4JI1M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
117
structure length
117
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 32
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ji1M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4ji1M02
4JI8M 4YHHM 3SAWA 3GPUA 5ITUA 2E5LM 4PDGA 3TWKA 1L2CA 2F5NA 5ITTA 3GO8A 3GPXA 3SBJA 3A45A 1MX0A 4B3RM 1XC8A 4LFCM 5A2QS 1NNJA 3U6MA 3T1HM 1HNZM 5FLXS 3SARA 1J5EM 4DR7M 2F5OA 1N32M 5IWAM 2XZUA 4LF4M 3GPPA 4G4OA 3A46A 3TWMA 3TWLA 3SASA 1TDHA 1HNWM 4DV1M 2VQFM 4DR4M 2HKJA 3J81S 4DV3M 2XZFA 4LFBM 4JI7M 3SAVA 2OPFA 1TDZA 1Z59A 3GQ3A 3VK8A 4DUZM 4LF6M 4DV4M 4DV6M 3A42A 4DV2M 3U6CA 2F5QA 1HR0M 4GKJM 2F4VM 4ITQA 3DOAA 4AQYM 4DUYM 4G4QA 4B3TM 3JR5A 4X66M 2ZM6M 3C58A 4JI0M 3U6DA 2EA0A 3U6QA 2UXBM 4DR6M 1N34M 4JI5M 4G4NA 1Z5CA 4PDIA 3JR4A 5LMNM 1PJJA 4PD2A 3GPYA 4B3SM 5IT9S 1L1ZA 4JI3M 3VK7A 2UXCM 4YY3M 2F5SA 4DR1M 4MB7A 1XNQM 3U6OA 1IBKM 1Q39A 3U6LA 1K82A 4B3MM 3OTOM 5ITXE 4NRWA 4NXNM 3U6SA 4G4RA 4DR5M 1N36M 1Q3CA 1EE8A 4JI4M 1IBMM 4JI2M 2UUAM 2F5PA 1IBLM 4LF5M 4JI6M 1K3WA 5ITYA 4JV5M 1HNXM 2ZBKB 1XMOM 1Z5AA 3SATA 4LF8M 3GP1A 4K0KM 4DV0M 4NRVA 1R2YA 3U6EA 1K3XA 3GQ5A 2UUCM 2Q2EB 1PJIA 4DV5M 4X64M 1R2ZA 5ITQA 4NXMM 4DR3M 1PM5A 1L2BA 3T1YM 1FJGM 3JAMS 2OQ4A 4GKKM 1L2DA 4CISA 1XMQM 4KHPM 4JYAM 2UXDM 4JI1M 2UUBM 1MU5A 4OX9M 3J7AS 4PCZA 3GQ4A 1L1TA 1KFVA 3W0FA 4X65M 5ITXA 5LMUM 3SAUA 1Z5BA 4DV7M 1I94M 4X62M 1N33M 1Q3BA 1XNRM 2VQEM 4DR2M 4LFAM 3U6PA 2HHHM 4LF7M 2UU9M 5ITRA 3J80S 4LF9M 5BR8M
chains in the Genus database with same CATH superfamily
2V1UA 1TH4A 2DAGA 3KP0E 4PDGA 3HKPA 5FTMA 4RKUF 1OFIA 1OTRA 3TWKA 1L2CA 3K2LA 3GPXA 2KHHA 3HY5A 4LZZA 4MGKE 2VF8A 4B3RM 3DA1A 1NNJA 1G3IA 1OQYA 1IY2A 2CHQA 2W82A 5FLXS 3GLGA 5E6JA 2BWBA 4IBFA 4LF4M 3A46A 2RGHA 3TWLA 5KPRA 3GLIE 2HKJA 3SC3A 2LVAA 2APLA 3J81S 5JI3E 3GLHA 3GLHE 4AW4A 5KO3A 4AZFA 2FS1A 3HWSA 3FTDA 3M6AA 3AKZA 2Z4RA 2LXEA 2Z7JA 2R44A 1QVRA 3K9PA 3MMPA 3GLFE 3SAVA 1G59A 1GVNA 4IBKA 2M60A 5FTLA 3CF6E 2O5RA 3KP1E 2R46A 2YFQA 3HGIA 2KW0A 1HJPA 3FUXA 4I5SA 4MM3B 1IFYA 3B9PA 3J7BA 4JI0M 2XLJA 3U6QA 2CWBA 3GLFA 4DR6M 3I51A 3NBXX 1GL7A 4WP2A 1PJJA 2MR9A 4B3SM 3RGSA 4JI3M 3VK7A 2UXCM 2CRUA 1QUSA 2L4FA 4YY3M 3KS4A 2ZAOA 2C9CA 3U6OA 2D7GA 3E4RA 4IJFA 3ZQJA 1K82A 1C1KA 1E94E 2QPAA 3LCVB 4XK8F 3T6PA 2C5RA 7CATA 4NXNM 4KT0F 3KOXE 1QYRA 1UFZA 1YE9A 1ZV1A 2L09A 2H5XA 4JI4M 3L26A 3WHKA 2R0IA 3AJIB 5FTKA 2FE8A 2FNAA 4JN6A 4LRTA 4DBGB 5IREB 3PVSA 4P16A 4JI6M 2CHVA 1K3WA 1N78A 2MGWA 2KZUA 2BNKA 2X49A 2QZ4A 2K6BA 4AG6A 1R2YA 3Q8GA 1NO1A 3GQ5A 1OKSA 1R2ZA 1G41A 2ZAMA 4DR3M 1PM5A 3GRRA 3JAMS 2Z8YM 4CISA 2LVQD 4IIWA 3VDPA 1XMQM 1E32A 1VEKA 3VLFB 1D2NA 4IBDA 1JR3D 4JI1M 3LCUA 5F3WA 5GKNA 1XWIA 4LJ8A 4PCZA 1NHWC 3KFUG 4LY6A 1L1TA 1V34A 1KFVA 4FCVA 3W0FA 2L4EA 5LMUM 2JY8A 3W0LB 2DWNA 1SXJE 2FOIC 1HT1E 4MGHA 1QAQA 2G5GX 2WSCF 2BJVA 4AKGA 3SHFA 4IBBA 1IY1A 2M5ZA 1GJSA 2Y20A 4LFAM 3U6PA 4LGMA 1WHCA 4B7GA 5ITRA 1LTMA 4LF8M 3R9XB 1Q02A 3KOWE 2CV2A 4AKHA 4R7GA 2OOBA 4JI8M 1OFHA 5ITUA 3LQQA 3RFWA 1NY5A 4BLCA 2EO2A 1YSYA 1QQWA 5ITTA 3A45A 3SBJA 1MX0A 2XF3A 3B7QA 3I04M 4RF0A 1X37A 3RE8A 4IBEA 3M7GA 5C18A 4DR7M 1DGHA 2CUZA 2XH9A 3GRVA 3TL4X 3AV0A 4G4OA 1XXHB 2VIIA 2G3QA 4AG5A 3TWMA 3R8FA 1S3SA 3C3DA 1TDHA 4EIWA 1HNWM 4DV1M 3B74A 3DFZA 5EXTA 3KOYE 2VQFM 4DR4M 2XEPA 2D7HA 2XSZD 4LJ6A 3VFDA 4GHLA 5EJCA 3BBZA 5E26A 2DWLA 4LFBM 3GRUA 1QZMA 2RKOA 2KNZA 3UZUA 4DUZM 4DV4M 1ZQ9A 3QYEA 2DHYA 4IBGA 4RF1A 3A42A 2MJ5B 4DV2M 4MGYE 2R62A 1HR0M 2A5YB 1J09A 1VDLA 3DOAA 4AQYM 4BB9A 1XHBA 4FCWA 3U5ZA 2L2DA 4KLNA 1NVMA 2R18A 2Z3XA 1XXHA 5EP2A 4G4QA 3BXWA 1SG9A 4GC5A 2ZM6M 1OAOC 3KSJA 3C58A 4ANRA 2R45A 2XGNA 3U6DA 1MJGM 2VF7A 1N34M 4GH9A 4JI5M 3EIHA 3DZDA 3KSXA 2LWXA 3UK6A 3GLIA 4L8RC 1IXSB 3D8LA 4PDIA 5BPVA 3BOSA 3I4VA 2I7NA 4L15A 4TUWA 2LHCA 1PGYA 1L1ZA 4IBIA 2KNVA 3KOZE 1NV8A 3NWLA 8CATA 1NHGC 4L78A 4JXJA 4DR1M 3HJQA 1IM2A 2JZ1A 1TGUA 2C96A 1Q39A 3U6LA 4LJ9A 2C99A 3I4YA 3M0EA 3U60B 1WIVA 5ITXE 3F92A 2R6FA 4UN2B 2DZNB 4LJ5A 4Y28F 3U6SA 1YLAA 4GRIA 3KXEC 1WR1B 2BJWA 3LVVA 2MH8A 5FTNA 2KRKA 1IBMM 1HQYE 3QYBA 4QNRA 1SXJA 2EKKA 1PJTA 3KVWA 2QHOB 1V92A 2DZOB 3HU3A 1JR3E 4HL4A 1HNXM 3KS8A 2AHMA 2I7PA 5DYGA 5DNYA 2B3TA 4K0KM 1FNNA 3FTCA 4M0WA 3U6EA 1EIJA 2G8LA 3SYLA 2R65A 1PJSA 4IBJA 3FTFA 1QDRA 3B7ZA 1FJGM 1IXRC 2KXEA 3T1YM 5C1BA 2OQ4A 3GLHB 2Y21A 1ZAEA 3HJ8A 2CV1A 2JY7A 4GHAA 4G3OA 2FFJA 1XXHE 3UJNA 2LBCA 2CHGA 3AOEC 2WSFF 2LVNC 4OX9M 3J7AS 3VKHA 3GQ4A 1NJGA 3GLIB 3FKEA 1QAMA 3L29A 5IZ7D 3FYDA 5ITXA 3W67A 2CV0A 3W68A 1D0MA 3SAUA 2DAEA 4D82A 3CTWB 2QNJA 4FCTA 4X62M 4CIZA 3L2AA 2C98A 5JI2E 3ZC7B 1KYIA 2EJSA 2VQEM 2HHHM 1J7KA 3T15A 2DWZB 2EKFA 2HL7A 1NV9A 4LJ7A 3T38A 1L8QA 1WJ7A 4YHHM 3SAWA 4GC9A 1G4AE 2E5LM 4QOSA 4QNMA 1DGBA 1AIPC 2DKLA 3RGPA 4F1IA 2ZTCA 1H6UA 3FUWA 4LFCM 5A2QS 2WZJA 1IN8A 3U6MA 3T1HM 1HNZM 3SARA 1J5EM 3J2PB 1R6BX 3HJSA 5IWAM 2Z4SA 3GPPA 2Y0QA 4L16A 4MH0E 3THGA 1T3TA 2DI0A 2QSFX 4LGYA 3AFHA 3E9SA 1PRBA 2DNAA 1Z6TA 2QBYB 2VDBB 3U61B 4DV3M 1WGLA 2JZ0A 4S12A 2RGOA 2XZFA 2KDLA 4JI7M 2OPFA 1E9RA 4KO8A 3SFZA 1Z59A 3GQ3A 3VK8A 4LF6M 2CE7A 4LJ4A 1OAIA 2F5QA 3U5ZB 1VQ1A 3AOGA 2JWSA 3B7NA 2QENA 3LQRA 4L4UA 1G8PA 3K1JA 3PNVA 4MGZE 3TQSA 4DUYM 2DENA 1OIZA 4X66M 3FUVA 4R3DA 1NNUC 5FSWA 2JP7A 3D8BA 4LZJA 3KW6A 2R4EA 1IN6A 1UM8A 4RNAA 4REZA 2DAIA 1DV0A 1Z5CA 4I81A 2GQFA 2KZSA 2XSZA 3LMMA 4PD2A 1GKIA 2XFTA 3TE6A 1SXJB 1ZMVA 3CF2A 3GPYA 4AI6A 1E9SA 2H1RA 1GABA 4I4LA 5EP4A 2LHGA 2QCUA 1GO5A 4IBCA 2QBYA 3PNYA 5EP1A 4B7HA 3HU1A 4B3MM 3FTEA 2DVWB 4FWGA 2CP8A 4LG2A 2MROB 1JR3A 5KQDA 1F4IA 1RU3A 2D7EA 3QWLA 2K47A 3AL0C 4JI2M 4NC6A 1IBLM 4W5WA 4LF5M 1GLNA 1XB2B 3H4JA 2X8AA 3NBIA 3IECA 1DGHB 3FUUA 5ITYA 4JV5M 1DO2A 1OIPA 4FW9A 1EFUB 1Z5AA 1WGNA 3SATA 1DO0A 1HQCA 3GP1A 2XFSA 4NRVA 3HU2A 2K9DA 4B7FA 5KPTA 2J5YA 2Q2EB 4WW0A 4DV5M 4X64M 1TTEA 5ITQA 2LNHC 4D81A 4NXMM 2V6ZM 1L2BA 2L6OA 1DGFA 4PT5A 4BBAA 3FE3A 1L2DA 4KHPM 2UXDM 2J7NA 1MU5A 3FRIA 3VDUA 2BWEA 3K8ZA 3LW5F 4FWDA 2P5TA 1IXSA 4II7A 4X65M 1VEJA 1IN5A 2DAKA 3J27B 2NQ8C 3HZJA 2YNMD 1SXJD 1Y8GA 4DV7M 1SXJC 5EQTA 1GL6A 3EIEA 1NY6A 5DFLA 1N33M 3C3EA 1Q3BA 5EXSA 1N75A 4Q7JA 2DZLA 1PJQA 3ILKA 1TH3A 4XBOA 4GITA 1XNRM 4ZPXA 4DR2M 2C9OA 2EUCA 3WHLA 2JXNA 5BR8M 1DGGA 4G6ZA 4Z6YA 3L25A 3U61A 3GPUA 2JNHA 3L28A 4R71A 4OW0A 2RRUA 2F5NA 3QAUA 3GO8A 2KA6B 2KNAA 1XC8A 1D0KA 2ZTDA 3PFIA 1IN4A 2HCBA 2F5OA 1N32M 2XZUA 3SMSA 1T43A 4CGYB 2ZANA 3A98B 1IN7A 4WURA 2O01F 2V1CA 4NL4H 5EP3A 1YUBA 3FYCA 2CFOA 3SASA 5L8RF 2QQ8A 3K92A 1GJTA 3HHWA 4F2LA 5FTJA 4Z8XA 3V76A 5H37D 2HAKA 4LF9M 2R4JA 3Q8XA 1N77A 2LVPC 2GNOA 1TDZA 2L7IA 3ZCBB 1QUTA 1WXQA 2KEBA 3FRHA 4NOOB 4DV6M 2L7HA 3ZH9B 3U6CA 2LH0A 4GKJM 1QANA 3FUTA 3HHYA 1NSFA 3UMMA 1BVSA 4ITQA 2F4VM 2OOAA 2FH0A 3MK6A 4B3TM 3JR5A 3E46A 4HLQA 3GLGE 3MJ5A 5KPZA 3CF0A 4KODA 5DYIA 2DXIA 2DWMA 3AOEA 3B89A 2EA0A 3L27A 1IXZA 3LVWA 2UXBM 4FVMA 4M9SA 4G4NA 3JR4A 5LMNM 1AUAA 1KSFX 3PXGA 1A5TA 1JQJC 3C9PA 1IQPA 4GMQA 2LTUA 2X4AA 5IT9S 4GIPA 1LV7A 2HWJA 2KRUA 3HHXA 3SHGB 4P17A 2N35A 2ERCA 5EXXA 2F5SA 4MB7A 3CGWA 1XNQM 2JA2A 2QP9X 1ZMUA 1IY0A 1IBKM 3VKGA 3HX3A 5EXPA 1R4GA 1T6OA 3OTOM 3GLFB 1TH2A 3E21A 4NRWA 3I01M 4OVZB 4G4RA 4DR5M 1N36M 1Q3CA 4LCBA 1ZMWA 1EE8A 3U60A 1TF0B 1ORYB 3FD9A 1CUKA 1R5LA 4B08A 2UUAM 2F5PA 1NJFA 1W5SA 4MGIE 1VG5A 3IG8A 2O25A 3IG5A 3TPZA 4QOZC 2JY6B 2ZBKB 1HT2E 2K0BX 4IJEA 3GLGB 1XMOM 1OJLA 4FD2A 3K9OA 2JUJA 1TR8A 4OU7A 4DV0M 1D0LA 3GRYA 1K3XA 3SYKA 2UUCM 4QHTA 1PJIA 4QHSA 2OO9A 3H4MA 2DHRA 4HEOA 4NSOB 2CEAA 1JB0F 4CJ6A 4FWHA 2LVOC 4GKKM 4JYAM 3KDSE 4GEWA 1QDTA 1VEGA 4NSRA 4OVZA 4LJAA 2UUBM 4I8OA 2DAMA 4CHTB 2Y0TA 3SMPA 3UGJA 1QAOA 1QZEA 4A3VB 5KQ8A 2WSEF 1V33A 1W5TA 1G71A 4M9ZA 1C7YA 4LRSA 2YR0A 2JY5A 1Z5BA 4AKIA 1I94M 4L6V6 1R7RA 4D80A 1I4WA 4M9XA 4XGIA 2J7OA 3IHPA 4M0DA 1VDDA 1P3QQ 3MHVC 4LF7M 2UU9M 3HHZA 3J80S 2YQZA 1MN3A
chains in the Genus database with same CATH topology
2V1UA 1TH4A 3KP0E 4PDGA 3HKPA 5FTMA 1OFIA 3TWKA 1L2CA 3K2LA 3GPXA 4LZZA 4MGKE 4B3RM 3DA1A 1NNJA 1G3IA 5FLXS 1IY2A 2CHQA 2W82A 3GLGA 5E6JA 4IBFA 4LF4M 3A46A 2RGHA 3TWLA 5KPRA 2HKJA 3SC3A 3J81S 5JI3E 3GLHA 4AW4A 5KO3A 4AZFA 3HWSA 3FTDA 3M6AA 3AKZA 2Z4RA 2LXEA 2Z7JA 3SAVA 1QVRA 3U60A 1G59A 1GVNA 4IBKA 2M60A 5FTLA 3CF6E 2O5RA 3KP1E 2R46A 2YFQA 3HGIA 2KW0A 3FUXA 4I5SA 4MM3B 3B9PA 3J7BA 4JI0M 2XLJA 3U6QA 3GLFA 4DR6M 3I51A 1GL7A 1PJJA 4B3SM 3RGSA 4JI3M 3VK7A 2UXCM 4YY3M 3KS4A 2ZAOA 2C9CA 3U6OA 2D7GA 3E4RA 4IJFA 1K82A 1C1KA 1E94E 2QPAA 2C5RA 7CATA 4NXNM 3KOXE 1QYRA 1YE9A 2L09A 4JI4M 3L26A 3WHKA 3AJIB 5FTKA 2FE8A 2FNAA 4JN6A 4LRTA 5IREB 3PVSA 4P16A 4JI6M 2CHVA 1K3WA 1N78A 2BNKA 2KZUA 2X49A 2QZ4A 4AG6A 1R2YA 3GQ5A 1R2ZA 1G41A 2ZAMA 4DR3M 1PM5A 3GRRA 3JAMS 4CISA 4IIWA 3VDPA 1XMQM 1E32A 3VLFB 1D2NA 4IBDA 1JR3D 4JI1M 5F3WA 5GKNA 1XWIA 4LJ8A 4PCZA 1NHWC 3KFUG 4LY6A 1L1TA 1KFVA 4FCVA 3W0FA 5LMUM 3W0LB 2DWNA 1SXJE 2FOIC 1HT1E 4MGHA 1QAQA 2G5GX 2BJVA 4AKGA 3SHFA 4IBBA 1IY1A 2M5ZA 2Y20A 4LFAM 3U6PA 4LGMA 4B7GA 5ITRA 4LF8M 3R9XB 3KOWE 2CV2A 4AKHA 4R7GA 4JI8M 1OFHA 5ITUA 3LQQA 3RFWA 1NY5A 4BLCA 2EO2A 1YSYA 1QQWA 5ITTA 3A45A 3SBJA 1MX0A 2XF3A 4RF0A 1X37A 3RE8A 4IBEA 3M7GA 5C18A 4DR7M 1DGHA 2CUZA 2XH9A 3GRVA 3TL4X 3AV0A 4G4OA 1XXHB 2VIIA 3TWMA 4AG5A 3R8FA 1S3SA 1TDHA 4EIWA 1HNWM 4DV1M 3DFZA 5EXTA 3KOYE 2VQFM 4DR4M 2XEPA 2D7HA 2XSZD 4LJ6A 3VFDA 4GHLA 5EJCA 5E26A 2DWLA 4LFBM 3GRUA 1QZMA 2RKOA 3UZUA 4DUZM 4DV4M 1ZQ9A 4IBGA 4RF1A 3A42A 4DV2M 4MGYE 2R62A 1HR0M 2A5YB 1J09A 3DOAA 4AQYM 4BB9A 1XHBA 4FCWA 3U5ZA 4KLNA 1NVMA 2R18A 2Z3XA 1XXHA 5EP2A 4G4QA 4GC5A 2ZM6M 3KSJA 3C58A 3U6DA 2R45A 2XGNA 1N34M 4GH9A 4JI5M 3EIHA 3DZDA 3KSXA 2LWXA 3UK6A 3GLIA 4L8RC 1IXSB 3D8LA 4PDIA 5BPVA 3BOSA 3I4VA 2I7NA 4L15A 4TUWA 1L1ZA 4IBIA 3KOZE 3NWLA 8CATA 1NHGC 4L78A 4JXJA 4DR1M 3HJQA 1IM2A 1TGUA 2C96A 1Q39A 3U6LA 4LJ9A 2C99A 3I4YA 3M0EA 3U60B 5ITXE 3U6SA 2DZNB 4LJ5A 4GRIA 3KXEC 2BJWA 3LVVA 5FTNA 1IBMM 2KRKA 1HQYE 4QNRA 1SXJA 3KVWA 2DZOB 3HU3A 1HNXM 4HL4A 3KS8A 2AHMA 2I7PA 5DYGA 5DNYA 4K0KM 1FNNA 3FTCA 4M0WA 3U6EA 2G8LA 3SYLA 2R65A 4IBJA 3FTFA 1FJGM 1IXRC 2KXEA 3T1YM 5C1BA 2OQ4A 3GLHB 2Y21A 1ZAEA 3HJ8A 2CV1A 4GHAA 2FFJA 3UJNA 2CHGA 3AOEC 4OX9M 3J7AS 3VKHA 3GQ4A 1NJGA 3GLIB 3FKEA 1QAMA 3L29A 5IZ7D 3FYDA 5ITXA 2CV0A 3SAUA 4D82A 3CTWB 4FCTA 4X62M 3L2AA 2C98A 5JI2E 3ZC7B 1KYIA 2VQEM 2HHHM 1J7KA 3T15A 2DWZB 2HL7A 4LJ7A 3T38A 1L8QA 4YHHM 3SAWA 4GC9A 1G4AE 2E5LM 4QOSA 4QNMA 1DGBA 3RGPA 1H6UA 3FUWA 4LFCM 5A2QS 3SARA 1IN8A 3U6MA 3T1HM 1HNZM 1J5EM 3J2PB 1R6BX 3HJSA 5IWAM 2Z4SA 3GPPA 2Y0QA 4L16A 4MH0E 3THGA 1T3TA 4LGYA 3AFHA 3E9SA 2QBYB 1Z6TA 3U61B 4DV3M 4S12A 2RGOA 2XZFA 4JI7M 2OPFA 1E9RA 4KO8A 3SFZA 1Z59A 3GQ3A 3VK8A 4LF6M 2CE7A 4LJ4A 2F5QA 3U5ZB 3AOGA 2QENA 3LQRA 4L4UA 1G8PA 3K1JA 3PNVA 4MGZE 3TQSA 4DUYM 4X66M 3FUVA 4R3DA 1NNUC 5FSWA 3D8BA 4LZJA 3KW6A 2R4EA 1IN6A 1UM8A 4RNAA 4REZA 1Z5CA 4I81A 3LMMA 2KZSA 2XSZA 4PD2A 1GKIA 2XFTA 3TE6A 1SXJB 3GPYA 3CF2A 4AI6A 1E9SA 2H1RA 4I4LA 5EP4A 2QCUA 4IBCA 2QBYA 3PNYA 5EP1A 4B7HA 3HU1A 4B3MM 3FTEA 2DVWB 4FWGA 4LG2A 1JR3A 5KQDA 2D7EA 3QWLA 2K47A 3AL0C 4JI2M 1IBLM 4W5WA 4LF5M 1GLNA 2X8AA 3NBIA 1DGHB 3FUUA 5ITYA 4JV5M 4FW9A 1DO2A 1Z5AA 3SATA 1DO0A 1HQCA 3GP1A 2XFSA 4NRVA 3HU2A 4B7FA 5KPTA 2Q2EB 4WW0A 4DV5M 4X64M 5ITQA 2LNHC 4D81A 4NXMM 2V6ZM 1L2BA 2L6OA 1DGFA 4PT5A 4BBAA 1L2DA 4KHPM 2UXDM 2J7NA 1MU5A 3VDUA 3K8ZA 4FWDA 2P5TA 4II7A 4X65M 1IN5A 3J27B 2NQ8C 2YNMD 1SXJD 4DV7M 1SXJC 5EQTA 1GL6A 3EIEA 1NY6A 1N33M 1Q3BA 5EXSA 1N75A 3ILKA 1TH3A 4XBOA 4GITA 1XNRM 4ZPXA 4DR2M 2C9OA 2EUCA 3WHLA 5BR8M 1DGGA 4G6ZA 4Z6YA 3L25A 3U61A 3GPUA 3L28A 4OW0A 2F5NA 3QAUA 3GO8A 2KA6B 1XC8A 3PFIA 1IN4A 2HCBA 2F5OA 1N32M 2XZUA 3SMSA 4CGYB 2ZANA 3A98B 1IN7A 4WURA 2V1CA 4NL4H 5EP3A 1YUBA 3FYCA 2CFOA 3SASA 3K92A 3HHWA 5FTJA 4Z8XA 5H37D 4LF9M 2R4JA 3Q8XA 1TDZA 2L7IA 3ZCBB 1WXQA 2KEBA 4NOOB 4DV6M 2L7HA 3ZH9B 3U6CA 2LH0A 4GKJM 1QANA 3FUTA 3HHYA 1NSFA 3UMMA 2F4VM 4ITQA 3MK6A 4B3TM 3JR5A 4HLQA 3MJ5A 5KPZA 3CF0A 4KODA 5DYIA 2DXIA 2DWMA 3AOEA 2EA0A 3L27A 1IXZA 3LVWA 2UXBM 4FVMA 4M9SA 4G4NA 3JR4A 5LMNM 1KSFX 3PXGA 1JQJC 4GMQA 1IQPA 2X4AA 5IT9S 4GIPA 1LV7A 2KRUA 3HHXA 3SHGB 2ERCA 5EXXA 2F5SA 4MB7A 1XNQM 2JA2A 2QP9X 1IBKM 1IY0A 3VKGA 5EXPA 3OTOM 3GLFB 1TH2A 4NRWA 4OVZB 4G4RA 4DR5M 1N36M 1Q3CA 4LCBA 1EE8A 1ORYB 3FD9A 4B08A 2UUAM 2F5PA 1NJFA 1W5SA 4MGIE 3IG8A 3IG5A 3TPZA 4QOZC 2ZBKB 1XMOM 1HT2E 4IJEA 3GLGB 1OJLA 4FD2A 4OU7A 4DV0M 3GRYA 1K3XA 3SYKA 2UUCM 4QHTA 1PJIA 4QHSA 3H4MA 2DHRA 4NSOB 2CEAA 4FWHA 4GKKM 4JYAM 3KDSE 4NSRA 4OVZA 4LJAA 2UUBM 4I8OA 4CHTB 2Y0TA 3SMPA 3UGJA 1QAOA 4A3VB 5KQ8A 1W5TA 4M9ZA 4LRSA 2YR0A 1Z5BA 4AKIA 1I94M 1R7RA 4D80A 1I4WA 4M9XA 4XGIA 2J7OA 4M0DA 1VDDA 3MHVC 4LF7M 2UU9M 3HHZA 3J80S 2YQZA 1N77A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI8 M;  4YHH M;  3SAW A;  3GPU A;  5ITU A;  2E5L M;  4PDG A;  3TWK A;  1L2C A;  2F5N A;  5ITT A;  3GO8 A;  3GPX A;  3SBJ A;  3A45 A;  1MX0 A;  4B3R M;  1XC8 A;  4LFC M;  5A2Q S;  1NNJ A;  3U6M A;  3T1H M;  1HNZ M;  5FLX S;  3SAR A;  1J5E M;  4DR7 M;  2F5O A;  1N32 M;  5IWA M;  2XZU A;  4LF4 M;  3GPP A;  4G4O A;  3A46 A;  3TWM A;  3TWL A;  3SAS A;  1TDH A;  1HNW M;  4DV1 M;  2VQF M;  4DR4 M;  2HKJ A;  3J81 S;  4DV3 M;  2XZF A;  4LFB M;  4JI7 M;  3SAV A;  2OPF A;  1TDZ A;  1Z59 A;  3GQ3 A;  3VK8 A;  4DUZ M;  4LF6 M;  4DV4 M;  4DV6 M;  3A42 A;  4DV2 M;  3U6C A;  2F5Q A;  1HR0 M;  4GKJ M;  2F4V M;  4ITQ A;  3DOA A;  4AQY M;  4DUY M;  4G4Q A;  4B3T M;  3JR5 A;  4X66 M;  2ZM6 M;  3C58 A;  4JI0 M;  3U6D A;  2EA0 A;  3U6Q A;  2UXB M;  4DR6 M;  1N34 M;  4JI5 M;  4G4N A;  1Z5C A;  4PDI A;  3JR4 A;  5LMN M;  1PJJ A;  4PD2 A;  3GPY A;  4B3S M;  5IT9 S;  1L1Z A;  4JI3 M;  3VK7 A;  2UXC M;  4YY3 M;  2F5S A;  4DR1 M;  4MB7 A;  1XNQ M;  3U6O A;  1IBK M;  1Q39 A;  3U6L A;  1K82 A;  4B3M M;  3OTO M;  5ITX E;  4NRW A;  4NXN M;  3U6S A;  4G4R A;  4DR5 M;  1N36 M;  1Q3C A;  1EE8 A;  4JI4 M;  1IBM M;  4JI2 M;  2UUA M;  2F5P A;  1IBL M;  4LF5 M;  4JI6 M;  1K3W A;  5ITY A;  4JV5 M;  1HNX M;  2ZBK B;  1XMO M;  1Z5A A;  3SAT A;  4LF8 M;  3GP1 A;  4K0K M;  4DV0 M;  4NRV A;  1R2Y A;  3U6E A;  1K3X A;  3GQ5 A;  2UUC M;  2Q2E B;  1PJI A;  4DV5 M;  4X64 M;  1R2Z A;  5ITQ A;  4NXM M;  4DR3 M;  1PM5 A;  1L2B A;  3T1Y M;  1FJG M;  3JAM S;  2OQ4 A;  4GKK M;  1L2D A;  4CIS A;  1XMQ M;  4KHP M;  4JYA M;  2UXD M;  4JI1 M;  2UUB M;  1MU5 A;  4OX9 M;  3J7A S;  4PCZ A;  3GQ4 A;  1L1T A;  1KFV A;  3W0F A;  4X65 M;  5ITX A;  5LMU M;  3SAU A;  1Z5B A;  4DV7 M;  1I94 M;  4X62 M;  1N33 M;  1Q3B A;  1XNR M;  2VQE M;  4DR2 M;  4LFA M;  3U6P A;  2HHH M;  4LF7 M;  2UU9 M;  5ITR A;  3J80 S;  4LF9 M;  5BR8 M; 
#chains in the Genus database with same CATH topology
 2V1U A;  1TH4 A;  2DAG A;  3KP0 E;  4PDG A;  3HKP A;  5FTM A;  4RKU F;  1OFI A;  1OTR A;  3TWK A;  1L2C A;  3K2L A;  3GPX A;  2KHH A;  3HY5 A;  4LZZ A;  4MGK E;  2VF8 A;  4B3R M;  3DA1 A;  1NNJ A;  1G3I A;  1OQY A;  1IY2 A;  2CHQ A;  2W82 A;  5FLX S;  3GLG A;  5E6J A;  2BWB A;  4IBF A;  4LF4 M;  3A46 A;  2RGH A;  3TWL A;  5KPR A;  3GLI E;  2HKJ A;  3SC3 A;  2LVA A;  2APL A;  3J81 S;  5JI3 E;  3GLH A;  3GLH E;  4AW4 A;  5KO3 A;  4AZF A;  2FS1 A;  3HWS A;  3FTD A;  3M6A A;  3AKZ A;  2Z4R A;  2LXE A;  2Z7J A;  2R44 A;  1QVR A;  3K9P A;  3MMP A;  3GLF E;  3SAV A;  1G59 A;  1GVN A;  4IBK A;  2M60 A;  5FTL A;  3CF6 E;  2O5R A;  3KP1 E;  2R46 A;  2YFQ A;  3HGI A;  2KW0 A;  1HJP A;  3FUX A;  4I5S A;  4MM3 B;  1IFY A;  3B9P A;  3J7B A;  4JI0 M;  2XLJ A;  3U6Q A;  2CWB A;  3GLF A;  4DR6 M;  3I51 A;  3NBX X;  1GL7 A;  4WP2 A;  1PJJ A;  2MR9 A;  4B3S M;  3RGS A;  4JI3 M;  3VK7 A;  2UXC M;  2CRU A;  1QUS A;  2L4F A;  4YY3 M;  3KS4 A;  2ZAO A;  2C9C A;  3U6O A;  2D7G A;  3E4R A;  4IJF A;  3ZQJ A;  1K82 A;  1C1K A;  1E94 E;  2QPA A;  3LCV B;  4XK8 F;  3T6P A;  2C5R A;  7CAT A;  4NXN M;  4KT0 F;  3KOX E;  1QYR A;  1UFZ A;  1YE9 A;  1ZV1 A;  2L09 A;  2H5X A;  4JI4 M;  3L26 A;  3WHK A;  2R0I A;  3AJI B;  5FTK A;  2FE8 A;  2FNA A;  4JN6 A;  4LRT A;  4DBG B;  5IRE B;  3PVS A;  4P16 A;  4JI6 M;  2CHV A;  1K3W A;  1N78 A;  2MGW A;  2KZU A;  2BNK A;  2X49 A;  2QZ4 A;  2K6B A;  4AG6 A;  1R2Y A;  3Q8G A;  1NO1 A;  3GQ5 A;  1OKS A;  1R2Z A;  1G41 A;  2ZAM A;  4DR3 M;  1PM5 A;  3GRR A;  3JAM S;  2Z8Y M;  4CIS A;  2LVQ D;  4IIW A;  3VDP A;  1XMQ M;  1E32 A;  1VEK A;  3VLF B;  1D2N A;  4IBD A;  1JR3 D;  4JI1 M;  3LCU A;  5F3W A;  5GKN A;  1XWI A;  4LJ8 A;  4PCZ A;  1NHW C;  3KFU G;  4LY6 A;  1L1T A;  1V34 A;  1KFV A;  4FCV A;  3W0F A;  2L4E A;  5LMU M;  2JY8 A;  3W0L B;  2DWN A;  1SXJ E;  2FOI C;  1HT1 E;  4MGH A;  1QAQ A;  2G5G X;  2WSC F;  2BJV A;  4AKG A;  3SHF A;  4IBB A;  1IY1 A;  2M5Z A;  1GJS A;  2Y20 A;  4LFA M;  3U6P A;  4LGM A;  1WHC A;  4B7G A;  5ITR A;  1LTM A;  4LF8 M;  3R9X B;  1Q02 A;  3KOW E;  2CV2 A;  4AKH A;  4R7G A;  2OOB A;  4JI8 M;  1OFH A;  5ITU A;  3LQQ A;  3RFW A;  1NY5 A;  4BLC A;  2EO2 A;  1YSY A;  1QQW A;  5ITT A;  3A45 A;  3SBJ A;  1MX0 A;  2XF3 A;  3B7Q A;  3I04 M;  4RF0 A;  1X37 A;  3RE8 A;  4IBE A;  3M7G A;  5C18 A;  4DR7 M;  1DGH A;  2CUZ A;  2XH9 A;  3GRV A;  3TL4 X;  3AV0 A;  4G4O A;  1XXH B;  2VII A;  2G3Q A;  4AG5 A;  3TWM A;  3R8F A;  1S3S A;  3C3D A;  1TDH A;  4EIW A;  1HNW M;  4DV1 M;  3B74 A;  3DFZ A;  5EXT A;  3KOY E;  2VQF M;  4DR4 M;  2XEP A;  2D7H A;  2XSZ D;  4LJ6 A;  3VFD A;  4GHL A;  5EJC A;  3BBZ A;  5E26 A;  2DWL A;  4LFB M;  3GRU A;  1QZM A;  2RKO A;  2KNZ A;  3UZU A;  4DUZ M;  4DV4 M;  1ZQ9 A;  3QYE A;  2DHY A;  4IBG A;  4RF1 A;  3A42 A;  2MJ5 B;  4DV2 M;  4MGY E;  2R62 A;  1HR0 M;  2A5Y B;  1J09 A;  1VDL A;  3DOA A;  4AQY M;  4BB9 A;  1XHB A;  4FCW A;  3U5Z A;  2L2D A;  4KLN A;  1NVM A;  2R18 A;  2Z3X A;  1XXH A;  5EP2 A;  4G4Q A;  3BXW A;  1SG9 A;  4GC5 A;  2ZM6 M;  1OAO C;  3KSJ A;  3C58 A;  4ANR A;  2R45 A;  2XGN A;  3U6D A;  1MJG M;  2VF7 A;  1N34 M;  4GH9 A;  4JI5 M;  3EIH A;  3DZD A;  3KSX A;  2LWX A;  3UK6 A;  3GLI A;  4L8R C;  1IXS B;  3D8L A;  4PDI A;  5BPV A;  3BOS A;  3I4V A;  2I7N A;  4L15 A;  4TUW A;  2LHC A;  1PGY A;  1L1Z A;  4IBI A;  2KNV A;  3KOZ E;  1NV8 A;  3NWL A;  8CAT A;  1NHG C;  4L78 A;  4JXJ A;  4DR1 M;  3HJQ A;  1IM2 A;  2JZ1 A;  1TGU A;  2C96 A;  1Q39 A;  3U6L A;  4LJ9 A;  2C99 A;  3I4Y A;  3M0E A;  3U60 B;  1WIV A;  5ITX E;  3F92 A;  2R6F A;  4UN2 B;  2DZN B;  4LJ5 A;  4Y28 F;  3U6S A;  1YLA A;  4GRI A;  3KXE C;  1WR1 B;  2BJW A;  3LVV A;  2MH8 A;  5FTN A;  2KRK A;  1IBM M;  1HQY E;  3QYB A;  4QNR A;  1SXJ A;  2EKK A;  1PJT A;  3KVW A;  2QHO B;  1V92 A;  2DZO B;  3HU3 A;  1JR3 E;  4HL4 A;  1HNX M;  3KS8 A;  2AHM A;  2I7P A;  5DYG A;  5DNY A;  2B3T A;  4K0K M;  1FNN A;  3FTC A;  4M0W A;  3U6E A;  1EIJ A;  2G8L A;  3SYL A;  2R65 A;  1PJS A;  4IBJ A;  3FTF A;  1QDR A;  3B7Z A;  1FJG M;  1IXR C;  2KXE A;  3T1Y M;  5C1B A;  2OQ4 A;  3GLH B;  2Y21 A;  1ZAE A;  3HJ8 A;  2CV1 A;  2JY7 A;  4GHA A;  4G3O A;  2FFJ A;  1XXH E;  3UJN A;  2LBC A;  2CHG A;  3AOE C;  2WSF F;  2LVN C;  4OX9 M;  3J7A S;  3VKH A;  3GQ4 A;  1NJG A;  3GLI B;  3FKE A;  1QAM A;  3L29 A;  5IZ7 D;  3FYD A;  5ITX A;  3W67 A;  2CV0 A;  3W68 A;  1D0M A;  3SAU A;  2DAE A;  4D82 A;  3CTW B;  2QNJ A;  4FCT A;  4X62 M;  4CIZ A;  3L2A A;  2C98 A;  5JI2 E;  3ZC7 B;  1KYI A;  2EJS A;  2VQE M;  2HHH M;  1J7K A;  3T15 A;  2DWZ B;  2EKF A;  2HL7 A;  1NV9 A;  4LJ7 A;  3T38 A;  1L8Q A;  1WJ7 A;  4YHH M;  3SAW A;  4GC9 A;  1G4A E;  2E5L M;  4QOS A;  4QNM A;  1DGB A;  1AIP C;  2DKL A;  3RGP A;  4F1I A;  2ZTC A;  1H6U A;  3FUW A;  4LFC M;  5A2Q S;  2WZJ A;  1IN8 A;  3U6M A;  3T1H M;  1HNZ M;  3SAR A;  1J5E M;  3J2P B;  1R6B X;  3HJS A;  5IWA M;  2Z4S A;  3GPP A;  2Y0Q A;  4L16 A;  4MH0 E;  3THG A;  1T3T A;  2DI0 A;  2QSF X;  4LGY A;  3AFH A;  3E9S A;  1PRB A;  2DNA A;  1Z6T A;  2QBY B;  2VDB B;  3U61 B;  4DV3 M;  1WGL A;  2JZ0 A;  4S12 A;  2RGO A;  2XZF A;  2KDL A;  4JI7 M;  2OPF A;  1E9R A;  4KO8 A;  3SFZ A;  1Z59 A;  3GQ3 A;  3VK8 A;  4LF6 M;  2CE7 A;  4LJ4 A;  1OAI A;  2F5Q A;  3U5Z B;  1VQ1 A;  3AOG A;  2JWS A;  3B7N A;  2QEN A;  3LQR A;  4L4U A;  1G8P A;  3K1J A;  3PNV A;  4MGZ E;  3TQS A;  4DUY M;  2DEN A;  1OIZ A;  4X66 M;  3FUV A;  4R3D A;  1NNU C;  5FSW A;  2JP7 A;  3D8B A;  4LZJ A;  3KW6 A;  2R4E A;  1IN6 A;  1UM8 A;  4RNA A;  4REZ A;  2DAI A;  1DV0 A;  1Z5C A;  4I81 A;  2GQF A;  2KZS A;  2XSZ A;  3LMM A;  4PD2 A;  1GKI A;  2XFT A;  3TE6 A;  1SXJ B;  1ZMV A;  3CF2 A;  3GPY A;  4AI6 A;  1E9S A;  2H1R A;  1GAB A;  4I4L A;  5EP4 A;  2LHG A;  2QCU A;  1GO5 A;  4IBC A;  2QBY A;  3PNY A;  5EP1 A;  4B7H A;  3HU1 A;  4B3M M;  3FTE A;  2DVW B;  4FWG A;  2CP8 A;  4LG2 A;  2MRO B;  1JR3 A;  5KQD A;  1F4I A;  1RU3 A;  2D7E A;  3QWL A;  2K47 A;  3AL0 C;  4JI2 M;  4NC6 A;  1IBL M;  4W5W A;  4LF5 M;  1GLN A;  1XB2 B;  3H4J A;  2X8A A;  3NBI A;  3IEC A;  1DGH B;  3FUU A;  5ITY A;  4JV5 M;  1DO2 A;  1OIP A;  4FW9 A;  1EFU B;  1Z5A A;  1WGN A;  3SAT A;  1DO0 A;  1HQC A;  3GP1 A;  2XFS A;  4NRV A;  3HU2 A;  2K9D A;  4B7F A;  5KPT A;  2J5Y A;  2Q2E B;  4WW0 A;  4DV5 M;  4X64 M;  1TTE A;  5ITQ A;  2LNH C;  4D81 A;  4NXM M;  2V6Z M;  1L2B A;  2L6O A;  1DGF A;  4PT5 A;  4BBA A;  3FE3 A;  1L2D A;  4KHP M;  2UXD M;  2J7N A;  1MU5 A;  3FRI A;  3VDU A;  2BWE A;  3K8Z A;  3LW5 F;  4FWD A;  2P5T A;  1IXS A;  4II7 A;  4X65 M;  1VEJ A;  1IN5 A;  2DAK A;  3J27 B;  2NQ8 C;  3HZJ A;  2YNM D;  1SXJ D;  1Y8G A;  4DV7 M;  1SXJ C;  5EQT A;  1GL6 A;  3EIE A;  1NY6 A;  5DFL A;  1N33 M;  3C3E A;  1Q3B A;  5EXS A;  1N75 A;  4Q7J A;  2DZL A;  1PJQ A;  3ILK A;  1TH3 A;  4XBO A;  4GIT A;  1XNR M;  4ZPX A;  4DR2 M;  2C9O A;  2EUC A;  3WHL A;  2JXN A;  5BR8 M;  1DGG A;  4G6Z A;  4Z6Y A;  3L25 A;  3U61 A;  3GPU A;  2JNH A;  3L28 A;  4R71 A;  4OW0 A;  2RRU A;  2F5N A;  3QAU A;  3GO8 A;  2KA6 B;  2KNA A;  1XC8 A;  1D0K A;  2ZTD A;  3PFI A;  1IN4 A;  2HCB A;  2F5O A;  1N32 M;  2XZU A;  3SMS A;  1T43 A;  4CGY B;  2ZAN A;  3A98 B;  1IN7 A;  4WUR A;  2O01 F;  2V1C A;  4NL4 H;  5EP3 A;  1YUB A;  3FYC A;  2CFO A;  3SAS A;  5L8R F;  2QQ8 A;  3K92 A;  1GJT A;  3HHW A;  4F2L A;  5FTJ A;  4Z8X A;  3V76 A;  5H37 D;  2HAK A;  4LF9 M;  2R4J A;  3Q8X A;  1N77 A;  2LVP C;  2GNO A;  1TDZ A;  2L7I A;  3ZCB B;  1QUT A;  1WXQ A;  2KEB A;  3FRH A;  4NOO B;  4DV6 M;  2L7H A;  3ZH9 B;  3U6C A;  2LH0 A;  4GKJ M;  1QAN A;  3FUT A;  3HHY A;  1NSF A;  3UMM A;  1BVS A;  4ITQ A;  2F4V M;  2OOA A;  2FH0 A;  3MK6 A;  4B3T M;  3JR5 A;  3E46 A;  4HLQ A;  3GLG E;  3MJ5 A;  5KPZ A;  3CF0 A;  4KOD A;  5DYI A;  2DXI A;  2DWM A;  3AOE A;  3B89 A;  2EA0 A;  3L27 A;  1IXZ A;  3LVW A;  2UXB M;  4FVM A;  4M9S A;  4G4N A;  3JR4 A;  5LMN M;  1AUA A;  1KSF X;  3PXG A;  1A5T A;  1JQJ C;  3C9P A;  1IQP A;  4GMQ A;  2LTU A;  2X4A A;  5IT9 S;  4GIP A;  1LV7 A;  2HWJ A;  2KRU A;  3HHX A;  3SHG B;  4P17 A;  2N35 A;  2ERC A;  5EXX A;  2F5S A;  4MB7 A;  3CGW A;  1XNQ M;  2JA2 A;  2QP9 X;  1ZMU A;  1IY0 A;  1IBK M;  3VKG A;  3HX3 A;  5EXP A;  1R4G A;  1T6O A;  3OTO M;  3GLF B;  1TH2 A;  3E21 A;  4NRW A;  3I01 M;  4OVZ B;  4G4R A;  4DR5 M;  1N36 M;  1Q3C A;  4LCB A;  1ZMW A;  1EE8 A;  3U60 A;  1TF0 B;  1ORY B;  3FD9 A;  1CUK A;  1R5L A;  4B08 A;  2UUA M;  2F5P A;  1NJF A;  1W5S A;  4MGI E;  1VG5 A;  3IG8 A;  2O25 A;  3IG5 A;  3TPZ A;  4QOZ C;  2JY6 B;  2ZBK B;  1HT2 E;  2K0B X;  4IJE A;  3GLG B;  1XMO M;  1OJL A;  4FD2 A;  3K9O A;  2JUJ A;  1TR8 A;  4OU7 A;  4DV0 M;  1D0L A;  3GRY A;  1K3X A;  3SYK A;  2UUC M;  4QHT A;  1PJI A;  4QHS A;  2OO9 A;  3H4M A;  2DHR A;  4HEO A;  4NSO B;  2CEA A;  1JB0 F;  4CJ6 A;  4FWH A;  2LVO C;  4GKK M;  4JYA M;  3KDS E;  4GEW A;  1QDT A;  1VEG A;  4NSR A;  4OVZ A;  4LJA A;  2UUB M;  4I8O A;  2DAM A;  4CHT B;  2Y0T A;  3SMP A;  3UGJ A;  1QAO A;  1QZE A;  4A3V B;  5KQ8 A;  2WSE F;  1V33 A;  1W5T A;  1G71 A;  4M9Z A;  1C7Y A;  4LRS A;  2YR0 A;  2JY5 A;  1Z5B A;  4AKI A;  1I94 M;  4L6V 6;  1R7R A;  4D80 A;  1I4W A;  4M9X A;  4XGI A;  2J7O A;  3IHP A;  4M0D A;  1VDD A;  1P3Q Q;  3MHV C;  4LF7 M;  2UU9 M;  3HHZ A;  3J80 S;  2YQZ A;  1MN3 A; 
#chains in the Genus database with same CATH homology
 2V1U A;  1TH4 A;  3KP0 E;  4PDG A;  3HKP A;  5FTM A;  1OFI A;  3TWK A;  1L2C A;  3K2L A;  3GPX A;  4LZZ A;  4MGK E;  4B3R M;  3DA1 A;  1NNJ A;  1G3I A;  5FLX S;  1IY2 A;  2CHQ A;  2W82 A;  3GLG A;  5E6J A;  4IBF A;  4LF4 M;  3A46 A;  2RGH A;  3TWL A;  5KPR A;  2HKJ A;  3SC3 A;  3J81 S;  5JI3 E;  3GLH A;  4AW4 A;  5KO3 A;  4AZF A;  3HWS A;  3FTD A;  3M6A A;  3AKZ A;  2Z4R A;  2LXE A;  2Z7J A;  3SAV A;  1QVR A;  3U60 A;  1G59 A;  1GVN A;  4IBK A;  2M60 A;  5FTL A;  3CF6 E;  2O5R A;  3KP1 E;  2R46 A;  2YFQ A;  3HGI A;  2KW0 A;  3FUX A;  4I5S A;  4MM3 B;  3B9P A;  3J7B A;  4JI0 M;  2XLJ A;  3U6Q A;  3GLF A;  4DR6 M;  3I51 A;  1GL7 A;  1PJJ A;  4B3S M;  3RGS A;  4JI3 M;  3VK7 A;  2UXC M;  4YY3 M;  3KS4 A;  2ZAO A;  2C9C A;  3U6O A;  2D7G A;  3E4R A;  4IJF A;  1K82 A;  1C1K A;  1E94 E;  2QPA A;  2C5R A;  7CAT A;  4NXN M;  3KOX E;  1QYR A;  1YE9 A;  2L09 A;  4JI4 M;  3L26 A;  3WHK A;  3AJI B;  5FTK A;  2FE8 A;  2FNA A;  4JN6 A;  4LRT A;  5IRE B;  3PVS A;  4P16 A;  4JI6 M;  2CHV A;  1K3W A;  1N78 A;  2BNK A;  2KZU A;  2X49 A;  2QZ4 A;  4AG6 A;  1R2Y A;  3GQ5 A;  1R2Z A;  1G41 A;  2ZAM A;  4DR3 M;  1PM5 A;  3GRR A;  3JAM S;  4CIS A;  4IIW A;  3VDP A;  1XMQ M;  1E32 A;  3VLF B;  1D2N A;  4IBD A;  1JR3 D;  4JI1 M;  5F3W A;  5GKN A;  1XWI A;  4LJ8 A;  4PCZ A;  1NHW C;  3KFU G;  4LY6 A;  1L1T A;  1KFV A;  4FCV A;  3W0F A;  5LMU M;  3W0L B;  2DWN A;  1SXJ E;  2FOI C;  1HT1 E;  4MGH A;  1QAQ A;  2G5G X;  2BJV A;  4AKG A;  3SHF A;  4IBB A;  1IY1 A;  2M5Z A;  2Y20 A;  4LFA M;  3U6P A;  4LGM A;  4B7G A;  5ITR A;  4LF8 M;  3R9X B;  3KOW E;  2CV2 A;  4AKH A;  4R7G A;  4JI8 M;  1OFH A;  5ITU A;  3LQQ A;  3RFW A;  1NY5 A;  4BLC A;  2EO2 A;  1YSY A;  1QQW A;  5ITT A;  3A45 A;  3SBJ A;  1MX0 A;  2XF3 A;  4RF0 A;  1X37 A;  3RE8 A;  4IBE A;  3M7G A;  5C18 A;  4DR7 M;  1DGH A;  2CUZ A;  2XH9 A;  3GRV A;  3TL4 X;  3AV0 A;  4G4O A;  1XXH B;  2VII A;  3TWM A;  4AG5 A;  3R8F A;  1S3S A;  1TDH A;  4EIW A;  1HNW M;  4DV1 M;  3DFZ A;  5EXT A;  3KOY E;  2VQF M;  4DR4 M;  2XEP A;  2D7H A;  2XSZ D;  4LJ6 A;  3VFD A;  4GHL A;  5EJC A;  5E26 A;  2DWL A;  4LFB M;  3GRU A;  1QZM A;  2RKO A;  3UZU A;  4DUZ M;  4DV4 M;  1ZQ9 A;  4IBG A;  4RF1 A;  3A42 A;  4DV2 M;  4MGY E;  2R62 A;  1HR0 M;  2A5Y B;  1J09 A;  3DOA A;  4AQY M;  4BB9 A;  1XHB A;  4FCW A;  3U5Z A;  4KLN A;  1NVM A;  2R18 A;  2Z3X A;  1XXH A;  5EP2 A;  4G4Q A;  4GC5 A;  2ZM6 M;  3KSJ A;  3C58 A;  3U6D A;  2R45 A;  2XGN A;  1N34 M;  4GH9 A;  4JI5 M;  3EIH A;  3DZD A;  3KSX A;  2LWX A;  3UK6 A;  3GLI A;  4L8R C;  1IXS B;  3D8L A;  4PDI A;  5BPV A;  3BOS A;  3I4V A;  2I7N A;  4L15 A;  4TUW A;  1L1Z A;  4IBI A;  3KOZ E;  3NWL A;  8CAT A;  1NHG C;  4L78 A;  4JXJ A;  4DR1 M;  3HJQ A;  1IM2 A;  1TGU A;  2C96 A;  1Q39 A;  3U6L A;  4LJ9 A;  2C99 A;  3I4Y A;  3M0E A;  3U60 B;  5ITX E;  3U6S A;  2DZN B;  4LJ5 A;  4GRI A;  3KXE C;  2BJW A;  3LVV A;  5FTN A;  1IBM M;  2KRK A;  1HQY E;  4QNR A;  1SXJ A;  3KVW A;  2DZO B;  3HU3 A;  1HNX M;  4HL4 A;  3KS8 A;  2AHM A;  2I7P A;  5DYG A;  5DNY A;  4K0K M;  1FNN A;  3FTC A;  4M0W A;  3U6E A;  2G8L A;  3SYL A;  2R65 A;  4IBJ A;  3FTF A;  1FJG M;  1IXR C;  2KXE A;  3T1Y M;  5C1B A;  2OQ4 A;  3GLH B;  2Y21 A;  1ZAE A;  3HJ8 A;  2CV1 A;  4GHA A;  2FFJ A;  3UJN A;  2CHG A;  3AOE C;  4OX9 M;  3J7A S;  3VKH A;  3GQ4 A;  1NJG A;  3GLI B;  3FKE A;  1QAM A;  3L29 A;  5IZ7 D;  3FYD A;  5ITX A;  2CV0 A;  3SAU A;  4D82 A;  3CTW B;  4FCT A;  4X62 M;  3L2A A;  2C98 A;  5JI2 E;  3ZC7 B;  1KYI A;  2VQE M;  2HHH M;  1J7K A;  3T15 A;  2DWZ B;  2HL7 A;  4LJ7 A;  3T38 A;  1L8Q A;  4YHH M;  3SAW A;  4GC9 A;  1G4A E;  2E5L M;  4QOS A;  4QNM A;  1DGB A;  3RGP A;  1H6U A;  3FUW A;  4LFC M;  5A2Q S;  3SAR A;  1IN8 A;  3U6M A;  3T1H M;  1HNZ M;  1J5E M;  3J2P B;  1R6B X;  3HJS A;  5IWA M;  2Z4S A;  3GPP A;  2Y0Q A;  4L16 A;  4MH0 E;  3THG A;  1T3T A;  4LGY A;  3AFH A;  3E9S A;  2QBY B;  1Z6T A;  3U61 B;  4DV3 M;  4S12 A;  2RGO A;  2XZF A;  4JI7 M;  2OPF A;  1E9R A;  4KO8 A;  3SFZ A;  1Z59 A;  3GQ3 A;  3VK8 A;  4LF6 M;  2CE7 A;  4LJ4 A;  2F5Q A;  3U5Z B;  3AOG A;  2QEN A;  3LQR A;  4L4U A;  1G8P A;  3K1J A;  3PNV A;  4MGZ E;  3TQS A;  4DUY M;  4X66 M;  3FUV A;  4R3D A;  1NNU C;  5FSW A;  3D8B A;  4LZJ A;  3KW6 A;  2R4E A;  1IN6 A;  1UM8 A;  4RNA A;  4REZ A;  1Z5C A;  4I81 A;  3LMM A;  2KZS A;  2XSZ A;  4PD2 A;  1GKI A;  2XFT A;  3TE6 A;  1SXJ B;  3GPY A;  3CF2 A;  4AI6 A;  1E9S A;  2H1R A;  4I4L A;  5EP4 A;  2QCU A;  4IBC A;  2QBY A;  3PNY A;  5EP1 A;  4B7H A;  3HU1 A;  4B3M M;  3FTE A;  2DVW B;  4FWG A;  4LG2 A;  1JR3 A;  5KQD A;  2D7E A;  3QWL A;  2K47 A;  3AL0 C;  4JI2 M;  1IBL M;  4W5W A;  4LF5 M;  1GLN A;  2X8A A;  3NBI A;  1DGH B;  3FUU A;  5ITY A;  4JV5 M;  4FW9 A;  1DO2 A;  1Z5A A;  3SAT A;  1DO0 A;  1HQC A;  3GP1 A;  2XFS A;  4NRV A;  3HU2 A;  4B7F A;  5KPT A;  2Q2E B;  4WW0 A;  4DV5 M;  4X64 M;  5ITQ A;  2LNH C;  4D81 A;  4NXM M;  2V6Z M;  1L2B A;  2L6O A;  1DGF A;  4PT5 A;  4BBA A;  1L2D A;  4KHP M;  2UXD M;  2J7N A;  1MU5 A;  3VDU A;  3K8Z A;  4FWD A;  2P5T A;  4II7 A;  4X65 M;  1IN5 A;  3J27 B;  2NQ8 C;  2YNM D;  1SXJ D;  4DV7 M;  1SXJ C;  5EQT A;  1GL6 A;  3EIE A;  1NY6 A;  1N33 M;  1Q3B A;  5EXS A;  1N75 A;  3ILK A;  1TH3 A;  4XBO A;  4GIT A;  1XNR M;  4ZPX A;  4DR2 M;  2C9O A;  2EUC A;  3WHL A;  5BR8 M;  1DGG A;  4G6Z A;  4Z6Y A;  3L25 A;  3U61 A;  3GPU A;  3L28 A;  4OW0 A;  2F5N A;  3QAU A;  3GO8 A;  2KA6 B;  1XC8 A;  3PFI A;  1IN4 A;  2HCB A;  2F5O A;  1N32 M;  2XZU A;  3SMS A;  4CGY B;  2ZAN A;  3A98 B;  1IN7 A;  4WUR A;  2V1C A;  4NL4 H;  5EP3 A;  1YUB A;  3FYC A;  2CFO A;  3SAS A;  3K92 A;  3HHW A;  5FTJ A;  4Z8X A;  5H37 D;  4LF9 M;  2R4J A;  3Q8X A;  1TDZ A;  2L7I A;  3ZCB B;  1WXQ A;  2KEB A;  4NOO B;  4DV6 M;  2L7H A;  3ZH9 B;  3U6C A;  2LH0 A;  4GKJ M;  1QAN A;  3FUT A;  3HHY A;  1NSF A;  3UMM A;  2F4V M;  4ITQ A;  3MK6 A;  4B3T M;  3JR5 A;  4HLQ A;  3MJ5 A;  5KPZ A;  3CF0 A;  4KOD A;  5DYI A;  2DXI A;  2DWM A;  3AOE A;  2EA0 A;  3L27 A;  1IXZ A;  3LVW A;  2UXB M;  4FVM A;  4M9S A;  4G4N A;  3JR4 A;  5LMN M;  1KSF X;  3PXG A;  1JQJ C;  4GMQ A;  1IQP A;  2X4A A;  5IT9 S;  4GIP A;  1LV7 A;  2KRU A;  3HHX A;  3SHG B;  2ERC A;  5EXX A;  2F5S A;  4MB7 A;  1XNQ M;  2JA2 A;  2QP9 X;  1IBK M;  1IY0 A;  3VKG A;  5EXP A;  3OTO M;  3GLF B;  1TH2 A;  4NRW A;  4OVZ B;  4G4R A;  4DR5 M;  1N36 M;  1Q3C A;  4LCB A;  1EE8 A;  1ORY B;  3FD9 A;  4B08 A;  2UUA M;  2F5P A;  1NJF A;  1W5S A;  4MGI E;  3IG8 A;  3IG5 A;  3TPZ A;  4QOZ C;  2ZBK B;  1XMO M;  1HT2 E;  4IJE A;  3GLG B;  1OJL A;  4FD2 A;  4OU7 A;  4DV0 M;  3GRY A;  1K3X A;  3SYK A;  2UUC M;  4QHT A;  1PJI A;  4QHS A;  3H4M A;  2DHR A;  4NSO B;  2CEA A;  4FWH A;  4GKK M;  4JYA M;  3KDS E;  4NSR A;  4OVZ A;  4LJA A;  2UUB M;  4I8O A;  4CHT B;  2Y0T A;  3SMP A;  3UGJ A;  1QAO A;  4A3V B;  5KQ8 A;  1W5T A;  4M9Z A;  4LRS A;  2YR0 A;  1Z5B A;  4AKI A;  1I94 M;  1R7R A;  4D80 A;  1I4W A;  4M9X A;  4XGI A;  2J7O A;  4M0D A;  1VDD A;  3MHV C;  4LF7 M;  2UU9 M;  3HHZ A;  3J80 S;  2YQZ A;  1N77 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...