4JI1M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
117
structure length
117
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 32
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ji1M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4ji1M02
5ITQA 1HR0M 1K3XA 1Q3BA 4DR7M 3U6EA 1HNZM 2OQ4A 1N34M 1XC8A 4LFCM 4B3TM 3SBJA 4GKJM 1N36M 2UXBM 1L2BA 2Q2EB 4DUZM 5ITTA 1XNQM 1XNRM 2UXCM 4NXMM 4JI8M 4JI3M 2XZUA 1EE8A 4DR4M 4JI7M 4DV7M 4NRVA 1IBMM 4DR3M 3GQ3A 2F5NA 4B3MM 5IT9S 3GPPA 5BR8M 5ITYA 4OX9M 4DR1M 4JV5M 3GPYA 5LMNM 2UUCM 5ITXE 3SASA 3U6CA 3SAUA 4JI1M 2UUAM 4B3RM 1L2DA 4JI2M 4KHPM 1K82A 4LF8M 5FLXS 1MU5A 1PM5A 4DUYM 1NNJA 1N33M 1TDHA 3W0FA 5A2QS 3U6OA 4DV2M 4ITQA 2ZM6M 5IWAM 1R2ZA 1Q3CA 1PJJA 1N32M 4DV6M 4MB7A 5ITUA 5ITRA 4JI6M 3SAVA 1K3WA 1Z5AA 3JAMS 1J5EM 3OTOM 3U6MA 4AQYM 4DV0M 1KFVA 2HKJA 4X65M 4LF6M 4X64M 3J81S 2ZBKB 4NRWA 4CISA 1Z5BA 4G4OA 1Z59A 3SATA 3U6QA 3U6LA 3JR5A 4DR6M 1L2CA 1FJGM 4JI0M 3GQ5A 2HHHM 4JI4M 2F5SA 5LMUM 4JI5M 3VK8A 3A45A 2F4VM 4LF7M 2E5LM 4DR2M 1XMOM 3A46A 3C58A 4X66M 4PCZA 1HNWM 3DOAA 3U6PA 4PDIA 3VK7A 3GPXA 3T1YM 1I94M 1IBLM 4YHHM 3JR4A 4G4QA 4LF9M 4G4NA 4PDGA 2UUBM 2UXDM 3SARA 3GP1A 2EA0A 4DV3M 3SAWA 2UU9M 4B3SM 3T1HM 4NXNM 2XZFA 1HNXM 1Z5CA 4PD2A 2VQFM 5ITXA 2OPFA 1XMQM 4YY3M 2F5OA 1IBKM 4JYAM 4G4RA 2VQEM 1R2YA 1MX0A 3A42A 1L1ZA 3J80S 2F5PA 3J7AS 4K0KM 2F5QA 1Q39A 3GQ4A 3TWMA 3U6DA 3U6SA 4DV5M 4X62M 1L1TA 4DR5M 3TWLA 3GO8A 4DV1M 4LF4M 4LF5M 4DV4M 1PJIA 3GPUA 4LFBM 4LFAM 4GKKM 1TDZA 3TWKA
chains in the Genus database with same CATH superfamily
1GVNA 5KPTA 3AOGA 5DYIA 3BXWA 4AKIA 3K92A 3B7NA 3HU2A 1GJTA 4IIWA 3U6EA 2R44A 5FTLA 2QNJA 3UK6A 1NVMA 1DGHB 3FD9A 2DAGA 1YE9A 2VDBB 4IBJA 2R62A 3TE6A 4R7GA 1DGBA 2CEAA 3LQRA 5L8RF 1XNRM 3FTDA 1IXSB 2YNMD 1IQPA 1D2NA 4GIPA 3Q8GA 4JI7M 2H1RA 5BPVA 3T6PA 3AFHA 2LXEA 2JWSA 2Y21A 4OVZB 5BR8M 1G3IA 2DHYA 4M0DA 3GRUA 3NWLA 3GRVA 2M60A 4P16A 4MGZE 1OTRA 3GLHB 3HJQA 1HT1E 3NBIA 4JI1M 2UUAM 4JI2M 3QAUA 4IBCA 1OIZA 5FLXS 2CV2A 2KXEA 3K8ZA 3WHLA 1T43A 1IN6A 1PJTA 4KODA 1N33M 1E9RA 1OJLA 3U6OA 4DV2M 4ITQA 2YQZA 2C5RA 2VF7A 1OIPA 1JR3E 2QCUA 2XSZA 4KLNA 5EP2A 4ANRA 3THGA 2G3QA 1A5TA 3J7BA 1GABA 5DFLA 4MB7A 4FCTA 5EP1A 1E94E 4KT0F 1Z5AA 4LJ6A 4IBDA 3M6AA 3U6MA 1KFVA 4QOZC 3U61B 4LZZA 3C3EA 3KXEC 4LF6M 4FCVA 4XGIA 1OQYA 4F2LA 2R0IA 4NRWA 1J09A 4LRSA 1IFYA 3SATA 2QP9X 3KOYE 2RKOA 7CATA 3JR5A 4DR6M 2HL7A 2JA2A 3RE8A 4QHSA 4IBFA 4G6ZA 3U5ZB 1NY5A 1WGLA 3FE3A 2L4FA 4JI5M 1NHWC 3SYLA 1QQWA 2ZTDA 3VK8A 3ILKA 4B7GA 2F4VM 3GLGB 3HHZA 2E5LM 1XMOM 2GNOA 3U60B 3E21A 2DAKA 1NV8A 3FYCA 4S12A 4QHTA 1HNWM 1QAMA 4FVMA 4IBKA 1TF0B 3GPXA 2JY6B 1G59A 3GLFB 1EIJA 2XGNA 4WW0A 2Z4SA 2L09A 5EXPA 5C18A 3SARA 3GP1A 3VDUA 2FNAA 2VF8A 2QSFX 2CHVA 3R8FA 3B7QA 1Z5CA 1N78A 2DNAA 1OFIA 2OPFA 4GHLA 3ZC7B 4JYAM 2KEBA 4G4RA 3GRYA 1NNUC 1WXQA 3M7GA 4IBEA 4WURA 2KHHA 3BBZA 4MGKE 2WZJA 3J2PB 1X37A 3FYDA 1YLAA 4IBBA 3T15A 3ZQJA 1EFUB 2OOBA 3U6SA 3LQQA 1L1TA 1WJ7A 3CF6E 4Y28F 2O25A 5KQ8A 4L4UA 2DWZB 3L26A 1XXHB 3ZH9B 1NO1A 2LBCA 2K9DA 2JUJA 3FUWA 4R3DA 1TDZA 1L2CA 3E46A 2UXBM 3TPZA 1SG9A 1GLNA 1Q3BA 2QBYB 4IBGA 4AKGA 3L29A 5IZ7D 3IECA 4DR7M 3FRHA 4TUWA 1XC8A 2Z3XA 2KA6B 3HGIA 1TH2A 2JY7A 1N77A 3H4MA 3WHKA 3SBJA 1DGGA 1T6OA 1IN4A 2CHQA 3CF0A 1VDLA 5ITTA 4M9SA 4DUZM 3DZDA 4NXMM 3KP1E 3W68A 2UXCM 3FUVA 4GH9A 2XZUA 4MM3B 2DXIA 4FWGA 4XBOA 3FUXA 2XSZD 2RGOA 4NRVA 2R4EA 1IBMM 2L4EA 3CF2A 2F5NA 4B3MM 1VDDA 2C96A 5ITYA 2D7GA 4L78A 1XWIA 3KW6A 4I81A 5KPZA 4JV5M 1MN3A 1IXRC 3RGSA 3EIHA 4AG6A 5LMNM 4NOOB 2UUCM 2R45A 5ITXE 1IY1A 2XF3A 4M0WA 3I4YA 3LCUA 1L2DA 4KHPM 2EKKA 1K82A 4LF8M 1T3TA 1WR1B 1P3QQ 1YSYA 3GRRA 2LVPC 3I4VA 3AOEA 3QYBA 1N75A 3C9PA 2DVWB 4QOSA 1JB0F 1QAOA 4AG5A 5F3WA 2GQFA 1FNNA 2KNAA 1TTEA 1AIPC 3FRIA 3KOXE 3T38A 4L16A 2Z7JA 1PJJA 4DV6M 4B7HA 2Y20A 4RF0A 4LZJA 4JI6M 1VG5A 3QYEA 4I8OA 3SAVA 1PJQA 4L8RC 3JAMS 5FTKA 1J5EM 4CIZA 4AQYM 2BJVA 4QNMA 3J81S 1VEKA 2ZBKB 3HY5A 3GLIB 1R5LA 2BJWA 3QWLA 1IY0A 4M9XA 4CISA 1Z5BA 1NSFA 4G4OA 3FTCA 3AV0A 3W67A 3AL0C 3SHFA 4Z6YA 2HWJA 3U6LA 1SXJE 1WGNA 2I7PA 5EXSA 1D0KA 5FTNA 4LCBA 2K6BA 1UFZA 5E6JA 1TH4A 2JY8A 3MK6A 3GQ5A 2HHHM 2LH0A 1L8QA 4FD2A 4OU7A 2D7EA 4AI6A 4IBIA 3D8BA 2R4JA 3KS4A 2XFTA 4X66M 3MMPA 2LVQD 4NL4H 4MGIE 2CP8A 4G4NA 4I5SA 4FCWA 2ZAOA 3TL4X 2EA0A 4GC5A 2Y0QA 4B3SM 3T1HM 3KS8A 1GL6A 1HNXM 2DZLA 1ZQ9A 2FH0A 3MJ5A 5GKNA 3DA1A 4R71A 5ITXA 2VQFM 2CV1A 4GHAA 1HT2E 5H37D 1E32A 1W5SA 2DWLA 1DO0A 2JP7A 2VQEM 3J80S 3HHYA 3I04M 3K1JA 4KO8A 4W5WA 2F5QA 2DWNA 1QAQA 2CE7A 3CTWB 3DFZA 3NBXX 2L2DA 2L6OA 4LGMA 5EXXA 3SMPA 3TWMA 1DV0A 1ZMVA 5EXTA 2JXNA 1S3SA 1I4WA 1GL7A 2G8LA 4A3VB 3TWLA 4B08A 4X62M 3GO8A 4DV1M 4DR5M 4LF4M 4DV4M 3IG5A 1D0LA 1ZMUA 3AJIB 1GO5A 1KYIA 3GPUA 4RNAA 1HQCA 2RGHA 3IHPA 3K2LA 4Z8XA 4LFAM 4GKKM 4LFBM 3GLIE 3UZUA 5ITQA 3GLHE 1IXZA 1K3XA 4DBGB 3HU1A 2V1UA 2L7HA 1QYRA 2OQ4A 1HNZM 1CUKA 2C99A 1PGYA 4LFCM 1BVSA 2K47A 2DWMA 1ZV1A 4GKJM 3AOEC 1XNQM 1SXJA 3IG8A 3HZJA 2YR0A 1Z6TA 2WSFF 2Z4RA 4JI3M 1EE8A 3HHXA 4DR4M 2QENA 1NV9A 2Y0TA 2ERCA 4DV7M 2KNZA 2C9OA 2KDLA 1JR3A 2R46A 3FTFA 1TH3A 2LTUA 2EJSA 4FWDA 4L6V6 1QVRA 3SFZA 3UGJA 4OX9M 2JZ0A 4IJEA 2FOIC 4RF1A 5C1BA 3F92A 3GPYA 2W82A 1VEJA 5JI2E 2ZANA 3SASA 3U6CA 1DO2A 3SAUA 2ZTCA 4FW9A 5EQTA 2Z8YM 1OAIA 4BBAA 1DGHA 2LVNC 3KFUG 1H6UA 3H4JA 5EP4A 1TDHA 5A2QS 1NNJA 3FTEA 2FS1A 2ZM6M 3HJSA 3PNYA 5JI3E 1QZMA 3GLGE 1C1KA 1IXSA 4IJFA 1Q3CA 2CHGA 2KNVA 3RGPA 2DENA 1N32M 3M0EA 3L25A 4L15A 5ITUA 5ITRA 3GLFE 1K3WA 2ZAMA 3E9SA 5KQDA 2HCBA 2FFJA 2LHCA 1ZAEA 4OVZA 3OTOM 3CGWA 4AW4A 2HKJA 1IN8A 3LVVA 4X64M 3SC3A 2J7OA 1ORYB 4LJ5A 3GLHA 3I01M 3L27A 4Q7JA 3R9XB 4MH0E 1WHCA 3HU3A 3U6QA 2DI0A 1J7KA 2FE8A 4GEWA 1FJGM 2M5ZA 5KO3A 1G8PA 2DAIA 2N35A 3VFDA 2F5SA 1NHGC 2LVOC 2R65A 1HJPA 2R6FA 3A45A 1V33A 3FUTA 2V1CA 4LJ8A 4LF7M 1G41A 1XXHE 2MGWA 2MJ5B 3SYKA 4DR2M 3A46A 4PT5A 1C7YA 5FTMA 4BB9A 3U6PA 3VK7A 4LJAA 1I94M 2DHRA 3HJ8A 4G4QA 2UXDM 4LF9M 4PDGA 2QHOB 1PJSA 4GC9A 3U61A 4DV3M 1W5TA 2UU9M 4II7A 1IY2A 4NXNM 2LHGA 3ZCBB 4PD2A 2J5YA 1D0MA 4GMQA 4YY3M 1OFHA 4LJ9A 2DAEA 3VDPA 4NC6A 1Q02A 3J27B 2QQ8A 1SXJC 4QNRA 1MX0A 3A42A 4G3OA 1L1ZA 3U5ZA 1G4AE 4K0KM 5DYGA 1QZEA 1SXJD 3GQ4A 2KRKA 4HLQA 3GLGA 3B9PA 4DV5M 3W0LB 1XHBA 2XLJA 2JY5A 3B89A 4WP2A 3U60A 1PJIA 4D80A 4LF5M 1JR3D 2JZ1A 2RRUA 4HEOA 3TWKA 3GLFA 1HR0M 3HHWA 3Q8XA 2J7NA 3AKZA 3KOWE 1WIVA 2EO2A 3MHVC 4LJ7A 1N34M 4B7FA 2CFOA 4XK8F 4B3TM 2K0BX 2D7HA 3KSJA 4MGYE 3L28A 1N36M 4LY6A 2L7IA 3FUUA 1L2BA 2Q2EB 1MJGM 1QDRA 4JI8M 5EJCA 1TGUA 3LCVB 1QANA 2CV0A 2X8AA 2QZ4A 1NY6A 3HKPA 4DR3M 1F4IA 3PXGA 3GQ3A 3I51A 1OAOC 5IT9S 2BWBA 2EUCA 2B3TA 1XXHA 4P17A 2O01F 2DZNB 4ZPXA 3GPPA 3SHGB 5EP3A 2P5TA 4DR1M 3VKHA 3C3DA 2BWEA 2X49A 3EIEA 2BNKA 2HAKA 3V76A 2MH8A 2QBYA 1IN5A 4NSRA 1PRBA 3BOSA 4LG2A 4UN2B 4B3RM 1R7RA 2I7NA 5FTJA 1R6BX 1MU5A 1LTMA 4M9ZA 1PM5A 2JNHA 4DUYM 2VIIA 4GRIA 1HQYE 3RFWA 3W0FA 3FKEA 8CATA 2WSCF 2CUZA 2OOAA 4D82A 2DKLA 5IWAM 1R2ZA 2KRUA 2CRUA 3VLFB 3KOZE 4JXJA 2G5GX 3D8LA 1ZMWA 1V92A 2A5YB 1GKIA 3PFIA 4I4LA 3HWSA 2KW0A 4HL4A 4F1IA 2H5XA 1IN7A 4DV0M 1NJGA 4GITA 4X65M 2DAMA 3KSXA 5KPRA 2C9CA 4JN6A 3LVWA 2MROB 1Y8GA 2LWXA 1VQ1A 2APLA 2V6ZM 1IM2A 3B74A 4LRTA 1Z59A 1TR8A 1V34A 3L2AA 2XFSA 1GJSA 4FWHA 4REZA 4NSOB 4JI0M 2C98A 2X4AA 1RU3A 4D81A 4MGHA 1R4GA 3SMSA 4JI4M 1QUSA 5LMUM 1E9SA 2O5RA 3HX3A 2R18A 2YFQA 1UM8A 5E26A 4AZFA 4OW0A 3C58A 4PCZA 3A98B 3PNVA 3DOAA 3PVSA 4PDIA 1IBLM 3T1YM 4EIWA 3UJNA 1VEGA 4YHHM 1NJFA 3JR4A 2UUBM 1KSFX 2OO9A 1QDTA 2XH9A 5DNYA 3SAWA 3LMMA 1YUBA 2XZFA 3UMMA 3VKGA 3K9OA 3GLIA 3B7ZA 2XEPA 2EKFA 3KVWA 3KDSE 1XMQM 2AHMA 2QPAA 4BLCA 2F5OA 1IBKM 1AUAA 2CWBA 1R2YA 4AKHA 1XB2B 1SXJB 2MR9A 4RKUF 5IREB 5FSWA 2F5PA 2NQ8C 3J7AS 2WSEF 4LGYA 1OKSA 2KZSA 1LV7A 4CJ6A 1Q39A 3U6DA 2LVAA 1G71A 4CHTB 2KZUA 3K9PA 4CGYB 3LW5F 1DGFA 1JQJC 2DZOB 2LNHC 3E4RA 3TQSA 3KP0E 1QUTA 4LJ4A
chains in the Genus database with same CATH topology
1GVNA 5KPTA 3AOGA 5DYIA 4AKIA 3K92A 3HU2A 4IIWA 3U6EA 5FTLA 3UK6A 1NVMA 1DGHB 3FD9A 1YE9A 4IBJA 2R62A 3TE6A 4R7GA 1DGBA 2CEAA 3LQRA 1XNRM 3FTDA 1IXSB 2YNMD 1IQPA 1D2NA 4GIPA 4JI7M 2H1RA 5BPVA 3AFHA 2LXEA 2Y21A 4OVZB 5BR8M 1G3IA 4M0DA 3GRUA 3NWLA 3GRVA 2M60A 4P16A 4MGZE 3GLHB 3HJQA 1HT1E 3NBIA 4JI1M 2UUAM 4JI2M 3QAUA 4IBCA 5FLXS 2CV2A 2KXEA 3K8ZA 3WHLA 1IN6A 4KODA 1N33M 1E9RA 1OJLA 3U6OA 4DV2M 4ITQA 2YQZA 2C5RA 2XSZA 2QCUA 4KLNA 5EP2A 3THGA 3J7BA 4MB7A 4FCTA 5EP1A 1E94E 1Z5AA 4LJ6A 4IBDA 3M6AA 3U6MA 1KFVA 4QOZC 3U61B 4LZZA 3KXEC 4LF6M 4FCVA 4XGIA 4NRWA 1J09A 4LRSA 3SATA 2QP9X 3KOYE 2RKOA 7CATA 3JR5A 4DR6M 2HL7A 2JA2A 3RE8A 4QHSA 4IBFA 4G6ZA 3U5ZB 1NY5A 4JI5M 1NHWC 3SYLA 1QQWA 3VK8A 3ILKA 4B7GA 2F4VM 3GLGB 3HHZA 2E5LM 1XMOM 3U60B 4S12A 3FYCA 4QHTA 1HNWM 1QAMA 4FVMA 4IBKA 1G59A 3GPXA 3GLFB 2XGNA 4WW0A 2Z4SA 2L09A 5EXPA 5C18A 3SARA 3GP1A 3VDUA 2FNAA 2CHVA 3R8FA 1Z5CA 1N78A 1OFIA 2OPFA 4GHLA 3ZC7B 4JYAM 2KEBA 4G4RA 3GRYA 1NNUC 1WXQA 3M7GA 4IBEA 4WURA 4MGKE 3J2PB 1X37A 3FYDA 3T15A 4IBBA 3U6SA 3LQQA 1L1TA 3CF6E 5KQ8A 4L4UA 2DWZB 3L26A 1XXHB 3ZH9B 1TDZA 1L2CA 2UXBM 3FUWA 4R3DA 3TPZA 1GLNA 1Q3BA 2QBYB 4IBGA 4AKGA 3L29A 5IZ7D 4DR7M 4TUWA 1XC8A 2Z3XA 2KA6B 3HGIA 1TH2A 1N77A 3H4MA 3WHKA 3SBJA 1DGGA 1IN4A 2CHQA 3CF0A 5ITTA 4DUZM 4M9SA 3DZDA 4NXMM 3KP1E 2UXCM 3FUVA 4GH9A 2XZUA 4MM3B 2DXIA 4FWGA 4XBOA 3FUXA 2XSZD 2RGOA 4NRVA 2R4EA 1IBMM 3CF2A 2F5NA 4B3MM 1VDDA 2C96A 5ITYA 2D7GA 4L78A 1XWIA 3KW6A 4I81A 5KPZA 4JV5M 1IXRC 3RGSA 3EIHA 4AG6A 5LMNM 4NOOB 2UUCM 2R45A 5ITXE 1IY1A 2XF3A 4M0WA 3I4YA 1L2DA 4KHPM 1K82A 4LF8M 1T3TA 1YSYA 3GRRA 3FTEA 3I4VA 3AOEA 5F3WA 1N75A 2DVWB 4QOSA 4AG5A 1QAOA 1FNNA 3KOXE 3T38A 1PJJA 4L16A 2Z7JA 4DV6M 4B7HA 2Y20A 4RF0A 4LZJA 4JI6M 4I8OA 3SAVA 4L8RC 3JAMS 5FTKA 1J5EM 4AQYM 2BJVA 4QNMA 3J81S 2ZBKB 3GLIB 3QWLA 2BJWA 1IY0A 4M9XA 4CISA 1Z5BA 1NSFA 4G4OA 3FTCA 3AV0A 3AL0C 3SHFA 4Z6YA 3U6LA 1SXJE 2I7PA 5EXSA 5FTNA 4LCBA 5E6JA 1TH4A 3MK6A 3GQ5A 2HHHM 2LH0A 1L8QA 4FD2A 4OU7A 2D7EA 4AI6A 4IBIA 3D8BA 2R4JA 3KS4A 2XFTA 4X66M 4NL4H 4MGIE 4G4NA 4I5SA 4FCWA 2ZAOA 3TL4X 2EA0A 4GC5A 2Y0QA 4B3SM 3T1HM 3KS8A 1GL6A 1HNXM 1ZQ9A 3MJ5A 5GKNA 3DA1A 2VQFM 5ITXA 2CV1A 4GHAA 1HT2E 5H37D 1E32A 1W5SA 2DWLA 1DO0A 2VQEM 3J80S 3HHYA 3K1JA 4KO8A 4W5WA 2F5QA 2DWNA 1QAQA 2CE7A 3CTWB 3DFZA 4LGMA 5EXXA 2L6OA 3SMPA 3TWMA 5EXTA 1S3SA 1I4WA 1GL7A 2G8LA 4A3VB 3TWLA 4B08A 4X62M 3GO8A 4DV1M 4DR5M 4LF4M 4DV4M 3IG5A 3AJIB 1KYIA 3GPUA 4RNAA 2RGHA 1HQCA 3K2LA 4LFAM 4Z8XA 4GKKM 4LFBM 3UZUA 5ITQA 1K3XA 1IXZA 3HU1A 2V1UA 2L7HA 1QYRA 2OQ4A 1HNZM 2C99A 4LFCM 2K47A 2DWMA 4GKJM 3AOEC 1XNQM 1SXJA 3IG8A 2YR0A 1Z6TA 2Z4RA 4JI3M 4DR4M 1EE8A 3HHXA 2QENA 2Y0TA 4DV7M 2ERCA 2C9OA 1JR3A 2R46A 3FTFA 1TH3A 4FWDA 3SFZA 1QVRA 3UGJA 4OX9M 4IJEA 4RF1A 2FOIC 5C1BA 3GPYA 2W82A 5JI2E 2ZANA 3SASA 3U6CA 1DO2A 3SAUA 4FW9A 5EQTA 4BBAA 1DGHA 3KFUG 1H6UA 5EP4A 1NNJA 1TDHA 5A2QS 2ZM6M 3HJSA 3PNYA 5JI3E 1QZMA 1C1KA 4IJFA 1Q3CA 2CHGA 3RGPA 1N32M 3M0EA 3L25A 4L15A 5ITUA 5ITRA 1K3WA 2ZAMA 3E9SA 5KQDA 2HCBA 2FFJA 1ZAEA 4OVZA 3OTOM 4AW4A 2HKJA 1IN8A 3LVVA 4X64M 3SC3A 2J7OA 1ORYB 4LJ5A 3GLHA 3L27A 3R9XB 4MH0E 3HU3A 3U6QA 1J7KA 2FE8A 1FJGM 2M5ZA 5KO3A 1G8PA 3VFDA 2F5SA 1NHGC 2R65A 3A45A 3FUTA 2V1CA 4LJ8A 4LF7M 1G41A 3SYKA 4DR2M 3A46A 4PT5A 5FTMA 4BB9A 3U6PA 3VK7A 4LJAA 1I94M 2DHRA 3HJ8A 4G4QA 2UXDM 4LF9M 4PDGA 4GC9A 3U61A 4DV3M 1W5TA 2UU9M 4II7A 1IY2A 4NXNM 3ZCBB 4PD2A 4GMQA 4YY3M 1OFHA 4LJ9A 3VDPA 3J27B 1SXJC 4QNRA 1MX0A 3A42A 1L1ZA 3U5ZA 1G4AE 4K0KM 5DYGA 1SXJD 3GQ4A 2KRKA 4HLQA 3GLGA 3B9PA 4DV5M 3W0LB 1XHBA 2XLJA 3U60A 4LF5M 1PJIA 4D80A 1JR3D 3TWKA 3GLFA 1HR0M 3HHWA 3Q8XA 2J7NA 3AKZA 3KOWE 2EO2A 3MHVC 4LJ7A 1N34M 4B7FA 2CFOA 4B3TM 2D7HA 3KSJA 4MGYE 3L28A 1N36M 4LY6A 2L7IA 3FUUA 1L2BA 2Q2EB 4JI8M 5EJCA 1TGUA 1QANA 2CV0A 2X8AA 2QZ4A 1NY6A 3HKPA 4DR3M 3PXGA 3GQ3A 3I51A 5IT9S 2EUCA 1XXHA 2DZNB 4ZPXA 3GPPA 3SHGB 5EP3A 2P5TA 4DR1M 3VKHA 2X49A 3EIEA 2BNKA 2QBYA 1IN5A 4NSRA 4LG2A 3BOSA 4B3RM 1R7RA 2I7NA 5FTJA 1R6BX 1MU5A 4M9ZA 1PM5A 4DUYM 2VIIA 4GRIA 1HQYE 3RFWA 3W0FA 3FKEA 8CATA 2CUZA 5IWAM 4D82A 1R2ZA 2KRUA 3VLFB 3KOZE 4JXJA 2G5GX 3D8LA 2A5YB 1GKIA 3PFIA 4I4LA 3HWSA 2KW0A 4HL4A 4DV0M 1IN7A 1NJGA 4GITA 4X65M 3KSXA 5KPRA 2C9CA 4JN6A 3LVWA 2V6ZM 2LWXA 1IM2A 4LRTA 1Z59A 3L2AA 2XFSA 4FWHA 4REZA 4NSOB 4JI0M 2C98A 2X4AA 4D81A 4MGHA 4JI4M 3SMSA 5LMUM 1E9SA 2O5RA 2R18A 2YFQA 1UM8A 5E26A 4AZFA 4OW0A 3C58A 4PCZA 3A98B 3PNVA 3DOAA 3PVSA 4PDIA 1IBLM 3T1YM 4EIWA 3UJNA 4YHHM 3JR4A 1NJFA 2UUBM 1KSFX 2XH9A 5DNYA 3SAWA 3LMMA 1YUBA 2XZFA 3UMMA 3VKGA 3GLIA 2XEPA 3KVWA 3KDSE 1XMQM 2AHMA 2QPAA 4BLCA 2F5OA 1IBKM 1R2YA 4AKHA 1SXJB 5IREB 5FSWA 2F5PA 2NQ8C 3J7AS 4LGYA 2KZSA 1LV7A 1Q39A 3U6DA 4CHTB 2KZUA 4CGYB 1DGFA 1JQJC 2DZOB 2LNHC 3E4RA 3TQSA 3KP0E 4LJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ITQ A;  1HR0 M;  1K3X A;  1Q3B A;  4DR7 M;  3U6E A;  1HNZ M;  2OQ4 A;  1N34 M;  1XC8 A;  4LFC M;  4B3T M;  3SBJ A;  4GKJ M;  1N36 M;  2UXB M;  1L2B A;  2Q2E B;  4DUZ M;  5ITT A;  1XNQ M;  1XNR M;  2UXC M;  4NXM M;  4JI8 M;  4JI3 M;  2XZU A;  1EE8 A;  4DR4 M;  4JI7 M;  4DV7 M;  4NRV A;  1IBM M;  4DR3 M;  3GQ3 A;  2F5N A;  4B3M M;  5IT9 S;  3GPP A;  5BR8 M;  5ITY A;  4OX9 M;  4DR1 M;  4JV5 M;  3GPY A;  5LMN M;  2UUC M;  5ITX E;  3SAS A;  3U6C A;  3SAU A;  4JI1 M;  2UUA M;  4B3R M;  1L2D A;  4JI2 M;  4KHP M;  1K82 A;  4LF8 M;  5FLX S;  1MU5 A;  1PM5 A;  4DUY M;  1NNJ A;  1N33 M;  1TDH A;  3W0F A;  5A2Q S;  3U6O A;  4DV2 M;  4ITQ A;  2ZM6 M;  5IWA M;  1R2Z A;  1Q3C A;  1PJJ A;  1N32 M;  4DV6 M;  4MB7 A;  5ITU A;  5ITR A;  4JI6 M;  3SAV A;  1K3W A;  1Z5A A;  3JAM S;  1J5E M;  3OTO M;  3U6M A;  4AQY M;  4DV0 M;  1KFV A;  2HKJ A;  4X65 M;  4LF6 M;  4X64 M;  3J81 S;  2ZBK B;  4NRW A;  4CIS A;  1Z5B A;  4G4O A;  1Z59 A;  3SAT A;  3U6Q A;  3U6L A;  3JR5 A;  4DR6 M;  1L2C A;  1FJG M;  4JI0 M;  3GQ5 A;  2HHH M;  4JI4 M;  2F5S A;  5LMU M;  4JI5 M;  3VK8 A;  3A45 A;  2F4V M;  4LF7 M;  2E5L M;  4DR2 M;  1XMO M;  3A46 A;  3C58 A;  4X66 M;  4PCZ A;  1HNW M;  3DOA A;  3U6P A;  4PDI A;  3VK7 A;  3GPX A;  3T1Y M;  1I94 M;  1IBL M;  4YHH M;  3JR4 A;  4G4Q A;  4LF9 M;  4G4N A;  4PDG A;  2UUB M;  2UXD M;  3SAR A;  3GP1 A;  2EA0 A;  4DV3 M;  3SAW A;  2UU9 M;  4B3S M;  3T1H M;  4NXN M;  2XZF A;  1HNX M;  1Z5C A;  4PD2 A;  2VQF M;  5ITX A;  2OPF A;  1XMQ M;  4YY3 M;  2F5O A;  1IBK M;  4JYA M;  4G4R A;  2VQE M;  1R2Y A;  1MX0 A;  3A42 A;  1L1Z A;  3J80 S;  2F5P A;  3J7A S;  4K0K M;  2F5Q A;  1Q39 A;  3GQ4 A;  3TWM A;  3U6D A;  3U6S A;  4DV5 M;  4X62 M;  1L1T A;  4DR5 M;  3TWL A;  3GO8 A;  4DV1 M;  4LF4 M;  4LF5 M;  4DV4 M;  1PJI A;  3GPU A;  4LFB M;  4LFA M;  4GKK M;  1TDZ A;  3TWK A; 
#chains in the Genus database with same CATH topology
 1GVN A;  5KPT A;  3AOG A;  5DYI A;  3BXW A;  4AKI A;  3K92 A;  3B7N A;  3HU2 A;  1GJT A;  4IIW A;  3U6E A;  2R44 A;  5FTL A;  2QNJ A;  3UK6 A;  1NVM A;  1DGH B;  3FD9 A;  2DAG A;  1YE9 A;  2VDB B;  4IBJ A;  2R62 A;  3TE6 A;  4R7G A;  1DGB A;  2CEA A;  3LQR A;  5L8R F;  1XNR M;  3FTD A;  1IXS B;  2YNM D;  1IQP A;  1D2N A;  4GIP A;  3Q8G A;  4JI7 M;  2H1R A;  5BPV A;  3T6P A;  3AFH A;  2LXE A;  2JWS A;  2Y21 A;  4OVZ B;  5BR8 M;  1G3I A;  2DHY A;  4M0D A;  3GRU A;  3NWL A;  3GRV A;  2M60 A;  4P16 A;  4MGZ E;  1OTR A;  3GLH B;  3HJQ A;  1HT1 E;  3NBI A;  4JI1 M;  2UUA M;  4JI2 M;  3QAU A;  4IBC A;  1OIZ A;  5FLX S;  2CV2 A;  2KXE A;  3K8Z A;  3WHL A;  1T43 A;  1IN6 A;  1PJT A;  4KOD A;  1N33 M;  1E9R A;  1OJL A;  3U6O A;  4DV2 M;  4ITQ A;  2YQZ A;  2C5R A;  2VF7 A;  1OIP A;  1JR3 E;  2QCU A;  2XSZ A;  4KLN A;  5EP2 A;  4ANR A;  3THG A;  2G3Q A;  1A5T A;  3J7B A;  1GAB A;  5DFL A;  4MB7 A;  4FCT A;  5EP1 A;  1E94 E;  4KT0 F;  1Z5A A;  4LJ6 A;  4IBD A;  3M6A A;  3U6M A;  1KFV A;  4QOZ C;  3U61 B;  4LZZ A;  3C3E A;  3KXE C;  4LF6 M;  4FCV A;  4XGI A;  1OQY A;  4F2L A;  2R0I A;  4NRW A;  1J09 A;  4LRS A;  1IFY A;  3SAT A;  2QP9 X;  3KOY E;  2RKO A;  7CAT A;  3JR5 A;  4DR6 M;  2HL7 A;  2JA2 A;  3RE8 A;  4QHS A;  4IBF A;  4G6Z A;  3U5Z B;  1NY5 A;  1WGL A;  3FE3 A;  2L4F A;  4JI5 M;  1NHW C;  3SYL A;  1QQW A;  2ZTD A;  3VK8 A;  3ILK A;  4B7G A;  2F4V M;  3GLG B;  3HHZ A;  2E5L M;  1XMO M;  2GNO A;  3U60 B;  3E21 A;  2DAK A;  1NV8 A;  3FYC A;  4S12 A;  4QHT A;  1HNW M;  1QAM A;  4FVM A;  4IBK A;  1TF0 B;  3GPX A;  2JY6 B;  1G59 A;  3GLF B;  1EIJ A;  2XGN A;  4WW0 A;  2Z4S A;  2L09 A;  5EXP A;  5C18 A;  3SAR A;  3GP1 A;  3VDU A;  2FNA A;  2VF8 A;  2QSF X;  2CHV A;  3R8F A;  3B7Q A;  1Z5C A;  1N78 A;  2DNA A;  1OFI A;  2OPF A;  4GHL A;  3ZC7 B;  4JYA M;  2KEB A;  4G4R A;  3GRY A;  1NNU C;  1WXQ A;  3M7G A;  4IBE A;  4WUR A;  2KHH A;  3BBZ A;  4MGK E;  2WZJ A;  3J2P B;  1X37 A;  3FYD A;  1YLA A;  4IBB A;  3T15 A;  3ZQJ A;  1EFU B;  2OOB A;  3U6S A;  3LQQ A;  1L1T A;  1WJ7 A;  3CF6 E;  4Y28 F;  2O25 A;  5KQ8 A;  4L4U A;  2DWZ B;  3L26 A;  1XXH B;  3ZH9 B;  1NO1 A;  2LBC A;  2K9D A;  2JUJ A;  3FUW A;  4R3D A;  1TDZ A;  1L2C A;  3E46 A;  2UXB M;  3TPZ A;  1SG9 A;  1GLN A;  1Q3B A;  2QBY B;  4IBG A;  4AKG A;  3L29 A;  5IZ7 D;  3IEC A;  4DR7 M;  3FRH A;  4TUW A;  1XC8 A;  2Z3X A;  2KA6 B;  3HGI A;  1TH2 A;  2JY7 A;  1N77 A;  3H4M A;  3WHK A;  3SBJ A;  1DGG A;  1T6O A;  1IN4 A;  2CHQ A;  3CF0 A;  1VDL A;  5ITT A;  4M9S A;  4DUZ M;  3DZD A;  4NXM M;  3KP1 E;  3W68 A;  2UXC M;  3FUV A;  4GH9 A;  2XZU A;  4MM3 B;  2DXI A;  4FWG A;  4XBO A;  3FUX A;  2XSZ D;  2RGO A;  4NRV A;  2R4E A;  1IBM M;  2L4E A;  3CF2 A;  2F5N A;  4B3M M;  1VDD A;  2C96 A;  5ITY A;  2D7G A;  4L78 A;  1XWI A;  3KW6 A;  4I81 A;  5KPZ A;  4JV5 M;  1MN3 A;  1IXR C;  3RGS A;  3EIH A;  4AG6 A;  5LMN M;  4NOO B;  2UUC M;  2R45 A;  5ITX E;  1IY1 A;  2XF3 A;  4M0W A;  3I4Y A;  3LCU A;  1L2D A;  4KHP M;  2EKK A;  1K82 A;  4LF8 M;  1T3T A;  1WR1 B;  1P3Q Q;  1YSY A;  3GRR A;  2LVP C;  3I4V A;  3AOE A;  3QYB A;  1N75 A;  3C9P A;  2DVW B;  4QOS A;  1JB0 F;  1QAO A;  4AG5 A;  5F3W A;  2GQF A;  1FNN A;  2KNA A;  1TTE A;  1AIP C;  3FRI A;  3KOX E;  3T38 A;  4L16 A;  2Z7J A;  1PJJ A;  4DV6 M;  4B7H A;  2Y20 A;  4RF0 A;  4LZJ A;  4JI6 M;  1VG5 A;  3QYE A;  4I8O A;  3SAV A;  1PJQ A;  4L8R C;  3JAM S;  5FTK A;  1J5E M;  4CIZ A;  4AQY M;  2BJV A;  4QNM A;  3J81 S;  1VEK A;  2ZBK B;  3HY5 A;  3GLI B;  1R5L A;  2BJW A;  3QWL A;  1IY0 A;  4M9X A;  4CIS A;  1Z5B A;  1NSF A;  4G4O A;  3FTC A;  3AV0 A;  3W67 A;  3AL0 C;  3SHF A;  4Z6Y A;  2HWJ A;  3U6L A;  1SXJ E;  1WGN A;  2I7P A;  5EXS A;  1D0K A;  5FTN A;  4LCB A;  2K6B A;  1UFZ A;  5E6J A;  1TH4 A;  2JY8 A;  3MK6 A;  3GQ5 A;  2HHH M;  2LH0 A;  1L8Q A;  4FD2 A;  4OU7 A;  2D7E A;  4AI6 A;  4IBI A;  3D8B A;  2R4J A;  3KS4 A;  2XFT A;  4X66 M;  3MMP A;  2LVQ D;  4NL4 H;  4MGI E;  2CP8 A;  4G4N A;  4I5S A;  4FCW A;  2ZAO A;  3TL4 X;  2EA0 A;  4GC5 A;  2Y0Q A;  4B3S M;  3T1H M;  3KS8 A;  1GL6 A;  1HNX M;  2DZL A;  1ZQ9 A;  2FH0 A;  3MJ5 A;  5GKN A;  3DA1 A;  4R71 A;  5ITX A;  2VQF M;  2CV1 A;  4GHA A;  1HT2 E;  5H37 D;  1E32 A;  1W5S A;  2DWL A;  1DO0 A;  2JP7 A;  2VQE M;  3J80 S;  3HHY A;  3I04 M;  3K1J A;  4KO8 A;  4W5W A;  2F5Q A;  2DWN A;  1QAQ A;  2CE7 A;  3CTW B;  3DFZ A;  3NBX X;  2L2D A;  2L6O A;  4LGM A;  5EXX A;  3SMP A;  3TWM A;  1DV0 A;  1ZMV A;  5EXT A;  2JXN A;  1S3S A;  1I4W A;  1GL7 A;  2G8L A;  4A3V B;  3TWL A;  4B08 A;  4X62 M;  3GO8 A;  4DV1 M;  4DR5 M;  4LF4 M;  4DV4 M;  3IG5 A;  1D0L A;  1ZMU A;  3AJI B;  1GO5 A;  1KYI A;  3GPU A;  4RNA A;  1HQC A;  2RGH A;  3IHP A;  3K2L A;  4Z8X A;  4LFA M;  4GKK M;  4LFB M;  3GLI E;  3UZU A;  5ITQ A;  3GLH E;  1IXZ A;  1K3X A;  4DBG B;  3HU1 A;  2V1U A;  2L7H A;  1QYR A;  2OQ4 A;  1HNZ M;  1CUK A;  2C99 A;  1PGY A;  4LFC M;  1BVS A;  2K47 A;  2DWM A;  1ZV1 A;  4GKJ M;  3AOE C;  1XNQ M;  1SXJ A;  3IG8 A;  3HZJ A;  2YR0 A;  1Z6T A;  2WSF F;  2Z4R A;  4JI3 M;  1EE8 A;  3HHX A;  4DR4 M;  2QEN A;  1NV9 A;  2Y0T A;  2ERC A;  4DV7 M;  2KNZ A;  2C9O A;  2KDL A;  1JR3 A;  2R46 A;  3FTF A;  1TH3 A;  2LTU A;  2EJS A;  4FWD A;  4L6V 6;  1QVR A;  3SFZ A;  3UGJ A;  4OX9 M;  2JZ0 A;  4IJE A;  2FOI C;  4RF1 A;  5C1B A;  3F92 A;  3GPY A;  2W82 A;  1VEJ A;  5JI2 E;  2ZAN A;  3SAS A;  3U6C A;  1DO2 A;  3SAU A;  2ZTC A;  4FW9 A;  5EQT A;  2Z8Y M;  1OAI A;  4BBA A;  1DGH A;  2LVN C;  3KFU G;  1H6U A;  3H4J A;  5EP4 A;  1TDH A;  5A2Q S;  1NNJ A;  3FTE A;  2FS1 A;  2ZM6 M;  3HJS A;  3PNY A;  5JI3 E;  1QZM A;  3GLG E;  1C1K A;  1IXS A;  4IJF A;  1Q3C A;  2CHG A;  2KNV A;  3RGP A;  2DEN A;  1N32 M;  3M0E A;  3L25 A;  4L15 A;  5ITU A;  5ITR A;  3GLF E;  1K3W A;  2ZAM A;  3E9S A;  5KQD A;  2HCB A;  2FFJ A;  2LHC A;  1ZAE A;  4OVZ A;  3OTO M;  3CGW A;  4AW4 A;  2HKJ A;  1IN8 A;  3LVV A;  4X64 M;  3SC3 A;  2J7O A;  1ORY B;  4LJ5 A;  3GLH A;  3I01 M;  3L27 A;  4Q7J A;  3R9X B;  4MH0 E;  1WHC A;  3HU3 A;  3U6Q A;  2DI0 A;  1J7K A;  2FE8 A;  4GEW A;  1FJG M;  2M5Z A;  5KO3 A;  1G8P A;  2DAI A;  2N35 A;  3VFD A;  2F5S A;  1NHG C;  2LVO C;  2R65 A;  1HJP A;  2R6F A;  3A45 A;  1V33 A;  3FUT A;  2V1C A;  4LJ8 A;  4LF7 M;  1G41 A;  1XXH E;  2MGW A;  2MJ5 B;  3SYK A;  4DR2 M;  3A46 A;  4PT5 A;  1C7Y A;  5FTM A;  4BB9 A;  3U6P A;  3VK7 A;  4LJA A;  1I94 M;  2DHR A;  3HJ8 A;  4G4Q A;  2UXD M;  4LF9 M;  4PDG A;  2QHO B;  1PJS A;  4GC9 A;  3U61 A;  4DV3 M;  1W5T A;  2UU9 M;  4II7 A;  1IY2 A;  4NXN M;  2LHG A;  3ZCB B;  4PD2 A;  2J5Y A;  1D0M A;  4GMQ A;  4YY3 M;  1OFH A;  4LJ9 A;  2DAE A;  3VDP A;  4NC6 A;  1Q02 A;  3J27 B;  2QQ8 A;  1SXJ C;  4QNR A;  1MX0 A;  3A42 A;  4G3O A;  1L1Z A;  3U5Z A;  1G4A E;  4K0K M;  5DYG A;  1QZE A;  1SXJ D;  3GQ4 A;  2KRK A;  4HLQ A;  3GLG A;  3B9P A;  4DV5 M;  3W0L B;  1XHB A;  2XLJ A;  2JY5 A;  3B89 A;  4WP2 A;  3U60 A;  1PJI A;  4D80 A;  4LF5 M;  1JR3 D;  2JZ1 A;  2RRU A;  4HEO A;  3TWK A;  3GLF A;  1HR0 M;  3HHW A;  3Q8X A;  2J7N A;  3AKZ A;  3KOW E;  1WIV A;  2EO2 A;  3MHV C;  4LJ7 A;  1N34 M;  4B7F A;  2CFO A;  4XK8 F;  4B3T M;  2K0B X;  2D7H A;  3KSJ A;  4MGY E;  3L28 A;  1N36 M;  4LY6 A;  2L7I A;  3FUU A;  1L2B A;  2Q2E B;  1MJG M;  1QDR A;  4JI8 M;  5EJC A;  1TGU A;  3LCV B;  1QAN A;  2CV0 A;  2X8A A;  2QZ4 A;  1NY6 A;  3HKP A;  4DR3 M;  1F4I A;  3PXG A;  3GQ3 A;  3I51 A;  1OAO C;  5IT9 S;  2BWB A;  2EUC A;  2B3T A;  1XXH A;  4P17 A;  2O01 F;  2DZN B;  4ZPX A;  3GPP A;  3SHG B;  5EP3 A;  2P5T A;  4DR1 M;  3VKH A;  3C3D A;  2BWE A;  2X49 A;  3EIE A;  2BNK A;  2HAK A;  3V76 A;  2MH8 A;  2QBY A;  1IN5 A;  4NSR A;  1PRB A;  3BOS A;  4LG2 A;  4UN2 B;  4B3R M;  1R7R A;  2I7N A;  5FTJ A;  1R6B X;  1MU5 A;  1LTM A;  4M9Z A;  1PM5 A;  2JNH A;  4DUY M;  2VII A;  4GRI A;  1HQY E;  3RFW A;  3W0F A;  3FKE A;  8CAT A;  2WSC F;  2CUZ A;  2OOA A;  4D82 A;  2DKL A;  5IWA M;  1R2Z A;  2KRU A;  2CRU A;  3VLF B;  3KOZ E;  4JXJ A;  2G5G X;  3D8L A;  1ZMW A;  1V92 A;  2A5Y B;  1GKI A;  3PFI A;  4I4L A;  3HWS A;  2KW0 A;  4HL4 A;  4F1I A;  2H5X A;  1IN7 A;  4DV0 M;  1NJG A;  4GIT A;  4X65 M;  2DAM A;  3KSX A;  5KPR A;  2C9C A;  4JN6 A;  3LVW A;  2MRO B;  1Y8G A;  2LWX A;  1VQ1 A;  2APL A;  2V6Z M;  1IM2 A;  3B74 A;  4LRT A;  1Z59 A;  1TR8 A;  1V34 A;  3L2A A;  2XFS A;  1GJS A;  4FWH A;  4REZ A;  4NSO B;  4JI0 M;  2C98 A;  2X4A A;  1RU3 A;  4D81 A;  4MGH A;  1R4G A;  3SMS A;  4JI4 M;  1QUS A;  5LMU M;  1E9S A;  2O5R A;  3HX3 A;  2R18 A;  2YFQ A;  1UM8 A;  5E26 A;  4AZF A;  4OW0 A;  3C58 A;  4PCZ A;  3A98 B;  3PNV A;  3DOA A;  3PVS A;  4PDI A;  1IBL M;  3T1Y M;  4EIW A;  3UJN A;  1VEG A;  4YHH M;  1NJF A;  3JR4 A;  2UUB M;  1KSF X;  2OO9 A;  1QDT A;  2XH9 A;  5DNY A;  3SAW A;  3LMM A;  1YUB A;  2XZF A;  3UMM A;  3VKG A;  3K9O A;  3GLI A;  3B7Z A;  2XEP A;  2EKF A;  3KVW A;  3KDS E;  1XMQ M;  2AHM A;  2QPA A;  4BLC A;  2F5O A;  1IBK M;  1AUA A;  2CWB A;  1R2Y A;  4AKH A;  1XB2 B;  1SXJ B;  2MR9 A;  4RKU F;  5IRE B;  5FSW A;  2F5P A;  2NQ8 C;  3J7A S;  2WSE F;  4LGY A;  1OKS A;  2KZS A;  1LV7 A;  4CJ6 A;  1Q39 A;  3U6D A;  2LVA A;  1G71 A;  4CHT B;  2KZU A;  3K9P A;  4CGY B;  3LW5 F;  1DGF A;  1JQJ C;  2DZO B;  2LNH C;  3E4R A;  3TQS A;  3KP0 E;  1QUT A;  4LJ4 A; 
#chains in the Genus database with same CATH homology
 1GVN A;  5KPT A;  3AOG A;  5DYI A;  4AKI A;  3K92 A;  3HU2 A;  4IIW A;  3U6E A;  5FTL A;  3UK6 A;  1NVM A;  1DGH B;  3FD9 A;  1YE9 A;  4IBJ A;  2R62 A;  3TE6 A;  4R7G A;  1DGB A;  2CEA A;  3LQR A;  1XNR M;  3FTD A;  1IXS B;  2YNM D;  1IQP A;  1D2N A;  4GIP A;  4JI7 M;  2H1R A;  5BPV A;  3AFH A;  2LXE A;  2Y21 A;  4OVZ B;  5BR8 M;  1G3I A;  4M0D A;  3GRU A;  3NWL A;  3GRV A;  2M60 A;  4P16 A;  4MGZ E;  3GLH B;  3HJQ A;  1HT1 E;  3NBI A;  4JI1 M;  2UUA M;  4JI2 M;  3QAU A;  4IBC A;  5FLX S;  2CV2 A;  2KXE A;  3K8Z A;  3WHL A;  1IN6 A;  4KOD A;  1N33 M;  1E9R A;  1OJL A;  3U6O A;  4DV2 M;  4ITQ A;  2YQZ A;  2C5R A;  2XSZ A;  2QCU A;  4KLN A;  5EP2 A;  3THG A;  3J7B A;  4MB7 A;  4FCT A;  5EP1 A;  1E94 E;  1Z5A A;  4LJ6 A;  4IBD A;  3M6A A;  3U6M A;  1KFV A;  4QOZ C;  3U61 B;  4LZZ A;  3KXE C;  4LF6 M;  4FCV A;  4XGI A;  4NRW A;  1J09 A;  4LRS A;  3SAT A;  2QP9 X;  3KOY E;  2RKO A;  7CAT A;  3JR5 A;  4DR6 M;  2HL7 A;  2JA2 A;  3RE8 A;  4QHS A;  4IBF A;  4G6Z A;  3U5Z B;  1NY5 A;  4JI5 M;  1NHW C;  3SYL A;  1QQW A;  3VK8 A;  3ILK A;  4B7G A;  2F4V M;  3GLG B;  3HHZ A;  2E5L M;  1XMO M;  3U60 B;  4S12 A;  3FYC A;  4QHT A;  1HNW M;  1QAM A;  4FVM A;  4IBK A;  1G59 A;  3GPX A;  3GLF B;  2XGN A;  4WW0 A;  2Z4S A;  2L09 A;  5EXP A;  5C18 A;  3SAR A;  3GP1 A;  3VDU A;  2FNA A;  2CHV A;  3R8F A;  1Z5C A;  1N78 A;  1OFI A;  2OPF A;  4GHL A;  3ZC7 B;  4JYA M;  2KEB A;  4G4R A;  3GRY A;  1NNU C;  1WXQ A;  3M7G A;  4IBE A;  4WUR A;  4MGK E;  3J2P B;  1X37 A;  3FYD A;  3T15 A;  4IBB A;  3U6S A;  3LQQ A;  1L1T A;  3CF6 E;  5KQ8 A;  4L4U A;  2DWZ B;  3L26 A;  1XXH B;  3ZH9 B;  1TDZ A;  1L2C A;  2UXB M;  3FUW A;  4R3D A;  3TPZ A;  1GLN A;  1Q3B A;  2QBY B;  4IBG A;  4AKG A;  3L29 A;  5IZ7 D;  4DR7 M;  4TUW A;  1XC8 A;  2Z3X A;  2KA6 B;  3HGI A;  1TH2 A;  1N77 A;  3H4M A;  3WHK A;  3SBJ A;  1DGG A;  1IN4 A;  2CHQ A;  3CF0 A;  5ITT A;  4DUZ M;  4M9S A;  3DZD A;  4NXM M;  3KP1 E;  2UXC M;  3FUV A;  4GH9 A;  2XZU A;  4MM3 B;  2DXI A;  4FWG A;  4XBO A;  3FUX A;  2XSZ D;  2RGO A;  4NRV A;  2R4E A;  1IBM M;  3CF2 A;  2F5N A;  4B3M M;  1VDD A;  2C96 A;  5ITY A;  2D7G A;  4L78 A;  1XWI A;  3KW6 A;  4I81 A;  5KPZ A;  4JV5 M;  1IXR C;  3RGS A;  3EIH A;  4AG6 A;  5LMN M;  4NOO B;  2UUC M;  2R45 A;  5ITX E;  1IY1 A;  2XF3 A;  4M0W A;  3I4Y A;  1L2D A;  4KHP M;  1K82 A;  4LF8 M;  1T3T A;  1YSY A;  3GRR A;  3FTE A;  3I4V A;  3AOE A;  5F3W A;  1N75 A;  2DVW B;  4QOS A;  4AG5 A;  1QAO A;  1FNN A;  3KOX E;  3T38 A;  1PJJ A;  4L16 A;  2Z7J A;  4DV6 M;  4B7H A;  2Y20 A;  4RF0 A;  4LZJ A;  4JI6 M;  4I8O A;  3SAV A;  4L8R C;  3JAM S;  5FTK A;  1J5E M;  4AQY M;  2BJV A;  4QNM A;  3J81 S;  2ZBK B;  3GLI B;  3QWL A;  2BJW A;  1IY0 A;  4M9X A;  4CIS A;  1Z5B A;  1NSF A;  4G4O A;  3FTC A;  3AV0 A;  3AL0 C;  3SHF A;  4Z6Y A;  3U6L A;  1SXJ E;  2I7P A;  5EXS A;  5FTN A;  4LCB A;  5E6J A;  1TH4 A;  3MK6 A;  3GQ5 A;  2HHH M;  2LH0 A;  1L8Q A;  4FD2 A;  4OU7 A;  2D7E A;  4AI6 A;  4IBI A;  3D8B A;  2R4J A;  3KS4 A;  2XFT A;  4X66 M;  4NL4 H;  4MGI E;  4G4N A;  4I5S A;  4FCW A;  2ZAO A;  3TL4 X;  2EA0 A;  4GC5 A;  2Y0Q A;  4B3S M;  3T1H M;  3KS8 A;  1GL6 A;  1HNX M;  1ZQ9 A;  3MJ5 A;  5GKN A;  3DA1 A;  2VQF M;  5ITX A;  2CV1 A;  4GHA A;  1HT2 E;  5H37 D;  1E32 A;  1W5S A;  2DWL A;  1DO0 A;  2VQE M;  3J80 S;  3HHY A;  3K1J A;  4KO8 A;  4W5W A;  2F5Q A;  2DWN A;  1QAQ A;  2CE7 A;  3CTW B;  3DFZ A;  4LGM A;  5EXX A;  2L6O A;  3SMP A;  3TWM A;  5EXT A;  1S3S A;  1I4W A;  1GL7 A;  2G8L A;  4A3V B;  3TWL A;  4B08 A;  4X62 M;  3GO8 A;  4DV1 M;  4DR5 M;  4LF4 M;  4DV4 M;  3IG5 A;  3AJI B;  1KYI A;  3GPU A;  4RNA A;  2RGH A;  1HQC A;  3K2L A;  4LFA M;  4Z8X A;  4GKK M;  4LFB M;  3UZU A;  5ITQ A;  1K3X A;  1IXZ A;  3HU1 A;  2V1U A;  2L7H A;  1QYR A;  2OQ4 A;  1HNZ M;  2C99 A;  4LFC M;  2K47 A;  2DWM A;  4GKJ M;  3AOE C;  1XNQ M;  1SXJ A;  3IG8 A;  2YR0 A;  1Z6T A;  2Z4R A;  4JI3 M;  4DR4 M;  1EE8 A;  3HHX A;  2QEN A;  2Y0T A;  4DV7 M;  2ERC A;  2C9O A;  1JR3 A;  2R46 A;  3FTF A;  1TH3 A;  4FWD A;  3SFZ A;  1QVR A;  3UGJ A;  4OX9 M;  4IJE A;  4RF1 A;  2FOI C;  5C1B A;  3GPY A;  2W82 A;  5JI2 E;  2ZAN A;  3SAS A;  3U6C A;  1DO2 A;  3SAU A;  4FW9 A;  5EQT A;  4BBA A;  1DGH A;  3KFU G;  1H6U A;  5EP4 A;  1NNJ A;  1TDH A;  5A2Q S;  2ZM6 M;  3HJS A;  3PNY A;  5JI3 E;  1QZM A;  1C1K A;  4IJF A;  1Q3C A;  2CHG A;  3RGP A;  1N32 M;  3M0E A;  3L25 A;  4L15 A;  5ITU A;  5ITR A;  1K3W A;  2ZAM A;  3E9S A;  5KQD A;  2HCB A;  2FFJ A;  1ZAE A;  4OVZ A;  3OTO M;  4AW4 A;  2HKJ A;  1IN8 A;  3LVV A;  4X64 M;  3SC3 A;  2J7O A;  1ORY B;  4LJ5 A;  3GLH A;  3L27 A;  3R9X B;  4MH0 E;  3HU3 A;  3U6Q A;  1J7K A;  2FE8 A;  1FJG M;  2M5Z A;  5KO3 A;  1G8P A;  3VFD A;  2F5S A;  1NHG C;  2R65 A;  3A45 A;  3FUT A;  2V1C A;  4LJ8 A;  4LF7 M;  1G41 A;  3SYK A;  4DR2 M;  3A46 A;  4PT5 A;  5FTM A;  4BB9 A;  3U6P A;  3VK7 A;  4LJA A;  1I94 M;  2DHR A;  3HJ8 A;  4G4Q A;  2UXD M;  4LF9 M;  4PDG A;  4GC9 A;  3U61 A;  4DV3 M;  1W5T A;  2UU9 M;  4II7 A;  1IY2 A;  4NXN M;  3ZCB B;  4PD2 A;  4GMQ A;  4YY3 M;  1OFH A;  4LJ9 A;  3VDP A;  3J27 B;  1SXJ C;  4QNR A;  1MX0 A;  3A42 A;  1L1Z A;  3U5Z A;  1G4A E;  4K0K M;  5DYG A;  1SXJ D;  3GQ4 A;  2KRK A;  4HLQ A;  3GLG A;  3B9P A;  4DV5 M;  3W0L B;  1XHB A;  2XLJ A;  3U60 A;  4LF5 M;  1PJI A;  4D80 A;  1JR3 D;  3TWK A;  3GLF A;  1HR0 M;  3HHW A;  3Q8X A;  2J7N A;  3AKZ A;  3KOW E;  2EO2 A;  3MHV C;  4LJ7 A;  1N34 M;  4B7F A;  2CFO A;  4B3T M;  2D7H A;  3KSJ A;  4MGY E;  3L28 A;  1N36 M;  4LY6 A;  2L7I A;  3FUU A;  1L2B A;  2Q2E B;  4JI8 M;  5EJC A;  1TGU A;  1QAN A;  2CV0 A;  2X8A A;  2QZ4 A;  1NY6 A;  3HKP A;  4DR3 M;  3PXG A;  3GQ3 A;  3I51 A;  5IT9 S;  2EUC A;  1XXH A;  2DZN B;  4ZPX A;  3GPP A;  3SHG B;  5EP3 A;  2P5T A;  4DR1 M;  3VKH A;  2X49 A;  3EIE A;  2BNK A;  2QBY A;  1IN5 A;  4NSR A;  4LG2 A;  3BOS A;  4B3R M;  1R7R A;  2I7N A;  5FTJ A;  1R6B X;  1MU5 A;  4M9Z A;  1PM5 A;  4DUY M;  2VII A;  4GRI A;  1HQY E;  3RFW A;  3W0F A;  3FKE A;  8CAT A;  2CUZ A;  5IWA M;  4D82 A;  1R2Z A;  2KRU A;  3VLF B;  3KOZ E;  4JXJ A;  2G5G X;  3D8L A;  2A5Y B;  1GKI A;  3PFI A;  4I4L A;  3HWS A;  2KW0 A;  4HL4 A;  4DV0 M;  1IN7 A;  1NJG A;  4GIT A;  4X65 M;  3KSX A;  5KPR A;  2C9C A;  4JN6 A;  3LVW A;  2V6Z M;  2LWX A;  1IM2 A;  4LRT A;  1Z59 A;  3L2A A;  2XFS A;  4FWH A;  4REZ A;  4NSO B;  4JI0 M;  2C98 A;  2X4A A;  4D81 A;  4MGH A;  4JI4 M;  3SMS A;  5LMU M;  1E9S A;  2O5R A;  2R18 A;  2YFQ A;  1UM8 A;  5E26 A;  4AZF A;  4OW0 A;  3C58 A;  4PCZ A;  3A98 B;  3PNV A;  3DOA A;  3PVS A;  4PDI A;  1IBL M;  3T1Y M;  4EIW A;  3UJN A;  4YHH M;  3JR4 A;  1NJF A;  2UUB M;  1KSF X;  2XH9 A;  5DNY A;  3SAW A;  3LMM A;  1YUB A;  2XZF A;  3UMM A;  3VKG A;  3GLI A;  2XEP A;  3KVW A;  3KDS E;  1XMQ M;  2AHM A;  2QPA A;  4BLC A;  2F5O A;  1IBK M;  1R2Y A;  4AKH A;  1SXJ B;  5IRE B;  5FSW A;  2F5P A;  2NQ8 C;  3J7A S;  4LGY A;  2KZS A;  1LV7 A;  1Q39 A;  3U6D A;  4CHT B;  2KZU A;  4CGY B;  1DGF A;  1JQJ C;  2DZO B;  2LNH C;  3E4R A;  3TQS A;  3KP0 E;  4LJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...