4JI1O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4ji1O00
2UXCO 1AB3A 4YY3O 1HNXO 4K0KO 2UXBO 1HR0O 4AQYO 1YZBA 4NXMO 4X66O 4B3MO 2F4VO 3JAMN 4LFAO 3M8AA 2AGAA 3RT3C 5LL6Y 4DV6O 4LF8O 1XNRO 3O65A 4JI6O 4JI1O 4DR6O 1AILA 2FKXA 4DUZO 4JI4O 1R6TA 5IWAO 3R66A 4X64O 3J80N 2VQEO 1XMOO 4DR4O 4DR3O 1DK1A 2HHHO 4JV5O 4B3TO 2ZKOA 5BXZA 2DOSA 5LMUO 1N36O 5IT9N 2UUBO 1J5EO 1X59A 5H5NA 1HNZO 4DR5O 1A32A 4DV0O 1XMQO 4JI8O 1IBMO 1FYJA 4JI5O 4LFCO 4GKKO 4DV2O 3J7AU 4DV7O 2DJVA 2E5LO 4KHPO 4DUYO 4X65O 2UUCO 1N34O 1N32O 3F5TA 1XEQA 1G1XB 4DR2O 1FKAO 4NXNO 4B3RO 4DR7O 4LF9O 2UUAO 1KUQA 2Z0AA 2LW7A 4JI2O 4GKJO 4LF4O 1FJGO 4OX9O 1XNQO 1F7YA 3T1HO 1D2DA 4YHHO 4OPHA 3SDLA 2VQFO 1N33O 4DR1O 2ZM6O 2UU9O 1NS1A 2JRIA 4JI3O 4A5UB 5BY1A 3J81N 5BR8O 1I94O 4X62O 2UXDO 5LMNO 1IBLO 5A2QN 4LF7O 4OPAA 4DV4O 4B3SO 4LF5O 3OTOO 5FLXN 3T1YO 4LF6O 4DV5O 4JI7O 1IBKO 4JYAO 4LFBO 1HNWO 4JI0O 2N74A 4DV1O 4DV3O 1R1BA
chains in the Genus database with same CATH superfamily
4DW0A 3S3WA 2ARHA 2P67A 2Q8VA 5FNVB 2Y0PA 3ZHTA 4NXMO 2VWKA 3M8AA 1NR7A 4QIWF 4ZHQA 2HP8A 5JCOA 1XNRO 3RW0A 2EZOA 2HVJC 3MDSA 1OCCB 4UVBA 2CAZC 2AW9A 1CPYA 1N0JA 4DR3O 3AK3A 3QO5A 1N36O 2X0LA 5E1AC 5B3SB 2BOBC 5AG2A 1Q3EA 3JATA 4IIJB 4R8CA 1QQCA 2EIJC 4GKKO 5EYPB 3UO3A 3OMNB 3M99B 4FZ1A 4Z1VA 5L3EA 2LP7A 3TJTA 2WLHA 1MABG 4HNAA 4JYAB 3F5TA 2WLIB 1BQ0A 3CCQV 3ZBHA 5IYBO 3CSXA 1S77D 2X7RB 3OW2U 2YC0A 4NXMB 2ZNJA 3U0ZA 1Q6HA 3D3IA 3LNNA 1VQPV 5IY5C 3C3SA 1ZUQA 3D36C 2P6JA 1XNRB 3EFFK 2P7TC 4HAMA 3SYCA 2IM9A 4QPJA 2QR4A 3ZHVA 4QE9A 3OEEG 4P2ZA 4AHCA 4B7EA 4PI2A 3ASOB 3WU2Z 3RYIA 4Z1MG 3N2KB 3QO8A 4FM0A 4YXWG 4JI7O 2PI5A 4DR3B 1SA0B 2OT5A 1N36B 5LGTA 4R7CA 3ZHQA 3T1CA 4DXWA 1RFYA 3HKDA 2W6IG 4WFBV 4BIOA 3E8BA 1EZJA 4FLTA 4GKKB 4X66O 2Y69B 2WA3A 1ZWIC 1E1RG 4H44B 1VF7A 2GBOA 1KKCA 2Q69A 4YJ3A 2EINC 3CB2A 4CS4A 2DWDC 3G4SV 3JD3A 3K9SA 1XL4A 4KP4A 2OCCC 4DO2A 2RQ6A 1ENVA 4X1YA 3JAWA 5BMVA 1B04A 3J80N 3K0GA 1WA8A 2EULA 4DYLA 2MK3A 4G2KA 2YS8A 1KC8W 1SZTA 5C93A 4FVMA 1H8EG 5GONB 4UCVA 1GRJA 1FFTB 5EZYB 1GN2A 1QNMA 1P49A 1NVPB 1JJOA 4X8AA 1IBMO 2Y4TA 1K97A 1Y4MA 1MOFA 1S5LZ 1SC5B 2B1GA 4TV9B 4MTXA 5KHKA 4O4LB 3VQXA 3ABMB 4JI7B 3FFQA 4GUNA 3RYHB 3ETGA 4QPKA 2WLNA 2H94A 5KHHA 1OZ0A 2Z0AA 3OFNG 5HFLA 1QLNA 4X20B 5D5QA 3GWOA 4MVSA 4X66B 3A8TA 1SRYA 1WB8A 3B2EE 1PNMA 2UU9O 1BL8A 2OIEA 4WCEV 1ZL8A 2CTWA 4I50A 2ZE6A 3IGAC 4MTFA 4Z2WA 4NVPA 3HKEB 4DV4O 4DV3O 3U10A 2YIAA 2UXCO 1U97A 5JJNB 1NH2D 4U3JB 1IBMB 1FXVA 1YJWV 2F95B 1XDCA 5K1PA 3K59A 2E74B 1AP6A 3D3QA 5LGNA 2NN4A 5CB4B 3RT3C 1M57B 1QLEB 1K33A 4X88A 1F51A 4J9ZB 1K5SA 5KA6A 1Q6IA 2HR3A 4WFGA 1YVWA 1R6TA 2XUMA 1IX9A 3JD4A 3BCCH 4P30A 5LA6A 2HHHO 4JAAA 2IW5A 5LYJA 2LGQA 2QTSA 2EIMB 5IE9A 2UU9B 4F6RA 5GW7A 3Q4HA 1OCCC 1K3EA 5LXTA 1JOYA 1H8HG 3H1LH 5EBWC 4DV4B 2QM7A 5B1NA 2QKAA 4DV3B 2IU0A 3ZMTA 2UXCB 2EILB 2IJJA 1AR4A 1FJGO 1FAFA 3RN4A 1QU7A 5IJ9A 1MNGA 4E4EA 1MZFA 4U3FH 2ILMA 3LNMB 3LSUA 2R9IA 1TA8A 2JVDA 3ETEA 4I0XA 5J2TA 5BR8O 3HR0A 2ITCC 1PD3A 2AZ0A 5J9PC 4MVRA 4K8XA 1IBLO 1ZTEA 4D6TH 1JPXA 4O2BA 4JPRA 3KCXA 3CC4V 1EM1A 4IT5A 1NT2B 3T1YO 1XHZA 2HHHB 5KLVH 3FB8C 2ZDIA 4AI8A 3IC9A 2WPDG 4FLYA 1YI2V 5KA5A 3ASOC 3N2GA 4U7OA 1XREA 2YUAA 3G67A 3ZHSA 1E1QG 2BTQB 3STZC 1H2SB 4WBNA 2F43G 2YXLA 1V9PA 1K4CC 4W4LA 1HDJA 1L8DA 3BA8A 3JCZA 5IWAO 4TSFG 1FJGB 1F4NA 1I5XA 4BR6A 4C7UA 3DXRB 1D5AA 4K35A 3UCSC 5F2VO 1KBHA 1J5EO 4CBCA 5KUKA 1XMQO 4ZBMA 3SPIA 5B1OA 5BR8B 2F1MA 2GTSA 3BEHA 3FX7A 3GB7C 1Y6XA 1IBLB 2N05A 1BZKA 2P06A 4I9QA 1EN4A 4UUJC 2XASA 4KHPO 2L35A 2WLMA 1AR1B 3T1YB 5KHIA 1N4CA 2ZE5A 1DTOA 1PV0A 2JEXA 1K5QA 4KXRA 2RCVA 5JVDA 1WJZA 1B3QA 3K03A 1XNQO 1VP7A 3HKBB 4HYOA 1F7YA 3ABMC 1GMGA 2PZSA 4WFHA 2QSAA 1SZXA 2QWOB 3ZMVA 3OM3B 2NNUA 2VWJA 1GKFA 4CZZA 5IWAB 2ATKC 4B3SO 1R3LC 2ZINA 5LGUA 1RM1B 1HNWO 2F66C 5CA0A 2FYUH 1Q90D 4CH5A 4BW9A 2LFRA 1J5EB 4X1YB 3CYOA 5GTIZ 1XMQB 5BMVB 4PDLA 2O57A 1YF2A 5LHIA 5J2UA 1KB9F 3E8FA 1PL0A 4KHPB 3VBBA 4JYYA 2DQ0A 1TUBA 1CEZA 1S5JA 4DR6O 1SERA 2EINB 4IGGA 4NYKA 2LW1A 1XNQB 3H1HH 1M57C 3UKMA 1QLEC 4JV5O 3AG1C 3ZIAG 4PA9A 5LMUO 4LC1A 2JIZG 4LBEC 4RUFA 4DV0O 1UJWB 4LWSA 1GM9A 5JJEB 3JALB 5EK0A 2UXXA 4JI5O 1E79G 2DQ3A 1PL4A 1FXHA 3T4DA 2CH7A 4B3SB 1N34O 2YIDA 1HNWB 4NXNO 3FAVB 2ZCEA 1B6QA 4JAVA 2OIGA 2WLLA 1OCOB 4GKJO 2Q9LA 4O2AA 1SQBH 1W0JG 3STLC 4EFEA 2E76B 3OR7C 4OPHA 4XDJA 3OAAG 4DRXA 4JI3O 1UFIA 1NJIW 4DR6B 1Q5OA 2C2AA 5CBHA 3AK2A 4CS3A 4LF7O 4IHJA 1JQ0A 1KU9A 1PP9H 2JS3A 4LFBO 4JV5B 3H1KH 4O4HB 5LMUB 1R3KC 3F7YC 2CTQA 3T2MA 1YJNV 2AHYA 4DV0B 5B1AC 2IBZH 1QCEA 4XDLA 1HNXO 4GT1A 4JI5B 3BVOA 3OR6C 4H13B 5JCOC 4JASA 3B09A 3JASB 1N34B 3Q4HB 4YJ2A 4NXNB 4NB5A 5IYZA 5LXTB 4J7KA 3SYAA 1Y76B 4OXSA 4GKJB 1BE3H 3MAQA 2QWRB 2YEVB 3CX5F 2WSSG 1SESA 3SR2C 3AG2B 2DN9A 4QNHB 3JCUZ 4QGPA 5BXZA 3QTCA 3CRCA 4FLVA 2QKSA 4JI3B 1Q86W 1K73W 2M7WA 3E22A 5CN0A 3W7WA 1V54C 2Z5UA 5IJ9B 4LF7B 2HJFC 1F4MA 2YSUB 3L75H 3CS5A 3B40A 2K1EA 4DK0A 4LFBB 1WPBA 1US6A 1XEQA 2XAGA 1IXBA 2ODMA 4K3AA 3ZRVA 2EZPA 3KG2A 3L9DA 4UFZA 3UT5B 1HNXB 5ITZB 1S5HC 4FJCC 2ZR2A 3ML0A 3BAAA 4YHHO 1YDXA 3K5OA 2W6JG 4MT8A 4WFEA 1NVPD 4PDMA 2XHBA 3A0RA 5LOVA 2ZM6O 1BHBA 1BCCH 3LDEA 4BWAA 4BW5A 1I94O 5IYDO 4FIPC 2ITDC 3K3WA 5EIBD 1XHXA 3KZIZ 1GM7A 3CMEV 3SJAC 3T4ZA 3W7TA 1M56C 4I4TA 1CP9A 4L87A 2ZE7A 4YY3O 4FPPA 2GUZA 4MS2A 5JH7A 3M7MX 1VF6A 2IH1C 4MVQA 5KMGB 4I9WA 3C90A 1RM1C 2F4VO 1Q81W 2AGAA 4B08A 3CPWU 4H0LB 1GK9A 4D7TA 3CCUV 1OHHG 1Y67A 2ZQMA 4BAYA 2ZXWC 2ZD9A 1OJHA 1F23A 1VF5B 1NBMG 3CJHB 4DK1A 4YHHB 1VMGA 1H2KA 3WB2A 2ZKOA 3E8GA 5IT9N 4ZI7B 2UUBO 5L3CA 2JJ1G 1KP2A 2ZM6B 3FB6C 1I94B 4CH3A 3ABLC 3QG5A 3ETDA 2HJDA 2Z3YA 2E5LO 3WG7C 3QF7A 1AI7A 3NR7A 1H2GA 4LP8A 4TV8A 3MD0A 3L71H 1SQQH 3AG4B 1VQ9V 2EX3A 2PI4A 3UQ8A 4YY3B 1ZSPA 5CBGA 1NZ6A 1IURA 1P7BA 3OD4A 2BSKB 2F4VB 5CA0B 1FPOA 3ZX6A 4FK5C 3AG3C 3W7XA 1WB7A 3HPLC 5BY1A 4ZOLA 1OCOC 4PA6A 2E3CA 5J2UB 2EJRA 1KYOF 3OGCC 2YI9A 4O4IA 4K8ZA 1TVKA 1VQOV 3RYCA 3THOA 2H8PC 2IJHA 4RO2A 4DV1O 1JJ2U 2LO1A 3ZHUA 1R1BA 4GX2A 2UUBB 1W0KG 3B77A 4TUYB 2CGOA 4PA7A 3JSLA 2Q7GA 4I55A 4IL6Z 4PA3A 5KHGA 2IU3A 2E5LB 2Q67A 3JAMN 1COWG 3ZMZA 1W2BU 4LFAO 2A3QA 2HG5C 1O9HA 1H38A 2MW2B 5C8YB 5LHGA 5CA1B 4JAUA 4MTGA 4JI6O 3CWBH 1AVMA 4UVCA 4JF3A 2PYJA 4X89A 3CEIA 2DOSA 1GN3A 4HZ3A 1CXZB 3ZHRA 1YTFD 3E35A 4X9QA 5DN6G 2YICA 4O2AB 3HKCA 2CGNA 3AG1B 1JFFA 3AG2C 3TXQA 4ASUG 1S72V 1NR1A 4X65O 2UUCO 3E89A 4H37A 4DV1B 4G28B 3SPHA 4DR7O 4CH6A 1Q7YW 3ZMUA 2LGWA 4JGSA 1L0NH 1KUQA 2KG7A 2LW7A 1G8MA 5FL7G 4LNUB 3RGBA 1TAEA 2ZNIA 2B9ZA 3SDLA 1Y74B 4LFAB 4DW1A 3JAKA 5EC1C 2RMKB 1M9NA 4JI6B 4EB6A 2GV9A 1IZ3A 2W0XA 1GO3F 1XOUA 2ZDIC 1K4DC 4X1KB 3CCLV 4YJ2B 3VQVA 4JI0O 5B1BC 4PDVA 1WAZA 3P3PA 2G38A 4ABMA 3G6EV 1SQXH 3CC7V 4I5SA 4I7ZB 2DYRC 3O9OA 3ZRSA 4J9YB 1HR0O 3WFVA 3KKYA 4YIOA 3W7SA 1YZBA 3LUTB 3OTFA 3OE7G 3FB5C 1MA1A 5B1AB 4X65B 2UUCB 2F93B 1WP8A 2CE4A 3GWKC 4XBFA 4FLZA 2H3OA 1FXKA 4ZHQB 3AG7A 3DGEA 3BA9A 4DR7B 1Z2GA 1J95A 4FLXA 4TQDA 3LSQA 3WB0A 4NTWA 2P22C 4EKWA 4X64O 1VQ5V 1XILA 5GTHZ 1NQTA 1LUWA 1YTFB 1LR1A 1PKXA 1XUQA 1FD9A 3ZCCA 4TWKA 1URFA 3JATB 4MVOA 4WF9V 4LFCO 5EYPA 2XAHA 3P30A 3CRQA 1V54B 2B5UA 5LP6A 4HNAB 4JI0B 1AI4A 4IYHA 2IJKA 5CBFA 2CDYA 1KD1W 5IDJA 1HR0B 4O4JA 1GAXA 2QWQB 3AG4C 3ZRWA 4OGQB 1FS0G 2JRIA 5JH7B 4EEQA 1JCHA 4X62O 4CH4A 3C3TA 3PJSK 3OGIB 1PNKA 3N2KA 2BOCC 3RYIB 1MMMA 4X64B 2GSMB 5KAFZ 2DWEC 2X6CA 4MTOA 1BGYH 3SJCC 2JS5A 2XOKG 2DYSC 1QHTA 3HKDB 1YEWA 2V7QG 4LFCB 1M56B 3A0HZ 1JX9A 2BTOA 3CD6V 5FPRA 2YIBD 3K5LA 5FPOA 2Q7HA 4CS2A 4YJ3B 3H1JH 3SYOA 2UXNA 2XAQA 4DV6O 1BT8A 4LF8O 3I55V 1BSMA 3K58A 2VS0A 1ORQC 2AZ2A 4PV1B 2OWOA 2FKXA 3LDDA 1VARA 4UCTA 3JAWB 2QEXV 4TV8B 1MSWD 2ZXWB 2KB1A 1WA8B 2GDSA 1DGSA 5GONA 2PY5A 1GM8A 4KL1A 1I0HA 1Q8IA 3ZJZA 5H9CA 1KMIZ 4X62B 1R3JC 1Q6UA 4UCOA 3E83A 3B8NA 5KX5A 2WAMA 4HBNA 1NKDA 1LNQA 1RPOA 4ZOLB 4J7ZA 1SQGA 3ABLB 3TXSA 3RYHA 3QVNA 4F6EA 1Q82W 1SS3A 3S3XA 1ZLZA 4O4IB 3WG7B 3EVKA 2JEUA 1AJPA 4X20A 3RYCB 1S76D 4PD4F 1YHQV 1SQVH 4DV6B 4LF8B 3CE2A 4MW3A 4I55B 1ZL8B 4J80A 4I50B 3E2EA 5LMNO 4UV9A 3CCJV 3AG3B 2F23A 4JYBA 4BIZA 2YI8A 3SPCA 2Y48A 1Z5WA 2N74A 1KKDA 5KHJA 1ZX3A 2XAFA 2A79B 4U3JA 2EIKC 3OT7A 3DC5A 1R3IC 2OYQA 1V55C 3BY6A 1H2LA 2BE3A 2E75B 5CB4A 1HP8A 4MVZA 4XDKA 4FLWA 3K0DA 1XL6A 2QTOA 1Y66A 1AILA 4QJFB 3JARA 4NTXA 4J11A 4X1IA 2R9AA 3CCEV 2JDIG 2RNBA 3UO2A 3ZEDA 1XMOO 3VQWA 5IJ0A 1VQ4V 2RJZA 4B3TO 5LA6B 5LYJB 2L6LA 2KG7B 2QM4A 4F6RB 2Q0AA 3I5DA 4RQFA 4AILC 1GN4A 1O9GA 3K5MA 5LMNB 4PJ0Z 2HEPA 4DV7O 1DLBA 2LFSA 3ASNC 3JAKB 3APOA 4KFMA 1L0LH 4DR2O 4FLUA 4KUMA 4LF9O 5CMUA 2UUAO 3OMIB 1YIJV 1K8AW 3ICXA 2LJ2A 1I08A 4U7NA 2Q4PA 2IJIA 3T1HO 3B4SA 3JD0A 2VQFO 2JGUA 1N33O 1XBLA 4JTDB 4I0XB 5J2TB 1YJ9V 3APQA 3LSSA 1VQ7V 3IC7A 4TQFA 2ZR3A 4O2BB 1FXKB 1XMOB 4LF6O 4B3TB 3ZN1A 1T5EA 1VF6C 3SPJA 3F5WC 1HWYA 2XNDG 3K06A 1VQKV 1NI8A 5EBLC 3N2GB 4K0KO 5JQGA 5B1BB 3JD2A 4B3MO 4DV7B 1HW7A 1BS3A 2DYRB 2BTQA 4LCUC 1DF4A 4DR2B 3CXCU 4WBNB 1I5YA 2GHYA 4LF9B 1TUEB 2UUAB 4R6ZA 1YITV 2Q7EA 2V1DA 3IJ4A 3R66A 1UPGA 1JVMA 2Q6AA 1WPXA 3ZRXA 1N8RW 3DXRA 3SYPA 5LP6B 3T1HB 4UVAA 4GX5A 1MG1A 1DK1A 3EHBB 2VQFB 5LHHA 1IVSA 1N33B 5LBQA 1ZAUA 3H01A 1A32A 2XT9A 4UXNA 2JGDA 4O4JB 3D8CA 1M5IA 1VEWA 3ZRWB 2A0LA 4RWUA 2P5OA 3H9VA 4L8JA 3DSQA 3RWRD 3ZMSA 4RQEA 1N32O 1R6KA 4LF6B 1G1XB 1K92A 1TGOA 4MSWC 2YXYA 4MW8A 2X6BA 4JYCA 1R6NA 4TT3G 4GX1A 3PN1A 1DF5A 2CTPA 1NTKH 2KKWA 2Q68A 3OMAB 4JI2O 5B5EZ 4K0KB 3SGIA 4LF4O 3HKBA 5JVDB 4FMTA 2Y0IA 1FFXA 1D2DA 4B3MB 1SF9A 2HVKC 3CP1A 3X2QB 4DR1O 2FL4A 2A7WA 3SJQC 3B8MA 3RYFA 1RPRA 2QWNB 2P4KA 3QO7A 3D36A 2R72A 1QBZA 3CCSV 3SYQA 2LQTA 1NTMH 1IBKO 1PM9A 3FYIB 4UV8A 3RFRA 3P32A 4CC5A 2KQXA 1KQSU 1MZEA 1VQ8V 3L73H 2WLKA 2DYSB 2A06H 1BHAA 5JJJB 1N32B 2HFEC 1H2NA 2YXHA 1AJQA 3O65A 1TUBB 2VRZA 2QA4V 4JI1O 4CC6A 3CHXA 2FB5A 5KX5B 2Y4UA 4JI4O 4JI2B 2OTLV 3OUSA 4LF4B 1G4YB 4GLXA 5BZBA 1QR8A 4NR1A 3U11A 3ABKB 3AEIA 4DR4O 4J10A 1OCZB 3K5NA 4J41A 5H6QA 4DR1B 1X59A 4FFKA 1SETA 4DR5O 3E8HA 3A2FA 3JALA 4NTYA 3VOUA 4LWSB 4ZIBA 2ETNA 3G6BA 3MHHC 1AP5A 4UCRA 2CH7B 1S3JA 1OCRC 3FB7C 4NKGB 1IBKB 3FAVA 3K9AA 4B3RO 3UM7A 3A0BZ 1S0VA 2ZT9B 4QE7A 2WLLB 1G6UA 2AHZA 3L70H 2DMXA 1H2MA 3QNEA 1VQLV 1LUVA 2QE7G 3ETQA 2WWWA 4DRXB 3SPGA 2YIBA 3CRMA 3GVMA 4JI1B 2KSDA 2P4VA 1KP3A 1BQZA 4JI4B 3ABUA 1GN6A 4IHJB 4R50A 5DECA 1NTZH 4LF5O 3OTOO 1AR5A 2XTAA 4DR4B 3CCMV 4O4HA 1RSOA 5E79Z 3JARB 2B1IA 4DR5B 4X1IB 3P3NA 4FFBA 2NR5A 4IYIA 1YSCA 4AQYO 5IJ0B 1FXKC 4MVMA 5TISZ 2EIKB 3AK1A 3JASA 5LL6Y 1V55B 4B3RB 3EXAA 3ZS8C 2A9HA 4W4KA 2Q5ZA 2N04A 1Y76A 5IYZB 4LH6A 4DUZO 4EFBA 4N23A 2FTKA 2YEVA 3K79A 1P84F 3JD1A 1JA8A 5B3SC 1EBOA 2JJ2G 3ZN0A 2VQEO 3N27A 5FNVA 3CMAV 3KCYA 1SQFA 5H5NA 1HNZO 1VQNV 1GH6A 2QM8A 2OCHA 2HKOA 3E22B 4YIPA 4DV2O 4RAIA 5LP6C 2CTRA 2GTAA 4ICGA 2QKCA 4DUYO 1PNLA 4JZGA 4LF5B 3OTOB 2DE0X 3CRRA 5EBMC 3OUFA 3W7UA 2QGNA 3JSNA 1PPJH 3ASNB 1Z5VA 3BFRA 1IDSA 3UT5A 4WFAV 4ZKIA 5ITZA 4B7KA 4IIJA 4AQYB 1XI1A 2XAJA 4OX9O 1NH2B 4FZ0A 2D2CB 2RN9A 1P7GA 1K7DA 5IYCO 5LOVB 4P9OA 3VQYA 2R9RB 5JQGB 4G27B 2WLIA 4GCZA 4DUZB 4OPAA 3H1IH 1IXMA 1AROP 3X2QC 2VQEB 2RDCA 1KECA 1SKVA 1VIBA 2K9PA 4I4TB 2Y69C 1HNZB 2ADPA 1D5NA 1WLEA 1AJNA 2GUZB 1QR9A 2UXBO 3CCRV 1YXBA 1EN5A 5KMGA 4DV2B 1AI5A 2V4DA 3DC6A 2BCCH 2WA4A 3K08A 4DUYB 4H33A 1M1KW 1W59A 5HFMA 5JWPA 2JGDB 3IAYA 5H2FZ 1SA0A 4GYCB 1ROPA 5DEDA 3L72H 4P9PA 4MVUA 3NXSA 2ADQB 5L3DA 3CJHA 4OX9B 2EIJB 2QJ1A 4J42A 4FM1A 2X6AA 4ZI7A 3TETA 1WNSA 4J7JA 1R73A 5K1XA 4JI8O 3TK1A 5EIBC 3CCVV 1FFXB 4TOIA 1EZVH 2PUSA 3J7AU 3ABKC 3BABA 2AXTZ 1OCZC 3RVZA 2NLJC 1M93A 1K34A 1YCIA 2ZIOA 1QVGU 3R65A 1VQMV 2EJ7A 2OTJV 3WB1A 1JMKC 2QWPB 2Q0OC 3RYFB 1VQ6V 5IY5B 2D3OW 1U96A 1RP3B 4GZRB 5EZYA 2UXBB 2M6YA 2BSKA 4TV9A 3RBZA 4JZ2A 4O4LA 5L3FA 1OV9A 1NS1A 5EC2C 3J81N 1EN6A 3RVYA 1M4UA 2UXDO 3FD9A 1TVKB 3K04A 4BIUA 4Q6GA 2P90A 2WLJA 3CXHF 4DV5O 4F4LA 1N0NA 4E2LA 4TUYA 3TGUH 1AI6A 1AB3A 4PA4A 4JI8B 2OCCB 3SJBC 5DM6V 2PTMA 3JYCA 4RUEA 5KAIZ 1MSDA 2FMLA 2YDEA 3DTUB 3LDCA 1X4TA 5C8YA 1GTOA 2PF4E 2Q73A 3HKEA 1BMFG 5CA1A 3L74H 2PGGA 3CRAA 3K57A 3ABTA 1SQPH 4PI0A 3F7VC 2HLDG 4JTAB 4UCSA 2EIMC 5A9GA 4D7SA 1I7FA 4PDRA 5H6RA 5KUMA 1B06A 3G71V 3G80A 4PHZA 5CA3A 1QVFU 4WFFA 3IFXA 3BHPA 4GX0A 2DW4A 2R70A 1FYJA 1P4RA 3HKCB 2UXDB 1JFFB 5D5PA 4LH7A 2DJVA 4PELA 3HB3B 4LR3A 2EILC 3FKSG 4DV5B 3BRCA 3I56V 1FKAO 2QDOA 1EFRG 4FM2A 2ZIMA 4N21A 5B66Z 1JR9A 3MHSC 1M90W 4LNUA 2JK5C 1OCRB 1Q43A 3FYEB 2CK3G 1XQ8A 1RSOB 1L1FA 1Y74A 1THZA 5L3BA 1NU1H 3BPZA 2EBOA 3CC2V 5L3GA 2CUGA 1WN7A 4FFBB 1K9MW 2PYLA 4A5UB 4UCUA 4UB8Z 3E86A 1WP7A 4EB6B 2IH3C 4Q20A 2W0FC 5A2QN 4JTCB 4UB6Z 2ZE8A 4X1KA 3TCUA 5FLXN 4JYAO 3OEHG
chains in the Genus database with same CATH topology
2UXCO 1AB3A 4YY3O 1HNXO 4K0KO 2UXBO 1HR0O 4AQYO 1YZBA 4NXMO 4X66O 4B3MO 2F4VO 3JAMN 4LFAO 3M8AA 2AGAA 3RT3C 5LL6Y 4DV6O 4LF8O 1XNRO 3O65A 4JI6O 4JI1O 4DR6O 1AILA 2FKXA 4DUZO 4JI4O 1R6TA 5IWAO 3R66A 4X64O 3J80N 2VQEO 1XMOO 4DR4O 4DR3O 1DK1A 2HHHO 4JV5O 4B3TO 2ZKOA 5BXZA 2DOSA 5LMUO 1N36O 5IT9N 2UUBO 1J5EO 1X59A 5H5NA 1HNZO 4DR5O 1A32A 4DV0O 1XMQO 4JI8O 1IBMO 1FYJA 4JI5O 4LFCO 4GKKO 4DV2O 3J7AU 4DV7O 2DJVA 2E5LO 4KHPO 4DUYO 4X65O 2UUCO 1N34O 1N32O 3F5TA 1XEQA 1G1XB 4DR2O 1FKAO 4NXNO 4B3RO 4DR7O 4LF9O 2UUAO 1KUQA 2Z0AA 2LW7A 4JI2O 4GKJO 4LF4O 1FJGO 4OX9O 1XNQO 1F7YA 3T1HO 1D2DA 4YHHO 4OPHA 3SDLA 2VQFO 1N33O 4DR1O 2ZM6O 2UU9O 1NS1A 2JRIA 4JI3O 4A5UB 5BY1A 3J81N 5BR8O 1I94O 4X62O 2UXDO 5LMNO 1IBLO 5A2QN 4LF7O 4OPAA 4DV4O 4B3SO 4LF5O 3OTOO 5FLXN 3T1YO 4LF6O 4DV5O 4JI7O 1IBKO 4JYAO 4LFBO 1HNWO 4JI0O 2N74A 4DV1O 4DV3O 1R1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXC O;  1AB3 A;  4YY3 O;  1HNX O;  4K0K O;  2UXB O;  1HR0 O;  4AQY O;  1YZB A;  4NXM O;  4X66 O;  4B3M O;  2F4V O;  3JAM N;  4LFA O;  3M8A A;  2AGA A;  3RT3 C;  5LL6 Y;  4DV6 O;  4LF8 O;  1XNR O;  3O65 A;  4JI6 O;  4JI1 O;  4DR6 O;  1AIL A;  2FKX A;  4DUZ O;  4JI4 O;  1R6T A;  5IWA O;  3R66 A;  4X64 O;  3J80 N;  2VQE O;  1XMO O;  4DR4 O;  4DR3 O;  1DK1 A;  2HHH O;  4JV5 O;  4B3T O;  2ZKO A;  5BXZ A;  2DOS A;  5LMU O;  1N36 O;  5IT9 N;  2UUB O;  1J5E O;  1X59 A;  5H5N A;  1HNZ O;  4DR5 O;  1A32 A;  4DV0 O;  1XMQ O;  4JI8 O;  1IBM O;  1FYJ A;  4JI5 O;  4LFC O;  4GKK O;  4DV2 O;  3J7A U;  4DV7 O;  2DJV A;  2E5L O;  4KHP O;  4DUY O;  4X65 O;  2UUC O;  1N34 O;  1N32 O;  3F5T A;  1XEQ A;  1G1X B;  4DR2 O;  1FKA O;  4NXN O;  4B3R O;  4DR7 O;  4LF9 O;  2UUA O;  1KUQ A;  2Z0A A;  2LW7 A;  4JI2 O;  4GKJ O;  4LF4 O;  1FJG O;  4OX9 O;  1XNQ O;  1F7Y A;  3T1H O;  1D2D A;  4YHH O;  4OPH A;  3SDL A;  2VQF O;  1N33 O;  4DR1 O;  2ZM6 O;  2UU9 O;  1NS1 A;  2JRI A;  4JI3 O;  4A5U B;  5BY1 A;  3J81 N;  5BR8 O;  1I94 O;  4X62 O;  2UXD O;  5LMN O;  1IBL O;  5A2Q N;  4LF7 O;  4OPA A;  4DV4 O;  4B3S O;  4LF5 O;  3OTO O;  5FLX N;  3T1Y O;  4LF6 O;  4DV5 O;  4JI7 O;  1IBK O;  4JYA O;  4LFB O;  1HNW O;  4JI0 O;  2N74 A;  4DV1 O;  4DV3 O;  1R1B A; 
#chains in the Genus database with same CATH topology
 4DW0 A;  3S3W A;  2ARH A;  2P67 A;  2Q8V A;  5FNV B;  2Y0P A;  3ZHT A;  4NXM O;  2VWK A;  3M8A A;  1NR7 A;  4QIW F;  4ZHQ A;  2HP8 A;  5JCO A;  1XNR O;  3RW0 A;  2EZO A;  2HVJ C;  3MDS A;  1OCC B;  4UVB A;  2CAZ C;  2AW9 A;  1CPY A;  1N0J A;  4DR3 O;  3AK3 A;  3QO5 A;  1N36 O;  2X0L A;  5E1A C;  5B3S B;  2BOB C;  5AG2 A;  1Q3E A;  3JAT A;  4IIJ B;  4R8C A;  1QQC A;  2EIJ C;  4GKK O;  5EYP B;  3UO3 A;  3OMN B;  3M99 B;  4FZ1 A;  4Z1V A;  5L3E A;  2LP7 A;  3TJT A;  2WLH A;  1MAB G;  4HNA A;  4JYA B;  3F5T A;  2WLI B;  1BQ0 A;  3CCQ V;  3ZBH A;  5IYB O;  3CSX A;  1S77 D;  2X7R B;  3OW2 U;  2YC0 A;  4NXM B;  2ZNJ A;  3U0Z A;  1Q6H A;  3D3I A;  3LNN A;  1VQP V;  5IY5 C;  3C3S A;  1ZUQ A;  3D36 C;  2P6J A;  1XNR B;  3EFF K;  2P7T C;  4HAM A;  3SYC A;  2IM9 A;  4QPJ A;  2QR4 A;  3ZHV A;  4QE9 A;  3OEE G;  4P2Z A;  4AHC A;  4B7E A;  4PI2 A;  3ASO B;  3WU2 Z;  3RYI A;  4Z1M G;  3N2K B;  3QO8 A;  4FM0 A;  4YXW G;  4JI7 O;  2PI5 A;  4DR3 B;  1SA0 B;  2OT5 A;  1N36 B;  5LGT A;  4R7C A;  3ZHQ A;  3T1C A;  4DXW A;  1RFY A;  3HKD A;  2W6I G;  4WFB V;  4BIO A;  3E8B A;  1EZJ A;  4FLT A;  4GKK B;  4X66 O;  2Y69 B;  2WA3 A;  1ZWI C;  1E1R G;  4H44 B;  1VF7 A;  2GBO A;  1KKC A;  2Q69 A;  4YJ3 A;  2EIN C;  3CB2 A;  4CS4 A;  2DWD C;  3G4S V;  3JD3 A;  3K9S A;  1XL4 A;  4KP4 A;  2OCC C;  4DO2 A;  2RQ6 A;  1ENV A;  4X1Y A;  3JAW A;  5BMV A;  1B04 A;  3J80 N;  3K0G A;  1WA8 A;  2EUL A;  4DYL A;  2MK3 A;  4G2K A;  2YS8 A;  1KC8 W;  1SZT A;  5C93 A;  4FVM A;  1H8E G;  5GON B;  4UCV A;  1GRJ A;  1FFT B;  5EZY B;  1GN2 A;  1QNM A;  1P49 A;  1NVP B;  1JJO A;  4X8A A;  1IBM O;  2Y4T A;  1K97 A;  1Y4M A;  1MOF A;  1S5L Z;  1SC5 B;  2B1G A;  4TV9 B;  4MTX A;  5KHK A;  4O4L B;  3VQX A;  3ABM B;  4JI7 B;  3FFQ A;  4GUN A;  3RYH B;  3ETG A;  4QPK A;  2WLN A;  2H94 A;  5KHH A;  1OZ0 A;  2Z0A A;  3OFN G;  5HFL A;  1QLN A;  4X20 B;  5D5Q A;  3GWO A;  4MVS A;  4X66 B;  3A8T A;  1SRY A;  1WB8 A;  3B2E E;  1PNM A;  2UU9 O;  1BL8 A;  2OIE A;  4WCE V;  1ZL8 A;  2CTW A;  4I50 A;  2ZE6 A;  3IGA C;  4MTF A;  4Z2W A;  4NVP A;  3HKE B;  4DV4 O;  4DV3 O;  3U10 A;  2YIA A;  2UXC O;  1U97 A;  5JJN B;  1NH2 D;  4U3J B;  1IBM B;  1FXV A;  1YJW V;  2F95 B;  1XDC A;  5K1P A;  3K59 A;  2E74 B;  1AP6 A;  3D3Q A;  5LGN A;  2NN4 A;  5CB4 B;  3RT3 C;  1M57 B;  1QLE B;  1K33 A;  4X88 A;  1F51 A;  4J9Z B;  1K5S A;  5KA6 A;  1Q6I A;  2HR3 A;  4WFG A;  1YVW A;  1R6T A;  2XUM A;  1IX9 A;  3JD4 A;  3BCC H;  4P30 A;  5LA6 A;  2HHH O;  4JAA A;  2IW5 A;  5LYJ A;  2LGQ A;  2QTS A;  2EIM B;  5IE9 A;  2UU9 B;  4F6R A;  5GW7 A;  3Q4H A;  1OCC C;  1K3E A;  5LXT A;  1JOY A;  1H8H G;  3H1L H;  5EBW C;  4DV4 B;  2QM7 A;  5B1N A;  2QKA A;  4DV3 B;  2IU0 A;  3ZMT A;  2UXC B;  2EIL B;  2IJJ A;  1AR4 A;  1FJG O;  1FAF A;  3RN4 A;  1QU7 A;  5IJ9 A;  1MNG A;  4E4E A;  1MZF A;  4U3F H;  2ILM A;  3LNM B;  3LSU A;  2R9I A;  1TA8 A;  2JVD A;  3ETE A;  4I0X A;  5J2T A;  5BR8 O;  3HR0 A;  2ITC C;  1PD3 A;  2AZ0 A;  5J9P C;  4MVR A;  4K8X A;  1IBL O;  1ZTE A;  4D6T H;  1JPX A;  4O2B A;  4JPR A;  3KCX A;  3CC4 V;  1EM1 A;  4IT5 A;  1NT2 B;  3T1Y O;  1XHZ A;  2HHH B;  5KLV H;  3FB8 C;  2ZDI A;  4AI8 A;  3IC9 A;  2WPD G;  4FLY A;  1YI2 V;  5KA5 A;  3ASO C;  3N2G A;  4U7O A;  1XRE A;  2YUA A;  3G67 A;  3ZHS A;  1E1Q G;  2BTQ B;  3STZ C;  1H2S B;  4WBN A;  2F43 G;  2YXL A;  1V9P A;  1K4C C;  4W4L A;  1HDJ A;  1L8D A;  3BA8 A;  3JCZ A;  5IWA O;  4TSF G;  1FJG B;  1F4N A;  1I5X A;  4BR6 A;  4C7U A;  3DXR B;  1D5A A;  4K35 A;  3UCS C;  5F2V O;  1KBH A;  1J5E O;  4CBC A;  5KUK A;  1XMQ O;  4ZBM A;  3SPI A;  5B1O A;  5BR8 B;  2F1M A;  2GTS A;  3BEH A;  3FX7 A;  3GB7 C;  1Y6X A;  1IBL B;  2N05 A;  1BZK A;  2P06 A;  4I9Q A;  1EN4 A;  4UUJ C;  2XAS A;  4KHP O;  2L35 A;  2WLM A;  1AR1 B;  3T1Y B;  5KHI A;  1N4C A;  2ZE5 A;  1DTO A;  1PV0 A;  2JEX A;  1K5Q A;  4KXR A;  2RCV A;  5JVD A;  1WJZ A;  1B3Q A;  3K03 A;  1XNQ O;  1VP7 A;  3HKB B;  4HYO A;  1F7Y A;  3ABM C;  1GMG A;  2PZS A;  4WFH A;  2QSA A;  1SZX A;  2QWO B;  3ZMV A;  3OM3 B;  2NNU A;  2VWJ A;  1GKF A;  4CZZ A;  5IWA B;  2ATK C;  4B3S O;  1R3L C;  2ZIN A;  5LGU A;  1RM1 B;  1HNW O;  2F66 C;  5CA0 A;  2FYU H;  1Q90 D;  4CH5 A;  4BW9 A;  2LFR A;  1J5E B;  4X1Y B;  3CYO A;  5GTI Z;  1XMQ B;  5BMV B;  4PDL A;  2O57 A;  1YF2 A;  5LHI A;  5J2U A;  1KB9 F;  3E8F A;  1PL0 A;  4KHP B;  3VBB A;  4JYY A;  2DQ0 A;  1TUB A;  1CEZ A;  1S5J A;  4DR6 O;  1SER A;  2EIN B;  4IGG A;  4NYK A;  2LW1 A;  1XNQ B;  3H1H H;  1M57 C;  3UKM A;  1QLE C;  4JV5 O;  3AG1 C;  3ZIA G;  4PA9 A;  5LMU O;  4LC1 A;  2JIZ G;  4LBE C;  4RUF A;  4DV0 O;  1UJW B;  4LWS A;  1GM9 A;  5JJE B;  3JAL B;  5EK0 A;  2UXX A;  4JI5 O;  1E79 G;  2DQ3 A;  1PL4 A;  1FXH A;  3T4D A;  2CH7 A;  4B3S B;  1N34 O;  2YID A;  1HNW B;  4NXN O;  3FAV B;  2ZCE A;  1B6Q A;  4JAV A;  2OIG A;  2WLL A;  1OCO B;  4GKJ O;  2Q9L A;  4O2A A;  1SQB H;  1W0J G;  3STL C;  4EFE A;  2E76 B;  3OR7 C;  4OPH A;  4XDJ A;  3OAA G;  4DRX A;  4JI3 O;  1UFI A;  1NJI W;  4DR6 B;  1Q5O A;  2C2A A;  5CBH A;  3AK2 A;  4CS3 A;  4LF7 O;  4IHJ A;  1JQ0 A;  1KU9 A;  1PP9 H;  2JS3 A;  4LFB O;  4JV5 B;  3H1K H;  4O4H B;  5LMU B;  1R3K C;  3F7Y C;  2CTQ A;  3T2M A;  1YJN V;  2AHY A;  4DV0 B;  5B1A C;  2IBZ H;  1QCE A;  4XDL A;  1HNX O;  4GT1 A;  4JI5 B;  3BVO A;  3OR6 C;  4H13 B;  5JCO C;  4JAS A;  3B09 A;  3JAS B;  1N34 B;  3Q4H B;  4YJ2 A;  4NXN B;  4NB5 A;  5IYZ A;  5LXT B;  4J7K A;  3SYA A;  1Y76 B;  4OXS A;  4GKJ B;  1BE3 H;  3MAQ A;  2QWR B;  2YEV B;  3CX5 F;  2WSS G;  1SES A;  3SR2 C;  3AG2 B;  2DN9 A;  4QNH B;  3JCU Z;  4QGP A;  5BXZ A;  3QTC A;  3CRC A;  4FLV A;  2QKS A;  4JI3 B;  1Q86 W;  1K73 W;  2M7W A;  3E22 A;  5CN0 A;  3W7W A;  1V54 C;  2Z5U A;  5IJ9 B;  4LF7 B;  2HJF C;  1F4M A;  2YSU B;  3L75 H;  3CS5 A;  3B40 A;  2K1E A;  4DK0 A;  4LFB B;  1WPB A;  1US6 A;  1XEQ A;  2XAG A;  1IXB A;  2ODM A;  4K3A A;  3ZRV A;  2EZP A;  3KG2 A;  3L9D A;  4UFZ A;  3UT5 B;  1HNX B;  5ITZ B;  1S5H C;  4FJC C;  2ZR2 A;  3ML0 A;  3BAA A;  4YHH O;  1YDX A;  3K5O A;  2W6J G;  4MT8 A;  4WFE A;  1NVP D;  4PDM A;  2XHB A;  3A0R A;  5LOV A;  2ZM6 O;  1BHB A;  1BCC H;  3LDE A;  4BWA A;  4BW5 A;  1I94 O;  5IYD O;  4FIP C;  2ITD C;  3K3W A;  5EIB D;  1XHX A;  3KZI Z;  1GM7 A;  3CME V;  3SJA C;  3T4Z A;  3W7T A;  1M56 C;  4I4T A;  1CP9 A;  4L87 A;  2ZE7 A;  4YY3 O;  4FPP A;  2GUZ A;  4MS2 A;  5JH7 A;  3M7M X;  1VF6 A;  2IH1 C;  4MVQ A;  5KMG B;  4I9W A;  3C90 A;  1RM1 C;  2F4V O;  1Q81 W;  2AGA A;  4B08 A;  3CPW U;  4H0L B;  1GK9 A;  4D7T A;  3CCU V;  1OHH G;  1Y67 A;  2ZQM A;  4BAY A;  2ZXW C;  2ZD9 A;  1OJH A;  1F23 A;  1VF5 B;  1NBM G;  3CJH B;  4DK1 A;  4YHH B;  1VMG A;  1H2K A;  3WB2 A;  2ZKO A;  3E8G A;  5IT9 N;  4ZI7 B;  2UUB O;  5L3C A;  2JJ1 G;  1KP2 A;  2ZM6 B;  3FB6 C;  1I94 B;  4CH3 A;  3ABL C;  3QG5 A;  3ETD A;  2HJD A;  2Z3Y A;  2E5L O;  3WG7 C;  3QF7 A;  1AI7 A;  3NR7 A;  1H2G A;  4LP8 A;  4TV8 A;  3MD0 A;  3L71 H;  1SQQ H;  3AG4 B;  1VQ9 V;  2EX3 A;  2PI4 A;  3UQ8 A;  4YY3 B;  1ZSP A;  5CBG A;  1NZ6 A;  1IUR A;  1P7B A;  3OD4 A;  2BSK B;  2F4V B;  5CA0 B;  1FPO A;  3ZX6 A;  4FK5 C;  3AG3 C;  3W7X A;  1WB7 A;  3HPL C;  5BY1 A;  4ZOL A;  1OCO C;  4PA6 A;  2E3C A;  5J2U B;  2EJR A;  1KYO F;  3OGC C;  2YI9 A;  4O4I A;  4K8Z A;  1TVK A;  1VQO V;  3RYC A;  3THO A;  2H8P C;  2IJH A;  4RO2 A;  4DV1 O;  1JJ2 U;  2LO1 A;  3ZHU A;  1R1B A;  4GX2 A;  2UUB B;  1W0K G;  3B77 A;  4TUY B;  2CGO A;  4PA7 A;  3JSL A;  2Q7G A;  4I55 A;  4IL6 Z;  4PA3 A;  5KHG A;  2IU3 A;  2E5L B;  2Q67 A;  3JAM N;  1COW G;  3ZMZ A;  1W2B U;  4LFA O;  2A3Q A;  2HG5 C;  1O9H A;  1H38 A;  2MW2 B;  5C8Y B;  5LHG A;  5CA1 B;  4JAU A;  4MTG A;  4JI6 O;  3CWB H;  1AVM A;  4UVC A;  4JF3 A;  2PYJ A;  4X89 A;  3CEI A;  2DOS A;  1GN3 A;  4HZ3 A;  1CXZ B;  3ZHR A;  1YTF D;  3E35 A;  4X9Q A;  5DN6 G;  2YIC A;  4O2A B;  3HKC A;  2CGN A;  3AG1 B;  1JFF A;  3AG2 C;  3TXQ A;  4ASU G;  1S72 V;  1NR1 A;  4X65 O;  2UUC O;  3E89 A;  4H37 A;  4DV1 B;  4G28 B;  3SPH A;  4DR7 O;  4CH6 A;  1Q7Y W;  3ZMU A;  2LGW A;  4JGS A;  1L0N H;  1KUQ A;  2KG7 A;  2LW7 A;  1G8M A;  5FL7 G;  4LNU B;  3RGB A;  1TAE A;  2ZNI A;  2B9Z A;  3SDL A;  1Y74 B;  4LFA B;  4DW1 A;  3JAK A;  5EC1 C;  2RMK B;  1M9N A;  4JI6 B;  4EB6 A;  2GV9 A;  1IZ3 A;  2W0X A;  1GO3 F;  1XOU A;  2ZDI C;  1K4D C;  4X1K B;  3CCL V;  4YJ2 B;  3VQV A;  4JI0 O;  5B1B C;  4PDV A;  1WAZ A;  3P3P A;  2G38 A;  4ABM A;  3G6E V;  1SQX H;  3CC7 V;  4I5S A;  4I7Z B;  2DYR C;  3O9O A;  3ZRS A;  4J9Y B;  1HR0 O;  3WFV A;  3KKY A;  4YIO A;  3W7S A;  1YZB A;  3LUT B;  3OTF A;  3OE7 G;  3FB5 C;  1MA1 A;  5B1A B;  4X65 B;  2UUC B;  2F93 B;  1WP8 A;  2CE4 A;  3GWK C;  4XBF A;  4FLZ A;  2H3O A;  1FXK A;  4ZHQ B;  3AG7 A;  3DGE A;  3BA9 A;  4DR7 B;  1Z2G A;  1J95 A;  4FLX A;  4TQD A;  3LSQ A;  3WB0 A;  4NTW A;  2P22 C;  4EKW A;  4X64 O;  1VQ5 V;  1XIL A;  5GTH Z;  1NQT A;  1LUW A;  1YTF B;  1LR1 A;  1PKX A;  1XUQ A;  1FD9 A;  3ZCC A;  4TWK A;  1URF A;  3JAT B;  4MVO A;  4WF9 V;  4LFC O;  5EYP A;  2XAH A;  3P30 A;  3CRQ A;  1V54 B;  2B5U A;  5LP6 A;  4HNA B;  4JI0 B;  1AI4 A;  4IYH A;  2IJK A;  5CBF A;  2CDY A;  1KD1 W;  5IDJ A;  1HR0 B;  4O4J A;  1GAX A;  2QWQ B;  3AG4 C;  3ZRW A;  4OGQ B;  1FS0 G;  2JRI A;  5JH7 B;  4EEQ A;  1JCH A;  4X62 O;  4CH4 A;  3C3T A;  3PJS K;  3OGI B;  1PNK A;  3N2K A;  2BOC C;  3RYI B;  1MMM A;  4X64 B;  2GSM B;  5KAF Z;  2DWE C;  2X6C A;  4MTO A;  1BGY H;  3SJC C;  2JS5 A;  2XOK G;  2DYS C;  1QHT A;  3HKD B;  1YEW A;  2V7Q G;  4LFC B;  1M56 B;  3A0H Z;  1JX9 A;  2BTO A;  3CD6 V;  5FPR A;  2YIB D;  3K5L A;  5FPO A;  2Q7H A;  4CS2 A;  4YJ3 B;  3H1J H;  3SYO A;  2UXN A;  2XAQ A;  4DV6 O;  1BT8 A;  4LF8 O;  3I55 V;  1BSM A;  3K58 A;  2VS0 A;  1ORQ C;  2AZ2 A;  4PV1 B;  2OWO A;  2FKX A;  3LDD A;  1VAR A;  4UCT A;  3JAW B;  2QEX V;  4TV8 B;  1MSW D;  2ZXW B;  2KB1 A;  1WA8 B;  2GDS A;  1DGS A;  5GON A;  2PY5 A;  1GM8 A;  4KL1 A;  1I0H A;  1Q8I A;  3ZJZ A;  5H9C A;  1KMI Z;  4X62 B;  1R3J C;  1Q6U A;  4UCO A;  3E83 A;  3B8N A;  5KX5 A;  2WAM A;  4HBN A;  1NKD A;  1LNQ A;  1RPO A;  4ZOL B;  4J7Z A;  1SQG A;  3ABL B;  3TXS A;  3RYH A;  3QVN A;  4F6E A;  1Q82 W;  1SS3 A;  3S3X A;  1ZLZ A;  4O4I B;  3WG7 B;  3EVK A;  2JEU A;  1AJP A;  4X20 A;  3RYC B;  1S76 D;  4PD4 F;  1YHQ V;  1SQV H;  4DV6 B;  4LF8 B;  3CE2 A;  4MW3 A;  4I55 B;  1ZL8 B;  4J80 A;  4I50 B;  3E2E A;  5LMN O;  4UV9 A;  3CCJ V;  3AG3 B;  2F23 A;  4JYB A;  4BIZ A;  2YI8 A;  3SPC A;  2Y48 A;  1Z5W A;  2N74 A;  1KKD A;  5KHJ A;  1ZX3 A;  2XAF A;  2A79 B;  4U3J A;  2EIK C;  3OT7 A;  3DC5 A;  1R3I C;  2OYQ A;  1V55 C;  3BY6 A;  1H2L A;  2BE3 A;  2E75 B;  5CB4 A;  1HP8 A;  4MVZ A;  4XDK A;  4FLW A;  3K0D A;  1XL6 A;  2QTO A;  1Y66 A;  1AIL A;  4QJF B;  3JAR A;  4NTX A;  4J11 A;  4X1I A;  2R9A A;  3CCE V;  2JDI G;  2RNB A;  3UO2 A;  3ZED A;  1XMO O;  3VQW A;  5IJ0 A;  1VQ4 V;  2RJZ A;  4B3T O;  5LA6 B;  5LYJ B;  2L6L A;  2KG7 B;  2QM4 A;  4F6R B;  2Q0A A;  3I5D A;  4RQF A;  4AIL C;  1GN4 A;  1O9G A;  3K5M A;  5LMN B;  4PJ0 Z;  2HEP A;  4DV7 O;  1DLB A;  2LFS A;  3ASN C;  3JAK B;  3APO A;  4KFM A;  1L0L H;  4DR2 O;  4FLU A;  4KUM A;  4LF9 O;  5CMU A;  2UUA O;  3OMI B;  1YIJ V;  1K8A W;  3ICX A;  2LJ2 A;  1I08 A;  4U7N A;  2Q4P A;  2IJI A;  3T1H O;  3B4S A;  3JD0 A;  2VQF O;  2JGU A;  1N33 O;  1XBL A;  4JTD B;  4I0X B;  5J2T B;  1YJ9 V;  3APQ A;  3LSS A;  1VQ7 V;  3IC7 A;  4TQF A;  2ZR3 A;  4O2B B;  1FXK B;  1XMO B;  4LF6 O;  4B3T B;  3ZN1 A;  1T5E A;  1VF6 C;  3SPJ A;  3F5W C;  1HWY A;  2XND G;  3K06 A;  1VQK V;  1NI8 A;  5EBL C;  3N2G B;  4K0K O;  5JQG A;  5B1B B;  3JD2 A;  4B3M O;  4DV7 B;  1HW7 A;  1BS3 A;  2DYR B;  2BTQ A;  4LCU C;  1DF4 A;  4DR2 B;  3CXC U;  4WBN B;  1I5Y A;  2GHY A;  4LF9 B;  1TUE B;  2UUA B;  4R6Z A;  1YIT V;  2Q7E A;  2V1D A;  3IJ4 A;  3R66 A;  1UPG A;  1JVM A;  2Q6A A;  1WPX A;  3ZRX A;  1N8R W;  3DXR A;  3SYP A;  5LP6 B;  3T1H B;  4UVA A;  4GX5 A;  1MG1 A;  1DK1 A;  3EHB B;  2VQF B;  5LHH A;  1IVS A;  1N33 B;  5LBQ A;  1ZAU A;  3H01 A;  1A32 A;  2XT9 A;  4UXN A;  2JGD A;  4O4J B;  3D8C A;  1M5I A;  1VEW A;  3ZRW B;  2A0L A;  4RWU A;  2P5O A;  3H9V A;  4L8J A;  3DSQ A;  3RWR D;  3ZMS A;  4RQE A;  1N32 O;  1R6K A;  4LF6 B;  1G1X B;  1K92 A;  1TGO A;  4MSW C;  2YXY A;  4MW8 A;  2X6B A;  4JYC A;  1R6N A;  4TT3 G;  4GX1 A;  3PN1 A;  1DF5 A;  2CTP A;  1NTK H;  2KKW A;  2Q68 A;  3OMA B;  4JI2 O;  5B5E Z;  4K0K B;  3SGI A;  4LF4 O;  3HKB A;  5JVD B;  4FMT A;  2Y0I A;  1FFX A;  1D2D A;  4B3M B;  1SF9 A;  2HVK C;  3CP1 A;  3X2Q B;  4DR1 O;  2FL4 A;  2A7W A;  3SJQ C;  3B8M A;  3RYF A;  1RPR A;  2QWN B;  2P4K A;  3QO7 A;  3D36 A;  2R72 A;  1QBZ A;  3CCS V;  3SYQ A;  2LQT A;  1NTM H;  1IBK O;  1PM9 A;  3FYI B;  4UV8 A;  3RFR A;  3P32 A;  4CC5 A;  2KQX A;  1KQS U;  1MZE A;  1VQ8 V;  3L73 H;  2WLK A;  2DYS B;  2A06 H;  1BHA A;  5JJJ B;  1N32 B;  2HFE C;  1H2N A;  2YXH A;  1AJQ A;  3O65 A;  1TUB B;  2VRZ A;  2QA4 V;  4JI1 O;  4CC6 A;  3CHX A;  2FB5 A;  5KX5 B;  2Y4U A;  4JI4 O;  4JI2 B;  2OTL V;  3OUS A;  4LF4 B;  1G4Y B;  4GLX A;  5BZB A;  1QR8 A;  4NR1 A;  3U11 A;  3ABK B;  3AEI A;  4DR4 O;  4J10 A;  1OCZ B;  3K5N A;  4J41 A;  5H6Q A;  4DR1 B;  1X59 A;  4FFK A;  1SET A;  4DR5 O;  3E8H A;  3A2F A;  3JAL A;  4NTY A;  3VOU A;  4LWS B;  4ZIB A;  2ETN A;  3G6B A;  3MHH C;  1AP5 A;  4UCR A;  2CH7 B;  1S3J A;  1OCR C;  3FB7 C;  4NKG B;  1IBK B;  3FAV A;  3K9A A;  4B3R O;  3UM7 A;  3A0B Z;  1S0V A;  2ZT9 B;  4QE7 A;  2WLL B;  1G6U A;  2AHZ A;  3L70 H;  2DMX A;  1H2M A;  3QNE A;  1VQL V;  1LUV A;  2QE7 G;  3ETQ A;  2WWW A;  4DRX B;  3SPG A;  2YIB A;  3CRM A;  3GVM A;  4JI1 B;  2KSD A;  2P4V A;  1KP3 A;  1BQZ A;  4JI4 B;  3ABU A;  1GN6 A;  4IHJ B;  4R50 A;  5DEC A;  1NTZ H;  4LF5 O;  3OTO O;  1AR5 A;  2XTA A;  4DR4 B;  3CCM V;  4O4H A;  1RSO A;  5E79 Z;  3JAR B;  2B1I A;  4DR5 B;  4X1I B;  3P3N A;  4FFB A;  2NR5 A;  4IYI A;  1YSC A;  4AQY O;  5IJ0 B;  1FXK C;  4MVM A;  5TIS Z;  2EIK B;  3AK1 A;  3JAS A;  5LL6 Y;  1V55 B;  4B3R B;  3EXA A;  3ZS8 C;  2A9H A;  4W4K A;  2Q5Z A;  2N04 A;  1Y76 A;  5IYZ B;  4LH6 A;  4DUZ O;  4EFB A;  4N23 A;  2FTK A;  2YEV A;  3K79 A;  1P84 F;  3JD1 A;  1JA8 A;  5B3S C;  1EBO A;  2JJ2 G;  3ZN0 A;  2VQE O;  3N27 A;  5FNV A;  3CMA V;  3KCY A;  1SQF A;  5H5N A;  1HNZ O;  1VQN V;  1GH6 A;  2QM8 A;  2OCH A;  2HKO A;  3E22 B;  4YIP A;  4DV2 O;  4RAI A;  5LP6 C;  2CTR A;  2GTA A;  4ICG A;  2QKC A;  4DUY O;  1PNL A;  4JZG A;  4LF5 B;  3OTO B;  2DE0 X;  3CRR A;  5EBM C;  3OUF A;  3W7U A;  2QGN A;  3JSN A;  1PPJ H;  3ASN B;  1Z5V A;  3BFR A;  1IDS A;  3UT5 A;  4WFA V;  4ZKI A;  5ITZ A;  4B7K A;  4IIJ A;  4AQY B;  1XI1 A;  2XAJ A;  4OX9 O;  1NH2 B;  4FZ0 A;  2D2C B;  2RN9 A;  1P7G A;  1K7D A;  5IYC O;  5LOV B;  4P9O A;  3VQY A;  2R9R B;  5JQG B;  4G27 B;  2WLI A;  4GCZ A;  4DUZ B;  4OPA A;  3H1I H;  1IXM A;  1ARO P;  3X2Q C;  2VQE B;  2RDC A;  1KEC A;  1SKV A;  1VIB A;  2K9P A;  4I4T B;  2Y69 C;  1HNZ B;  2ADP A;  1D5N A;  1WLE A;  1AJN A;  2GUZ B;  1QR9 A;  2UXB O;  3CCR V;  1YXB A;  1EN5 A;  5KMG A;  4DV2 B;  1AI5 A;  2V4D A;  3DC6 A;  2BCC H;  2WA4 A;  3K08 A;  4DUY B;  4H33 A;  1M1K W;  1W59 A;  5HFM A;  5JWP A;  2JGD B;  3IAY A;  5H2F Z;  1SA0 A;  4GYC B;  1ROP A;  5DED A;  3L72 H;  4P9P A;  4MVU A;  3NXS A;  2ADQ B;  5L3D A;  3CJH A;  4OX9 B;  2EIJ B;  2QJ1 A;  4J42 A;  4FM1 A;  2X6A A;  4ZI7 A;  3TET A;  1WNS A;  4J7J A;  1R73 A;  5K1X A;  4JI8 O;  3TK1 A;  5EIB C;  3CCV V;  1FFX B;  4TOI A;  1EZV H;  2PUS A;  3J7A U;  3ABK C;  3BAB A;  2AXT Z;  1OCZ C;  3RVZ A;  2NLJ C;  1M93 A;  1K34 A;  1YCI A;  2ZIO A;  1QVG U;  3R65 A;  1VQM V;  2EJ7 A;  2OTJ V;  3WB1 A;  1JMK C;  2QWP B;  2Q0O C;  3RYF B;  1VQ6 V;  5IY5 B;  2D3O W;  1U96 A;  1RP3 B;  4GZR B;  5EZY A;  2UXB B;  2M6Y A;  2BSK A;  4TV9 A;  3RBZ A;  4JZ2 A;  4O4L A;  5L3F A;  1OV9 A;  1NS1 A;  5EC2 C;  3J81 N;  1EN6 A;  3RVY A;  1M4U A;  2UXD O;  3FD9 A;  1TVK B;  3K04 A;  4BIU A;  4Q6G A;  2P90 A;  2WLJ A;  3CXH F;  4DV5 O;  4F4L A;  1N0N A;  4E2L A;  4TUY A;  3TGU H;  1AI6 A;  1AB3 A;  4PA4 A;  4JI8 B;  2OCC B;  3SJB C;  5DM6 V;  2PTM A;  3JYC A;  4RUE A;  5KAI Z;  1MSD A;  2FML A;  2YDE A;  3DTU B;  3LDC A;  1X4T A;  5C8Y A;  1GTO A;  2PF4 E;  2Q73 A;  3HKE A;  1BMF G;  5CA1 A;  3L74 H;  2PGG A;  3CRA A;  3K57 A;  3ABT A;  1SQP H;  4PI0 A;  3F7V C;  2HLD G;  4JTA B;  4UCS A;  2EIM C;  5A9G A;  4D7S A;  1I7F A;  4PDR A;  5H6R A;  5KUM A;  1B06 A;  3G71 V;  3G80 A;  4PHZ A;  5CA3 A;  1QVF U;  4WFF A;  3IFX A;  3BHP A;  4GX0 A;  2DW4 A;  2R70 A;  1FYJ A;  1P4R A;  3HKC B;  2UXD B;  1JFF B;  5D5P A;  4LH7 A;  2DJV A;  4PEL A;  3HB3 B;  4LR3 A;  2EIL C;  3FKS G;  4DV5 B;  3BRC A;  3I56 V;  1FKA O;  2QDO A;  1EFR G;  4FM2 A;  2ZIM A;  4N21 A;  5B66 Z;  1JR9 A;  3MHS C;  1M90 W;  4LNU A;  2JK5 C;  1OCR B;  1Q43 A;  3FYE B;  2CK3 G;  1XQ8 A;  1RSO B;  1L1F A;  1Y74 A;  1THZ A;  5L3B A;  1NU1 H;  3BPZ A;  2EBO A;  3CC2 V;  5L3G A;  2CUG A;  1WN7 A;  4FFB B;  1K9M W;  2PYL A;  4A5U B;  4UCU A;  4UB8 Z;  3E86 A;  1WP7 A;  4EB6 B;  2IH3 C;  4Q20 A;  2W0F C;  5A2Q N;  4JTC B;  4UB6 Z;  2ZE8 A;  4X1K A;  3TCU A;  5FLX N;  4JYA O;  3OEH G; 
#chains in the Genus database with same CATH homology
 2UXC O;  1AB3 A;  4YY3 O;  1HNX O;  4K0K O;  2UXB O;  1HR0 O;  4AQY O;  1YZB A;  4NXM O;  4X66 O;  4B3M O;  2F4V O;  3JAM N;  4LFA O;  3M8A A;  2AGA A;  3RT3 C;  5LL6 Y;  4DV6 O;  4LF8 O;  1XNR O;  3O65 A;  4JI6 O;  4JI1 O;  4DR6 O;  1AIL A;  2FKX A;  4DUZ O;  4JI4 O;  1R6T A;  5IWA O;  3R66 A;  4X64 O;  3J80 N;  2VQE O;  1XMO O;  4DR4 O;  4DR3 O;  1DK1 A;  2HHH O;  4JV5 O;  4B3T O;  2ZKO A;  5BXZ A;  2DOS A;  5LMU O;  1N36 O;  5IT9 N;  2UUB O;  1J5E O;  1X59 A;  5H5N A;  1HNZ O;  4DR5 O;  1A32 A;  4DV0 O;  1XMQ O;  4JI8 O;  1IBM O;  1FYJ A;  4JI5 O;  4LFC O;  4GKK O;  4DV2 O;  3J7A U;  4DV7 O;  2DJV A;  2E5L O;  4KHP O;  4DUY O;  4X65 O;  2UUC O;  1N34 O;  1N32 O;  3F5T A;  1XEQ A;  1G1X B;  4DR2 O;  1FKA O;  4NXN O;  4B3R O;  4DR7 O;  4LF9 O;  2UUA O;  1KUQ A;  2Z0A A;  2LW7 A;  4JI2 O;  4GKJ O;  4LF4 O;  1FJG O;  4OX9 O;  1XNQ O;  1F7Y A;  3T1H O;  1D2D A;  4YHH O;  4OPH A;  3SDL A;  2VQF O;  1N33 O;  4DR1 O;  2ZM6 O;  2UU9 O;  1NS1 A;  2JRI A;  4JI3 O;  4A5U B;  5BY1 A;  3J81 N;  5BR8 O;  1I94 O;  4X62 O;  2UXD O;  5LMN O;  1IBL O;  5A2Q N;  4LF7 O;  4OPA A;  4DV4 O;  4B3S O;  4LF5 O;  3OTO O;  5FLX N;  3T1Y O;  4LF6 O;  4DV5 O;  4JI7 O;  1IBK O;  4JYA O;  4LFB O;  1HNW O;  4JI0 O;  2N74 A;  4DV1 O;  4DV3 O;  1R1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...