4JI1M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
117
structure length
117
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 32
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ji1M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4ji1M02
4K0KM 5LMUM 4G4OA 2UXDM 5ITQA 2ZM6M 4PD2A 3OTOM 4DV0M 4DR7M 1K82A 1K3XA 5ITXA 4DR5M 5IT9S 1IBLM 1TDHA 4LFCM 3GQ4A 4NXMM 4JYAM 3SASA 4DV7M 1Q3CA 3DOAA 3JAMS 4G4RA 1HNXM 3T1YM 4NRVA 1K3WA 4JI3M 5ITTA 1Q39A 1IBMM 3SATA 1N33M 2Q2EB 1XC8A 2UUCM 1NNJA 4GKJM 3GP1A 2UUAM 4DV2M 4DUZM 1EE8A 3SBJA 1I94M 4X65M 2F5NA 1R2ZA 3A46A 4B3MM 4DV3M 1L2CA 4PCZA 4JI7M 4JI1M 3TWLA 4DR1M 3U6LA 1L1ZA 5ITUA 2UXBM 2XZUA 2UUBM 3U6QA 3GPPA 5ITRA 1N36M 1L1TA 4LF6M 4PDGA 2VQEM 1Z5AA 2F5PA 4JI0M 4PDIA 4NXNM 3JR5A 5ITXE 1Z5BA 4YHHM 5ITYA 4DR2M 2E5LM 5FLXS 3U6SA 4DV5M 4DV4M 3GPYA 4ITQA 3T1HM 3GQ5A 2F5SA 4LFAM 3VK7A 3U6DA 2OPFA 4JI2M 2F5OA 4JI8M 1XMQM 3SARA 4G4NA 5IWAM 4X62M 4AQYM 3VK8A 2XZFA 4DV6M 3SAVA 1HNWM 4YY3M 5BR8M 3JR4A 4MB7A 2EA0A 3SAUA 1PM5A 1N34M 2UU9M 4JI6M 4B3TM 4GKKM 4LF4M 3J81S 1TDZA 1KFVA 2HHHM 4LF8M 4KHPM 1Q3BA 3GPUA 4JI5M 3GPXA 4JV5M 3W0FA 4CISA 3U6MA 4LFBM 2ZBKB 4DR4M 1N32M 2F5QA 4B3RM 2VQFM 2F4VM 1J5EM 4DR3M 3SAWA 4B3SM 4DR6M 4LF7M 1L2BA 2HKJA 3A42A 4LF5M 3J80S 1XNQM 1PJJA 1R2YA 1XMOM 4DV1M 1HR0M 4DUYM 3U6EA 2OQ4A 3GQ3A 1IBKM 1Z5CA 3GO8A 1HNZM 1MU5A 3A45A 3J7AS 4JI4M 1MX0A 5LMNM 3U6PA 3C58A 1PJIA 1Z59A 1FJGM 4LF9M 4OX9M 4G4QA 4X64M 1L2DA 1XNRM 3U6OA 3TWMA 3TWKA 4NRWA 4X66M 2UXCM 5A2QS 3U6CA
chains in the Genus database with same CATH superfamily
4NSRA 3B74A 2LBCA 1IXRC 4LJ8A 3GLFB 1TF0B 2ZM6M 3FUXA 2LHGA 4LGMA 4REZA 1NO1A 2L7IA 3GLFA 2FS1A 2EO2A 2R4JA 4DR7M 3HHYA 1NHGC 4MM3B 2BWBA 5FTJA 1IBLM 4MGKE 1TDHA 4NOOB 1PRBA 5FTKA 2R4EA 3L26A 1Z6TA 2L6OA 5KO3A 4BLCA 4D80A 3E21A 3HU1A 3ZCBB 2R6FA 5EXXA 3FUTA 4CHTB 1NVMA 3T1YM 4M9XA 3L27A 4JI3M 3SATA 1IBMM 4FD2A 1VEJA 2K0BX 1SXJB 2I7NA 2UUCM 2K6BA 3H4JA 1IN5A 3GLGB 2UUAM 4S12A 3FE3A 5C18A 1SXJA 1I94M 3C3DA 2QQ8A 1DGGA 1R2ZA 3DA1A 5GKNA 3CF6E 4QNMA 5EXTA 1GO5A 1I4WA 1PJTA 2DZOB 4JI7M 3M6AA 3TWLA 1TR8A 4HEOA 4GH9A 3U6LA 3I4YA 4B08A 1QAMA 2KRKA 2DXIA 3NBXX 3M0EA 2J7NA 2H5XA 2CFOA 4LZJA 1SXJD 2CUZA 3RFWA 1N36M 2FOIC 4NC6A 3I04M 2LVPC 2R44A 3GLHB 4GMQA 2F5PA 1Z5AA 1ORYB 3GLHA 3HU2A 4JI0M 2XLJA 3D8LA 2DZNB 3J7BA 4G6ZA 3HU3A 1JR3A 2C96A 5FLXS 3U6SA 3HZJA 5DFLA 3KOZE 2L4EA 1N75A 4DV4M 2WSCF 3TE6A 3R8FA 3R9XB 1NSFA 3BXWA 4L78A 1VDLA 3U6DA 4CGYB 2F5OA 3KOXE 4LZZA 3E46A 1DGBA 3C3EA 4DV6M 3THGA 1NJGA 2LXEA 4D82A 3M7GA 1UFZA 1MJGM 4WP2A 3JR4A 1N34M 4AG6A 3U5ZB 4B3TM 4MGHA 1ZV1A 4LF4M 2HHHM 2C9OA 3IG5A 1TGUA 2KW0A 4GEWA 3HHZA 2NQ8C 4Z6YA 1E94E 3GPXA 4GC5A 5FTNA 3PXGA 3KDSE 4CISA 1HT2E 3U6MA 2G5GX 2DENA 4GHLA 2DNAA 1KSFX 2B3TA 1QUTA 2G8LA 2Z4SA 2F4VM 2KA6B 2DKLA 3GLIA 4DR3M 2LH0A 3I4VA 3SAWA 2C5RA 4B3SM 5E26A 4M0WA 4AKGA 4D81A 3A42A 1NJFA 3ZQJA 1YE9A 3LVVA 2X8AA 2XSZD 2QCUA 1GABA 4LRTA 2P5TA 2MROB 4OU7A 1JR3E 1NY6A 5FSWA 3B9PA 3CF2A 3K9PA 5KQDA 3QAUA 3SHFA 2CV0A 2ZANA 1Z5CA 1HNZM 3LVWA 2EKFA 3J7AS 4QHTA 1WHCA 4R3DA 2RGOA 1MX0A 8CATA 3U6PA 4IBEA 2XFTA 2BJWA 1GKIA 1Z59A 2D7EA 2EKKA 3KXEC 4OW0A 3HY5A 2MH8A 4Q7JA 4LF9M 1FJGM 3FRIA 1XB2B 4B7GA 2QPAA 3U6OA 4NRWA 2RGHA 1QDTA 2FNAA 1IXSA 2BJVA 2O5RA 3FD9A 4X66M 3U6CA 3W0LB 2LVQD 3PNYA 5DYIA 3WHKA 2OOAA 3T38A 3HWSA 4G4OA 3BOSA 2LNHC 3LCUA 1YLAA 2D7GA 2R46A 1OFIA 3AV0A 2DAIA 4R71A 1K3XA 2LTUA 1S3SA 1IN6A 3FTEA 1AUAA 3I01M 2JZ0A 4PT5A 4JYAM 4NXMM 3H4MA 3GLIE 3SASA 4IBCA 1DV0A 3DOAA 1WJ7A 4G4RA 2Y0QA 1IY0A 4FW9A 3KOWE 1HNXM 1OAIA 2QHOB 1Q39A 1N33M 3SYLA 3T15A 1XC8A 1NNJA 1HQYE 3B89A 4IBFA 4UN2B 2V6ZM 1VEKA 1IQPA 1WXQA 1WIVA 3A46A 4XBOA 5DYGA 4MH0E 4B3MM 1L2CA 2OOBA 4PCZA 3QYBA 2L2DA 3MJ5A 1HJPA 3GRVA 5FTMA 2M5ZA 4I81A 1OIZA 4L8RC 3VDUA 3VDPA 2UXBM 2JWSA 4IIWA 4RNAA 3GPPA 2R65A 4LY6A 1CUKA 3W67A 2CHVA 5FTLA 4ZPXA 1L1TA 1PGYA 2LHCA 1QDRA 5EQTA 1R5LA 1IY2A 2JA2A 3KSJA 4NSOB 2HWJA 2DZLA 2XFSA 4R7GA 3SC3A 3Q8GA 2JZ1A 3AOEC 2C98A 5ITYA 1T3TA 2KNAA 2JY7A 2DAMA 2Y21A 4DV5M 4I4LA 4I5SA 1D0LA 1TTEA 1FNNA 2X4AA 4BB9A 2V1UA 1JB0F 2Z4RA 3T1HM 5EP1A 1BVSA 2O25A 2R45A 4Z8XA 3VK7A 3LW5F 2OPFA 2RRUA 3HHWA 3SARA 4KLNA 2YQZA 3VK8A 2CHQA 1GJSA 1MN3A 2HL7A 2WZJA 4LCBA 4GITA 1HNWM 4YY3M 2YNMD 2KDLA 1VEGA 2CRUA 1DO2A 1TDZA 3U61A 2DWLA 1OKSA 3J2PB 4LF8M 4KHPM 4JI5M 3AJIB 2QNJA 4JV5M 3TL4X 3KVWA 1XWIA 2C9CA 2F5QA 1GL7A 4B3RM 1G41A 2VQFM 3B7ZA 1J5EM 2N35A 4QOZC 1F4IA 1D0KA 4DR6M 3VLFB 4LF7M 5KPRA 3WHLA 3CTWB 3VKHA 1DGHB 2XH9A 3GRYA 1DGHA 2J5YA 1IBKM 1VQ1A 3J27B 3KOYE 3GO8A 2DHYA 1JR3D 1L8QA 1MU5A 1C1KA 2CHGA 2DAKA 3A45A 3L28A 1OFHA 1XHBA 4IBDA 4IJFA 2Z8YM 1VG5A 3HJSA 4AW4A 5EXSA 1X37A 1SG9A 1LTMA 2R18A 2XGNA 2JY5A 2O01F 4ANRA 1L2DA 4X64M 4JN6A 3TWKA 1NNUC 3T6PA 5A2QS 4BBAA 3AOGA 3GLIB 2LVNC 4K0KM 4F1IA 5KQ8A 5LMUM 3HGIA 2UXDM 5ITQA 1IXZA 3FTCA 2VF8A 3OTOM 3V76A 1K82A 4L16A 2XF3A 5ITXA 4DR5M 3GLGE 2QP9X 2L09A 2I7PA 4QNRA 4LJ6A 2CV1A 4LFCM 2FH0A 3CGWA 4P17A 3GQ4A 4DV7M 2W82A 1Q3CA 4AKHA 3KP0E 2V1CA 4NL4H 4NRVA 5EP3A 3A98B 1K3WA 4AKIA 3HHXA 3LQRA 2FFJA 2R62A 3GP1A 2LWXA 1IXSB 3ZH9B 3HKPA 3FUVA 2CV2A 1EE8A 4DUZM 2ZAOA 4X65M 1AIPC 1LV7A 2ERCA 4DV3M 1JQJC 3VFDA 5EP4A 2MGWA 4IBBA 4DR1M 1QQWA 4LJAA 2KZSA 2QSFX 2XZUA 4OVZB 2UUBM 1J09A 2A5YB 4HLQA 3U6QA 5ITRA 1ZMWA 4OVZA 1GL6A 3RGSA 1QANA 3CF0A 4LF6M 1W5TA 2LVAA 3I51A 2VQEM 3FKEA 3UK6A 1V33A 2CP8A 1ZQ9A 3QYEA 1QZEA 4NXNM 3DFZA 5BPVA 1OAOC 5ITXE 4YHHM 1NV8A 3QWLA 4DR2M 2E5LM 2KNZA 2KZUA 1V34A 3SYKA 4QHSA 3GPYA 5EP2A 2MJ5B 3E9SA 3FTFA 2CE7A 3K2LA 5C1BA 3F92A 2JY6B 4FWDA 1QUSA 3KS4A 4FVMA 4M0DA 3SMSA 3MHVC 3GQ5A 2F5SA 3C9PA 4JI2M 4XK8F 1XMQM 2D7HA 1D2NA 4FWHA 3UGJA 5EJCA 1T6OA 3KS8A 5IWAM 4AQYM 5DNYA 3RE8A 4LRSA 2XZFA 3AL0C 3SAVA 2MR9A 2C99A 2EA0A 2UU9M 4FCWA 1ZAEA 4MB7A 2DI0A 2BNKA 2CWBA 3TQSA 4JI6M 3KP1E 4MGIE 3UMMA 1SXJC 1R7RA 3FYCA 3KW6A 2ZTCA 3J81S 1XXHE 2H1RA 4M9SA 4MGZE 3GPUA 4WW0A 5E6JA 1N78A 2GNOA 2KEBA 2APLA 3W0FA 1PJQA 1GLNA 3LCVB 1DGFA 2XEPA 3K8ZA 1G8PA 4GRIA 2KRUA 1KYIA 5JI2E 2DWNA 2QZ4A 4L4UA 1IN8A 1G71A 1GVNA 2HKJA 4GIPA 3MMPA 1XNQM 2ZTDA 2YR0A 5IREB 1QAQA 2Y0TA 2JP7A 4DUYM 1OTRA 3Q8XA 3U6EA 4MGYE 4AZFA 4RF0A 3GQ3A 3GRRA 4Y28F 1NV9A 2R0IA 3U61B 3ZC7B 1QYRA 4LJ9A 1EFUB 2ZAMA 1G3IA 1TH4A 1PJIA 2L7HA 4EIWA 4RF1A 3B7NA 2Z3XA 4IJEA 3D8BA 1H6UA 4QOSA 3W68A 3GLGA 1YSYA 4II7A 2OO9A 2RKOA 4IBGA 1D0MA 4HL4A 2M60A 2DVWB 3AFHA 3AOEA 3SHGB 4PD2A 3SMPA 4DV0M 4IBKA 1QVRA 1TH2A 1WGLA 5JI3E 1WGNA 3L2AA 2L4FA 5IT9S 1IN4A 4JXJA 3NWLA 3GRUA 5IZ7D 1EIJA 4P16A 2LVOC 1OIPA 2J7OA 1GJTA 4FWGA 3PNVA 3JAMS 3GLFE 2K47A 2YFQA 5F3WA 2KNVA 2Z7JA 4AG5A 1G4AE 2JUJA 7CATA 5ITTA 1Q02A 1PJSA 2K9DA 2Q2EB 2WSEF 3B7QA 3K92A 4IBIA 2QENA 3UJNA 3BBZA 4GKJM 4B7HA 3DZDA 4DV2M 3SBJA 2F5NA 5H37D 4WURA 2BWEA 2KHHA 1QAOA 3HX3A 4CIZA 4W5WA 4KT0F 2VF7A 3AKZA 1HQCA 4JI1M 3FUWA 2X49A 1V92A 1SXJE 1L1ZA 3KFUG 5ITUA 2EJSA 3FUUA 5EXPA 2FE8A 4RKUF 3EIEA 4GC9A 1W5SA 4F2LA 1IFYA 2XSZA 4PDGA 1NY5A 5KPZA 3U5ZA 1P3QQ 3PVSA 4PDIA 2DAEA 3ILKA 3JR5A 1Z5BA 1Y8GA 3RGPA 3MK6A 1DO0A 1C7YA 3E4RA 4B7FA 1NHWC 3GLHE 4IBJA 4ITQA 3IECA 4KODA 4XGIA 4LJ7A 1XXHB 2VIIA 4LFAM 1R6BX 4JI8M 1J7KA 1XXHA 4LJ4A 4LGYA 4CJ6A 1IM2A 4G4NA 4X62M 3FTDA 4DBGB 4I8OA 1E9SA 5L8RF 3L29A 3VKGA 3SAUA 3SFZA 5BR8M 2HAKA 1OJLA 1PM5A 2JY8A 4LJ5A 1QZMA 3FRHA 4FCVA 1VDDA 4GKKM 1KFVA 1IN7A 5KPTA 1Q3BA 1OQYA 2EUCA 2DAGA 4LFBM 3TPZA 2ZBKB 4DR4M 1N32M 2JNHA 2Y20A 1E9RA 3EIHA 2WSFF 2KXEA 3IHPA 3KSXA 2G3QA 1T43A 2CEAA 3LQQA 4L6V6 4KO8A 4TUWA 1N77A 1L2BA 1ZMVA 1HT1E 2GQFA 3K1JA 4LF5M 3J80S 4A3VB 2DWZB 1PJJA 1R2YA 4M9ZA 1E32A 1XMOM 1YUBA 4DV1M 1HR0M 2AHMA 3HJ8A 3FYDA 2OQ4A 1ZMUA 1WR1B 4FCTA 1UM8A 2DWMA 1A5TA 1R4GA 1TH3A 4JI4M 2VDBB 4L15A 3HJQA 3IG8A 3U60B 4G3OA 3UZUA 5LMNM 2QBYB 3C58A 2JXNA 3U60A 1G59A 1RU3A 4AI6A 2QBYA 4OX9M 2HCBA 4LG2A 4G4QA 3L25A 4GHAA 1XNRM 1IY1A 2DHRA 3K9OA 3NBIA 3TWMA 3LMMA 2UXCM 3PFIA
chains in the Genus database with same CATH topology
4NSRA 1IXRC 4LJ8A 3GLFB 2ZM6M 3FUXA 4LGMA 4REZA 2L7IA 3GLFA 4DR7M 2EO2A 2R4JA 3HHYA 1NHGC 4MM3B 5FTJA 1IBLM 4MGKE 1TDHA 4NOOB 5FTKA 2R4EA 3L26A 1Z6TA 2L6OA 5KO3A 4BLCA 4D80A 3HU1A 3ZCBB 5EXXA 3FUTA 4CHTB 1NVMA 3T1YM 4M9XA 3L27A 4JI3M 3SATA 1IBMM 4FD2A 1SXJB 2I7NA 2UUCM 1IN5A 3GLGB 2UUAM 4S12A 5C18A 1SXJA 1I94M 1DGGA 1R2ZA 3DA1A 5GKNA 3CF6E 4QNMA 5EXTA 1I4WA 2DZOB 4JI7M 3M6AA 3TWLA 4GH9A 3U6LA 3I4YA 4B08A 1QAMA 2KRKA 2DXIA 3M0EA 2J7NA 2CFOA 4LZJA 1SXJD 2CUZA 3RFWA 1N36M 2FOIC 3GLHB 4GMQA 2F5PA 1Z5AA 1ORYB 3GLHA 3HU2A 4JI0M 2XLJA 3D8LA 2DZNB 3J7BA 4G6ZA 3HU3A 1JR3A 2C96A 5FLXS 3U6SA 3KOZE 1N75A 4DV4M 3TE6A 3R8FA 3R9XB 1NSFA 4L78A 3U6DA 4CGYB 2F5OA 3KOXE 4LZZA 1DGBA 4DV6M 3THGA 1NJGA 2LXEA 4D82A 3M7GA 3JR4A 1N34M 4AG6A 3U5ZB 4B3TM 4MGHA 4LF4M 2HHHM 2C9OA 3IG5A 1TGUA 2KW0A 3HHZA 2NQ8C 4Z6YA 1E94E 3GPXA 4GC5A 5FTNA 3PXGA 3KDSE 4CISA 1HT2E 3U6MA 2G5GX 4GHLA 1KSFX 2Z4SA 2G8LA 2F4VM 2KA6B 3GLIA 4DR3M 2LH0A 3I4VA 3SAWA 2C5RA 4B3SM 5E26A 4M0WA 4AKGA 4D81A 3A42A 1NJFA 1YE9A 3LVVA 2X8AA 2XSZD 2QCUA 4LRTA 2P5TA 4OU7A 1NY6A 5FSWA 3B9PA 3CF2A 5KQDA 3QAUA 3SHFA 2CV0A 2ZANA 1Z5CA 1HNZM 3LVWA 3J7AS 4QHTA 4R3DA 2RGOA 1MX0A 8CATA 3U6PA 4IBEA 2XFTA 3KXEC 1GKIA 1Z59A 2BJWA 2D7EA 4OW0A 4LF9M 1FJGM 4B7GA 3U6OA 2QPAA 4NRWA 2RGHA 2FNAA 2O5RA 4X66M 2BJVA 3U6CA 3FD9A 3W0LB 3PNYA 5DYIA 3WHKA 3T38A 3HWSA 4G4OA 3BOSA 2LNHC 2R46A 2D7GA 1OFIA 3AV0A 1K3XA 1S3SA 1IN6A 3FTEA 4PT5A 4JYAM 4NXMM 3H4MA 3SASA 4IBCA 3DOAA 4G4RA 1HNXM 2Y0QA 1IY0A 4FW9A 3KOWE 1Q39A 1N33M 3SYLA 3T15A 1XC8A 1NNJA 1HQYE 4IBFA 2V6ZM 1IQPA 1WXQA 3A46A 4B3MM 4XBOA 5DYGA 4MH0E 1L2CA 4PCZA 3MJ5A 3GRVA 5FTMA 2M5ZA 4I81A 4L8RC 2UXBM 3VDUA 3VDPA 4IIWA 4RNAA 3GPPA 2R65A 4LY6A 5FTLA 2CHVA 4ZPXA 1L1TA 5EQTA 1IY2A 2JA2A 3KSJA 4NSOB 2XFSA 4R7GA 3SC3A 3AOEC 2C98A 5ITYA 1T3TA 2Y21A 4DV5M 4I4LA 4I5SA 1FNNA 2X4AA 4BB9A 2V1UA 2Z4RA 3T1HM 5EP1A 4Z8XA 2R45A 3VK7A 2OPFA 3HHWA 3SARA 4KLNA 2YQZA 3VK8A 2CHQA 2HL7A 4LCBA 4GITA 1HNWM 4YY3M 2YNMD 1DO2A 1TDZA 3U61A 2DWLA 3J2PB 4LF8M 4KHPM 4JI5M 3AJIB 4JV5M 3TL4X 3KVWA 1XWIA 2C9CA 2F5QA 1GL7A 4B3RM 1G41A 2VQFM 1J5EM 4QOZC 4DR6M 3VLFB 4LF7M 5KPRA 3WHLA 3CTWB 3VKHA 1DGHB 2XH9A 3GRYA 1DGHA 1IBKM 3J27B 3KOYE 3GO8A 1L8QA 1JR3D 3L28A 1MU5A 1C1KA 2CHGA 3A45A 4IJFA 1OFHA 1XHBA 4IBDA 3HJSA 4AW4A 5EXSA 1X37A 2R18A 2XGNA 1L2DA 4X64M 4JN6A 3TWKA 1NNUC 5A2QS 4BBAA 3AOGA 3GLIB 4K0KM 5KQ8A 5LMUM 3HGIA 2UXDM 5ITQA 1IXZA 3FTCA 3OTOM 1K82A 4L16A 2XF3A 5ITXA 4DR5M 2QP9X 2L09A 2I7PA 4QNRA 4LJ6A 2CV1A 4LFCM 3GQ4A 4DV7M 2W82A 1Q3CA 4AKHA 3KP0E 2V1CA 4NL4H 4NRVA 5EP3A 3A98B 1K3WA 4AKIA 3HHXA 3LQRA 2FFJA 2R62A 3GP1A 2LWXA 1IXSB 3ZH9B 3HKPA 3FUVA 2CV2A 1EE8A 4DUZM 2ZAOA 4X65M 1LV7A 2ERCA 4DV3M 1JQJC 3VFDA 5EP4A 4DR1M 4IBBA 1QQWA 4LJAA 2KZSA 2XZUA 4OVZB 2UUBM 1J09A 2A5YB 4HLQA 3U6QA 5ITRA 4OVZA 3RGSA 1GL6A 1QANA 3CF0A 4LF6M 1W5TA 3I51A 2VQEM 3FKEA 3UK6A 1ZQ9A 4NXNM 3DFZA 5BPVA 5ITXE 4YHHM 3QWLA 4DR2M 2E5LM 2KZUA 3SYKA 4QHSA 3GPYA 5EP2A 3FTFA 3E9SA 2CE7A 3K2LA 5C1BA 4FVMA 4FWDA 3KS4A 4M0DA 3SMSA 3MHVC 3GQ5A 2F5SA 4JI2M 1XMQM 2D7HA 1D2NA 4FWHA 3UGJA 5EJCA 3KS8A 5IWAM 4AQYM 5DNYA 3RE8A 4LRSA 2XZFA 3AL0C 3SAVA 2C99A 2EA0A 2UU9M 4FCWA 1ZAEA 4MB7A 2BNKA 3TQSA 4JI6M 3KP1E 4MGIE 3UMMA 1SXJC 3KW6A 1R7RA 3FYCA 3J81S 2H1RA 4M9SA 4MGZE 3GPUA 4WW0A 5E6JA 1N78A 2KEBA 3W0FA 1GLNA 1DGFA 2XEPA 3K8ZA 1G8PA 4GRIA 2KRUA 1KYIA 5JI2E 2DWNA 2QZ4A 4L4UA 1IN8A 4GIPA 1GVNA 2HKJA 1XNQM 2YR0A 5IREB 1QAQA 2Y0TA 4DUYM 3Q8XA 3U6EA 4MGYE 4AZFA 4RF0A 3GQ3A 3GRRA 3U61B 3ZC7B 1QYRA 4LJ9A 2ZAMA 1G3IA 1TH4A 1PJIA 2L7HA 4EIWA 4RF1A 2Z3XA 4IJEA 3D8BA 1H6UA 4QOSA 3GLGA 1YSYA 4II7A 2RKOA 4IBGA 4HL4A 2M60A 2DVWB 3AFHA 3AOEA 3SHGB 4PD2A 3SMPA 4DV0M 4IBKA 1QVRA 1TH2A 5JI3E 3L2AA 5IT9S 1IN4A 4JXJA 3NWLA 3GRUA 5IZ7D 4P16A 2J7OA 3JAMS 4FWGA 3PNVA 2K47A 2YFQA 5F3WA 2Z7JA 4AG5A 1G4AE 7CATA 5ITTA 2Q2EB 4IBIA 3K92A 2QENA 3UJNA 4GKJM 4B7HA 3DZDA 4DV2M 3SBJA 2F5NA 5H37D 4WURA 1QAOA 4W5WA 3AKZA 1HQCA 4JI1M 3FUWA 2X49A 1SXJE 1L1ZA 3KFUG 5ITUA 3FUUA 5EXPA 2FE8A 3EIEA 4GC9A 1W5SA 2XSZA 4PDGA 1NY5A 5KPZA 3U5ZA 3PVSA 4PDIA 3ILKA 3JR5A 1Z5BA 3RGPA 3MK6A 1DO0A 3E4RA 4B7FA 1NHWC 4IBJA 4ITQA 4KODA 4XGIA 4LJ7A 1XXHB 2VIIA 4LFAM 1R6BX 4JI8M 1J7KA 1XXHA 4LJ4A 4LGYA 1IM2A 4G4NA 4X62M 3FTDA 4I8OA 1E9SA 3L29A 3VKGA 3SAUA 3SFZA 5BR8M 1PM5A 1OJLA 4LJ5A 1QZMA 4GKKM 4FCVA 1VDDA 1KFVA 1IN7A 5KPTA 1Q3BA 2EUCA 4LFBM 3TPZA 2ZBKB 4DR4M 1N32M 3EIHA 1E9RA 2Y20A 2KXEA 3KSXA 2CEAA 3LQQA 4KO8A 4TUWA 1N77A 1L2BA 1HT1E 3K1JA 4LF5M 3J80S 4A3VB 2DWZB 1PJJA 1R2YA 4M9ZA 1E32A 1XMOM 1YUBA 4DV1M 1HR0M 2AHMA 3HJ8A 3FYDA 2OQ4A 4FCTA 1UM8A 2DWMA 1TH3A 4JI4M 4L15A 3HJQA 3IG8A 3U60B 3UZUA 5LMNM 2QBYB 3C58A 3U60A 1G59A 4AI6A 2QBYA 4OX9M 2HCBA 4LG2A 4G4QA 3L25A 4GHAA 1XNRM 1IY1A 2DHRA 3TWMA 3NBIA 3LMMA 2UXCM 3PFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K0K M;  5LMU M;  4G4O A;  2UXD M;  5ITQ A;  2ZM6 M;  4PD2 A;  3OTO M;  4DV0 M;  4DR7 M;  1K82 A;  1K3X A;  5ITX A;  4DR5 M;  5IT9 S;  1IBL M;  1TDH A;  4LFC M;  3GQ4 A;  4NXM M;  4JYA M;  3SAS A;  4DV7 M;  1Q3C A;  3DOA A;  3JAM S;  4G4R A;  1HNX M;  3T1Y M;  4NRV A;  1K3W A;  4JI3 M;  5ITT A;  1Q39 A;  1IBM M;  3SAT A;  1N33 M;  2Q2E B;  1XC8 A;  2UUC M;  1NNJ A;  4GKJ M;  3GP1 A;  2UUA M;  4DV2 M;  4DUZ M;  1EE8 A;  3SBJ A;  1I94 M;  4X65 M;  2F5N A;  1R2Z A;  3A46 A;  4B3M M;  4DV3 M;  1L2C A;  4PCZ A;  4JI7 M;  4JI1 M;  3TWL A;  4DR1 M;  3U6L A;  1L1Z A;  5ITU A;  2UXB M;  2XZU A;  2UUB M;  3U6Q A;  3GPP A;  5ITR A;  1N36 M;  1L1T A;  4LF6 M;  4PDG A;  2VQE M;  1Z5A A;  2F5P A;  4JI0 M;  4PDI A;  4NXN M;  3JR5 A;  5ITX E;  1Z5B A;  4YHH M;  5ITY A;  4DR2 M;  2E5L M;  5FLX S;  3U6S A;  4DV5 M;  4DV4 M;  3GPY A;  4ITQ A;  3T1H M;  3GQ5 A;  2F5S A;  4LFA M;  3VK7 A;  3U6D A;  2OPF A;  4JI2 M;  2F5O A;  4JI8 M;  1XMQ M;  3SAR A;  4G4N A;  5IWA M;  4X62 M;  4AQY M;  3VK8 A;  2XZF A;  4DV6 M;  3SAV A;  1HNW M;  4YY3 M;  5BR8 M;  3JR4 A;  4MB7 A;  2EA0 A;  3SAU A;  1PM5 A;  1N34 M;  2UU9 M;  4JI6 M;  4B3T M;  4GKK M;  4LF4 M;  3J81 S;  1TDZ A;  1KFV A;  2HHH M;  4LF8 M;  4KHP M;  1Q3B A;  3GPU A;  4JI5 M;  3GPX A;  4JV5 M;  3W0F A;  4CIS A;  3U6M A;  4LFB M;  2ZBK B;  4DR4 M;  1N32 M;  2F5Q A;  4B3R M;  2VQF M;  2F4V M;  1J5E M;  4DR3 M;  3SAW A;  4B3S M;  4DR6 M;  4LF7 M;  1L2B A;  2HKJ A;  3A42 A;  4LF5 M;  3J80 S;  1XNQ M;  1PJJ A;  1R2Y A;  1XMO M;  4DV1 M;  1HR0 M;  4DUY M;  3U6E A;  2OQ4 A;  3GQ3 A;  1IBK M;  1Z5C A;  3GO8 A;  1HNZ M;  1MU5 A;  3A45 A;  3J7A S;  4JI4 M;  1MX0 A;  5LMN M;  3U6P A;  3C58 A;  1PJI A;  1Z59 A;  1FJG M;  4LF9 M;  4OX9 M;  4G4Q A;  4X64 M;  1L2D A;  1XNR M;  3U6O A;  3TWM A;  3TWK A;  4NRW A;  4X66 M;  2UXC M;  5A2Q S;  3U6C A; 
#chains in the Genus database with same CATH topology
 4NSR A;  3B74 A;  2LBC A;  1IXR C;  4LJ8 A;  3GLF B;  1TF0 B;  2ZM6 M;  3FUX A;  2LHG A;  4LGM A;  4REZ A;  1NO1 A;  2L7I A;  3GLF A;  2FS1 A;  2EO2 A;  2R4J A;  4DR7 M;  3HHY A;  1NHG C;  4MM3 B;  2BWB A;  5FTJ A;  1IBL M;  4MGK E;  1TDH A;  4NOO B;  1PRB A;  5FTK A;  2R4E A;  3L26 A;  1Z6T A;  2L6O A;  5KO3 A;  4BLC A;  4D80 A;  3E21 A;  3HU1 A;  3ZCB B;  2R6F A;  5EXX A;  3FUT A;  4CHT B;  1NVM A;  3T1Y M;  4M9X A;  3L27 A;  4JI3 M;  3SAT A;  1IBM M;  4FD2 A;  1VEJ A;  2K0B X;  1SXJ B;  2I7N A;  2UUC M;  2K6B A;  3H4J A;  1IN5 A;  3GLG B;  2UUA M;  4S12 A;  3FE3 A;  5C18 A;  1SXJ A;  1I94 M;  3C3D A;  2QQ8 A;  1DGG A;  1R2Z A;  3DA1 A;  5GKN A;  3CF6 E;  4QNM A;  5EXT A;  1GO5 A;  1I4W A;  1PJT A;  2DZO B;  4JI7 M;  3M6A A;  3TWL A;  1TR8 A;  4HEO A;  4GH9 A;  3U6L A;  3I4Y A;  4B08 A;  1QAM A;  2KRK A;  2DXI A;  3NBX X;  3M0E A;  2J7N A;  2H5X A;  2CFO A;  4LZJ A;  1SXJ D;  2CUZ A;  3RFW A;  1N36 M;  2FOI C;  4NC6 A;  3I04 M;  2LVP C;  2R44 A;  3GLH B;  4GMQ A;  2F5P A;  1Z5A A;  1ORY B;  3GLH A;  3HU2 A;  4JI0 M;  2XLJ A;  3D8L A;  2DZN B;  3J7B A;  4G6Z A;  3HU3 A;  1JR3 A;  2C96 A;  5FLX S;  3U6S A;  3HZJ A;  5DFL A;  3KOZ E;  2L4E A;  1N75 A;  4DV4 M;  2WSC F;  3TE6 A;  3R8F A;  3R9X B;  1NSF A;  3BXW A;  4L78 A;  1VDL A;  3U6D A;  4CGY B;  2F5O A;  3KOX E;  4LZZ A;  3E46 A;  1DGB A;  3C3E A;  4DV6 M;  3THG A;  1NJG A;  2LXE A;  4D82 A;  3M7G A;  1UFZ A;  1MJG M;  4WP2 A;  3JR4 A;  1N34 M;  4AG6 A;  3U5Z B;  4B3T M;  4MGH A;  1ZV1 A;  4LF4 M;  2HHH M;  2C9O A;  3IG5 A;  1TGU A;  2KW0 A;  4GEW A;  3HHZ A;  2NQ8 C;  4Z6Y A;  1E94 E;  3GPX A;  4GC5 A;  5FTN A;  3PXG A;  3KDS E;  4CIS A;  1HT2 E;  3U6M A;  2G5G X;  2DEN A;  4GHL A;  2DNA A;  1KSF X;  2B3T A;  1QUT A;  2G8L A;  2Z4S A;  2F4V M;  2KA6 B;  2DKL A;  3GLI A;  4DR3 M;  2LH0 A;  3I4V A;  3SAW A;  2C5R A;  4B3S M;  5E26 A;  4M0W A;  4AKG A;  4D81 A;  3A42 A;  1NJF A;  3ZQJ A;  1YE9 A;  3LVV A;  2X8A A;  2XSZ D;  2QCU A;  1GAB A;  4LRT A;  2P5T A;  2MRO B;  4OU7 A;  1JR3 E;  1NY6 A;  5FSW A;  3B9P A;  3CF2 A;  3K9P A;  5KQD A;  3QAU A;  3SHF A;  2CV0 A;  2ZAN A;  1Z5C A;  1HNZ M;  3LVW A;  2EKF A;  3J7A S;  4QHT A;  1WHC A;  4R3D A;  2RGO A;  1MX0 A;  8CAT A;  3U6P A;  4IBE A;  2XFT A;  2BJW A;  1GKI A;  1Z59 A;  2D7E A;  2EKK A;  3KXE C;  4OW0 A;  3HY5 A;  2MH8 A;  4Q7J A;  4LF9 M;  1FJG M;  3FRI A;  1XB2 B;  4B7G A;  2QPA A;  3U6O A;  4NRW A;  2RGH A;  1QDT A;  2FNA A;  1IXS A;  2BJV A;  2O5R A;  3FD9 A;  4X66 M;  3U6C A;  3W0L B;  2LVQ D;  3PNY A;  5DYI A;  3WHK A;  2OOA A;  3T38 A;  3HWS A;  4G4O A;  3BOS A;  2LNH C;  3LCU A;  1YLA A;  2D7G A;  2R46 A;  1OFI A;  3AV0 A;  2DAI A;  4R71 A;  1K3X A;  2LTU A;  1S3S A;  1IN6 A;  3FTE A;  1AUA A;  3I01 M;  2JZ0 A;  4PT5 A;  4JYA M;  4NXM M;  3H4M A;  3GLI E;  3SAS A;  4IBC A;  1DV0 A;  3DOA A;  1WJ7 A;  4G4R A;  2Y0Q A;  1IY0 A;  4FW9 A;  3KOW E;  1HNX M;  1OAI A;  2QHO B;  1Q39 A;  1N33 M;  3SYL A;  3T15 A;  1XC8 A;  1NNJ A;  1HQY E;  3B89 A;  4IBF A;  4UN2 B;  2V6Z M;  1VEK A;  1IQP A;  1WXQ A;  1WIV A;  3A46 A;  4XBO A;  5DYG A;  4MH0 E;  4B3M M;  1L2C A;  2OOB A;  4PCZ A;  3QYB A;  2L2D A;  3MJ5 A;  1HJP A;  3GRV A;  5FTM A;  2M5Z A;  4I81 A;  1OIZ A;  4L8R C;  3VDU A;  3VDP A;  2UXB M;  2JWS A;  4IIW A;  4RNA A;  3GPP A;  2R65 A;  4LY6 A;  1CUK A;  3W67 A;  2CHV A;  5FTL A;  4ZPX A;  1L1T A;  1PGY A;  2LHC A;  1QDR A;  5EQT A;  1R5L A;  1IY2 A;  2JA2 A;  3KSJ A;  4NSO B;  2HWJ A;  2DZL A;  2XFS A;  4R7G A;  3SC3 A;  3Q8G A;  2JZ1 A;  3AOE C;  2C98 A;  5ITY A;  1T3T A;  2KNA A;  2JY7 A;  2DAM A;  2Y21 A;  4DV5 M;  4I4L A;  4I5S A;  1D0L A;  1TTE A;  1FNN A;  2X4A A;  4BB9 A;  2V1U A;  1JB0 F;  2Z4R A;  3T1H M;  5EP1 A;  1BVS A;  2O25 A;  2R45 A;  4Z8X A;  3VK7 A;  3LW5 F;  2OPF A;  2RRU A;  3HHW A;  3SAR A;  4KLN A;  2YQZ A;  3VK8 A;  2CHQ A;  1GJS A;  1MN3 A;  2HL7 A;  2WZJ A;  4LCB A;  4GIT A;  1HNW M;  4YY3 M;  2YNM D;  2KDL A;  1VEG A;  2CRU A;  1DO2 A;  1TDZ A;  3U61 A;  2DWL A;  1OKS A;  3J2P B;  4LF8 M;  4KHP M;  4JI5 M;  3AJI B;  2QNJ A;  4JV5 M;  3TL4 X;  3KVW A;  1XWI A;  2C9C A;  2F5Q A;  1GL7 A;  4B3R M;  1G41 A;  2VQF M;  3B7Z A;  1J5E M;  2N35 A;  4QOZ C;  1F4I A;  1D0K A;  4DR6 M;  3VLF B;  4LF7 M;  5KPR A;  3WHL A;  3CTW B;  3VKH A;  1DGH B;  2XH9 A;  3GRY A;  1DGH A;  2J5Y A;  1IBK M;  1VQ1 A;  3J27 B;  3KOY E;  3GO8 A;  2DHY A;  1JR3 D;  1L8Q A;  1MU5 A;  1C1K A;  2CHG A;  2DAK A;  3A45 A;  3L28 A;  1OFH A;  1XHB A;  4IBD A;  4IJF A;  2Z8Y M;  1VG5 A;  3HJS A;  4AW4 A;  5EXS A;  1X37 A;  1SG9 A;  1LTM A;  2R18 A;  2XGN A;  2JY5 A;  2O01 F;  4ANR A;  1L2D A;  4X64 M;  4JN6 A;  3TWK A;  1NNU C;  3T6P A;  5A2Q S;  4BBA A;  3AOG A;  3GLI B;  2LVN C;  4K0K M;  4F1I A;  5KQ8 A;  5LMU M;  3HGI A;  2UXD M;  5ITQ A;  1IXZ A;  3FTC A;  2VF8 A;  3OTO M;  3V76 A;  1K82 A;  4L16 A;  2XF3 A;  5ITX A;  4DR5 M;  3GLG E;  2QP9 X;  2L09 A;  2I7P A;  4QNR A;  4LJ6 A;  2CV1 A;  4LFC M;  2FH0 A;  3CGW A;  4P17 A;  3GQ4 A;  4DV7 M;  2W82 A;  1Q3C A;  4AKH A;  3KP0 E;  2V1C A;  4NL4 H;  4NRV A;  5EP3 A;  3A98 B;  1K3W A;  4AKI A;  3HHX A;  3LQR A;  2FFJ A;  2R62 A;  3GP1 A;  2LWX A;  1IXS B;  3ZH9 B;  3HKP A;  3FUV A;  2CV2 A;  1EE8 A;  4DUZ M;  2ZAO A;  4X65 M;  1AIP C;  1LV7 A;  2ERC A;  4DV3 M;  1JQJ C;  3VFD A;  5EP4 A;  2MGW A;  4IBB A;  4DR1 M;  1QQW A;  4LJA A;  2KZS A;  2QSF X;  2XZU A;  4OVZ B;  2UUB M;  1J09 A;  2A5Y B;  4HLQ A;  3U6Q A;  5ITR A;  1ZMW A;  4OVZ A;  1GL6 A;  3RGS A;  1QAN A;  3CF0 A;  4LF6 M;  1W5T A;  2LVA A;  3I51 A;  2VQE M;  3FKE A;  3UK6 A;  1V33 A;  2CP8 A;  1ZQ9 A;  3QYE A;  1QZE A;  4NXN M;  3DFZ A;  5BPV A;  1OAO C;  5ITX E;  4YHH M;  1NV8 A;  3QWL A;  4DR2 M;  2E5L M;  2KNZ A;  2KZU A;  1V34 A;  3SYK A;  4QHS A;  3GPY A;  5EP2 A;  2MJ5 B;  3E9S A;  3FTF A;  2CE7 A;  3K2L A;  5C1B A;  3F92 A;  2JY6 B;  4FWD A;  1QUS A;  3KS4 A;  4FVM A;  4M0D A;  3SMS A;  3MHV C;  3GQ5 A;  2F5S A;  3C9P A;  4JI2 M;  4XK8 F;  1XMQ M;  2D7H A;  1D2N A;  4FWH A;  3UGJ A;  5EJC A;  1T6O A;  3KS8 A;  5IWA M;  4AQY M;  5DNY A;  3RE8 A;  4LRS A;  2XZF A;  3AL0 C;  3SAV A;  2MR9 A;  2C99 A;  2EA0 A;  2UU9 M;  4FCW A;  1ZAE A;  4MB7 A;  2DI0 A;  2BNK A;  2CWB A;  3TQS A;  4JI6 M;  3KP1 E;  4MGI E;  3UMM A;  1SXJ C;  1R7R A;  3FYC A;  3KW6 A;  2ZTC A;  3J81 S;  1XXH E;  2H1R A;  4M9S A;  4MGZ E;  3GPU A;  4WW0 A;  5E6J A;  1N78 A;  2GNO A;  2KEB A;  2APL A;  3W0F A;  1PJQ A;  1GLN A;  3LCV B;  1DGF A;  2XEP A;  3K8Z A;  1G8P A;  4GRI A;  2KRU A;  1KYI A;  5JI2 E;  2DWN A;  2QZ4 A;  4L4U A;  1IN8 A;  1G71 A;  1GVN A;  2HKJ A;  4GIP A;  3MMP A;  1XNQ M;  2ZTD A;  2YR0 A;  5IRE B;  1QAQ A;  2Y0T A;  2JP7 A;  4DUY M;  1OTR A;  3Q8X A;  3U6E A;  4MGY E;  4AZF A;  4RF0 A;  3GQ3 A;  3GRR A;  4Y28 F;  1NV9 A;  2R0I A;  3U61 B;  3ZC7 B;  1QYR A;  4LJ9 A;  1EFU B;  2ZAM A;  1G3I A;  1TH4 A;  1PJI A;  2L7H A;  4EIW A;  4RF1 A;  3B7N A;  2Z3X A;  4IJE A;  3D8B A;  1H6U A;  4QOS A;  3W68 A;  3GLG A;  1YSY A;  4II7 A;  2OO9 A;  2RKO A;  4IBG A;  1D0M A;  4HL4 A;  2M60 A;  2DVW B;  3AFH A;  3AOE A;  3SHG B;  4PD2 A;  3SMP A;  4DV0 M;  4IBK A;  1QVR A;  1TH2 A;  1WGL A;  5JI3 E;  1WGN A;  3L2A A;  2L4F A;  5IT9 S;  1IN4 A;  4JXJ A;  3NWL A;  3GRU A;  5IZ7 D;  1EIJ A;  4P16 A;  2LVO C;  1OIP A;  2J7O A;  1GJT A;  4FWG A;  3PNV A;  3JAM S;  3GLF E;  2K47 A;  2YFQ A;  5F3W A;  2KNV A;  2Z7J A;  4AG5 A;  1G4A E;  2JUJ A;  7CAT A;  5ITT A;  1Q02 A;  1PJS A;  2K9D A;  2Q2E B;  2WSE F;  3B7Q A;  3K92 A;  4IBI A;  2QEN A;  3UJN A;  3BBZ A;  4GKJ M;  4B7H A;  3DZD A;  4DV2 M;  3SBJ A;  2F5N A;  5H37 D;  4WUR A;  2BWE A;  2KHH A;  1QAO A;  3HX3 A;  4CIZ A;  4W5W A;  4KT0 F;  2VF7 A;  3AKZ A;  1HQC A;  4JI1 M;  3FUW A;  2X49 A;  1V92 A;  1SXJ E;  1L1Z A;  3KFU G;  5ITU A;  2EJS A;  3FUU A;  5EXP A;  2FE8 A;  4RKU F;  3EIE A;  4GC9 A;  1W5S A;  4F2L A;  1IFY A;  2XSZ A;  4PDG A;  1NY5 A;  5KPZ A;  3U5Z A;  1P3Q Q;  3PVS A;  4PDI A;  2DAE A;  3ILK A;  3JR5 A;  1Z5B A;  1Y8G A;  3RGP A;  3MK6 A;  1DO0 A;  1C7Y A;  3E4R A;  4B7F A;  1NHW C;  3GLH E;  4IBJ A;  4ITQ A;  3IEC A;  4KOD A;  4XGI A;  4LJ7 A;  1XXH B;  2VII A;  4LFA M;  1R6B X;  4JI8 M;  1J7K A;  1XXH A;  4LJ4 A;  4LGY A;  4CJ6 A;  1IM2 A;  4G4N A;  4X62 M;  3FTD A;  4DBG B;  4I8O A;  1E9S A;  5L8R F;  3L29 A;  3VKG A;  3SAU A;  3SFZ A;  5BR8 M;  2HAK A;  1OJL A;  1PM5 A;  2JY8 A;  4LJ5 A;  1QZM A;  3FRH A;  4FCV A;  1VDD A;  4GKK M;  1KFV A;  1IN7 A;  5KPT A;  1Q3B A;  1OQY A;  2EUC A;  2DAG A;  4LFB M;  3TPZ A;  2ZBK B;  4DR4 M;  1N32 M;  2JNH A;  2Y20 A;  1E9R A;  3EIH A;  2WSF F;  2KXE A;  3IHP A;  3KSX A;  2G3Q A;  1T43 A;  2CEA A;  3LQQ A;  4L6V 6;  4KO8 A;  4TUW A;  1N77 A;  1L2B A;  1ZMV A;  1HT1 E;  2GQF A;  3K1J A;  4LF5 M;  3J80 S;  4A3V B;  2DWZ B;  1PJJ A;  1R2Y A;  4M9Z A;  1E32 A;  1XMO M;  1YUB A;  4DV1 M;  1HR0 M;  2AHM A;  3HJ8 A;  3FYD A;  2OQ4 A;  1ZMU A;  1WR1 B;  4FCT A;  1UM8 A;  2DWM A;  1A5T A;  1R4G A;  1TH3 A;  4JI4 M;  2VDB B;  4L15 A;  3HJQ A;  3IG8 A;  3U60 B;  4G3O A;  3UZU A;  5LMN M;  2QBY B;  3C58 A;  2JXN A;  3U60 A;  1G59 A;  1RU3 A;  4AI6 A;  2QBY A;  4OX9 M;  2HCB A;  4LG2 A;  4G4Q A;  3L25 A;  4GHA A;  1XNR M;  1IY1 A;  2DHR A;  3K9O A;  3NBI A;  3TWM A;  3LMM A;  2UXC M;  3PFI A; 
#chains in the Genus database with same CATH homology
 4NSR A;  1IXR C;  4LJ8 A;  3GLF B;  2ZM6 M;  3FUX A;  4LGM A;  4REZ A;  2L7I A;  3GLF A;  4DR7 M;  2EO2 A;  2R4J A;  3HHY A;  1NHG C;  4MM3 B;  5FTJ A;  1IBL M;  4MGK E;  1TDH A;  4NOO B;  5FTK A;  2R4E A;  3L26 A;  1Z6T A;  2L6O A;  5KO3 A;  4BLC A;  4D80 A;  3HU1 A;  3ZCB B;  5EXX A;  3FUT A;  4CHT B;  1NVM A;  3T1Y M;  4M9X A;  3L27 A;  4JI3 M;  3SAT A;  1IBM M;  4FD2 A;  1SXJ B;  2I7N A;  2UUC M;  1IN5 A;  3GLG B;  2UUA M;  4S12 A;  5C18 A;  1SXJ A;  1I94 M;  1DGG A;  1R2Z A;  3DA1 A;  5GKN A;  3CF6 E;  4QNM A;  5EXT A;  1I4W A;  2DZO B;  4JI7 M;  3M6A A;  3TWL A;  4GH9 A;  3U6L A;  3I4Y A;  4B08 A;  1QAM A;  2KRK A;  2DXI A;  3M0E A;  2J7N A;  2CFO A;  4LZJ A;  1SXJ D;  2CUZ A;  3RFW A;  1N36 M;  2FOI C;  3GLH B;  4GMQ A;  2F5P A;  1Z5A A;  1ORY B;  3GLH A;  3HU2 A;  4JI0 M;  2XLJ A;  3D8L A;  2DZN B;  3J7B A;  4G6Z A;  3HU3 A;  1JR3 A;  2C96 A;  5FLX S;  3U6S A;  3KOZ E;  1N75 A;  4DV4 M;  3TE6 A;  3R8F A;  3R9X B;  1NSF A;  4L78 A;  3U6D A;  4CGY B;  2F5O A;  3KOX E;  4LZZ A;  1DGB A;  4DV6 M;  3THG A;  1NJG A;  2LXE A;  4D82 A;  3M7G A;  3JR4 A;  1N34 M;  4AG6 A;  3U5Z B;  4B3T M;  4MGH A;  4LF4 M;  2HHH M;  2C9O A;  3IG5 A;  1TGU A;  2KW0 A;  3HHZ A;  2NQ8 C;  4Z6Y A;  1E94 E;  3GPX A;  4GC5 A;  5FTN A;  3PXG A;  3KDS E;  4CIS A;  1HT2 E;  3U6M A;  2G5G X;  4GHL A;  1KSF X;  2Z4S A;  2G8L A;  2F4V M;  2KA6 B;  3GLI A;  4DR3 M;  2LH0 A;  3I4V A;  3SAW A;  2C5R A;  4B3S M;  5E26 A;  4M0W A;  4AKG A;  4D81 A;  3A42 A;  1NJF A;  1YE9 A;  3LVV A;  2X8A A;  2XSZ D;  2QCU A;  4LRT A;  2P5T A;  4OU7 A;  1NY6 A;  5FSW A;  3B9P A;  3CF2 A;  5KQD A;  3QAU A;  3SHF A;  2CV0 A;  2ZAN A;  1Z5C A;  1HNZ M;  3LVW A;  3J7A S;  4QHT A;  4R3D A;  2RGO A;  1MX0 A;  8CAT A;  3U6P A;  4IBE A;  2XFT A;  3KXE C;  1GKI A;  1Z59 A;  2BJW A;  2D7E A;  4OW0 A;  4LF9 M;  1FJG M;  4B7G A;  3U6O A;  2QPA A;  4NRW A;  2RGH A;  2FNA A;  2O5R A;  4X66 M;  2BJV A;  3U6C A;  3FD9 A;  3W0L B;  3PNY A;  5DYI A;  3WHK A;  3T38 A;  3HWS A;  4G4O A;  3BOS A;  2LNH C;  2R46 A;  2D7G A;  1OFI A;  3AV0 A;  1K3X A;  1S3S A;  1IN6 A;  3FTE A;  4PT5 A;  4JYA M;  4NXM M;  3H4M A;  3SAS A;  4IBC A;  3DOA A;  4G4R A;  1HNX M;  2Y0Q A;  1IY0 A;  4FW9 A;  3KOW E;  1Q39 A;  1N33 M;  3SYL A;  3T15 A;  1XC8 A;  1NNJ A;  1HQY E;  4IBF A;  2V6Z M;  1IQP A;  1WXQ A;  3A46 A;  4B3M M;  4XBO A;  5DYG A;  4MH0 E;  1L2C A;  4PCZ A;  3MJ5 A;  3GRV A;  5FTM A;  2M5Z A;  4I81 A;  4L8R C;  2UXB M;  3VDU A;  3VDP A;  4IIW A;  4RNA A;  3GPP A;  2R65 A;  4LY6 A;  5FTL A;  2CHV A;  4ZPX A;  1L1T A;  5EQT A;  1IY2 A;  2JA2 A;  3KSJ A;  4NSO B;  2XFS A;  4R7G A;  3SC3 A;  3AOE C;  2C98 A;  5ITY A;  1T3T A;  2Y21 A;  4DV5 M;  4I4L A;  4I5S A;  1FNN A;  2X4A A;  4BB9 A;  2V1U A;  2Z4R A;  3T1H M;  5EP1 A;  4Z8X A;  2R45 A;  3VK7 A;  2OPF A;  3HHW A;  3SAR A;  4KLN A;  2YQZ A;  3VK8 A;  2CHQ A;  2HL7 A;  4LCB A;  4GIT A;  1HNW M;  4YY3 M;  2YNM D;  1DO2 A;  1TDZ A;  3U61 A;  2DWL A;  3J2P B;  4LF8 M;  4KHP M;  4JI5 M;  3AJI B;  4JV5 M;  3TL4 X;  3KVW A;  1XWI A;  2C9C A;  2F5Q A;  1GL7 A;  4B3R M;  1G41 A;  2VQF M;  1J5E M;  4QOZ C;  4DR6 M;  3VLF B;  4LF7 M;  5KPR A;  3WHL A;  3CTW B;  3VKH A;  1DGH B;  2XH9 A;  3GRY A;  1DGH A;  1IBK M;  3J27 B;  3KOY E;  3GO8 A;  1L8Q A;  1JR3 D;  3L28 A;  1MU5 A;  1C1K A;  2CHG A;  3A45 A;  4IJF A;  1OFH A;  1XHB A;  4IBD A;  3HJS A;  4AW4 A;  5EXS A;  1X37 A;  2R18 A;  2XGN A;  1L2D A;  4X64 M;  4JN6 A;  3TWK A;  1NNU C;  5A2Q S;  4BBA A;  3AOG A;  3GLI B;  4K0K M;  5KQ8 A;  5LMU M;  3HGI A;  2UXD M;  5ITQ A;  1IXZ A;  3FTC A;  3OTO M;  1K82 A;  4L16 A;  2XF3 A;  5ITX A;  4DR5 M;  2QP9 X;  2L09 A;  2I7P A;  4QNR A;  4LJ6 A;  2CV1 A;  4LFC M;  3GQ4 A;  4DV7 M;  2W82 A;  1Q3C A;  4AKH A;  3KP0 E;  2V1C A;  4NL4 H;  4NRV A;  5EP3 A;  3A98 B;  1K3W A;  4AKI A;  3HHX A;  3LQR A;  2FFJ A;  2R62 A;  3GP1 A;  2LWX A;  1IXS B;  3ZH9 B;  3HKP A;  3FUV A;  2CV2 A;  1EE8 A;  4DUZ M;  2ZAO A;  4X65 M;  1LV7 A;  2ERC A;  4DV3 M;  1JQJ C;  3VFD A;  5EP4 A;  4DR1 M;  4IBB A;  1QQW A;  4LJA A;  2KZS A;  2XZU A;  4OVZ B;  2UUB M;  1J09 A;  2A5Y B;  4HLQ A;  3U6Q A;  5ITR A;  4OVZ A;  3RGS A;  1GL6 A;  1QAN A;  3CF0 A;  4LF6 M;  1W5T A;  3I51 A;  2VQE M;  3FKE A;  3UK6 A;  1ZQ9 A;  4NXN M;  3DFZ A;  5BPV A;  5ITX E;  4YHH M;  3QWL A;  4DR2 M;  2E5L M;  2KZU A;  3SYK A;  4QHS A;  3GPY A;  5EP2 A;  3FTF A;  3E9S A;  2CE7 A;  3K2L A;  5C1B A;  4FVM A;  4FWD A;  3KS4 A;  4M0D A;  3SMS A;  3MHV C;  3GQ5 A;  2F5S A;  4JI2 M;  1XMQ M;  2D7H A;  1D2N A;  4FWH A;  3UGJ A;  5EJC A;  3KS8 A;  5IWA M;  4AQY M;  5DNY A;  3RE8 A;  4LRS A;  2XZF A;  3AL0 C;  3SAV A;  2C99 A;  2EA0 A;  2UU9 M;  4FCW A;  1ZAE A;  4MB7 A;  2BNK A;  3TQS A;  4JI6 M;  3KP1 E;  4MGI E;  3UMM A;  1SXJ C;  3KW6 A;  1R7R A;  3FYC A;  3J81 S;  2H1R A;  4M9S A;  4MGZ E;  3GPU A;  4WW0 A;  5E6J A;  1N78 A;  2KEB A;  3W0F A;  1GLN A;  1DGF A;  2XEP A;  3K8Z A;  1G8P A;  4GRI A;  2KRU A;  1KYI A;  5JI2 E;  2DWN A;  2QZ4 A;  4L4U A;  1IN8 A;  4GIP A;  1GVN A;  2HKJ A;  1XNQ M;  2YR0 A;  5IRE B;  1QAQ A;  2Y0T A;  4DUY M;  3Q8X A;  3U6E A;  4MGY E;  4AZF A;  4RF0 A;  3GQ3 A;  3GRR A;  3U61 B;  3ZC7 B;  1QYR A;  4LJ9 A;  2ZAM A;  1G3I A;  1TH4 A;  1PJI A;  2L7H A;  4EIW A;  4RF1 A;  2Z3X A;  4IJE A;  3D8B A;  1H6U A;  4QOS A;  3GLG A;  1YSY A;  4II7 A;  2RKO A;  4IBG A;  4HL4 A;  2M60 A;  2DVW B;  3AFH A;  3AOE A;  3SHG B;  4PD2 A;  3SMP A;  4DV0 M;  4IBK A;  1QVR A;  1TH2 A;  5JI3 E;  3L2A A;  5IT9 S;  1IN4 A;  4JXJ A;  3NWL A;  3GRU A;  5IZ7 D;  4P16 A;  2J7O A;  3JAM S;  4FWG A;  3PNV A;  2K47 A;  2YFQ A;  5F3W A;  2Z7J A;  4AG5 A;  1G4A E;  7CAT A;  5ITT A;  2Q2E B;  4IBI A;  3K92 A;  2QEN A;  3UJN A;  4GKJ M;  4B7H A;  3DZD A;  4DV2 M;  3SBJ A;  2F5N A;  5H37 D;  4WUR A;  1QAO A;  4W5W A;  3AKZ A;  1HQC A;  4JI1 M;  3FUW A;  2X49 A;  1SXJ E;  1L1Z A;  3KFU G;  5ITU A;  3FUU A;  5EXP A;  2FE8 A;  3EIE A;  4GC9 A;  1W5S A;  2XSZ A;  4PDG A;  1NY5 A;  5KPZ A;  3U5Z A;  3PVS A;  4PDI A;  3ILK A;  3JR5 A;  1Z5B A;  3RGP A;  3MK6 A;  1DO0 A;  3E4R A;  4B7F A;  1NHW C;  4IBJ A;  4ITQ A;  4KOD A;  4XGI A;  4LJ7 A;  1XXH B;  2VII A;  4LFA M;  1R6B X;  4JI8 M;  1J7K A;  1XXH A;  4LJ4 A;  4LGY A;  1IM2 A;  4G4N A;  4X62 M;  3FTD A;  4I8O A;  1E9S A;  3L29 A;  3VKG A;  3SAU A;  3SFZ A;  5BR8 M;  1PM5 A;  1OJL A;  4LJ5 A;  1QZM A;  4GKK M;  4FCV A;  1VDD A;  1KFV A;  1IN7 A;  5KPT A;  1Q3B A;  2EUC A;  4LFB M;  3TPZ A;  2ZBK B;  4DR4 M;  1N32 M;  3EIH A;  1E9R A;  2Y20 A;  2KXE A;  3KSX A;  2CEA A;  3LQQ A;  4KO8 A;  4TUW A;  1N77 A;  1L2B A;  1HT1 E;  3K1J A;  4LF5 M;  3J80 S;  4A3V B;  2DWZ B;  1PJJ A;  1R2Y A;  4M9Z A;  1E32 A;  1XMO M;  1YUB A;  4DV1 M;  1HR0 M;  2AHM A;  3HJ8 A;  3FYD A;  2OQ4 A;  4FCT A;  1UM8 A;  2DWM A;  1TH3 A;  4JI4 M;  4L15 A;  3HJQ A;  3IG8 A;  3U60 B;  3UZU A;  5LMN M;  2QBY B;  3C58 A;  3U60 A;  1G59 A;  4AI6 A;  2QBY A;  4OX9 M;  2HCB A;  4LG2 A;  4G4Q A;  3L25 A;  4GHA A;  1XNR M;  1IY1 A;  2DHR A;  3TWM A;  3NBI A;  3LMM A;  2UXC M;  3PFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...