E 1QAQA 1HQCA 3MJ5A 3RE8A 5EXSA 5E6JA 3I01M 2GQFA 4LJ4A 5GKNA 3ZC7B 1KFVA 4RKUF 3B7NA 5EP1A 2DAKA 2NQ8C 2UUAM 1XXHB 1D2NA 3MHVC 4OVZB 1XNQM 2JUJA 4FWGA 1IY2A 2DNAA 3U61B 1KSFX 1NSFA 1SXJB 2CP8A 4MGHA 4R7GA 3FUXA 4IBGA 2V1CA 5EJCA 4CIZA 1CUKA 3GLGA 2ZANA 4B7FA 3CF0A 2DAIA 2LWXA 4IBKA 4M9SA 3L28A 4A3VB 1JR3E 1N33M 2JWSA 3SBJA 3H4JA 1V33A 2F4VM 3GPYA 1TF0B 1OIZA 2ERCA 1WGLA 3E9SA 2H1RA 2LVNC 3FUTA 3MK6A 1KYIA 4FWHA 2R65A 2VDBB 5IZ7D 1G8PA 4DV3M 1Z5AA 4RF1A 2CWBA 4FVMA 4PT5A 3HWSA 2XLJA 3T1HM 1DO0A 4R71A 4DV6M 1J7KA 3AOEA 1VQ1A 3FUVA 2KNVA 3L27A 1Z5CA 1NJFA 1QANA 4LCBA 2Z4RA 1VDDA 3EIEA 4LGYA 2B3TA 1IY0A 3WHKA 1PGYA 3HHXA 4JN6A 1IXRC 1DGGA 2O25A 3FYCA 4GHLA 1H6UA 3QWLA 4K0KM 1LV7A 1NY5A 2FE8A 3ZQJA 4DR1M 1F4IA 1E9SA 3FRHA 4LJ8A 1X37A 4IBDA 1WGNA 3F92A 2C99A 1VEGA 1L1ZA 3U6PA 4G6ZA 3GRVA 2KA6B 4KLNA 4G4NA 3PVSA 2G8LA 3MMPA 1R4GA 1TH4A 2I7PA 3I4YA 4CHTB 4GKKM 3GLIE 3TWLA 3AFHA 3D8BA 3FUWA 4I4LA 3W68A 2LVPC 1QYRA 5KO3A 5ITRA 3L2AA 5KQDA 3PNYA 1MJGM 2WSCF 4IIWA 3PNVA 3SARA 3M6AA 2CV1A 4LZZA 4IJFA 4FD2A 4NRWA 3B74A 3BXWA 2UXBM 1GKIA 2RGOA 3KSJA 3KOWE 4JXJA 3DZDA 2LVOC 2QENA 2LVAA 2JXNA 2Y20A 2EUCA 3K2LA 4M0DA 4OX9M 4Z8XA 3U6CA 4DR3M 2XZFA 1IBMM 1Z6TA 4NOOB 2G5GX 2D7GA 4QHTA 4QOSA 1E94E 1N77A 2BNKA 2J5YA 2P5TA 2L2DA 4QHSA 2FNAA 3FRIA 3C58A 2DWZB 3TWKA 5F3WA 1XMQM 2JZ1A 1IN6A 2MROB 1C1KA 1WHCA 3UJNA 4PD2A 4HEOA 2CUZA 4IBJA 3GLGE 1OAIA 4WW0A 1TDZA 2GNOA 3ZCBB 3FTEA 2V6ZM 3AOEC 4B3RM 2ZBKB 3HY5A 3KOZE 4LF5M 3A98B 4DR2M 3B7ZA 4II7A 1Q3CA 3IG8A 3C3EA 1WXQA 4WURA 5FTJA 4B7HA 5EXXA 4B3TM 3RFWA 2FFJA 2CV0A 4JI7M 4REZA 2KDLA 1QZMA 5KPRA 3K9OA 1L2CA 1D0LA 1R6BX 2UXCM 3GPXA 2QBYA 3C3DA 3GLFA 2F5QA 1N78A 2VIIA 1XXHE 2WZJA 4DV4M 2QPAA 3J7BA 3SAVA 1VEKA 1PJJA 2KNZA 3BOSA 4DUZM 1W5TA 2KNAA 2KXEA 3QAUA 4LJ5A 3UK6A 1Z5BA 2HAKA 5FTKA 4PDIA 2HHHM 3TQSA 4RF0A 1DGBA 3HU2A 3HX3A 2R62A 4IBEA 1XXHA 3U60B 3E46A 1PJSA 4BLCA 5A2QS 4LF4M 2O5RA 3U6EA 3I04M 1AUAA 2XEPA 3JR4A 3CGWA 3FYDA 5EP3A 2R0IA 2DZOB 4LFCM 3J2PB 4D82A 4Z6YA 4DR7M 2QBYB 1FNNA 2Q2EB 1IFYA 5BR8M 1YLAA 2FS1A 3U6MA 4LF7M 1R7RA 1IN7A 2DENA 4JI6M 1N32M 5KPTA 1AIPC 1R5LA 1TDHA 3VKHA 3KS8A 4MGYE 2DI0A 2DZNB 1GLNA 4FW9A 1OJLA 3IHPA 1A5TA 5LMUM 3HHZA 4IBIA 5FTLA 3SAUA 1YSYA 4DR4M 3J80S 2C96A 1HNXM 3L29A 4CISA 4W5WA 1K3WA 1DO2A 1OQYA 1NNUC 3K92A 3JR5A 4GKJM 3GRRA 3EIHA 2C98A 3LVVA 5KQ8A 2VQFM 3W0LB 2KW0A 1TH2A 4L6V6 2XFSA 3HJ8A 1GO5A 5DYGA 1DV0A 4IBFA 1SXJC 3GPUA 3J27B 1XB2B 1ZAEA 5E26A 2KHHA 4CJ6A 1QUTA 3A45A 3FKEA 2APLA 3C9PA 2JY8A 2I7NA 3GLIA 2H5XA 4DV0M 2EO2A 2QZ4A 3LVWA 2Y0QA 2DAEA 2MJ5B 1T6OA 3KP0E 3LCVB 3U6LA 2AHMA 2DZLA 1IY1A 2DKLA 2DWLA 1DGHB 1GJSA 3IECA 2QP9X 1N75A 4HL4A 3GLHB 2KRUA 2Y0TA 3RGPA 3VK7A 4P16A 4AKGA 3K1JA 1HT2E 2ZTCA 2YQZA 4JI4M 1Q02A 2HWJA 4FCVA 2MR9A 3IG5A 1ZV1A 3CTWB 3M0EA 3VK8A 2C5RA 2LVQD 4B08A 1IXSA 2W82A 3DOAA 4L78A 2F5PA 4NXMM 3FUUA 4LZJA 3U61A 5ITUA 1PRBA 1TR8A 3KW6A 3VDPA 1J5EM 3VLFB 3LQRA 1G4AE 5ITQA 3GLHE 3SYKA 3GLFB 4WP2A 1J09A 1E32A 1V92A 5EXTA 5IT9S 3E4RA 1HQYE 4IBBA 1IN8A 5EP2A 1OAOC 3U6SA 1XHBA 5DYIA 2ZAMA 5ITXE 3KOXE 4OU7A 4X66M 1NNJA 2MH8A 3VDUA 3T38A 2XGNA 2UU9M 3ZH9B 1HT1E 4GC9A 2J7NA 4M9ZA 4G4OA 3T15A 4M9XA 2ZTDA 3HJSA 4LF9M 4BBAA 4GIPA 2L4FA 1PJTA 1L2BA 1JQJC 4KT0F 4LRTA 2XFTA 4GHAA 3TE6A 3QYBA 3TL4X 3PFIA 2DVWB 4B3MM 1IM2A 5EP4A 2XH9A 4MGKE 4ANRA 4AKIA 2QNJA 5FTMA 4FWDA 3PXGA 4AKHA 2JNHA 4X62M 3L25A 3GO8A 3RGSA 3R9XB 2R18A 4IBCA 2JA2A 1K82A 2F5NA 1IQPA 1UFZA 3GQ4A 3I51A 4AG6A 3QYEA 3VFDA 3HU3A 1HNZM 1G71A 1QQWA 2M5ZA 3SHFA 4L16A 4NRVA 5ITXA 3GPPA 2A5YB 1W5SA 2R46A 3CF2A 1VDLA 4LJ6A 1XMOM 1HR0M 1WJ7A 2LHCA 1G41A 4GH9A 5FTNA 2WSFF 3OTOM 2UXDM 1NV8A 1ORYB 3FD9A 3SASA 1N34M 3I4VA 1IN5A 3KS4A 3E21A 4LFAM 1EIJA 3HGIA 4JI1M 2E5LM 4DBGB 4LFBM 2XF3A 1HNWM 1P3QQ 5IREB 1NO1A 4KO8A 4MGIE 4QOZC 1EE8A
chains in the Genus database with same CATH topology
3U6OA 4LF8M 2HL7A 3SHGB 4DV5M 2ZAOA 3HHWA 3L26A 2Z7JA 2K47A 4YHHM 3GQ3A 2QCUA 2ZM6M 4FCWA 2X49A 4KHPM 5C1BA 4AG5A 5DNYA 5ITTA 3Q8XA 3GLIB 2CHVA 2L7IA 4JI3M 4X65M 2DWMA 3H4MA 4NL4H 1TGUA 2D7EA 4G4RA 1OFIA 1PM5A 1QVRA 1I4WA 2DXIA 2HKJA 3TPZA 1DGHA 3LMMA 8CATA 3AJIB 4I81A 2CHQA 3A46A 3KXEC 2J7OA 1L2DA 3DFZA 2RKOA 3KOYE 2CE7A 4YY3M 4DV2M 1IBLM 1FJGM 4BB9A 4GMQA 3UMMA 1G59A 4MB7A 1PJIA 1TH3A 1IXSB 3CF6E 1XC8A 3U5ZA 1I94M 3KVWA 1DGFA 2V1UA 3NBIA 1QAOA 1MX0A 3U60A 1L8QA 3SMSA 3U6QA 1IXZA 2FOIC 5IWAM 4GITA 3B9PA 3SMPA 4DR6M 5JI2E 1K3XA 2L7HA 2LXEA 3A42A 4M0WA 2Z3XA 3T1YM 2HCBA 4LY6A 3FTCA 4OW0A 2YNMD 1NY6A 1E9RA 4LRSA 3AOGA 3GP1A 3LQQA 2OPFA 2M60A 2XSZD 3U5ZB 2R45A 4I8OA 2DWNA 2BJWA 1SXJA 4G4QA 4ITQA 1NHWC 5EQTA 4JI8M 1T3TA 4TUWA 4JI2M 4DUYM 4KODA 3THGA 2Y21A 3GLHA 3SFZA 3JAMS 2KZSA 4D81A 1R2ZA 4B3SM 2XZUA 2X4AA 2Z4SA 3SC3A 5FLXS 2F5SA 4MM3B 1NVMA 3KDSE 4LGMA 4GRIA 4NXNM 4B7GA 3K8ZA 2LH0A 7CATA 4LF6M 4AQYM 4QNMA 1Q3BA 4PCZA 2LNHC 3AL0C 3UGJA 4AI6A 1R2YA 1OFHA 1L1TA 5LMNM 1Z59A 2XSZA 4GC5A 3SYLA 2CV2A 1GL7A 3M7GA 3HHYA 5JI3E 2C9OA 4DR5M 4L4UA 4LJ9A 4LG2A 3J7AS 3NWLA 2EA0A 3ILKA 4JI5M 1UM8A 4IJEA 3HKPA 2VQEM 1XWIA 3UZUA 2OQ4A 3SATA 3FTFA 5BPVA 4XGIA 3WHLA 4HLQA 1IN4A 2KEBA 1S3SA 1NJGA 1XNRM 4LJ7A 4D80A 5H37D 1SXJD 3W0FA 4FCTA 3D8LA 1YUBA 4L15A 3DA1A 1N36M 1G3IA 2CFOA 5KPZA 5C18A 4DV7M 3U6DA 3VKGA 1MU5A 1ZQ9A 2X8AA 2UUBM 5FSWA 4OVZA 4R3DA 2C9CA 1GVNA 4NSOB 2UUCM 4MH0E 3SAWA 4JI0M 4XBOA 4PDGA 2L6OA 3KSXA 4MGZE 5ITYA 1SXJE 4S12A 3GLGB 4AZFA 4ZPXA 4L8RC 2CEAA 1JR3D 2YR0A 1JR3A 2BJVA 4QNRA 3AV0A 4EIWA 2D7HA 1NHGC 1QAMA 3AKZA 1GL6A 1IBKM 4JV5M 4RNAA 1YE9A 2YFQA 2KRKA 5EXPA 3HJQA 4CGYB 3GRUA 2KZUA 2DHRA 4I5SA 4AW4A 3KFUG 4X64M 4DV1M 3TWMA 4LJAA 4NSRA 3J81S 3HU1A 2RGHA 2L09A 3R8FA 3GQ5A 2R4JA 2F5OA 2CHGA 1Q39A 4JYAM 3GRYA 3FTDA 2R4EA 3KP1E 1QAQA 1HQCA 3MJ5A 3RE8A 5EXSA 5E6JA 5GKNA 4LJ4A 1KFVA 3ZC7B 5EP1A 2NQ8C 2UUAM 1XXHB 1D2NA 3MHVC 4OVZB 1XNQM 4FWGA 1IY2A 3U61B 1KSFX 1NSFA 1SXJB 4MGHA 4R7GA 3FUXA 4IBGA 2V1CA 5EJCA 3GLGA 2ZANA 4B7FA 3CF0A 2LWXA 4M9SA 4IBKA 4A3VB 3L28A 1N33M 3SBJA 2F4VM 3GPYA 2ERCA 3FUTA 3E9SA 2H1RA 3MK6A 1KYIA 4FWHA 2R65A 5IZ7D 1G8PA 4DV3M 1Z5AA 4RF1A 4FVMA 4PT5A 3HWSA 2XLJA 3T1HM 1DO0A 4DV6M 1J7KA 3AOEA 3FUVA 3L27A 1Z5CA 1NJFA 1QANA 4LCBA 2Z4RA 1VDDA 3EIEA 4LGYA 1IY0A 3WHKA 4JN6A 3HHXA 1IXRC 1DGGA 3FYCA 4GHLA 3QWLA 1H6UA 4K0KM 1LV7A 1NY5A 2FE8A 4DR1M 1E9SA 4LJ8A 1X37A 4IBDA 2C99A 1L1ZA 3U6PA 4G6ZA 3GRVA 2KA6B 4KLNA 4G4NA 3PVSA 2G8LA 1TH4A 2I7PA 3I4YA 4CHTB 4GKKM 3TWLA 3AFHA 3D8BA 3FUWA 4I4LA 1QYRA 5KO3A 5ITRA 3L2AA 5KQDA 3PNYA 4IIWA 3PNVA 3SARA 3M6AA 2CV1A 4LZZA 4IJFA 4FD2A 4NRWA 2UXBM 1GKIA 2RGOA 3KSJA 3KOWE 4JXJA 3DZDA 2QENA 4OX9M 2Y20A 2EUCA 3K2LA 4M0DA 4Z8XA 3U6CA 4DR3M 2XZFA 1IBMM 1Z6TA 4NOOB 2G5GX 2D7GA 4QHTA 4QOSA 1E94E 1N77A 2BNKA 2P5TA 4QHSA 2FNAA 3C58A 2DWZB 3TWKA 5F3WA 1XMQM 1IN6A 1C1KA 3UJNA 4PD2A 4IBJA 2CUZA 4WW0A 1TDZA 3ZCBB 3FTEA 2V6ZM 3AOEC 4B3RM 2ZBKB 4LF5M 3KOZE 3A98B 4DR2M 4II7A 1Q3CA 3IG8A 1WXQA 4WURA 5FTJA 4B7HA 5EXXA 4B3TM 3RFWA 2FFJA 2CV0A 4JI7M 4REZA 1QZMA 5KPRA 1L2CA 1R6BX 2UXCM 3GPXA 2QBYA 3GLFA 2F5QA 1N78A 2VIIA 4DV4M 2QPAA 3J7BA 3SAVA 1PJJA 3BOSA 4DUZM 1W5TA 2KXEA 3QAUA 4LJ5A 3UK6A 1Z5BA 5FTKA 4PDIA 2HHHM 3TQSA 4RF0A 1DGBA 3HU2A 2R62A 4IBEA 1XXHA 3U60B 4BLCA 5A2QS 4LF4M 2O5RA 3U6EA 2XEPA 3JR4A 3FYDA 5EP3A 2DZOB 4LFCM 3J2PB 4D82A 4Z6YA 4DR7M 2QBYB 1FNNA 2Q2EB 5BR8M 4LF7M 3U6MA 1R7RA 1IN7A 4JI6M 1N32M 5KPTA 1TDHA 3VKHA 3KS8A 4MGYE 2DZNB 1GLNA 4FW9A 1OJLA 5LMUM 3HHZA 4IBIA 5FTLA 3SAUA 1YSYA 4DR4M 3J80S 2C96A 1HNXM 3L29A 4CISA 4W5WA 1K3WA 1DO2A 1NNUC 3K92A 3JR5A 4GKJM 3GRRA 3EIHA 2C98A 3LVVA 5KQ8A 2VQFM 3W0LB 2KW0A 1TH2A 2XFSA 3HJ8A 5DYGA 4IBFA 1SXJC 3GPUA 3J27B 1ZAEA 5E26A 3A45A 3FKEA 3GLIA 2I7NA 4DV0M 2EO2A 2QZ4A 3LVWA 2Y0QA 3KP0E 3U6LA 2AHMA 1IY1A 2DWLA 1DGHB 2QP9X 1N75A 4HL4A 3GLHB 2KRUA 2Y0TA 3RGPA 3VK7A 4P16A 4AKGA 3K1JA 1HT2E 2YQZA 4JI4M 4FCVA 3IG5A 3CTWB 3M0EA 3VK8A 2C5RA 4B08A 4L78A 2W82A 3DOAA 2F5PA 4NXMM 3FUUA 4LZJA 3U61A 5ITUA 3KW6A 3VDPA 1J5EM 3VLFB 3LQRA 1G4AE 5ITQA 3SYKA 3GLFB 1J09A 1E32A 5EXTA 5IT9S 3E4RA 1HQYE 4IBBA 1IN8A 5EP2A 3U6SA 1XHBA 5DYIA 2ZAMA 5ITXE 3KOXE 4OU7A 4X66M 1NNJA 3VDUA 3T38A 2XGNA 2UU9M 3ZH9B 1HT1E 4GC9A 2J7NA 4M9ZA 4G4OA 3T15A 4M9XA 4LF9M 3HJSA 4BBAA 4GIPA 1L2BA 1JQJC 4LRTA 2XFTA 4GHAA 3TE6A 3TL4X 3PFIA 2DVWB 4B3MM 1IM2A 5EP4A 2XH9A 4MGKE 4AKIA 5FTMA 4FWDA 3PXGA 4AKHA 4X62M 3L25A 3GO8A 3RGSA 3R9XB 2R18A 4IBCA 2JA2A 1K82A 2F5NA 1IQPA 3GQ4A 3I51A 4AG6A 3VFDA 3HU3A 1HNZM 1QQWA 2M5ZA 3SHFA 4L16A 4NRVA 5ITXA 3GPPA 2A5YB 1W5SA 2R46A 3CF2A 4LJ6A 1XMOM 1HR0M 1G41A 4GH9A 5FTNA 3OTOM 2UXDM 1ORYB 3FD9A 3SASA 1N34M 3I4VA 1IN5A 3KS4A 4LFAM 3HGIA 4JI1M 2E5LM 4LFBM 2XF3A 1HNWM 5IREB 4MGIE 4KO8A 4QOZC 1EE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQE M;  4DR1 M;  3U6O A;  4LF8 M;  2OQ4 A;  3SAT A;  4DV5 M;  3SAU A;  4DR4 M;  4YHH M;  3J80 S;  1L1Z A;  3GQ3 A;  1HNX M;  2ZM6 M;  4CIS A;  3U6P A;  1K3W A;  4KHP M;  1XNR M;  4G4N A;  3W0F A;  5ITT A;  4JI3 M;  3JR5 A;  4X65 M;  4GKJ M;  4GKK M;  2VQF M;  3TWL A;  4G4R A;  1PM5 A;  1N36 M;  5ITR A;  2HKJ A;  4DV7 M;  3GPU A;  3U6D A;  1MU5 A;  2UUB M;  3A45 A;  3A46 A;  3SAR A;  1L2D A;  4YY3 M;  4DV0 M;  2UUC M;  4DV2 M;  4NRW A;  3SAW A;  1IBL M;  4JI0 M;  4PDG A;  1FJG M;  2UXB M;  5ITY A;  4MB7 A;  1PJI A;  4OX9 M;  3U6L A;  1XC8 A;  3U6C A;  2XZF A;  1EE8 A;  4DR3 M;  1I94 M;  1IBM M;  1MX0 A;  1IBK M;  3VK7 A;  4JV5 M;  3C58 A;  4JI4 M;  3U6Q A;  3TWK A;  5IWA M;  1XMQ M;  3VK8 A;  4DR6 M;  1K3X A;  4PD2 A;  3DOA A;  2F5P A;  4NXM M;  4X64 M;  4DV1 M;  5ITU A;  1TDZ A;  3TWM A;  1J5E M;  3J81 S;  5ITQ A;  3A42 A;  4B3R M;  2ZBK B;  3T1Y M;  4LF5 M;  3GQ5 A;  5IT9 S;  4DR2 M;  2F5O A;  1Q3C A;  1Q39 A;  4JYA M;  3GP1 A;  2OPF A;  3U6S A;  5ITX E;  4B3T M;  4G4Q A;  4X66 M;  4JI7 M;  4ITQ A;  1NNJ A;  1KFV A;  4JI8 M;  2UU9 M;  1L2C A;  2UXC M;  4JI2 M;  2UUA M;  3GPX A;  2F5Q A;  4G4O A;  4DUY M;  4LF9 M;  4DV4 M;  1XNQ M;  3SAV A;  1L2B A;  1PJJ A;  4B3M M;  4DUZ M;  3JAM S;  1R2Z A;  4B3S M;  2XZU A;  5FLX S;  1Z5B A;  4PDI A;  2F5S A;  4X62 M;  2HHH M;  3GO8 A;  1K82 A;  1N33 M;  3SBJ A;  2F5N A;  4NXN M;  2F4V M;  3GPY A;  4LF4 M;  5A2Q S;  3GQ4 A;  3U6E A;  4LF6 M;  3JR4 A;  4AQY M;  1HNZ M;  4PCZ A;  1Q3B A;  4NRV A;  5ITX A;  4DV3 M;  3GPP A;  4LFC M;  1Z5A A;  4DR7 M;  1R2Y A;  1XMO M;  1L1T A;  2Q2E B;  1HR0 M;  5BR8 M;  5LMN M;  1Z59 A;  3T1H M;  3U6M A;  4LF7 M;  4DV6 M;  3OTO M;  2UXD M;  4JI6 M;  1N32 M;  3SAS A;  1Z5C A;  1N34 M;  1TDH A;  4DR5 M;  4LFA M;  4JI1 M;  2E5L M;  3J7A S;  4LFB M;  2EA0 A;  1HNW M;  4JI5 M;  4K0K M;  5LMU M; 
#chains in the Genus database with same CATH topology
 3U6O A;  4LF8 M;  4UN2 B;  2HL7 A;  2OOA A;  3SHG B;  4DV5 M;  2ZAO A;  3HHW A;  3L26 A;  2Z7J A;  2K47 A;  4YHH M;  3GQ3 A;  2QCU A;  2DAM A;  2ZM6 M;  2VF8 A;  4FCW A;  2X49 A;  4KHP M;  5C1B A;  4AG5 A;  5DNY A;  5ITT A;  3Q8X A;  3GLI B;  2CHV A;  2O01 F;  2L7I A;  4JI3 M;  4X65 M;  2DWM A;  3H4M A;  4NL4 H;  1TGU A;  2D7E A;  2JP7 A;  1OFI A;  4G4R A;  1PM5 A;  1QVR A;  1I4W A;  2L4E A;  2Z8Y M;  2DXI A;  2HKJ A;  3HZJ A;  1DGH A;  3TPZ A;  1D0M A;  1V34 A;  3LMM A;  8CAT A;  3AJI B;  1QDR A;  2CHQ A;  3NBX X;  4G3O A;  4I81 A;  3A46 A;  3KXE C;  2J7O A;  1L2D A;  3DFZ A;  2RKO A;  3KOY E;  2CE7 A;  4YY3 M;  4DV2 M;  2BWE A;  1IBL M;  1WIV A;  4BB9 A;  4GMQ A;  3UMM A;  1G59 A;  1FJG M;  4MB7 A;  1ZMU A;  1TH3 A;  2LBC A;  1PJI A;  1IXS B;  3CF6 E;  2BWB A;  1XC8 A;  1MN3 A;  3U5Z A;  1I94 M;  3KVW A;  1DGF A;  2QSF X;  2V1U A;  3NBI A;  1MX0 A;  1QAO A;  3U60 A;  1L8Q A;  3SMS A;  3U6Q A;  2FH0 A;  1IXZ A;  2FOI C;  5IWA M;  4GIT A;  2LTU A;  3B9P A;  3SMP A;  4DR6 M;  5JI2 E;  1K3X A;  1OIP A;  2R6F A;  2R44 A;  2JZ0 A;  2L7H A;  2DHY A;  2LXE A;  2EJS A;  3A42 A;  3K9P A;  4M0W A;  2Z3X A;  3T1Y M;  2RRU A;  2HCB A;  1Y8G A;  3FTC A;  4LY6 A;  4OW0 A;  2YNM D;  5DFL A;  5L8R F;  2K9D A;  1OTR A;  1NY6 A;  1E9R A;  4LRS A;  3AOG A;  3GP1 A;  3LQQ A;  2OPF A;  2M60 A;  2XSZ D;  3U5Z B;  2R45 A;  4I8O A;  2DWN A;  2BJW A;  1SXJ A;  4G4Q A;  4ITQ A;  1NHW C;  3T6P A;  5EQT A;  4JI8 M;  1T3T A;  4TUW A;  1QUS A;  1PJQ A;  3B7Q A;  3FE3 A;  4JI2 M;  3B89 A;  4DUY M;  4KOD A;  1NV9 A;  1OKS A;  2Y21 A;  3THG A;  2QHO B;  3GLH A;  2JY7 A;  4Y28 F;  3SFZ A;  3JAM S;  2KZS A;  4F2L A;  4D81 A;  1R2Z A;  4B3S M;  3BBZ A;  2DAG A;  2XZU A;  2X4A A;  2Z4S A;  3SC3 A;  5FLX S;  2F5S A;  4MM3 B;  1D0K A;  1NVM A;  3KDS E;  2EKK A;  4LGM A;  1VEJ A;  4GRI A;  4NXN M;  4B7G A;  3K8Z A;  2LH0 A;  7CAT A;  4LF6 M;  3LCU A;  4AQY M;  4QNM A;  1Q3B A;  4PCZ A;  2MGW A;  2LNH C;  3AL0 C;  3UGJ A;  4AI6 A;  1R2Y A;  1OFH A;  1L1T A;  4F1I A;  4GEW A;  5LMN M;  1GAB A;  1Z59 A;  2N35 A;  2XSZ A;  1WR1 B;  4GC5 A;  3W67 A;  3SYL A;  2CV2 A;  1C7Y A;  1GL7 A;  3M7G A;  3HHY A;  1BVS A;  2C9O A;  5JI3 E;  4DR5 M;  1QZE A;  4L4U A;  4LJ9 A;  4LG2 A;  1T43 A;  2WSE F;  1QDT A;  3J7A S;  3NWL A;  2EA0 A;  3ILK A;  2JY6 B;  4JI5 M;  2G3Q A;  1UM8 A;  4IJE A;  3HKP A;  1JB0 F;  2VQE M;  2K6B A;  1RU3 A;  1XWI A;  3UZU A;  2OQ4 A;  3SAT A;  3FTF A;  5BPV A;  4XGI A;  3WHL A;  4HLQ A;  1IN4 A;  2KEB A;  3LW5 F;  2OO9 A;  4Q7J A;  1S3S A;  1VG5 A;  1HJP A;  1NJG A;  1XNR M;  4LJ7 A;  4D80 A;  5H37 D;  4NC6 A;  1SXJ D;  3W0F A;  1SG9 A;  4XK8 F;  4FCT A;  3D8L A;  1YUB A;  4L15 A;  3DA1 A;  1ZMV A;  1N36 M;  1G3I A;  2CFO A;  5KPZ A;  5C18 A;  4DV7 M;  2LHG A;  2VF7 A;  3U6D A;  2OOB A;  3VKG A;  1MU5 A;  1ZQ9 A;  4P17 A;  2X8A A;  2QQ8 A;  2UUB M;  5FSW A;  4OVZ A;  4R3D A;  2C9C A;  1GVN A;  4NSO B;  2UUC M;  4MH0 E;  3SAW A;  1GJT A;  4JI0 M;  4XBO A;  4PDG A;  2L6O A;  3KSX A;  4MGZ E;  1LTM A;  5ITY A;  1SXJ E;  4S12 A;  3GLG B;  3Q8G A;  4AZF A;  4ZPX A;  4L8R C;  2CEA A;  1JR3 D;  2K0B X;  1JR3 A;  2YR0 A;  2BJV A;  2EKF A;  4QNR A;  3AV0 A;  4EIW A;  2D7H A;  1NHG C;  1QAM A;  3AKZ A;  1GL6 A;  1IBK M;  4JV5 M;  3V76 A;  4RNA A;  1YE9 A;  2YFQ A;  2KRK A;  5EXP A;  3HJQ A;  4CGY B;  1ZMW A;  3GRU A;  2KZU A;  2DHR A;  4I5S A;  4AW4 A;  3KFU G;  2JY5 A;  4X64 M;  4DV1 M;  3TWM A;  2CRU A;  4LJA A;  4NSR A;  3J81 S;  1TTE A;  3HU1 A;  2RGH A;  1EFU B;  2L09 A;  3R8F A;  3GQ5 A;  2R4J A;  2F5O A;  2CHG A;  3GLF E;  1Q39 A;  4JYA M;  3GRY A;  3FTD A;  2R4E A;  3KP1 E;  1QAQ A;  1HQC A;  3MJ5 A;  3RE8 A;  5EXS A;  5E6J A;  3I01 M;  2GQF A;  4LJ4 A;  5GKN A;  3ZC7 B;  1KFV A;  4RKU F;  3B7N A;  5EP1 A;  2DAK A;  2NQ8 C;  2UUA M;  1XXH B;  1D2N A;  3MHV C;  4OVZ B;  1XNQ M;  2JUJ A;  4FWG A;  1IY2 A;  2DNA A;  3U61 B;  1KSF X;  1NSF A;  1SXJ B;  2CP8 A;  4MGH A;  4R7G A;  3FUX A;  4IBG A;  2V1C A;  5EJC A;  4CIZ A;  1CUK A;  3GLG A;  2ZAN A;  4B7F A;  3CF0 A;  2DAI A;  2LWX A;  4IBK A;  4M9S A;  3L28 A;  4A3V B;  1JR3 E;  1N33 M;  2JWS A;  3SBJ A;  3H4J A;  1V33 A;  2F4V M;  3GPY A;  1TF0 B;  1OIZ A;  2ERC A;  1WGL A;  3E9S A;  2H1R A;  2LVN C;  3FUT A;  3MK6 A;  1KYI A;  4FWH A;  2R65 A;  2VDB B;  5IZ7 D;  1G8P A;  4DV3 M;  1Z5A A;  4RF1 A;  2CWB A;  4FVM A;  4PT5 A;  3HWS A;  2XLJ A;  3T1H M;  1DO0 A;  4R71 A;  4DV6 M;  1J7K A;  3AOE A;  1VQ1 A;  3FUV A;  2KNV A;  3L27 A;  1Z5C A;  1NJF A;  1QAN A;  4LCB A;  2Z4R A;  1VDD A;  3EIE A;  4LGY A;  2B3T A;  1IY0 A;  3WHK A;  1PGY A;  3HHX A;  4JN6 A;  1IXR C;  1DGG A;  2O25 A;  3FYC A;  4GHL A;  1H6U A;  3QWL A;  4K0K M;  1LV7 A;  1NY5 A;  2FE8 A;  3ZQJ A;  4DR1 M;  1F4I A;  1E9S A;  3FRH A;  4LJ8 A;  1X37 A;  4IBD A;  1WGN A;  3F92 A;  2C99 A;  1VEG A;  1L1Z A;  3U6P A;  4G6Z A;  3GRV A;  2KA6 B;  4KLN A;  4G4N A;  3PVS A;  2G8L A;  3MMP A;  1R4G A;  1TH4 A;  2I7P A;  3I4Y A;  4CHT B;  4GKK M;  3GLI E;  3TWL A;  3AFH A;  3D8B A;  3FUW A;  4I4L A;  3W68 A;  2LVP C;  1QYR A;  5KO3 A;  5ITR A;  3L2A A;  5KQD A;  3PNY A;  1MJG M;  2WSC F;  4IIW A;  3PNV A;  3SAR A;  3M6A A;  2CV1 A;  4LZZ A;  4IJF A;  4FD2 A;  4NRW A;  3B74 A;  3BXW A;  2UXB M;  1GKI A;  2RGO A;  3KSJ A;  3KOW E;  4JXJ A;  3DZD A;  2LVO C;  2QEN A;  2LVA A;  2JXN A;  2Y20 A;  2EUC A;  3K2L A;  4M0D A;  4OX9 M;  4Z8X A;  3U6C A;  4DR3 M;  2XZF A;  1IBM M;  1Z6T A;  4NOO B;  2G5G X;  2D7G A;  4QHT A;  4QOS A;  1E94 E;  1N77 A;  2BNK A;  2J5Y A;  2P5T A;  2L2D A;  4QHS A;  2FNA A;  3FRI A;  3C58 A;  2DWZ B;  3TWK A;  5F3W A;  1XMQ M;  2JZ1 A;  1IN6 A;  2MRO B;  1C1K A;  1WHC A;  3UJN A;  4PD2 A;  4HEO A;  2CUZ A;  4IBJ A;  3GLG E;  1OAI A;  4WW0 A;  1TDZ A;  2GNO A;  3ZCB B;  3FTE A;  2V6Z M;  3AOE C;  4B3R M;  2ZBK B;  3HY5 A;  3KOZ E;  4LF5 M;  3A98 B;  4DR2 M;  3B7Z A;  4II7 A;  1Q3C A;  3IG8 A;  3C3E A;  1WXQ A;  4WUR A;  5FTJ A;  4B7H A;  5EXX A;  4B3T M;  3RFW A;  2FFJ A;  2CV0 A;  4JI7 M;  4REZ A;  2KDL A;  1QZM A;  5KPR A;  3K9O A;  1L2C A;  1D0L A;  1R6B X;  2UXC M;  3GPX A;  2QBY A;  3C3D A;  3GLF A;  2F5Q A;  1N78 A;  2VII A;  1XXH E;  2WZJ A;  4DV4 M;  2QPA A;  3J7B A;  3SAV A;  1VEK A;  1PJJ A;  2KNZ A;  3BOS A;  4DUZ M;  1W5T A;  2KNA A;  2KXE A;  3QAU A;  4LJ5 A;  3UK6 A;  1Z5B A;  2HAK A;  5FTK A;  4PDI A;  2HHH M;  3TQS A;  4RF0 A;  1DGB A;  3HU2 A;  3HX3 A;  2R62 A;  4IBE A;  1XXH A;  3U60 B;  3E46 A;  1PJS A;  4BLC A;  5A2Q S;  4LF4 M;  2O5R A;  3U6E A;  3I04 M;  1AUA A;  2XEP A;  3JR4 A;  3CGW A;  3FYD A;  5EP3 A;  2R0I A;  2DZO B;  4LFC M;  3J2P B;  4D82 A;  4Z6Y A;  4DR7 M;  2QBY B;  1FNN A;  2Q2E B;  1IFY A;  5BR8 M;  1YLA A;  2FS1 A;  3U6M A;  4LF7 M;  1R7R A;  1IN7 A;  2DEN A;  4JI6 M;  1N32 M;  5KPT A;  1AIP C;  1R5L A;  1TDH A;  3VKH A;  3KS8 A;  4MGY E;  2DI0 A;  2DZN B;  1GLN A;  4FW9 A;  1OJL A;  3IHP A;  1A5T A;  5LMU M;  3HHZ A;  4IBI A;  5FTL A;  3SAU A;  1YSY A;  4DR4 M;  3J80 S;  2C96 A;  1HNX M;  3L29 A;  4CIS A;  4W5W A;  1K3W A;  1DO2 A;  1OQY A;  1NNU C;  3K92 A;  3JR5 A;  4GKJ M;  3GRR A;  3EIH A;  2C98 A;  3LVV A;  5KQ8 A;  2VQF M;  3W0L B;  2KW0 A;  1TH2 A;  4L6V 6;  2XFS A;  3HJ8 A;  1GO5 A;  5DYG A;  1DV0 A;  4IBF A;  1SXJ C;  3GPU A;  3J27 B;  1XB2 B;  1ZAE A;  5E26 A;  2KHH A;  4CJ6 A;  1QUT A;  3A45 A;  3FKE A;  2APL A;  3C9P A;  2JY8 A;  2I7N A;  3GLI A;  2H5X A;  4DV0 M;  2EO2 A;  2QZ4 A;  3LVW A;  2Y0Q A;  2DAE A;  2MJ5 B;  1T6O A;  3KP0 E;  3LCV B;  3U6L A;  2AHM A;  2DZL A;  1IY1 A;  2DKL A;  2DWL A;  1DGH B;  1GJS A;  3IEC A;  2QP9 X;  1N75 A;  4HL4 A;  3GLH B;  2KRU A;  2Y0T A;  3RGP A;  3VK7 A;  4P16 A;  4AKG A;  3K1J A;  1HT2 E;  2ZTC A;  2YQZ A;  4JI4 M;  1Q02 A;  2HWJ A;  4FCV A;  2MR9 A;  3IG5 A;  1ZV1 A;  3CTW B;  3M0E A;  3VK8 A;  2C5R A;  2LVQ D;  4B08 A;  1IXS A;  2W82 A;  3DOA A;  4L78 A;  2F5P A;  4NXM M;  3FUU A;  4LZJ A;  3U61 A;  5ITU A;  1PRB A;  1TR8 A;  3KW6 A;  3VDP A;  1J5E M;  3VLF B;  3LQR A;  1G4A E;  5ITQ A;  3GLH E;  3SYK A;  3GLF B;  4WP2 A;  1J09 A;  1E32 A;  1V92 A;  5EXT A;  5IT9 S;  3E4R A;  1HQY E;  4IBB A;  1IN8 A;  5EP2 A;  1OAO C;  3U6S A;  1XHB A;  5DYI A;  2ZAM A;  5ITX E;  3KOX E;  4OU7 A;  4X66 M;  1NNJ A;  2MH8 A;  3VDU A;  3T38 A;  2XGN A;  2UU9 M;  3ZH9 B;  1HT1 E;  4GC9 A;  2J7N A;  4M9Z A;  4G4O A;  3T15 A;  4M9X A;  2ZTD A;  3HJS A;  4LF9 M;  4BBA A;  4GIP A;  2L4F A;  1PJT A;  1L2B A;  1JQJ C;  4KT0 F;  4LRT A;  2XFT A;  4GHA A;  3TE6 A;  3QYB A;  3TL4 X;  3PFI A;  2DVW B;  4B3M M;  1IM2 A;  5EP4 A;  2XH9 A;  4MGK E;  4ANR A;  4AKI A;  2QNJ A;  5FTM A;  4FWD A;  3PXG A;  4AKH A;  2JNH A;  4X62 M;  3L25 A;  3GO8 A;  3RGS A;  3R9X B;  2R18 A;  4IBC A;  2JA2 A;  1K82 A;  2F5N A;  1IQP A;  1UFZ A;  3GQ4 A;  3I51 A;  4AG6 A;  3QYE A;  3VFD A;  3HU3 A;  1HNZ M;  1G71 A;  1QQW A;  2M5Z A;  3SHF A;  4L16 A;  4NRV A;  5ITX A;  3GPP A;  2A5Y B;  1W5S A;  2R46 A;  3CF2 A;  1VDL A;  4LJ6 A;  1XMO M;  1HR0 M;  1WJ7 A;  2LHC A;  1G41 A;  4GH9 A;  5FTN A;  2WSF F;  3OTO M;  2UXD M;  1NV8 A;  1ORY B;  3FD9 A;  3SAS A;  1N34 M;  3I4V A;  1IN5 A;  3KS4 A;  3E21 A;  4LFA M;  1EIJ A;  3HGI A;  4JI1 M;  2E5L M;  4DBG B;  4LFB M;  2XF3 A;  1HNW M;  1P3Q Q;  5IRE B;  1NO1 A;  4KO8 A;  4MGI E;  4QOZ C;  1EE8 A; 
#chains in the Genus database with same CATH homology
 3U6O A;  4LF8 M;  2HL7 A;  3SHG B;  4DV5 M;  2ZAO A;  3HHW A;  3L26 A;  2Z7J A;  2K47 A;  4YHH M;  3GQ3 A;  2QCU A;  2ZM6 M;  4FCW A;  2X49 A;  4KHP M;  5C1B A;  4AG5 A;  5DNY A;  5ITT A;  3Q8X A;  3GLI B;  2CHV A;  2L7I A;  4JI3 M;  4X65 M;  2DWM A;  3H4M A;  4NL4 H;  1TGU A;  2D7E A;  4G4R A;  1OFI A;  1PM5 A;  1QVR A;  1I4W A;  2DXI A;  2HKJ A;  3TPZ A;  1DGH A;  3LMM A;  8CAT A;  3AJI B;  4I81 A;  2CHQ A;  3A46 A;  3KXE C;  2J7O A;  1L2D A;  3DFZ A;  2RKO A;  3KOY E;  2CE7 A;  4YY3 M;  4DV2 M;  1IBL M;  1FJG M;  4BB9 A;  4GMQ A;  3UMM A;  1G59 A;  4MB7 A;  1PJI A;  1TH3 A;  1IXS B;  3CF6 E;  1XC8 A;  3U5Z A;  1I94 M;  3KVW A;  1DGF A;  2V1U A;  3NBI A;  1QAO A;  1MX0 A;  3U60 A;  1L8Q A;  3SMS A;  3U6Q A;  1IXZ A;  2FOI C;  5IWA M;  4GIT A;  3B9P A;  3SMP A;  4DR6 M;  5JI2 E;  1K3X A;  2L7H A;  2LXE A;  3A42 A;  4M0W A;  2Z3X A;  3T1Y M;  2HCB A;  4LY6 A;  3FTC A;  4OW0 A;  2YNM D;  1NY6 A;  1E9R A;  4LRS A;  3AOG A;  3GP1 A;  3LQQ A;  2OPF A;  2M60 A;  2XSZ D;  3U5Z B;  2R45 A;  4I8O A;  2DWN A;  2BJW A;  1SXJ A;  4G4Q A;  4ITQ A;  1NHW C;  5EQT A;  4JI8 M;  1T3T A;  4TUW A;  4JI2 M;  4DUY M;  4KOD A;  3THG A;  2Y21 A;  3GLH A;  3SFZ A;  3JAM S;  2KZS A;  4D81 A;  1R2Z A;  4B3S M;  2XZU A;  2X4A A;  2Z4S A;  3SC3 A;  5FLX S;  2F5S A;  4MM3 B;  1NVM A;  3KDS E;  4LGM A;  4GRI A;  4NXN M;  4B7G A;  3K8Z A;  2LH0 A;  7CAT A;  4LF6 M;  4AQY M;  4QNM A;  1Q3B A;  4PCZ A;  2LNH C;  3AL0 C;  3UGJ A;  4AI6 A;  1R2Y A;  1OFH A;  1L1T A;  5LMN M;  1Z59 A;  2XSZ A;  4GC5 A;  3SYL A;  2CV2 A;  1GL7 A;  3M7G A;  3HHY A;  5JI3 E;  2C9O A;  4DR5 M;  4L4U A;  4LJ9 A;  4LG2 A;  3J7A S;  3NWL A;  2EA0 A;  3ILK A;  4JI5 M;  1UM8 A;  4IJE A;  3HKP A;  2VQE M;  1XWI A;  3UZU A;  2OQ4 A;  3SAT A;  3FTF A;  5BPV A;  4XGI A;  3WHL A;  4HLQ A;  1IN4 A;  2KEB A;  1S3S A;  1NJG A;  1XNR M;  4LJ7 A;  4D80 A;  5H37 D;  1SXJ D;  3W0F A;  4FCT A;  3D8L A;  1YUB A;  4L15 A;  3DA1 A;  1N36 M;  1G3I A;  2CFO A;  5KPZ A;  5C18 A;  4DV7 M;  3U6D A;  3VKG A;  1MU5 A;  1ZQ9 A;  2X8A A;  2UUB M;  5FSW A;  4OVZ A;  4R3D A;  2C9C A;  1GVN A;  4NSO B;  2UUC M;  4MH0 E;  3SAW A;  4JI0 M;  4XBO A;  4PDG A;  2L6O A;  3KSX A;  4MGZ E;  5ITY A;  1SXJ E;  4S12 A;  3GLG B;  4AZF A;  4ZPX A;  4L8R C;  2CEA A;  1JR3 D;  2YR0 A;  1JR3 A;  2BJV A;  4QNR A;  3AV0 A;  4EIW A;  2D7H A;  1NHG C;  1QAM A;  3AKZ A;  1GL6 A;  1IBK M;  4JV5 M;  4RNA A;  1YE9 A;  2YFQ A;  2KRK A;  5EXP A;  3HJQ A;  4CGY B;  3GRU A;  2KZU A;  2DHR A;  4I5S A;  4AW4 A;  3KFU G;  4X64 M;  4DV1 M;  3TWM A;  4LJA A;  4NSR A;  3J81 S;  3HU1 A;  2RGH A;  2L09 A;  3R8F A;  3GQ5 A;  2R4J A;  2F5O A;  2CHG A;  1Q39 A;  4JYA M;  3GRY A;  3FTD A;  2R4E A;  3KP1 E;  1QAQ A;  1HQC A;  3MJ5 A;  3RE8 A;  5EXS A;  5E6J A;  5GKN A;  4LJ4 A;  1KFV A;  3ZC7 B;  5EP1 A;  2NQ8 C;  2UUA M;  1XXH B;  1D2N A;  3MHV C;  4OVZ B;  1XNQ M;  4FWG A;  1IY2 A;  3U61 B;  1KSF X;  1NSF A;  1SXJ B;  4MGH A;  4R7G A;  3FUX A;  4IBG A;  2V1C A;  5EJC A;  3GLG A;  2ZAN A;  4B7F A;  3CF0 A;  2LWX A;  4M9S A;  4IBK A;  4A3V B;  3L28 A;  1N33 M;  3SBJ A;  2F4V M;  3GPY A;  2ERC A;  3FUT A;  3E9S A;  2H1R A;  3MK6 A;  1KYI A;  4FWH A;  2R65 A;  5IZ7 D;  1G8P A;  4DV3 M;  1Z5A A;  4RF1 A;  4FVM A;  4PT5 A;  3HWS A;  2XLJ A;  3T1H M;  1DO0 A;  4DV6 M;  1J7K A;  3AOE A;  3FUV A;  3L27 A;  1Z5C A;  1NJF A;  1QAN A;  4LCB A;  2Z4R A;  1VDD A;  3EIE A;  4LGY A;  1IY0 A;  3WHK A;  4JN6 A;  3HHX A;  1IXR C;  1DGG A;  3FYC A;  4GHL A;  3QWL A;  1H6U A;  4K0K M;  1LV7 A;  1NY5 A;  2FE8 A;  4DR1 M;  1E9S A;  4LJ8 A;  1X37 A;  4IBD A;  2C99 A;  1L1Z A;  3U6P A;  4G6Z A;  3GRV A;  2KA6 B;  4KLN A;  4G4N A;  3PVS A;  2G8L A;  1TH4 A;  2I7P A;  3I4Y A;  4CHT B;  4GKK M;  3TWL A;  3AFH A;  3D8B A;  3FUW A;  4I4L A;  1QYR A;  5KO3 A;  5ITR A;  3L2A A;  5KQD A;  3PNY A;  4IIW A;  3PNV A;  3SAR A;  3M6A A;  2CV1 A;  4LZZ A;  4IJF A;  4FD2 A;  4NRW A;  2UXB M;  1GKI A;  2RGO A;  3KSJ A;  3KOW E;  4JXJ A;  3DZD A;  2QEN A;  4OX9 M;  2Y20 A;  2EUC A;  3K2L A;  4M0D A;  4Z8X A;  3U6C A;  4DR3 M;  2XZF A;  1IBM M;  1Z6T A;  4NOO B;  2G5G X;  2D7G A;  4QHT A;  4QOS A;  1E94 E;  1N77 A;  2BNK A;  2P5T A;  4QHS A;  2FNA A;  3C58 A;  2DWZ B;  3TWK A;  5F3W A;  1XMQ M;  1IN6 A;  1C1K A;  3UJN A;  4PD2 A;  4IBJ A;  2CUZ A;  4WW0 A;  1TDZ A;  3ZCB B;  3FTE A;  2V6Z M;  3AOE C;  4B3R M;  2ZBK B;  4LF5 M;  3KOZ E;  3A98 B;  4DR2 M;  4II7 A;  1Q3C A;  3IG8 A;  1WXQ A;  4WUR A;  5FTJ A;  4B7H A;  5EXX A;  4B3T M;  3RFW A;  2FFJ A;  2CV0 A;  4JI7 M;  4REZ A;  1QZM A;  5KPR A;  1L2C A;  1R6B X;  2UXC M;  3GPX A;  2QBY A;  3GLF A;  2F5Q A;  1N78 A;  2VII A;  4DV4 M;  2QPA A;  3J7B A;  3SAV A;  1PJJ A;  3BOS A;  4DUZ M;  1W5T A;  2KXE A;  3QAU A;  4LJ5 A;  3UK6 A;  1Z5B A;  5FTK A;  4PDI A;  2HHH M;  3TQS A;  4RF0 A;  1DGB A;  3HU2 A;  2R62 A;  4IBE A;  1XXH A;  3U60 B;  4BLC A;  5A2Q S;  4LF4 M;  2O5R A;  3U6E A;  2XEP A;  3JR4 A;  3FYD A;  5EP3 A;  2DZO B;  4LFC M;  3J2P B;  4D82 A;  4Z6Y A;  4DR7 M;  2QBY B;  1FNN A;  2Q2E B;  5BR8 M;  4LF7 M;  3U6M A;  1R7R A;  1IN7 A;  4JI6 M;  1N32 M;  5KPT A;  1TDH A;  3VKH A;  3KS8 A;  4MGY E;  2DZN B;  1GLN A;  4FW9 A;  1OJL A;  5LMU M;  3HHZ A;  4IBI A;  5FTL A;  3SAU A;  1YSY A;  4DR4 M;  3J80 S;  2C96 A;  1HNX M;  3L29 A;  4CIS A;  4W5W A;  1K3W A;  1DO2 A;  1NNU C;  3K92 A;  3JR5 A;  4GKJ M;  3GRR A;  3EIH A;  2C98 A;  3LVV A;  5KQ8 A;  2VQF M;  3W0L B;  2KW0 A;  1TH2 A;  2XFS A;  3HJ8 A;  5DYG A;  4IBF A;  1SXJ C;  3GPU A;  3J27 B;  1ZAE A;  5E26 A;  3A45 A;  3FKE A;  3GLI A;  2I7N A;  4DV0 M;  2EO2 A;  2QZ4 A;  3LVW A;  2Y0Q A;  3KP0 E;  3U6L A;  2AHM A;  1IY1 A;  2DWL A;  1DGH B;  2QP9 X;  1N75 A;  4HL4 A;  3GLH B;  2KRU A;  2Y0T A;  3RGP A;  3VK7 A;  4P16 A;  4AKG A;  3K1J A;  1HT2 E;  2YQZ A;  4JI4 M;  4FCV A;  3IG5 A;  3CTW B;  3M0E A;  3VK8 A;  2C5R A;  4B08 A;  4L78 A;  2W82 A;  3DOA A;  2F5P A;  4NXM M;  3FUU A;  4LZJ A;  3U61 A;  5ITU A;  3KW6 A;  3VDP A;  1J5E M;  3VLF B;  3LQR A;  1G4A E;  5ITQ A;  3SYK A;  3GLF B;  1J09 A;  1E32 A;  5EXT A;  5IT9 S;  3E4R A;  1HQY E;  4IBB A;  1IN8 A;  5EP2 A;  3U6S A;  1XHB A;  5DYI A;  2ZAM A;  5ITX E;  3KOX E;  4OU7 A;  4X66 M;  1NNJ A;  3VDU A;  3T38 A;  2XGN A;  2UU9 M;  3ZH9 B;  1HT1 E;  4GC9 A;  2J7N A;  4M9Z A;  4G4O A;  3T15 A;  4M9X A;  4LF9 M;  3HJS A;  4BBA A;  4GIP A;  1L2B A;  1JQJ C;  4LRT A;  2XFT A;  4GHA A;  3TE6 A;  3TL4 X;  3PFI A;  2DVW B;  4B3M M;  1IM2 A;  5EP4 A;  2XH9 A;  4MGK E;  4AKI A;  5FTM A;  4FWD A;  3PXG A;  4AKH A;  4X62 M;  3L25 A;  3GO8 A;  3RGS A;  3R9X B;  2R18 A;  4IBC A;  2JA2 A;  1K82 A;  2F5N A;  1IQP A;  3GQ4 A;  3I51 A;  4AG6 A;  3VFD A;  3HU3 A;  1HNZ M;  1QQW A;  2M5Z A;  3SHF A;  4L16 A;  4NRV A;  5ITX A;  3GPP A;  2A5Y B;  1W5S A;  2R46 A;  3CF2 A;  4LJ6 A;  1XMO M;  1HR0 M;  1G41 A;  4GH9 A;  5FTN A;  3OTO M;  2UXD M;  1ORY B;  3FD9 A;  3SAS A;  1N34 M;  3I4V A;  1IN5 A;  3KS4 A;  4LFA M;  3HGI A;  4JI1 M;  2E5L M;  4LFB M;  2XF3 A;  1HNW M;  5IRE B;  4MGI E;  4KO8 A;  4QOZ C;  1EE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...