4JI1O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4ji1O00
1FYJA 4LF7O 1IBKO 4LF5O 1XNQO 3RT3C 3J81N 2VQFO 4DV4O 3JAMN 2E5LO 4X65O 1FJGO 3F5TA 3T1YO 1HR0O 2UXCO 4DR2O 1R6TA 3R66A 5BXZA 1J5EO 2UXDO 2UUCO 2VQEO 1HNXO 4DR3O 4JI4O 4NXNO 5LMNO 5BY1A 4DV7O 2UUBO 1YZBA 4GKKO 2UXBO 4LF6O 1I94O 1XNRO 1DK1A 2JRIA 4JI2O 2DOSA 4JI6O 4JV5O 4B3TO 3J7AU 2ZM6O 4B3MO 2LW7A 4JI1O 1AB3A 4X66O 1F7YA 4K0KO 4B3SO 1G1XB 4JI0O 1HNWO 4JI3O 4OX9O 5H5NA 1A32A 4LFCO 4JYAO 3M8AA 2N74A 1N36O 1HNZO 1XEQA 4B3RO 4DR5O 4DV6O 5A2QN 5LL6Y 4GKJO 4DV3O 2ZKOA 2UU9O 4DV5O 4OPHA 1XMOO 4AQYO 3OTOO 1NS1A 1IBMO 2F4VO 4JI7O 3J80N 4LFBO 2FKXA 1XMQO 4X64O 1FKAO 4DR4O 1IBLO 4DR6O 4NXMO 4OPAA 4DUYO 2DJVA 1N33O 4DV1O 3O65A 1D2DA 4LFAO 1AILA 1X59A 1KUQA 5IT9N 1R1BA 4KHPO 5IWAO 4LF8O 2HHHO 4DV0O 4JI5O 2UUAO 5LMUO 4DV2O 4LF4O 4YY3O 3SDLA 3T1HO 1N34O 4YHHO 5BR8O 4A5UB 4DR1O 1N32O 4X62O 5FLXN 4DUZO 4JI8O 2Z0AA 2AGAA 4LF9O 4DR7O
chains in the Genus database with same CATH superfamily
5EBWC 3A8TA 5LMUB 1XNQO 3RT3C 3JAMN 3BA9A 2GBOA 4WFGA 2F23A 3SJCC 4DR1B 1HR0O 2H8PC 2YC0A 2CTRA 5BXZA 1MSDA 4UCRA 1AJNA 1I5YA 3CYOA 5GTIZ 5EBLC 1GM8A 1Q7YW 1JJ2U 4LFAB 3MD0A 3ZCCA 4X65B 1U96A 2QM4A 3K5MA 3WG7B 4DR2B 1VQLV 2ITDC 2UUCB 2VQEB 3X2QC 2LW7A 3SYQA 5LMNB 4X66O 1M57C 2E75B 5L3CA 1G1XB 4NR1A 2P4KA 4LR3A 4CBCA 3VOUA 1M56C 2AHZA 4JAUA 4BIOA 1SQBH 4NTXA 3K06A 1MZFA 1OCOB 1ZWIC 4GUNA 1FJGB 3E2EA 2FB5A 2A7WA 3ZHVA 5HFLA 5EIBD 2XHBA 1SC5B 1EN6A 3CCEV 2ZKOA 1YF2A 1Y74B 1NTZH 3JATB 4BWAA 1PNMA 2C2AA 3APQA 1MABG 2HVKC 5GONA 1Q90D 2K1EA 1SQFA 2F43G 3VQVA 1AI4A 4JI7O 4F6RA 1XMQO 2JVDA 2RNBA 1BT8A 4MVQA 1H2GA 4UB6Z 3T2MA 1XMOB 1WPBA 3EVKA 4YJ3B 5ITZB 2YXLA 1VARA 4ZHQA 5L3DA 1TUBA 1R6KA 1BHAA 5IYZB 2P6JA 4IIJA 4F4LA 4X1KA 4CS4A 4DV2O 2WPDG 4U7NA 1V54B 1Q81W 4X62O 2XOKG 3JCZA 4JAVA 1G4YB 4BR6A 1K73W 4WFFA 4JI5B 1FYJA 3FX7A 5LP6B 5HFMA 2KG7B 1F51A 2KSDA 3T1HB 2W0XA 3ABKC 3T4ZA 3WB2A 3G6BA 1N32B 1SQGA 4CH6A 5J2TA 1NI8A 2OCCB 1J5EO 2LP7A 1L0NH 2YIAA 5CB4A 3STLC 4FLVA 4CS2A 1Q86W 4JTAB 3ZN1A 5LYJB 2QTOA 2VWKA 4LF8B 4FLWA 1SQPH 4JV5O 4B7EA 1QLNA 4J10A 4J7KA 4YY3B 1N34B 2F93B 3T1CA 1SESA 5E79Z 4HNAA 5E1AC 2KKWA 4LF9B 4G27B 3MDSA 3JALB 5H6QA 4B3TB 1YIJV 2ZIOA 1NVPB 5JH7A 3E89A 3SJBC 1KBHA 5D5QA 3ZRVA 3LDDA 3GB7C 2QEXV 4DW1A 4KUMA 3N2KB 2P90A 3A0RA 4P2ZA 1ZX3A 3BVOA 2LO1A 1VEWA 4X8AA 3CRRA 3RYIA 1PM9A 4UFZA 2R72A 2B1IA 4IHJB 4GKJB 2ZM6B 3AK1A 1AVMA 2WLHA 3O65A 4PELA 3E8GA 1AR1B 1R1BA 3OEHG 4DV0O 3RFRA 1JA8A 2XAJA 1FD9A 1NR1A 2GHYA 2M7WA 2WLNA 3ETEA 3OT7A 5B66Z 5H2FZ 3EFFK 3RWRD 4EFEA 1IX9A 2PZSA 4IYIA 5KA6A 2NN4A 1N8RW 2EILB 1NTKH 4RQFA 1FS0G 2BSKB 1IBKO 4DV5B 3SYAA 4LF5O 5L3BA 2NLJC 1SRYA 3CHXA 4WF9V 3AEIA 2W6IG 3WFVA 1L1FA 3SPIA 2UXCO 1YVWA 1BCCH 2ZXWB 3BFRA 4U3JB 1Q3EA 1IXBA 1CP9A 3CXHF 4LF7B 5CA1A 4G2KA 4CC5A 1SKVA 2DYRC 1B04A 1I5XA 3SYCA 1Y4MA 5IYCO 4JI2O 2QKSA 2DYSC 2EIKC 1K9MW 5FPRA 3C90A 2CTQA 2A3QA 3E83A 3OW2U 2LFSA 4LNUB 4K0KO 3FKSG 3EHBB 1ZTEA 1ORQC 1VQ5V 3B4SA 1LUWA 1AI5A 2JJ2G 4EFBA 3P3PA 3JARB 3PN1A 3K79A 2QA4V 1HNZO 1XEQA 4B3RO 2CTPA 4ASUG 1HNWB 2CAZC 2RJZA 2EIMC 2XUMA 2WSSG 4JYAB 4FZ1A 1CXZB 3ZRWB 2MK3A 1VQMV 1GRJA 2F4VO 2RDCA 2QWQB 4LFBO 5CA0B 3LSQA 3SR2C 5DM6V 4NVPA 4PA3A 4JI0B 1H2SB 4TV9B 4PD4F 2R9IA 3AG2C 4LCUC 3TCUA 3K3WA 1GN4A 5KUKA 4RUEA 1Y74A 4E2LA 3JATA 2JEUA 3K03A 1VF6A 3UO2A 1BSMA 3AG4C 1FXKC 1US6A 3WB0A 4CC6A 2E74B 4LF4B 3OE7G 1GH6A 5B1NA 4D6TH 3AG7A 1M1KW 4PJ0Z 3F5WC 1D5NA 2EZOA 5ITZA 2ZDIA 1XNQB 1XHZA 4I9WA 1YZBA 3K0DA 4BW5A 1HR0B 1HP8A 1EFRG 4UCTA 5B1AC 4O4IB 4B3MO 1ZAUA 2VWJA 4P9PA 5LP6A 4NYKA 5D5PA 2KG7A 1Y6XA 3DC6A 3I5DA 1DTOA 3LNNA 1I08A 2WLJA 4LFCO 4J42A 1E79G 5EZYA 5JQGB 3K58A 2W0FC 5J2UB 3QVNA 4PDLA 1LNQA 2AZ2A 4X1IB 3G80A 4DW0A 4X66B 1XL6A 3H1LH 3CC7V 2QKAA 3CJHA 5F2VO 4JTCB 2CH7A 1OCZB 1XHXA 5LOVA 4NKGB 4TUYB 4OPHA 3CCVV 3VQXA 4AQYO 3ABLB 1YJWV 1WNSA 3J80N 1KECA 2WA3A 5B3SB 3DXRA 1KB9F 2GUZB 1U97A 5IYBO 3E8BA 2QWPB 3IC7A 3APOA 3SPGA 3CRMA 1JOYA 5KHHA 1XMQB 1H2MA 3ASOB 4PA7A 4IT5A 2LGWA 4GX2A 3AG1C 2HEPA 2HKOA 2IH3C 5CMUA 4CS3A 1BHBA 4I55B 3WB1A 2WLLB 4K8XA 1P7BA 4X20B 3H01A 2ZR2A 5L3GA 3SYOA 2YXYA 3LDCA 3J81N 4DV2B 3CRQA 1EZVH 3F5TA 3T1YO 2OIEA 1FFXB 4X62B 2IBZH 2B9ZA 2LGQA 2YI8A 1P84F 1RSOB 4EEQA 4J11A 1S5JA 2QGNA 3N2GA 4NXNO 2UXBO 1RPOA 1YDXA 2OTLV 1Q43A 4B08A 1NJIW 2JRIA 4JYCA 3S3WA 2MW2B 1OCCB 4D7SA 1J5EB 3HKEA 3RYCA 3WG7C 3IFXA 3BPZA 4ZOLB 3FYIB 5L3FA 1NQTA 4QPJA 3BRCA 5AG2A 2BCCH 4DR7B 3W7XA 4J9YB 1GMGA 4R50A 5B1BB 4JV5B 4RO2A 1SQQH 4MT8A 1H2NA 2BTQB 1K3EA 2HJDA 3E35A 1OCOC 4GX0A 2YXHA 3TETA 1BMFG 1XUQA 1TA8A 2XAHA 4FM1A 1GM7A 4MTFA 3BY6A 3CD6V 3CC4V 3E22A 5L3EA 1H38A 2GSMB 1PNLA 3NR7A 1Y76A 4TWKA 1BGYH 4LNUA 4OPAA 4FLZA 4MVUA 3L74H 4DUYO 3QG5A 3JSLA 3TGUH 3JARA 1I7FA 1AI7A 3D8CA 5EC1C 1N36B 4TQFA 2FL4A 4O2AB 4OXSA 5FNVB 1B06A 1AR5A 3SGIA 3CCLV 5EBMC 1YITV 1SQXH 3FB5C 1V54C 2WWWA 4L87A 4DV0B 4I4TB 4O4HB 3W7UA 4EKWA 2ODMA 2X6CA 2RCVA 2YEVA 5LP6C 1BS3A 2LJ2A 4AHCA 1XBLA 1R6TA 1YHQV 1GN2A 4FFBA 2UXDO 3AG3B 4ZI7B 1UJWB 4JPRA 2OCCC 1JVMA 1IBKB 2YS8A 2UUBO 4W4LA 1I94O 4KHPB 1AI6A 2UXCB 3G6EV 1XREA 1QCEA 2OYQA 3W7SA 3E8HA 2CGOA 1B6QA 1K7DA 3BHPA 4QE7A 3ZX6A 1KU9A 3NXSA 4ICGA 4JI3O 5GW7A 5H5NA 3CXCU 2PI4A 2EINB 2X7RB 2QDOA 5BMVB 4K0KB 4MW3A 1W2BU 5KX5B 4FK5C 1XL4A 2YIBD 5CN0A 1WB8A 4TV8A 2V7QG 4O4IA 4UCUA 4ABMA 1HNZB 1YSCA 2QM8A 4B3RB 4O2BB 4HYOA 2WLKA 3GWOA 1VQ9V 4DR4O 2IW5A 3JD2A 3JD3A 2G38A 4K3AA 5KA5A 3CC2V 1QR9A 2DJVA 3ABTA 4JI1B 1RPRA 1VQ8V 1EN5A 1JCHA 2VRZA 2F4VB 5J2UA 4O4JA 2JGDB 2IU3A 4LFBB 1KYOF 1UFIA 1AROP 4X1IA 1TVKA 1K97A 4TQDA 2FMLA 4QJFB 4XBFA 1Z2GA 4RWUA 3A0HZ 3SDLA 5C8YA 1K92A 2QWRB 3JAWA 1EBOA 2YI9A 4QNHB 1JFFB 1I0HA 3ZMTA 3CCJV 3CCMV 2XASA 2JS3A 2E5LO 3CB2A 3CCRV 2XAQA 5K1XA 4AILC 2R9AA 4LWSB 1L8DA 2WLIB 2HJFC 1NH2D 4LF6O 4H0LB 2GV9A 4FVMA 2E76B 5LA6A 2LQTA 4JI6O 2EBOA 3STZC 1FPOA 5LHGA 2WLLA 3SJAC 4X20A 1F7YA 5KUMA 1MZEA 3D3IA 4D7TA 1UPGA 2QM7A 4EB6A 1Q6IA 5K1PA 2P4VA 3OMNB 4B3MB 1SA0B 4UVAA 4NTWA 4UCSA 4QIWF 1PP9H 1VIBA 4G28B 2EZPA 2H94A 2CUGA 2K9PA 3N27A 1FXKA 3CPWU 3UT5B 4DV3O 1VQ4V 4K35A 3IC9A 5KHIA 1OCRB 1OHHG 4LFCB 3UKMA 4RUFA 4W4KA 4K8ZA 1IBMO 2Y69B 4ZOLA 3VBBA 1VF7A 1O9GA 1NH2B 1M9NA 4DR6O 4NXMO 4IYHA 1X4TA 3JASB 2QWNB 1HWYA 2ZD9A 1N33O 4DV1O 4AQYB 3H9VA 4IL6Z 1KUQA 2GTAA 4WBNB 4P30A 4WFBV 2XNDG 2UUAO 3L70H 3HKBA 4FPPA 2ZINA 4ZIBA 3L72H 5JVDA 2A0LA 4X1YB 3RYHA 2WA4A 2KB1A 3FB8C 4DRXB 4DUZO 2F95B 5EYPA 4YJ2A 1K33A 1F4NA 1YEWA 1M90W 1SF9A 5JWPA 3VQYA 4MSWC 1M56B 2PI5A 4C7UA 3ZHUA 4GLXA 1FXVA 1VQPV 3ZMVA 3ETGA 3B40A 3GVMA 5IY5B 3T1YB 3QNEA 1DGSA 2ZT9B 3CCSV 1WA8B 2QWOB 1SETA 5LBQA 1SERA 3OMAB 2A79B 4NXNB 3C3TA 2UXBB 1OV9A 4O4HA 4I4TA 4JI8B 3Q4HB 1PV0A 4JASA 4L8JA 1K34A 1V55B 4ZI7A 1ZSPA 2Q5ZA 2Y4TA 4WFEA 3R65A 2AXTZ 1GM9A 1ZL8B 1SQVH 4BIUA 2IJHA 2A06H 1OCZC 1OZ0A 2ZE5A 4GT1A 3ASNB 3ABLC 1FKAO 3BABA 5LXTB 4CH3A 5CBHA 5B3SC 4Z1MG 2AHYA 1M5IA 1VQNV 1PD3A 5LGNA 2ZQMA 4LFAO 2EIJB 3OR7C 3ZHSA 3H1IH 3ASOC 5BR8O 4GX1A 2IU0A 1P49A 4RAIA 3RBZA 1IDSA 4FFKA 3FB7C 2OT5A 2M6YA 3IAYA 4DV4O 2GTSA 1RFYA 1FJGO 2CK3G 4FM0A 3K9AA 1BQ0A 3ZHRA 3K59A 1R3IC 2XTAA 3MAQA 3B2EE 2P5OA 2JGDA 4H33A 4DR3O 2JIZG 1AP5A 4DV7O 4JZ2A 3DGEA 2BTOA 3HR0A 1VP7A 4UVBA 1N0NA 3BAAA 2UXDB 2YIDA 1JFFA 3G4SV 1OCCC 4XDJA 5J9PC 3H1HH 2UUBB 3U0ZA 1VQOV 3ZN0A 1D5AA 2WAMA 5IE9A 4YJ3A 1LUVA 2CGNA 4OX9O 1PL4A 2Y0PA 5IYZA 5B1BC 3ABMB 4E4EA 4JYBA 3H1JH 4I9QA 2QTSA 3MHHC 4DR5O 4JI3B 4DV6O 2Q4PA 4J41A 2E3CA 4DO2A 1YCIA 2HP8A 4MVRA 2DMXA 5KAIZ 2EJRA 3OTOO 2ZNIA 2KQXA 2YDEA 2PF4E 4PDRA 1SS3A 2ADPA 5EK0A 3KG2A 3VQWA 2Q0OC 5LYJA 4LF8O 2HHHO 4DR4B 4IGGA 1F4MA 3IJ4A 4YY3O 1L0LH 1S5LZ 1N34O 4XDLA 5DECA 1GN6A 2R70A 3H1KH 1Q8IA 2AGAA 4LF9O 4WCEV 4J7JA 5IYDO 1M93A 3JALA 5GONB 1EZJA 1JQ0A 2ATKC 3K5OA 2Q69A 4JI7B 3LUTB 1DF4A 3N2KA 5LGUA 2O57A 5BZBA 3B09A 4WBNA 5LHIA 4PDMA 4WFHA 3AG3C 5B5EZ 2E5LB 4ZHQB 4CZZA 1TUBB 3P3NA 2EIMB 1DK1A 4IIJB 4H44B 5B1OA 4X1KB 1PKXA 1QVFU 4IHJA 2ZM6O 1H2KA 1KMIZ 2X0LA 2GDSA 2PUSA 1YI2V 4FLXA 4LF6B 3LSUA 3JD4A 3ZS8C 4JI6B 3RYFB 3K5LA 2A9HA 3K08A 3D36C 2EINC 1XOUA 4Q20A 5JJJB 2BOCC 5A2QN 3LSSA 3KZIZ 1H8HG 4H13B 3GWKC 4DV5O 2ZR3A 2DN9A 2JGUA 1XI1A 2BSKA 1AR4A 2P06A 2XAGA 2ETNA 4FZ0A 1NS1A 1G8MA 4CH5A 3SJQC 2PYJA 4DV3B 3Q4HA 2HLDG 4HNAB 4U3JA 3BA8A 3SPJA 4I5SA 2R9RB 1AJQA 3ICXA 3OUFA 1IBMB 2Q6AA 3W7WA 1DF5A 1E1QG 4DR6B 4NXMB 5JH7B 4NTYA 1ZL8A 1MOFA 1WAZA 2JEXA 2Q8VA 4A5UB 1N33B 1CPYA 2Z0AA 4JGSA 2UUAB 2B5UA 3RYIB 1QR8A 4FLUA 3P32A 1B3QA 3HPLC 3L75H 4MVMA 2JK5C 3A0BZ 2OTJV 1HDJA 3TXQA 4JI4O 2YUAA 4ZKIA 4GKKO 1NZ6A 3ZRWA 2RN9A 4KFMA 1E1RG 1MSWD 2LFRA 2EJ7A 1GAXA 5CA0A 4FIPC 2FYUH 5EIBC 1WPXA 1IXMA 4JI0O 2QJ1A 1WN7A 3OMIB 4TV9A 4N21A 4LF5B 5JJEB 1WB7A 4I7ZB 4TOIA 2V4DA 1WLEA 2UU9O 5JCOC 4OGQB 3CRAA 2NNUA 1Q6HA 3JYCA 1OCRC 4B7KA 2Z5UA 4JI2B 4UUJC 1K8AW 2VS0A 4P9OA 2Y69C 4J9ZB 1IVSA 4DK0A 2N05A 3CX5F 2OIGA 4XDKA 2DQ3A 3CE2A 1KKDA 3JAKB 3PJSK 1G6UA 1AILA 1OJHA 3CEIA 5IT9N 1QLEB 3OEEG 1NBMG 4YXWG 5IWAO 4MTXA 1S5HC 5FPOA 1JR9A 3HKCB 1P4RA 5FL7G 2PGGA 2Z3YA 4YHHO 3K0GA 4LC1A 2Y48A 1VQ7V 1FAFA 4DYLA 5JJNB 1YJNV 3FYEB 1Z5WA 2CTWA 2IJIA 2VQFO 1LR1A 3OM3B 3L9DA 5JQGA 1JJOA 5BR8B 3JD0A 4KP4A 5CBFA 5IJ0B 4R6ZA 1DLBA 3F7VC 1SZXA 1RM1B 2Q68A 1HNXO 2BOBC 5BY1A 4DV4B 4TUYA 4WFAV 2W6JG 1XNRO 5EC2C 3HB3B 1NKDA 5IY5C 2BE3A 2EILC 2GUZA 3AK2A 4DR3B 4KXRA 4DV7B 2HFEC 3F7YC 1SZTA 3I56V 3KCXA 1S3JA 1A32A 2ZXWC 2DQ0A 3K5NA 2N04A 3LNMB 1R73A 4GCZA 3QTCA 2EULA 1V55C 3CMEV 4QGPA 4OX9B 4I55A 1YJ9V 2Q7GA 5LGTA 3I55V 4JAAA 2ZNJA 4UCVA 3C3SA 1NU1H 4X64O 4DR5B 1FFXA 1J95A 4DV6B 2ADQB 1K5SA 3ASNC 1NVPD 1Q5OA 1RSOA 2PY5A 3RYFA 3TXSA 3OTOB 3EXAA 3ETQA 5C93A 1X59A 4HAMA 5EZYB 4JTDB 2EIJC 2DW4A 1H2LA 5H9CA 3U10A 3S3XA 3FB6C 4PI2A 1R3JC 3OR6C 3CJHB 1VMGA 3D3QA 4R7CA 1KQSU 1QU7A 3ZEDA 2CH7B 4DR7O 1WP8A 4U3FH 2HHHB 5LOVB 2L6LA 1XILA 1KKCA 2UXXA 1Y67A 3FFQA 3G67A 2IH1C 2BTQA 1GK9A 3FD9A 3DXRB 2ZE6A 4LBEC 2HVJC 2Q7EA 3T4DA 1JPXA 5KMGB 4PA6A 4PA9A 1EN4A 3QO8A 1MNGA 1WP7A 2ARHA 3B77A 3U11A 1BQZA 3L71H 3RVZA 3X2QB 3ZIAG 3J7AU 1M57B 4MVOA 2AZ0A 4O4LB 3HKDB 1PNKA 3OD4A 1ENVA 4B3SO 5H6RA 3CS5A 3KKYA 4MTGA 2N74A 2IJJA 1N36O 1S0VA 3K04A 4I50B 3ZHQA 4GZRB 4O2AA 5FNVA 1EM1A 3ABMC 3CWBH 3UCSC 3TJTA 3CRCA 4UVCA 3N2GB 4HBNA 3M99B 2NR5A 3HKEB 1IBLO 3RYCB 2RMKB 4PV1B 2Y4UA 3B8NA 4UV9A 4DXWA 4Z2WA 4BIZA 2X6AA 3JSNA 1S76D 4KHPO 3CP1A 5KAFZ 2Y0IA 3ZMZA 3FAVB 5LMUO 1RP3B 4LH6A 5CBGA 1KD1W 4DR1O 2F1MA 4X9QA 1GO3F 3ZHTA 2UXNA 3KCYA 4FM2A 5KLVH 4I0XB 2DWEC 3E22B 4J7ZA 3THOA 3ABKB 3D36A 3B8MA 2ZE8A 5TISZ 1Y76B 2QE7G 4X65O 5BMVA 1THZA 1R6NA 4DR2O 3JAKA 3A2FA 1PPJH 2UUCO 1Z5VA 1VQKV 1MG1A 3CMAV 2VQEO 4DUYB 3O9OA 1URFA 5KX5A 4FLTA 4LP8A 5LMNO 4YIPA 2Q0AA 3HKCA 2H3OA 2Q9LA 1MA1A 3QF7A 4O2BA 4ZBMA 1QVGU 1YTFD 4FMTA 4JI4B 2QKCA 4JI1O 2DE0X 3TK1A 4GKKB 1BZKA 1S77D 2P67A 5IJ0A 5IJ9B 2D3OW 2YEVB 3M7MX 1BE3H 3UM7A 2CDYA 4FFBB 4GYCB 2JJ1G 3RVYA 4BW9A 1XMOO 1VF5B 1FXHA 1GN3A 1I94B 2YIBA 5KHJA 2XAFA 2FKXA 2ILMA 4PA4A 3UO3A 3OTFA 3UQ8A 2UU9B 4LWSA 1MMMA 1GTOA 3SPCA 2WLIA 1YTFB 2ZCEA 5DN6G 1VQ6V 3BCCH 1P7GA 1IURA 5IDJA 4JI5O 5A9GA 1NR7A 3T1HO 4GX5A 2JS5A 1N32O 1AP6A 2Q7HA 4MS2A 5IWAB 2WLMA 4TV8B 4UXNA 4UB8Z 1YXBA 1K5QA 1KP3A 4YHHB 4F6EA 4LH7A 1SA0A 2Q73A 5KHKA 3K57A 1QNMA 2DYRB 4CH4A 1S72V 4NB5A 5JCOA 3UT5A 3OUSA 4TT3G 2VQFB 3CSXA 2CE4A 4FJCC 4O4JB 2DYSB 2EIKB 1TVKB 3JD1A 1COWG 2DOSA 2L35A 4B3TO 1ZLZA 5C8YB 1R3KC 3OAAG 3JAWB 1ROPA 1HNXB 4JZGA 3JASA 4F6RB 1AB3A 4PI0A 4R8CA 2OCHA 3WU2Z 1XNRB 4DK1A 3W7TA 1XDCA 2P22C 2ZE7A 3ABUA 5KHGA 2PTMA 5KMGA 4X1YA 3ZRXA 4MVZA 2HR3A 4Q6GA 4DRXA 4GKJO 4X89A 1N4CA 2XT9A 4RQEA 4UCOA 2LW1A 4QPKA 1M4UA 3OFNG 1TGOA 3ZRSA 5LA6B 4O4LA 3HKDA 1T5EA 3RN4A 3E86A 1N0JA 5DEDA 5J2TB 1O9HA 1JX9A 4KL1A 4YIOA 3AG2B 1QQCA 4EB6B 5CB4B 4I50A 1KC8W 4X88A 3QO5A 3AK3A 4X64B 1TUEB 1QLEC 3RW0A 1W59A 3K9SA 2X6BA 3QO7A 1H8EG 1WA8A 1NTMH 3OGCC 3AG4B 1FXKB 4Z1VA 3OGIB 5FLXN 4JI8O 4JF3A 2FTKA 2QSAA 2B1GA 1Y66A 4LF7O 2V1DA 2OWOA 1AJPA 2ZIMA 4MTOA 1R3LC 4MW8A 1FFTB 1NT2B 3ETDA 3R66A 5CA3A 2P7TC 4QE9A 2YICA 2QR4A 1HW7A 1K4DC 1Q6UA 2F66C 4DV1B 1TAEA 3FAVA 1RM1C 4PHZA 3DC5A 5B1AB 3BEHA 1V9PA 3E8FA 3SYPA 3CCQV 4N23A 3ML0A 2Q67A 1W0KG 3LDEA 1XQ8A 5LHHA 3HKBB 4TSFG 1WJZA 3ZMUA 4BAYA 5LXTA 5JVDB 2D2CB 2IM9A 2EX3A 3RYHB 4I0XA 5EYPB 3IGAC 4YJ2B 3ZMSA 2IJKA 4PDVA 4DUZB 1W0JG 1HNWO 3DTUB 1KP2A 3ZJZA 1QHTA 1VF6C 2DWDC 4JYAO 3M8AA 1CEZA 2AW9A 2PYLA 3G71V 1F23A 5GTHZ 1BL8A 4B3SB 5LL6Y 2ITCC 4AI8A 2HG5C 2ZDIC 1IZ3A 3DSQA 4MVSA 1Q82W 3P30A 1K4CC 2RQ6A 1PL0A 4U7OA 3CCUV 1QBZA 3L73H 2YSUB 4H37A 4UV8A 1D2DA 5IJ9A 2JDIG 5CA1B 1JMKC 3AG1B 1IBLB 4J80A 4JYYA 3RGBA 3MHSC 1GKFA 4LF4O 3ZBHA 1ZUQA 4HZ3A 3SPHA 3JCUZ 4FLYA
chains in the Genus database with same CATH topology
1FYJA 4LF7O 1IBKO 4LF5O 1XNQO 3RT3C 3J81N 2VQFO 4DV4O 3JAMN 2E5LO 4X65O 1FJGO 3F5TA 3T1YO 1HR0O 2UXCO 4DR2O 1R6TA 3R66A 5BXZA 1J5EO 2UXDO 2UUCO 2VQEO 1HNXO 4DR3O 4JI4O 4NXNO 5LMNO 5BY1A 4DV7O 2UUBO 1YZBA 4GKKO 2UXBO 4LF6O 1I94O 1XNRO 1DK1A 2JRIA 4JI2O 2DOSA 4JI6O 4JV5O 4B3TO 3J7AU 2ZM6O 4B3MO 2LW7A 4JI1O 1AB3A 4X66O 1F7YA 4K0KO 4B3SO 1G1XB 4JI0O 1HNWO 4JI3O 4OX9O 5H5NA 1A32A 4LFCO 4JYAO 3M8AA 2N74A 1N36O 1HNZO 1XEQA 4B3RO 4DR5O 4DV6O 5A2QN 5LL6Y 4GKJO 4DV3O 2ZKOA 2UU9O 4DV5O 4OPHA 1XMOO 4AQYO 3OTOO 1NS1A 1IBMO 2F4VO 4JI7O 3J80N 4LFBO 2FKXA 1XMQO 4X64O 1FKAO 4DR4O 1IBLO 4DR6O 4NXMO 4OPAA 4DUYO 2DJVA 1N33O 4DV1O 3O65A 1D2DA 4LFAO 1AILA 1X59A 1KUQA 5IT9N 1R1BA 4KHPO 5IWAO 4LF8O 2HHHO 4DV0O 4JI5O 2UUAO 5LMUO 4DV2O 4LF4O 4YY3O 3SDLA 3T1HO 1N34O 4YHHO 5BR8O 4A5UB 4DR1O 1N32O 4X62O 5FLXN 4DUZO 4JI8O 2Z0AA 2AGAA 4LF9O 4DR7O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FYJ A;  4LF7 O;  1IBK O;  4LF5 O;  1XNQ O;  3RT3 C;  3J81 N;  2VQF O;  4DV4 O;  3JAM N;  2E5L O;  4X65 O;  1FJG O;  3F5T A;  3T1Y O;  1HR0 O;  2UXC O;  4DR2 O;  1R6T A;  3R66 A;  5BXZ A;  1J5E O;  2UXD O;  2UUC O;  2VQE O;  1HNX O;  4DR3 O;  4JI4 O;  4NXN O;  5LMN O;  5BY1 A;  4DV7 O;  2UUB O;  1YZB A;  4GKK O;  2UXB O;  4LF6 O;  1I94 O;  1XNR O;  1DK1 A;  2JRI A;  4JI2 O;  2DOS A;  4JI6 O;  4JV5 O;  4B3T O;  3J7A U;  2ZM6 O;  4B3M O;  2LW7 A;  4JI1 O;  1AB3 A;  4X66 O;  1F7Y A;  4K0K O;  4B3S O;  1G1X B;  4JI0 O;  1HNW O;  4JI3 O;  4OX9 O;  5H5N A;  1A32 A;  4LFC O;  4JYA O;  3M8A A;  2N74 A;  1N36 O;  1HNZ O;  1XEQ A;  4B3R O;  4DR5 O;  4DV6 O;  5A2Q N;  5LL6 Y;  4GKJ O;  4DV3 O;  2ZKO A;  2UU9 O;  4DV5 O;  4OPH A;  1XMO O;  4AQY O;  3OTO O;  1NS1 A;  1IBM O;  2F4V O;  4JI7 O;  3J80 N;  4LFB O;  2FKX A;  1XMQ O;  4X64 O;  1FKA O;  4DR4 O;  1IBL O;  4DR6 O;  4NXM O;  4OPA A;  4DUY O;  2DJV A;  1N33 O;  4DV1 O;  3O65 A;  1D2D A;  4LFA O;  1AIL A;  1X59 A;  1KUQ A;  5IT9 N;  1R1B A;  4KHP O;  5IWA O;  4LF8 O;  2HHH O;  4DV0 O;  4JI5 O;  2UUA O;  5LMU O;  4DV2 O;  4LF4 O;  4YY3 O;  3SDL A;  3T1H O;  1N34 O;  4YHH O;  5BR8 O;  4A5U B;  4DR1 O;  1N32 O;  4X62 O;  5FLX N;  4DUZ O;  4JI8 O;  2Z0A A;  2AGA A;  4LF9 O;  4DR7 O; 
#chains in the Genus database with same CATH topology
 5EBW C;  3A8T A;  5LMU B;  1XNQ O;  3RT3 C;  3JAM N;  3BA9 A;  2GBO A;  4WFG A;  2F23 A;  3SJC C;  4DR1 B;  1HR0 O;  2H8P C;  2YC0 A;  2CTR A;  5BXZ A;  1MSD A;  4UCR A;  1AJN A;  1I5Y A;  3CYO A;  5GTI Z;  5EBL C;  1GM8 A;  1Q7Y W;  1JJ2 U;  4LFA B;  3MD0 A;  3ZCC A;  4X65 B;  1U96 A;  2QM4 A;  3K5M A;  3WG7 B;  4DR2 B;  1VQL V;  2ITD C;  2UUC B;  2VQE B;  3X2Q C;  2LW7 A;  3SYQ A;  5LMN B;  4X66 O;  1M57 C;  2E75 B;  5L3C A;  1G1X B;  4NR1 A;  2P4K A;  4LR3 A;  4CBC A;  3VOU A;  1M56 C;  2AHZ A;  4JAU A;  4BIO A;  1SQB H;  4NTX A;  3K06 A;  1MZF A;  1OCO B;  1ZWI C;  4GUN A;  1FJG B;  3E2E A;  2FB5 A;  2A7W A;  3ZHV A;  5HFL A;  5EIB D;  2XHB A;  1SC5 B;  1EN6 A;  3CCE V;  2ZKO A;  1YF2 A;  1Y74 B;  1NTZ H;  3JAT B;  4BWA A;  1PNM A;  2C2A A;  3APQ A;  1MAB G;  2HVK C;  5GON A;  1Q90 D;  2K1E A;  1SQF A;  2F43 G;  3VQV A;  1AI4 A;  4JI7 O;  4F6R A;  1XMQ O;  2JVD A;  2RNB A;  1BT8 A;  4MVQ A;  1H2G A;  4UB6 Z;  3T2M A;  1XMO B;  1WPB A;  3EVK A;  4YJ3 B;  5ITZ B;  2YXL A;  1VAR A;  4ZHQ A;  5L3D A;  1TUB A;  1R6K A;  1BHA A;  5IYZ B;  2P6J A;  4IIJ A;  4F4L A;  4X1K A;  4CS4 A;  4DV2 O;  2WPD G;  4U7N A;  1V54 B;  1Q81 W;  4X62 O;  2XOK G;  3JCZ A;  4JAV A;  1G4Y B;  4BR6 A;  1K73 W;  4WFF A;  4JI5 B;  1FYJ A;  3FX7 A;  5LP6 B;  5HFM A;  2KG7 B;  1F51 A;  2KSD A;  3T1H B;  2W0X A;  3ABK C;  3T4Z A;  3WB2 A;  3G6B A;  1N32 B;  1SQG A;  4CH6 A;  5J2T A;  1NI8 A;  2OCC B;  1J5E O;  2LP7 A;  1L0N H;  2YIA A;  5CB4 A;  3STL C;  4FLV A;  4CS2 A;  1Q86 W;  4JTA B;  3ZN1 A;  5LYJ B;  2QTO A;  2VWK A;  4LF8 B;  4FLW A;  1SQP H;  4JV5 O;  4B7E A;  1QLN A;  4J10 A;  4J7K A;  4YY3 B;  1N34 B;  2F93 B;  3T1C A;  1SES A;  5E79 Z;  4HNA A;  5E1A C;  2KKW A;  4LF9 B;  4G27 B;  3MDS A;  3JAL B;  5H6Q A;  4B3T B;  1YIJ V;  2ZIO A;  1NVP B;  5JH7 A;  3E89 A;  3SJB C;  1KBH A;  5D5Q A;  3ZRV A;  3LDD A;  3GB7 C;  2QEX V;  4DW1 A;  4KUM A;  3N2K B;  2P90 A;  3A0R A;  4P2Z A;  1ZX3 A;  3BVO A;  2LO1 A;  1VEW A;  4X8A A;  3CRR A;  3RYI A;  1PM9 A;  4UFZ A;  2R72 A;  2B1I A;  4IHJ B;  4GKJ B;  2ZM6 B;  3AK1 A;  1AVM A;  2WLH A;  3O65 A;  4PEL A;  3E8G A;  1AR1 B;  1R1B A;  3OEH G;  4DV0 O;  3RFR A;  1JA8 A;  2XAJ A;  1FD9 A;  1NR1 A;  2GHY A;  2M7W A;  2WLN A;  3ETE A;  3OT7 A;  5B66 Z;  5H2F Z;  3EFF K;  3RWR D;  4EFE A;  1IX9 A;  2PZS A;  4IYI A;  5KA6 A;  2NN4 A;  1N8R W;  2EIL B;  1NTK H;  4RQF A;  1FS0 G;  2BSK B;  1IBK O;  4DV5 B;  3SYA A;  4LF5 O;  5L3B A;  2NLJ C;  1SRY A;  3CHX A;  4WF9 V;  3AEI A;  2W6I G;  3WFV A;  1L1F A;  3SPI A;  2UXC O;  1YVW A;  1BCC H;  2ZXW B;  3BFR A;  4U3J B;  1Q3E A;  1IXB A;  1CP9 A;  3CXH F;  4LF7 B;  5CA1 A;  4G2K A;  4CC5 A;  1SKV A;  2DYR C;  1B04 A;  1I5X A;  3SYC A;  1Y4M A;  5IYC O;  4JI2 O;  2QKS A;  2DYS C;  2EIK C;  1K9M W;  5FPR A;  3C90 A;  2CTQ A;  2A3Q A;  3E83 A;  3OW2 U;  2LFS A;  4LNU B;  4K0K O;  3FKS G;  3EHB B;  1ZTE A;  1ORQ C;  1VQ5 V;  3B4S A;  1LUW A;  1AI5 A;  2JJ2 G;  4EFB A;  3P3P A;  3JAR B;  3PN1 A;  3K79 A;  2QA4 V;  1HNZ O;  1XEQ A;  4B3R O;  2CTP A;  4ASU G;  1HNW B;  2CAZ C;  2RJZ A;  2EIM C;  2XUM A;  2WSS G;  4JYA B;  4FZ1 A;  1CXZ B;  3ZRW B;  2MK3 A;  1VQM V;  1GRJ A;  2F4V O;  2RDC A;  2QWQ B;  4LFB O;  5CA0 B;  3LSQ A;  3SR2 C;  5DM6 V;  4NVP A;  4PA3 A;  4JI0 B;  1H2S B;  4TV9 B;  4PD4 F;  2R9I A;  3AG2 C;  4LCU C;  3TCU A;  3K3W A;  1GN4 A;  5KUK A;  4RUE A;  1Y74 A;  4E2L A;  3JAT A;  2JEU A;  3K03 A;  1VF6 A;  3UO2 A;  1BSM A;  3AG4 C;  1FXK C;  1US6 A;  3WB0 A;  4CC6 A;  2E74 B;  4LF4 B;  3OE7 G;  1GH6 A;  5B1N A;  4D6T H;  3AG7 A;  1M1K W;  4PJ0 Z;  3F5W C;  1D5N A;  2EZO A;  5ITZ A;  2ZDI A;  1XNQ B;  1XHZ A;  4I9W A;  1YZB A;  3K0D A;  4BW5 A;  1HR0 B;  1HP8 A;  1EFR G;  4UCT A;  5B1A C;  4O4I B;  4B3M O;  1ZAU A;  2VWJ A;  4P9P A;  5LP6 A;  4NYK A;  5D5P A;  2KG7 A;  1Y6X A;  3DC6 A;  3I5D A;  1DTO A;  3LNN A;  1I08 A;  2WLJ A;  4LFC O;  4J42 A;  1E79 G;  5EZY A;  5JQG B;  3K58 A;  2W0F C;  5J2U B;  3QVN A;  4PDL A;  1LNQ A;  2AZ2 A;  4X1I B;  3G80 A;  4DW0 A;  4X66 B;  1XL6 A;  3H1L H;  3CC7 V;  2QKA A;  3CJH A;  5F2V O;  4JTC B;  2CH7 A;  1OCZ B;  1XHX A;  5LOV A;  4NKG B;  4TUY B;  4OPH A;  3CCV V;  3VQX A;  4AQY O;  3ABL B;  1YJW V;  1WNS A;  3J80 N;  1KEC A;  2WA3 A;  5B3S B;  3DXR A;  1KB9 F;  2GUZ B;  1U97 A;  5IYB O;  3E8B A;  2QWP B;  3IC7 A;  3APO A;  3SPG A;  3CRM A;  1JOY A;  5KHH A;  1XMQ B;  1H2M A;  3ASO B;  4PA7 A;  4IT5 A;  2LGW A;  4GX2 A;  3AG1 C;  2HEP A;  2HKO A;  2IH3 C;  5CMU A;  4CS3 A;  1BHB A;  4I55 B;  3WB1 A;  2WLL B;  4K8X A;  1P7B A;  4X20 B;  3H01 A;  2ZR2 A;  5L3G A;  3SYO A;  2YXY A;  3LDC A;  3J81 N;  4DV2 B;  3CRQ A;  1EZV H;  3F5T A;  3T1Y O;  2OIE A;  1FFX B;  4X62 B;  2IBZ H;  2B9Z A;  2LGQ A;  2YI8 A;  1P84 F;  1RSO B;  4EEQ A;  4J11 A;  1S5J A;  2QGN A;  3N2G A;  4NXN O;  2UXB O;  1RPO A;  1YDX A;  2OTL V;  1Q43 A;  4B08 A;  1NJI W;  2JRI A;  4JYC A;  3S3W A;  2MW2 B;  1OCC B;  4D7S A;  1J5E B;  3HKE A;  3RYC A;  3WG7 C;  3IFX A;  3BPZ A;  4ZOL B;  3FYI B;  5L3F A;  1NQT A;  4QPJ A;  3BRC A;  5AG2 A;  2BCC H;  4DR7 B;  3W7X A;  4J9Y B;  1GMG A;  4R50 A;  5B1B B;  4JV5 B;  4RO2 A;  1SQQ H;  4MT8 A;  1H2N A;  2BTQ B;  1K3E A;  2HJD A;  3E35 A;  1OCO C;  4GX0 A;  2YXH A;  3TET A;  1BMF G;  1XUQ A;  1TA8 A;  2XAH A;  4FM1 A;  1GM7 A;  4MTF A;  3BY6 A;  3CD6 V;  3CC4 V;  3E22 A;  5L3E A;  1H38 A;  2GSM B;  1PNL A;  3NR7 A;  1Y76 A;  4TWK A;  1BGY H;  4LNU A;  4OPA A;  4FLZ A;  4MVU A;  3L74 H;  4DUY O;  3QG5 A;  3JSL A;  3TGU H;  3JAR A;  1I7F A;  1AI7 A;  3D8C A;  5EC1 C;  1N36 B;  4TQF A;  2FL4 A;  4O2A B;  4OXS A;  5FNV B;  1B06 A;  1AR5 A;  3SGI A;  3CCL V;  5EBM C;  1YIT V;  1SQX H;  3FB5 C;  1V54 C;  2WWW A;  4L87 A;  4DV0 B;  4I4T B;  4O4H B;  3W7U A;  4EKW A;  2ODM A;  2X6C A;  2RCV A;  2YEV A;  5LP6 C;  1BS3 A;  2LJ2 A;  4AHC A;  1XBL A;  1R6T A;  1YHQ V;  1GN2 A;  4FFB A;  2UXD O;  3AG3 B;  4ZI7 B;  1UJW B;  4JPR A;  2OCC C;  1JVM A;  1IBK B;  2YS8 A;  2UUB O;  4W4L A;  1I94 O;  4KHP B;  1AI6 A;  2UXC B;  3G6E V;  1XRE A;  1QCE A;  2OYQ A;  3W7S A;  3E8H A;  2CGO A;  1B6Q A;  1K7D A;  3BHP A;  4QE7 A;  3ZX6 A;  1KU9 A;  3NXS A;  4ICG A;  4JI3 O;  5GW7 A;  5H5N A;  3CXC U;  2PI4 A;  2EIN B;  2X7R B;  2QDO A;  5BMV B;  4K0K B;  4MW3 A;  1W2B U;  5KX5 B;  4FK5 C;  1XL4 A;  2YIB D;  5CN0 A;  1WB8 A;  4TV8 A;  2V7Q G;  4O4I A;  4UCU A;  4ABM A;  1HNZ B;  1YSC A;  2QM8 A;  4B3R B;  4O2B B;  4HYO A;  2WLK A;  3GWO A;  1VQ9 V;  4DR4 O;  2IW5 A;  3JD2 A;  3JD3 A;  2G38 A;  4K3A A;  5KA5 A;  3CC2 V;  1QR9 A;  2DJV A;  3ABT A;  4JI1 B;  1RPR A;  1VQ8 V;  1EN5 A;  1JCH A;  2VRZ A;  2F4V B;  5J2U A;  4O4J A;  2JGD B;  2IU3 A;  4LFB B;  1KYO F;  1UFI A;  1ARO P;  4X1I A;  1TVK A;  1K97 A;  4TQD A;  2FML A;  4QJF B;  4XBF A;  1Z2G A;  4RWU A;  3A0H Z;  3SDL A;  5C8Y A;  1K92 A;  2QWR B;  3JAW A;  1EBO A;  2YI9 A;  4QNH B;  1JFF B;  1I0H A;  3ZMT A;  3CCJ V;  3CCM V;  2XAS A;  2JS3 A;  2E5L O;  3CB2 A;  3CCR V;  2XAQ A;  5K1X A;  4AIL C;  2R9A A;  4LWS B;  1L8D A;  2WLI B;  2HJF C;  1NH2 D;  4LF6 O;  4H0L B;  2GV9 A;  4FVM A;  2E76 B;  5LA6 A;  2LQT A;  4JI6 O;  2EBO A;  3STZ C;  1FPO A;  5LHG A;  2WLL A;  3SJA C;  4X20 A;  1F7Y A;  5KUM A;  1MZE A;  3D3I A;  4D7T A;  1UPG A;  2QM7 A;  4EB6 A;  1Q6I A;  5K1P A;  2P4V A;  3OMN B;  4B3M B;  1SA0 B;  4UVA A;  4NTW A;  4UCS A;  4QIW F;  1PP9 H;  1VIB A;  4G28 B;  2EZP A;  2H94 A;  2CUG A;  2K9P A;  3N27 A;  1FXK A;  3CPW U;  3UT5 B;  4DV3 O;  1VQ4 V;  4K35 A;  3IC9 A;  5KHI A;  1OCR B;  1OHH G;  4LFC B;  3UKM A;  4RUF A;  4W4K A;  4K8Z A;  1IBM O;  2Y69 B;  4ZOL A;  3VBB A;  1VF7 A;  1O9G A;  1NH2 B;  1M9N A;  4DR6 O;  4NXM O;  4IYH A;  1X4T A;  3JAS B;  2QWN B;  1HWY A;  2ZD9 A;  1N33 O;  4DV1 O;  4AQY B;  3H9V A;  4IL6 Z;  1KUQ A;  2GTA A;  4WBN B;  4P30 A;  4WFB V;  2XND G;  2UUA O;  3L70 H;  3HKB A;  4FPP A;  2ZIN A;  4ZIB A;  3L72 H;  5JVD A;  2A0L A;  4X1Y B;  3RYH A;  2WA4 A;  2KB1 A;  3FB8 C;  4DRX B;  4DUZ O;  2F95 B;  5EYP A;  4YJ2 A;  1K33 A;  1F4N A;  1YEW A;  1M90 W;  1SF9 A;  5JWP A;  3VQY A;  4MSW C;  1M56 B;  2PI5 A;  4C7U A;  3ZHU A;  4GLX A;  1FXV A;  1VQP V;  3ZMV A;  3ETG A;  3B40 A;  3GVM A;  5IY5 B;  3T1Y B;  3QNE A;  1DGS A;  2ZT9 B;  3CCS V;  1WA8 B;  2QWO B;  1SET A;  5LBQ A;  1SER A;  3OMA B;  2A79 B;  4NXN B;  3C3T A;  2UXB B;  1OV9 A;  4O4H A;  4I4T A;  4JI8 B;  3Q4H B;  1PV0 A;  4JAS A;  4L8J A;  1K34 A;  1V55 B;  4ZI7 A;  1ZSP A;  2Q5Z A;  2Y4T A;  4WFE A;  3R65 A;  2AXT Z;  1GM9 A;  1ZL8 B;  1SQV H;  4BIU A;  2IJH A;  2A06 H;  1OCZ C;  1OZ0 A;  2ZE5 A;  4GT1 A;  3ASN B;  3ABL C;  1FKA O;  3BAB A;  5LXT B;  4CH3 A;  5CBH A;  5B3S C;  4Z1M G;  2AHY A;  1M5I A;  1VQN V;  1PD3 A;  5LGN A;  2ZQM A;  4LFA O;  2EIJ B;  3OR7 C;  3ZHS A;  3H1I H;  3ASO C;  5BR8 O;  4GX1 A;  2IU0 A;  1P49 A;  4RAI A;  3RBZ A;  1IDS A;  4FFK A;  3FB7 C;  2OT5 A;  2M6Y A;  3IAY A;  4DV4 O;  2GTS A;  1RFY A;  1FJG O;  2CK3 G;  4FM0 A;  3K9A A;  1BQ0 A;  3ZHR A;  3K59 A;  1R3I C;  2XTA A;  3MAQ A;  3B2E E;  2P5O A;  2JGD A;  4H33 A;  4DR3 O;  2JIZ G;  1AP5 A;  4DV7 O;  4JZ2 A;  3DGE A;  2BTO A;  3HR0 A;  1VP7 A;  4UVB A;  1N0N A;  3BAA A;  2UXD B;  2YID A;  1JFF A;  3G4S V;  1OCC C;  4XDJ A;  5J9P C;  3H1H H;  2UUB B;  3U0Z A;  1VQO V;  3ZN0 A;  1D5A A;  2WAM A;  5IE9 A;  4YJ3 A;  1LUV A;  2CGN A;  4OX9 O;  1PL4 A;  2Y0P A;  5IYZ A;  5B1B C;  3ABM B;  4E4E A;  4JYB A;  3H1J H;  4I9Q A;  2QTS A;  3MHH C;  4DR5 O;  4JI3 B;  4DV6 O;  2Q4P A;  4J41 A;  2E3C A;  4DO2 A;  1YCI A;  2HP8 A;  4MVR A;  2DMX A;  5KAI Z;  2EJR A;  3OTO O;  2ZNI A;  2KQX A;  2YDE A;  2PF4 E;  4PDR A;  1SS3 A;  2ADP A;  5EK0 A;  3KG2 A;  3VQW A;  2Q0O C;  5LYJ A;  4LF8 O;  2HHH O;  4DR4 B;  4IGG A;  1F4M A;  3IJ4 A;  4YY3 O;  1L0L H;  1S5L Z;  1N34 O;  4XDL A;  5DEC A;  1GN6 A;  2R70 A;  3H1K H;  1Q8I A;  2AGA A;  4LF9 O;  4WCE V;  4J7J A;  5IYD O;  1M93 A;  3JAL A;  5GON B;  1EZJ A;  1JQ0 A;  2ATK C;  3K5O A;  2Q69 A;  4JI7 B;  3LUT B;  1DF4 A;  3N2K A;  5LGU A;  2O57 A;  5BZB A;  3B09 A;  4WBN A;  5LHI A;  4PDM A;  4WFH A;  3AG3 C;  5B5E Z;  2E5L B;  4ZHQ B;  4CZZ A;  1TUB B;  3P3N A;  2EIM B;  1DK1 A;  4IIJ B;  4H44 B;  5B1O A;  4X1K B;  1PKX A;  1QVF U;  4IHJ A;  2ZM6 O;  1H2K A;  1KMI Z;  2X0L A;  2GDS A;  2PUS A;  1YI2 V;  4FLX A;  4LF6 B;  3LSU A;  3JD4 A;  3ZS8 C;  4JI6 B;  3RYF B;  3K5L A;  2A9H A;  3K08 A;  3D36 C;  2EIN C;  1XOU A;  4Q20 A;  5JJJ B;  2BOC C;  5A2Q N;  3LSS A;  3KZI Z;  1H8H G;  4H13 B;  3GWK C;  4DV5 O;  2ZR3 A;  2DN9 A;  2JGU A;  1XI1 A;  2BSK A;  1AR4 A;  2P06 A;  2XAG A;  2ETN A;  4FZ0 A;  1NS1 A;  1G8M A;  4CH5 A;  3SJQ C;  2PYJ A;  4DV3 B;  3Q4H A;  2HLD G;  4HNA B;  4U3J A;  3BA8 A;  3SPJ A;  4I5S A;  2R9R B;  1AJQ A;  3ICX A;  3OUF A;  1IBM B;  2Q6A A;  3W7W A;  1DF5 A;  1E1Q G;  4DR6 B;  4NXM B;  5JH7 B;  4NTY A;  1ZL8 A;  1MOF A;  1WAZ A;  2JEX A;  2Q8V A;  4A5U B;  1N33 B;  1CPY A;  2Z0A A;  4JGS A;  2UUA B;  2B5U A;  3RYI B;  1QR8 A;  4FLU A;  3P32 A;  1B3Q A;  3HPL C;  3L75 H;  4MVM A;  2JK5 C;  3A0B Z;  2OTJ V;  1HDJ A;  3TXQ A;  4JI4 O;  2YUA A;  4ZKI A;  4GKK O;  1NZ6 A;  3ZRW A;  2RN9 A;  4KFM A;  1E1R G;  1MSW D;  2LFR A;  2EJ7 A;  1GAX A;  5CA0 A;  4FIP C;  2FYU H;  5EIB C;  1WPX A;  1IXM A;  4JI0 O;  2QJ1 A;  1WN7 A;  3OMI B;  4TV9 A;  4N21 A;  4LF5 B;  5JJE B;  1WB7 A;  4I7Z B;  4TOI A;  2V4D A;  1WLE A;  2UU9 O;  5JCO C;  4OGQ B;  3CRA A;  2NNU A;  1Q6H A;  3JYC A;  1OCR C;  4B7K A;  2Z5U A;  4JI2 B;  4UUJ C;  1K8A W;  2VS0 A;  4P9O A;  2Y69 C;  4J9Z B;  1IVS A;  4DK0 A;  2N05 A;  3CX5 F;  2OIG A;  4XDK A;  2DQ3 A;  3CE2 A;  1KKD A;  3JAK B;  3PJS K;  1G6U A;  1AIL A;  1OJH A;  3CEI A;  5IT9 N;  1QLE B;  3OEE G;  1NBM G;  4YXW G;  5IWA O;  4MTX A;  1S5H C;  5FPO A;  1JR9 A;  3HKC B;  1P4R A;  5FL7 G;  2PGG A;  2Z3Y A;  4YHH O;  3K0G A;  4LC1 A;  2Y48 A;  1VQ7 V;  1FAF A;  4DYL A;  5JJN B;  1YJN V;  3FYE B;  1Z5W A;  2CTW A;  2IJI A;  2VQF O;  1LR1 A;  3OM3 B;  3L9D A;  5JQG A;  1JJO A;  5BR8 B;  3JD0 A;  4KP4 A;  5CBF A;  5IJ0 B;  4R6Z A;  1DLB A;  3F7V C;  1SZX A;  1RM1 B;  2Q68 A;  1HNX O;  2BOB C;  5BY1 A;  4DV4 B;  4TUY A;  4WFA V;  2W6J G;  1XNR O;  5EC2 C;  3HB3 B;  1NKD A;  5IY5 C;  2BE3 A;  2EIL C;  2GUZ A;  3AK2 A;  4DR3 B;  4KXR A;  4DV7 B;  2HFE C;  3F7Y C;  1SZT A;  3I56 V;  3KCX A;  1S3J A;  1A32 A;  2ZXW C;  2DQ0 A;  3K5N A;  2N04 A;  3LNM B;  1R73 A;  4GCZ A;  3QTC A;  2EUL A;  1V55 C;  3CME V;  4QGP A;  4OX9 B;  4I55 A;  1YJ9 V;  2Q7G A;  5LGT A;  3I55 V;  4JAA A;  2ZNJ A;  4UCV A;  3C3S A;  1NU1 H;  4X64 O;  4DR5 B;  1FFX A;  1J95 A;  4DV6 B;  2ADQ B;  1K5S A;  3ASN C;  1NVP D;  1Q5O A;  1RSO A;  2PY5 A;  3RYF A;  3TXS A;  3OTO B;  3EXA A;  3ETQ A;  5C93 A;  1X59 A;  4HAM A;  5EZY B;  4JTD B;  2EIJ C;  2DW4 A;  1H2L A;  5H9C A;  3U10 A;  3S3X A;  3FB6 C;  4PI2 A;  1R3J C;  3OR6 C;  3CJH B;  1VMG A;  3D3Q A;  4R7C A;  1KQS U;  1QU7 A;  3ZED A;  2CH7 B;  4DR7 O;  1WP8 A;  4U3F H;  2HHH B;  5LOV B;  2L6L A;  1XIL A;  1KKC A;  2UXX A;  1Y67 A;  3FFQ A;  3G67 A;  2IH1 C;  2BTQ A;  1GK9 A;  3FD9 A;  3DXR B;  2ZE6 A;  4LBE C;  2HVJ C;  2Q7E A;  3T4D A;  1JPX A;  5KMG B;  4PA6 A;  4PA9 A;  1EN4 A;  3QO8 A;  1MNG A;  1WP7 A;  2ARH A;  3B77 A;  3U11 A;  1BQZ A;  3L71 H;  3RVZ A;  3X2Q B;  3ZIA G;  3J7A U;  1M57 B;  4MVO A;  2AZ0 A;  4O4L B;  3HKD B;  1PNK A;  3OD4 A;  1ENV A;  4B3S O;  5H6R A;  3CS5 A;  3KKY A;  4MTG A;  2N74 A;  2IJJ A;  1N36 O;  1S0V A;  3K04 A;  4I50 B;  3ZHQ A;  4GZR B;  4O2A A;  5FNV A;  1EM1 A;  3ABM C;  3CWB H;  3UCS C;  3TJT A;  3CRC A;  4UVC A;  3N2G B;  4HBN A;  3M99 B;  2NR5 A;  3HKE B;  1IBL O;  3RYC B;  2RMK B;  4PV1 B;  2Y4U A;  3B8N A;  4UV9 A;  4DXW A;  4Z2W A;  4BIZ A;  2X6A A;  3JSN A;  1S76 D;  4KHP O;  3CP1 A;  5KAF Z;  2Y0I A;  3ZMZ A;  3FAV B;  5LMU O;  1RP3 B;  4LH6 A;  5CBG A;  1KD1 W;  4DR1 O;  2F1M A;  4X9Q A;  1GO3 F;  3ZHT A;  2UXN A;  3KCY A;  4FM2 A;  5KLV H;  4I0X B;  2DWE C;  3E22 B;  4J7Z A;  3THO A;  3ABK B;  3D36 A;  3B8M A;  2ZE8 A;  5TIS Z;  1Y76 B;  2QE7 G;  4X65 O;  5BMV A;  1THZ A;  1R6N A;  4DR2 O;  3JAK A;  3A2F A;  1PPJ H;  2UUC O;  1Z5V A;  1VQK V;  1MG1 A;  3CMA V;  2VQE O;  4DUY B;  3O9O A;  1URF A;  5KX5 A;  4FLT A;  4LP8 A;  5LMN O;  4YIP A;  2Q0A A;  3HKC A;  2H3O A;  2Q9L A;  1MA1 A;  3QF7 A;  4O2B A;  4ZBM A;  1QVG U;  1YTF D;  4FMT A;  4JI4 B;  2QKC A;  4JI1 O;  2DE0 X;  3TK1 A;  4GKK B;  1BZK A;  1S77 D;  2P67 A;  5IJ0 A;  5IJ9 B;  2D3O W;  2YEV B;  3M7M X;  1BE3 H;  3UM7 A;  2CDY A;  4FFB B;  4GYC B;  2JJ1 G;  3RVY A;  4BW9 A;  1XMO O;  1VF5 B;  1FXH A;  1GN3 A;  1I94 B;  2YIB A;  5KHJ A;  2XAF A;  2FKX A;  2ILM A;  4PA4 A;  3UO3 A;  3OTF A;  3UQ8 A;  2UU9 B;  4LWS A;  1MMM A;  1GTO A;  3SPC A;  2WLI A;  1YTF B;  2ZCE A;  5DN6 G;  1VQ6 V;  3BCC H;  1P7G A;  1IUR A;  5IDJ A;  4JI5 O;  5A9G A;  1NR7 A;  3T1H O;  4GX5 A;  2JS5 A;  1N32 O;  1AP6 A;  2Q7H A;  4MS2 A;  5IWA B;  2WLM A;  4TV8 B;  4UXN A;  4UB8 Z;  1YXB A;  1K5Q A;  1KP3 A;  4YHH B;  4F6E A;  4LH7 A;  1SA0 A;  2Q73 A;  5KHK A;  3K57 A;  1QNM A;  2DYR B;  4CH4 A;  1S72 V;  4NB5 A;  5JCO A;  3UT5 A;  3OUS A;  4TT3 G;  2VQF B;  3CSX A;  2CE4 A;  4FJC C;  4O4J B;  2DYS B;  2EIK B;  1TVK B;  3JD1 A;  1COW G;  2DOS A;  2L35 A;  4B3T O;  1ZLZ A;  5C8Y B;  1R3K C;  3OAA G;  3JAW B;  1ROP A;  1HNX B;  4JZG A;  3JAS A;  4F6R B;  1AB3 A;  4PI0 A;  4R8C A;  2OCH A;  3WU2 Z;  1XNR B;  4DK1 A;  3W7T A;  1XDC A;  2P22 C;  2ZE7 A;  3ABU A;  5KHG A;  2PTM A;  5KMG A;  4X1Y A;  3ZRX A;  4MVZ A;  2HR3 A;  4Q6G A;  4DRX A;  4GKJ O;  4X89 A;  1N4C A;  2XT9 A;  4RQE A;  4UCO A;  2LW1 A;  4QPK A;  1M4U A;  3OFN G;  1TGO A;  3ZRS A;  5LA6 B;  4O4L A;  3HKD A;  1T5E A;  3RN4 A;  3E86 A;  1N0J A;  5DED A;  5J2T B;  1O9H A;  1JX9 A;  4KL1 A;  4YIO A;  3AG2 B;  1QQC A;  4EB6 B;  5CB4 B;  4I50 A;  1KC8 W;  4X88 A;  3QO5 A;  3AK3 A;  4X64 B;  1TUE B;  1QLE C;  3RW0 A;  1W59 A;  3K9S A;  2X6B A;  3QO7 A;  1H8E G;  1WA8 A;  1NTM H;  3OGC C;  3AG4 B;  1FXK B;  4Z1V A;  3OGI B;  5FLX N;  4JI8 O;  4JF3 A;  2FTK A;  2QSA A;  2B1G A;  1Y66 A;  4LF7 O;  2V1D A;  2OWO A;  1AJP A;  2ZIM A;  4MTO A;  1R3L C;  4MW8 A;  1FFT B;  1NT2 B;  3ETD A;  3R66 A;  5CA3 A;  2P7T C;  4QE9 A;  2YIC A;  2QR4 A;  1HW7 A;  1K4D C;  1Q6U A;  2F66 C;  4DV1 B;  1TAE A;  3FAV A;  1RM1 C;  4PHZ A;  3DC5 A;  5B1A B;  3BEH A;  1V9P A;  3E8F A;  3SYP A;  3CCQ V;  4N23 A;  3ML0 A;  2Q67 A;  1W0K G;  3LDE A;  1XQ8 A;  5LHH A;  3HKB B;  4TSF G;  1WJZ A;  3ZMU A;  4BAY A;  5LXT A;  5JVD B;  2D2C B;  2IM9 A;  2EX3 A;  3RYH B;  4I0X A;  5EYP B;  3IGA C;  4YJ2 B;  3ZMS A;  2IJK A;  4PDV A;  4DUZ B;  1W0J G;  1HNW O;  3DTU B;  1KP2 A;  3ZJZ A;  1QHT A;  1VF6 C;  2DWD C;  4JYA O;  3M8A A;  1CEZ A;  2AW9 A;  2PYL A;  3G71 V;  1F23 A;  5GTH Z;  1BL8 A;  4B3S B;  5LL6 Y;  2ITC C;  4AI8 A;  2HG5 C;  2ZDI C;  1IZ3 A;  3DSQ A;  4MVS A;  1Q82 W;  3P30 A;  1K4C C;  2RQ6 A;  1PL0 A;  4U7O A;  3CCU V;  1QBZ A;  3L73 H;  2YSU B;  4H37 A;  4UV8 A;  1D2D A;  5IJ9 A;  2JDI G;  5CA1 B;  1JMK C;  3AG1 B;  1IBL B;  4J80 A;  4JYY A;  3RGB A;  3MHS C;  1GKF A;  4LF4 O;  3ZBH A;  1ZUQ A;  4HZ3 A;  3SPH A;  3JCU Z;  4FLY A; 
#chains in the Genus database with same CATH homology
 1FYJ A;  4LF7 O;  1IBK O;  4LF5 O;  1XNQ O;  3RT3 C;  3J81 N;  2VQF O;  4DV4 O;  3JAM N;  2E5L O;  4X65 O;  1FJG O;  3F5T A;  3T1Y O;  1HR0 O;  2UXC O;  4DR2 O;  1R6T A;  3R66 A;  5BXZ A;  1J5E O;  2UXD O;  2UUC O;  2VQE O;  1HNX O;  4DR3 O;  4JI4 O;  4NXN O;  5LMN O;  5BY1 A;  4DV7 O;  2UUB O;  1YZB A;  4GKK O;  2UXB O;  4LF6 O;  1I94 O;  1XNR O;  1DK1 A;  2JRI A;  4JI2 O;  2DOS A;  4JI6 O;  4JV5 O;  4B3T O;  3J7A U;  2ZM6 O;  4B3M O;  2LW7 A;  4JI1 O;  1AB3 A;  4X66 O;  1F7Y A;  4K0K O;  4B3S O;  1G1X B;  4JI0 O;  1HNW O;  4JI3 O;  4OX9 O;  5H5N A;  1A32 A;  4LFC O;  4JYA O;  3M8A A;  2N74 A;  1N36 O;  1HNZ O;  1XEQ A;  4B3R O;  4DR5 O;  4DV6 O;  5A2Q N;  5LL6 Y;  4GKJ O;  4DV3 O;  2ZKO A;  2UU9 O;  4DV5 O;  4OPH A;  1XMO O;  4AQY O;  3OTO O;  1NS1 A;  1IBM O;  2F4V O;  4JI7 O;  3J80 N;  4LFB O;  2FKX A;  1XMQ O;  4X64 O;  1FKA O;  4DR4 O;  1IBL O;  4DR6 O;  4NXM O;  4OPA A;  4DUY O;  2DJV A;  1N33 O;  4DV1 O;  3O65 A;  1D2D A;  4LFA O;  1AIL A;  1X59 A;  1KUQ A;  5IT9 N;  1R1B A;  4KHP O;  5IWA O;  4LF8 O;  2HHH O;  4DV0 O;  4JI5 O;  2UUA O;  5LMU O;  4DV2 O;  4LF4 O;  4YY3 O;  3SDL A;  3T1H O;  1N34 O;  4YHH O;  5BR8 O;  4A5U B;  4DR1 O;  1N32 O;  4X62 O;  5FLX N;  4DUZ O;  4JI8 O;  2Z0A A;  2AGA A;  4LF9 O;  4DR7 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...