4JI1O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4ji1O00
2UUBO 1NS1A 5BXZA 1N32O 4LF7O 4OPAA 5BY1A 4NXMO 4DUYO 3J80N 1D2DA 4DUZO 2VQEO 3F5TA 1IBLO 4OX9O 1J5EO 4GKKO 4X66O 5A2QN 4LF8O 2FKXA 1A32A 5LL6Y 1XMOO 4DV4O 2JRIA 4DV0O 2ZM6O 4DV5O 4LF9O 2ZKOA 4JI0O 4NXNO 2Z0AA 4DV6O 1XEQA 4LF5O 3J7AU 1KUQA 2N74A 4JI4O 2UXDO 3T1YO 4B3SO 1AB3A 3RT3C 4A5UB 1FJGO 4DR2O 4DR3O 4B3TO 3R66A 2LW7A 1FYJA 4JI5O 4JV5O 4OPHA 4DR6O 1HNWO 4DV2O 2VQFO 1HR0O 4DV7O 1XMQO 2AGAA 1N34O 1AILA 4DR4O 5IT9N 2F4VO 1R1BA 4YHHO 4LF6O 3T1HO 4JYAO 2DJVA 5H5NA 1N36O 1R6TA 4AQYO 1FKAO 4DR7O 5IWAO 4JI8O 4X62O 4JI1O 4JI7O 4B3RO 1G1XB 2UUAO 4LFAO 5LMNO 5BR8O 4LF4O 1I94O 4DV3O 4LFBO 4DV1O 1F7YA 3OTOO 1IBKO 2UXCO 3SDLA 4GKJO 3O65A 2UUCO 2HHHO 1HNZO 4B3MO 4X64O 1X59A 2DOSA 4JI3O 4DR5O 4YY3O 3J81N 1DK1A 1IBMO 4KHPO 5FLXN 2UXBO 1N33O 4K0KO 4LFCO 1XNRO 1XNQO 5LMUO 2UU9O 2E5LO 1YZBA 4X65O 3M8AA 4JI2O 4JI6O 1HNXO 4DR1O 3JAMN
chains in the Genus database with same CATH superfamily
3K57A 4IL6Z 4BW5A 4X65B 1AI5A 2GDSA 2ZDIA 1M90W 4LH6A 1VQ4V 3IAYA 1I08A 1LUWA 4JI4B 3RN4A 3D36C 5IYBO 3HKDA 1FD9A 5KA5A 3K5LA 1SC5B 2LO1A 4YJ2A 2GHYA 1KECA 5B1BB 1GO3F 4NTYA 1B6QA 4TUYA 1AJNA 4X20A 4XDKA 2ZKOA 2HHHB 4LNUB 2QM8A 1BMFG 1M57C 3N27A 3JASB 1V54C 3RT3C 5LHGA 3JD2A 2Y0IA 3UO2A 2HKOA 3M99B 3O9OA 3IGAC 3SYAA 5GONA 4IT5A 1K7DA 2E75B 2AGAA 1XMQO 5LHIA 5CMUA 3GB7C 2PF4E 3CSXA 2K9PA 3KCYA 1VQPV 4DR4O 3L75H 3SJAC 4DW0A 1N0NA 4JAAA 4IIJA 1FXHA 5LMNO 4LFAO 1J5EB 1Y76A 5JQGA 1DGSA 3RYIB 1Y67A 2YXLA 2GTAA 1OHHG 3B4SA 4X8AA 2UXCO 1ZSPA 1Y76B 5JQGB 3MDSA 1GN3A 1ZL8A 4JAUA 3SPCA 2FTKA 5KHHA 2AHYA 1KU9A 3Q4HB 4YHHB 1SQPH 4MW3A 1PPJH 3BA8A 3CCVV 2DWEC 1SA0B 3Q4HA 2E5LO 1CXZB 2A0LA 1M56C 4JI2O 4O4HB 3OFNG 2CGOA 1Y74A 3JAMN 1GN4A 4H0LB 3OR6C 1JCHA 3ZS8C 4NTWA 2IM9A 3G80A 3F5TA 2F4VB 2Q67A 5IJ0B 2Y69C 1BCCH 4GUNA 2P7TC 4DV0O 1WAZA 1B04A 2VS0A 1OCCB 5LOVA 2EBOA 2K1EA 2OT5A 2A9HA 4QE7A 3JATA 2CE4A 4A5UB 3ASNC 3H1KH 3HKEA 1BGYH 2P5OA 2ZINA 1K5QA 4MVSA 3JATB 5ITZB 5IYCO 1AR4A 2YSUB 4DV2O 3OGIB 3SPIA 3DTUB 4KUMA 3H9VA 4RQFA 2F4VO 3ZMUA 3BY6A 1IBMB 1PL0A 2PGGA 1LNQA 1SQFA 3H1LH 2YUAA 1MZFA 1N0JA 4FLTA 4DV0B 5H5NA 4DR5B 4DR3B 3K58A 4B3RO 4GX1A 4JI2B 2Z5UA 1MA1A 3KZIZ 4FLUA 3L71H 2A7WA 1VQKV 4CH6A 4PI2A 1F7YA 4LH7A 5B1AB 4UCRA 1JFFB 2UUCO 1VIBA 3CB2A 2EULA 3L72H 3AG3C 1SZXA 4C7UA 2P67A 3AG3B 2UXCB 2LGQA 1XI1A 4B7KA 1GM7A 4JYBA 3ZMZA 4Q20A 5B1NA 4DUZB 5LGTA 1Y4MA 4I0XB 2Y4TA 5BZBA 1OCOC 4X65O 3KG2A 1CPYA 4DR1O 2JGDB 2AZ2A 2CTRA 2WPDG 1VQ8V 1XNQB 3UKMA 1EBOA 1EFRG 1SETA 4PA4A 4W4KA 3RVYA 4JI0B 1MABG 1BZKA 2AW9A 4U7OA 4HNAA 4JI3B 4WF9V 5J2TA 1EZVH 2HJDA 4Q6GA 1NQTA 2H3OA 4HNAB 4O4JB 3ABKC 4J7ZA 1DTOA 3JD1A 3JCUZ 5CA0A 5CBHA 4F6EA 4PD4F 1K34A 1SKVA 5KMGB 1K73W 1WA8A 3R66A 3IC7A 1HR0O 2YIBD 3FB8C 4GT1A 3ZRXA 3K5MA 1OCOB 2VQEB 3ABMB 2LJ2A 3CXHF 1AI6A 2EINB 1FKAO 1N36O 1R6TA 4JZ2A 2V4DA 2QWQB 2RMKB 4EKWA 4FLXA 4ABMA 5H2FZ 1K92A 1U97A 1WP8A 3T1YB 1S77D 1IDSA 2EIKC 4LFBB 1N8RW 1WLEA 3D8CA 1M4UA 3GVMA 3RVZA 3KKYA 3CEIA 1NKDA 4J42A 4I50B 4MVUA 1MOFA 1KC8W 1VF6A 2Y48A 3ZJZA 4TUYB 1RP3B 3CRCA 3DGEA 4WFHA 1JPXA 2JEUA 1ZX3A 5D5QA 4NXMB 3N2GA 3CPWU 3BABA 3AG1C 2YC0A 4K35A 1BL8A 4RWUA 2UUAB 2PYLA 2WLLB 4JI6B 5IWAB 2QWNB 4X1YA 5BXZA 1N36B 2DYSB 2XTAA 5JCOA 5FL7G 4WFAV 5A2QN 2X6BA 1JMKC 3QO7A 3K5OA 5LGNA 1PP9H 3E22A 1JJ2U 1K9MW 1SQXH 3E83A 5KUMA 2IU3A 5B66Z 2YICA 1QLEC 3BCCH 4F4LA 4HYOA 2W6IG 4AHCA 2Z0AA 3I5DA 4DYLA 3CC7V 4BR6A 4FM0A 3PN1A 4Z2WA 1LR1A 2ITDC 4BIZA 1QBZA 2IJHA 2XAHA 3FB7C 3OAAG 4FZ0A 1PD3A 1FYJA 1PNLA 3B2EE 4DR6O 1I7FA 4CZZA 3B8NA 5KUKA 1OV9A 1QNMA 3ABUA 3W7UA 3L70H 2B9ZA 3T2MA 2ZDIC 5CA3A 1BQ0A 4ASUG 3ABLC 2B1GA 4FMTA 2Y69B 3S3XA 3JAKB 3OD4A 4EFEA 4X62O 4FLZA 1X4TA 1FFXB 2KKWA 4QE9A 5FPRA 4LFBO 1NZ6A 5B3SC 2GV9A 1H2SB 4DV6B 4MTOA 1N33B 2CTQA 3H1JH 5E79Z 1ZTEA 3U0ZA 4J7KA 3B77A 3CHXA 1NTKH 1Q90D 3JARA 5JH7B 1NBMG 4BIOA 5LHHA 1NU1H 1F51A 2Q9LA 1W0KG 3ETQA 1IZ3A 2Z3YA 5LMUO 3D3IA 5H9CA 1HNXO 4CC6A 1TAEA 1FJGB 1XNRB 2Q73A 1Y66A 4JF3A 1G8MA 4E4EA 1BSMA 4X66O 1XQ8A 4IIJB 2WWWA 1EZJA 2KG7B 4MW8A 2QWOB 5D5PA 4DV2B 3NXSA 3D36A 2QKCA 4JYYA 4U7NA 4JI0O 2BE3A 4J9YB 3APQA 1Q43A 1YJNV 1K33A 2BSKB 4X88A 3LDDA 3B8MA 1K5SA 3VQWA 1M1KW 1K4CC 2VWJA 1H38A 2QA4V 2YXHA 2QJ1A 5FNVB 3AG2C 3JASA 2HVJC 3K04A 1Q5OA 1N34O 3GWKC 5FNVA 5GTHZ 3TGUH 2FB5A 1BQZA 2JEXA 4LR3A 4KL1A 1SQGA 4X66B 3BAAA 5L3DA 1P7BA 4TQDA 3IFXA 2X0LA 4BAYA 4FK5C 5DECA 4X64O 4B3MO 2DYRC 2EINC 3ZBHA 5IY5B 4AQYB 3ETGA 5L3FA 3LSSA 1VQNV 2M7WA 1AJQA 4GYCB 5LP6C 3OEEG 4LF8B 2FL4A 4WCEV 4K8ZA 3RW0A 3ZRVA 2OIEA 1XNRO 4WFFA 1PKXA 1Z2GA 4FJCC 2GBOA 4H13B 2MW2B 1Z5VA 1J5EO 2ITCC 1HDJA 1XMOO 4CS3A 2EIJB 4G27B 4MVZA 1AVMA 3CCLV 4O2AA 4LC1A 4PELA 2LFSA 4DR2B 3E8HA 1ENVA 5EYPA 1YCIA 2CK3G 3RFRA 2EZOA 1KUQA 2N74A 3E8BA 2IBZH 2A06H 3OR7C 3CRQA 1FJGO 1P7GA 3JAWB 1QU7A 1VQ7V 1NI8A 4DR7B 1HNXB 1XILA 1NTZH 3G67A 4NYKA 1KD1W 1P4RA 3RYCA 2JVDA 3JAWA 4LFCB 1S76D 1TUEB 2YI9A 4IHJB 1Q8IA 2WA3A 4J10A 3LDEA 3OMNB 3IC9A 5IT9N 4KHPB 4LF6O 4JASA 4J9ZB 4PHZA 4IYHA 3DXRA 1W59A 3WB0A 4L8JA 4LBEC 4N23A 5KA6A 5C93A 4DV1O 3A0HZ 5H6RA 1GKFA 4LFAB 1HNZO 4TV8B 5GTIZ 2ZT9B 3CYOA 1OJHA 1PNKA 4E2LA 1IBKB 2P4KA 4IGGA 1COWG 1Q6UA 1SQQH 1JA8A 1XMQB 5IDJA 2RNBA 4DW1A 4JV5B 1FFTB 2DQ0A 2VRZA 3SYQA 2UUBO 2WSSG 4I7ZB 3VQYA 1NT2B 4LF7O 4OPAA 3FAVA 1XHZA 2PUSA 3VOUA 2QWRB 2WLKA 1V55B 5BMVA 1VQLV 2WLJA 5FPOA 2CGNA 5EIBC 2Q7EA 2Q7HA 3FB6C 2GUZB 2XAQA 4GX0A 1AI4A 4R7CA 2KSDA 2ZXWB 3ABKB 3T1YO 3ABMC 3TCUA 4FZ1A 1YTFD 2CUGA 2P4VA 4MVQA 4AI8A 2KQXA 2RDCA 5GW7A 1K3EA 4PDMA 4JV5O 3H1IH 1XHXA 3F7YC 5KMGA 1FPOA 1XL4A 3I56V 3CP1A 4R6ZA 4LNUA 3VBBA 5KHGA 2PI4A 4MVRA 2FYUH 4YIPA 4LF7B 4ZI7B 4JYAO 1RM1C 5B1BC 4ZKIA 5L3EA 1D5NA 4GLXA 3VQXA 1GN2A 2QR4A 5DN6G 4H33A 3C90A 1KYOF 1CEZA 3O65A 1GN6A 4O4LA 4JI3O 3BA9A 2CH7A 3RWRD 4EB6A 1R3LC 4DK0A 4LF6B 4CH3A 4KHPO 3OUFA 1NVPD 2OCCC 5HFLA 2IJJA 4MTGA 4DV7B 2ZE8A 4ZOLA 2ZIOA 3PJSK 2OTLV 2UU9O 2B1IA 1PV0A 4CC5A 2Q68A 3STLC 4DXWA 3P30A 2UUCB 1NS1A 1N32O 3AK1A 3K9SA 3CJHB 4FFKA 3RBZA 4ZI7A 2HEPA 5KX5A 1M57B 3ML0A 1WPXA 4GKKO 5GONB 3RYFA 4UCSA 5LL6Y 3CJHA 3OTFA 2V7QG 3W7XA 4JI8B 2ZIMA 4RQEA 1M56B 4UUJC 4H44B 2ZM6O 1VQ9V 3H01A 1SF9A 2QKAA 1N4CA 3CS5A 2XASA 3G71V 1XMOB 3ZX6A 4I55A 4NR1A 1Y74B 3E8FA 4EEQA 1HNWB 1WNSA 3APOA 3CXCU 4B3TO 1QVGU 1S3JA 4OPHA 4P30A 3NR7A 1GM9A 2B5UA 2RN9A 3D3QA 3OMIB 4LWSA 2OYQA 2QEXV 1KB9F 3BEHA 4UCOA 3K3WA 5KLVH 4O2BA 4UVCA 3E89A 3OW2U 2DJVA 4NB5A 4B3TB 1YF2A 4X64B 3U10A 1S5LZ 5JJEB 2P90A 1QCEA 2ADPA 3LNNA 3WB1A 3HKEB 4O2BB 5DM6V 2EJRA 2JS3A 2XHBA 3K06A 3E35A 3JD0A 5LP6A 4UXNA 1QLEB 1IXBA 4GX2A 4GX5A 4DR5O 4YY3O 1AI7A 4YJ3B 1VF5B 1R3KC 3DSQA 5LP6B 5IJ9A 2H8PC 3P3NA 4UVAA 1ORQC 4J7JA 3ZCCA 3JCZA 4UV8A 1N34B 3A8TA 2ODMA 4FM2A 2LW1A 4RUFA 2F95B 5A9GA 2GTSA 1JVMA 3B09A 4MT8A 4O4JA 5H6QA 1JFFA 3JSNA 5LMUB 4G2KA 1TVKA 2HR3A 3STZC 4QNHB 1F4NA 1FAFA 2UXBB 3FB5C 3FX7A 5LMNB 5EIBD 3EHBB 5KHIA 4LF9B 3E86A 2PY5A 1YHQV 4H37A 3DXRB 4NXNO 1QLNA 2ZNIA 2EILB 4DV6O 3QF7A 1XEQA 3ZMTA 2JK5C 2P6JA 4GZRB 3RYHB 2RQ6A 4UVBA 2QWPB 3ETDA 3ZHSA 3MD0A 4JTAB 1Z5WA 2WA4A 3B40A 1HNWO 2IJKA 5EBLC 3AK3A 1EN4A 2DYSC 4I50A 3UQ8A 3K0GA 1F4MA 1Q7YW 1FS0G 3X2QC 2R72A 5K1PA 1NH2B 1AR1B 3JALA 4N21A 1P84F 4BIUA 4I0XA 3T4DA 3UT5B 2DQ3A 3ZIAG 3JALB 1WA8B 1US6A 1K8AW 2ZCEA 3UT5A 4FFBB 1OCZC 2HHHO 2ZNJA 4MVMA 2DOSA 5LBQA 5CBFA 2AHZA 4L87A 1THZA 3ETEA 4FFBA 5EC1C 2EIMB 4DR4B 1N33O 1H2LA 4GCZA 5J2TB 2YEVA 5E1AC 4F6RB 3QTCA 4PA7A 3A2FA 3M8AA 3RYCB 4JI6O 2XAGA 3AK2A 2LQTA 1RM1B 4B7EA 1VQOV 3J80N 2ZXWC 3TK1A 1VF7A 4FM1A 4NTXA 3BVOA 4JYAB 5CA1B 1YITV 1PL4A 2C2AA 4DV5O 2VWKA 2LGWA 2M6YA 4QPKA 2XAJA 2E3CA 1SQBH 3F5WC 4KXRA 3HR0A 1O9GA 1QVFU 4WFEA 3JAKA 2E74B 1MG1A 4ICGA 5EYPB 1CP9A 2PTMA 1VEWA 1YTFB 4I5SA 3ASOC 2R9IA 5EBMC 3M7MX 3KCXA 4XDLA 3R65A 1L0NH 2Y4UA 2N05A 4X89A 3CCSV 5JCOC 4TQFA 1L1FA 2P06A 4X1KB 4DV5B 1HW7A 5K1XA 4DR7O 2UUBB 2QSAA 1LUVA 5IWAO 2HVKC 2HJFC 4XDJA 1D5AA 4J80A 5TISZ 1G1XB 4GKJB 4D7TA 1V9PA 3FKSG 4OXSA 1ROPA 4UCTA 4CS4A 4UCVA 1MMMA 3L74H 5BR8B 4GKJO 3SPGA 3H1HH 4UCUA 1XUQA 5JVDB 3K79A 4U3JB 5CB4A 1E1QG 1Q6IA 4X1IB 1URFA 3CMEV 1HNZB 3ZHUA 5IYDO 2UXBO 5JWPA 4TV8A 3P32A 5L3GA 1ZUQA 1BE3H 1IXMA 1NR7A 5F2VO 1H8HG 3I55V 4X1IA 4I55B 2Q5ZA 1YZBA 3UCSC 2QE7G 4Z1MG 4JI5B 2IJIA 2BSKA 2WLNA 3SYCA 1IURA 1M5IA 4DV1B 4ZIBA 1V54B 4WFBV 5KAFZ 1U96A 2BTQA 4LF8O 5DEDA 3FAVB 3SPHA 2O57A 1GRJA 2Y0PA 3A0RA 1OCRB 4NVPA 1OCRC 5J2UA 1SA0A 4O4LB 1IBLB 3S3WA 1FFXA 2OTJV 1S5HC 4O4HA 1UJWB 3OGCC 2BTOA 2XAFA 1VQ5V 1UPGA 3THOA 4DR2O 2AXTZ 2QTSA 1AP6A 4DRXB 2P22C 2KG7A 2VQFO 2JJ2G 1T5EA 5IJ0A 4DV4B 3GWOA 3HKBA 2JS5A 2F66C 2XOKG 4YJ3A 1VP7A 4QIWF 3SYOA 4DRXA 4JGSA 2F23A 5EZYA 1KBHA 3HKBB 3ZMVA 1E1RG 2BTQB 3EFFK 3ZN1A 1QQCA 1AJPA 3TJTA 2JIZG 1IX9A 4UV9A 5IYZA 2HP8A 4B3SB 2W0FC 2IH3C 3FD9A 5EZYB 2DMXA 4DUYB 3WB2A 4LF5B 1HWYA 1H2KA 4XBFA 1TVKB 1KKDA 2LP7A 1NJIW 3LNMB 4JTCB 1H8EG 3W7WA 3ABTA 3JYCA 1L0LH 5IY5C 3C3SA 1IBMO 3WU2Z 4B3MB 3TXSA 2CH7B 4EB6B 4K0KO 2X7RB 4PDVA 5B1OA 2ADQB 3BFRA 2R70A 2JJ1G 5LOVB 1WP7A 4UFZA 3X2QB 3CRAA 4PDRA 3ZHVA 3HB3B 3RYHA 2YIBA 4J11A 2UU9B 2DN9A 1TUBA 5J9PC 3W7SA 3MHSC 4TSFG 1XOUA 2D3OW 2EIMC 2L35A 1A32A 4DV4O 1WPBA 1RSOA 1TUBB 3K59A 1Q82W 2EIJC 1WB7A 3WG7C 1YXBA 4EFBA 3HKCB 1OCCC 2Q8VA 3OUSA 1RPRA 3HPLC 5LGUA 4TT3G 3MHHC 1Q3EA 4O4IA 2ZE7A 4WBNA 3SJQC 4JYCA 2ILMA 2A79B 1JJOA 1GK9A 3L73H 1AILA 2ZR2A 1XL6A 2ARHA 1W0JG 5B1AC 1R1BA 1V55C 5LYJA 4YHHO 3A0BZ 2F93B 3SYPA 2F1MA 3LDCA 2ZM6B 4YY3B 2F43G 1WJZA 2YEVB 3EXAA 2EJ7A 3W7TA 1KQSU 2E5LB 1I94O 4IYIA 2YXYA 1B3QA 3SDLA 2NN4A 3N2KA 1X59A 4OGQB 4MS2A 3G6BA 3QO5A 3BRCA 1BT8A 2EZPA 2EX3A 3CRMA 2GUZA 2X6CA 3ASNB 4MVOA 2EIKB 4I4TA 2WLHA 1YJ9V 2PZSA 4DO2A 4JAVA 4TOIA 1YDXA 4MSWC 4X62B 3P3PA 5LYJB 1XBLA 4P9OA 4FIPC 4NXMO 1IBLO 2QM7A 4HAMA 4PDLA 5LA6A 2W0XA 3FYIB 2XUMA 1L8DA 1YJWV 5EK0A 5LA6B 1R6NA 4PJ0Z 3SGIA 4PA3A 2Q6AA 4GKKB 2JGDA 4JI4O 4DV3B 2QKSA 3LSUA 1O9HA 1SS3A 4LP8A 3OM3B 4K8XA 5IE9A 1XREA 1SZTA 3CE2A 2CTPA 1JR9A 1R73A 4U3JA 3U11A 1KMIZ 2Q4PA 3EVKA 2ZE5A 1HR0B 1AR5A 4NKGB 2Q69A 1RFYA 2YDEA 3TETA 3SPJA 3HKDB 1NR1A 1Q86W 1KP3A 2V1DA 4YJ2B 1DF4A 3RGBA 2OCHA 4ZOLB 1S72V 1R6KA 2R9RB 1SQVH 1ZL8B 4RAIA 4X20B 4X9QA 4DV3O 2OWOA 1S0VA 2IU0A 3CCMV 1Y6XA 4CH4A 1OCZB 2QM4A 2ZQMA 1IBKO 2HLDG 1VMGA 1BS3A 5KX5B 1SESA 3UO3A 4QGPA 1FXKB 1FXKC 3J81N 1BHAA 4PV1B 1VQ6V 4CBCA 3CMAV 3ZHTA 1K4DC 1ZAUA 5J2UB 5EBWC 3AG1B 5L3CA 1XNQO 1EM1A 1MZEA 4FVMA 4FLVA 2AZ0A 1EN5A 5BY1A 4HZ3A 5C8YA 3OT7A 4DUZO 4FLWA 2VQEO 2OCCB 1R3JC 4FPPA 3QVNA 5JH7A 3CCUV 3CCJV 5B3SB 2JRIA 3K0DA 2PYJA 3FFQA 3E2EA 4LWSB 2Q7GA 1AP5A 1GTOA 4TV9B 3C3TA 1FXKA 2BOCC 4OX9B 2WLLA 3ZEDA 1YEWA 2HG5C 1FXVA 1YVWA 4FLYA 4NXNB 1AROP 4DR3O 2YI8A 2JDIG 3DC5A 5KAIZ 3RYFB 2W6JG 3ICXA 2GSMB 3AG2B 3TXQA 3ZRWB 4KP4A 2DWDC 3K03A 4R50A 5KHJA 3T4ZA 1H2GA 3AEIA 4PI0A 2EILC 1I5XA 2A3QA 3T1HO 1SERA 1NH2D 1OZ0A 3QO8A 4DR1B 4JI1O 1GMGA 3QNEA 4CS2A 3WG7B 4LF4O 3CCEV 1WN7A 2CAZC 3K5NA 2G38A 3WFVA 1ZWIC 5EC2C 5CBGA 1I94B 3BHPA 4G28B 4TV9A 2L6LA 4KFMA 2D2CB 2PI5A 3OMAB 5AG2A 3MAQA 4AILC 2RCVA 1B06A 4D6TH 4LFCO 5ITZA 1UFIA 1PNMA 1ZLZA 3ZRWA 4Z1VA 4DK1A 2QGNA 3RYIA 1GH6A 2R9AA 4I9WA 2WLMA 4I9QA 4DUYO 5B5EZ 4B08A 1TGOA 1EN6A 1M93A 3ABLB 1YIJV 2NR5A 4JTDB 4B3RB 3JSLA 1MSWD 2FMLA 5CN0A 2YIAA 3JD4A 4ZBMA 4LF9O 5CA0B 3ZHRA 4LF5O 3J7AU 4MTXA 2Q0OC 1F23A 3JD3A 4UB8Z 4B3SO 3ZHQA 1AB3A 3ZRSA 3LSQA 2NLJC 5HFMA 2IH1C 1KP2A 1BHBA 3LUTB 4BWAA 4HBNA 1DF5A 1JX9A 4W4LA 3CCQV 3AG7A 4UB6Z 5LXTA 4K0KB 1MSDA 3IJ4A 4RUEA 5IJ9B 2BCCH 1N32B 5LXTB 4AQYO 2WLIB 4I4TB 4JI8O 2E76B 2WAMA 2ZD9A 3G6EV 2ZE6A 2QTOA 1M9NA 2X6AA 4WFGA 2WLIA 4JZGA 2CTWA 2DYRB 3HKCA 1JOYA 1GM8A 3FYEB 3CC4V 5IYZB 4JI1B 1Q81W 2YS8A 2QDOA 2N04A 2BOBC 1R3IC 4IHJA 3T1HB 1RPOA 3N2GB 1NVPB 4TWKA 2NNUA 4P9PA 2MK3A 1H2MA 1I5YA 2OIGA 4P2ZA 2VQFB 5JJJB 4LF4B 4JPRA 3G4SV 1Q6HA 3SJCC 4PA6A 1QR8A 3OE7G 1KKCA 4K3AA 4YIOA 3E22B 1K97A 1D2DA 4OX9O 1JQ0A 2CDYA 3CD6V 1G6UA 4RO2A 5KHKA 3BPZA 2FKXA 3ZN0A 2ATKC 2YIDA 2UXXA 4U3FH 2DW4A 4CH5A 3SR2C 4F6RA 4QPJA 3ZMSA 1RSOB 3OTOB 5L3BA 4QJFB 3F7VC 1QHTA 2UXDO 1MNGA 3SJBC 1I0HA 3T1CA 2UXNA 2XNDG 2LW7A 4BW9A 3K9AA 4JI5O 2XT9A 3E8GA 1PM9A 1VQMV 3CCRV 4R8CA 4DV7O 1G4YB 4O4IB 1W2BU 1SRYA 2KB1A 4X1YB 4O2AB 5JVDA 4WBNB 5CB4B 1HP8A 3QG5A 4YXWG 1E79G 3CWBH 4J41A 1IVSA 3CRRA 4JI7O 1VARA 3VQVA 1YI2V 1WB8A 2UUAO 1XDCA 5BR8O 2ETNA 1P49A 2HFEC 3ASOB 3AG4B 1QR9A 3JARB 2UXDB 1DLBA 3OTOO 2RJZA 5C8YB 2H94A 2JGUA 3DC6A 1GAXA 1H2NA 4PA9A 3CC2V 4MTFA 1TA8A 4ZHQB 1YSCA 3OEHG 2LFRA 4D7SA 5BMVB 3UM7A 1DK1A 5CA1A 3N2KB 1S5JA 4LCUC 5FLXN 1J95A 4X1KA 2IW5A 1VF6C 2DE0X 2Q0AA 4ZHQA 3K08A 3L9DA 3AG4C 4DR6B 1NTMH 3CX5F 5JJNB 2ZR3A 4JI7B
chains in the Genus database with same CATH topology
2UUBO 1NS1A 5BXZA 1N32O 4LF7O 4OPAA 5BY1A 4NXMO 4DUYO 3J80N 1D2DA 4DUZO 2VQEO 3F5TA 1IBLO 4OX9O 1J5EO 4GKKO 4X66O 5A2QN 4LF8O 2FKXA 1A32A 5LL6Y 1XMOO 4DV4O 2JRIA 4DV0O 2ZM6O 4DV5O 4LF9O 2ZKOA 4JI0O 4NXNO 2Z0AA 4DV6O 1XEQA 4LF5O 3J7AU 1KUQA 2N74A 4JI4O 2UXDO 3T1YO 4B3SO 1AB3A 3RT3C 4A5UB 1FJGO 4DR2O 4DR3O 4B3TO 3R66A 2LW7A 1FYJA 4JI5O 4JV5O 4OPHA 4DR6O 1HNWO 4DV2O 2VQFO 1HR0O 4DV7O 1XMQO 2AGAA 1N34O 1AILA 4DR4O 5IT9N 2F4VO 1R1BA 4YHHO 4LF6O 3T1HO 4JYAO 2DJVA 5H5NA 1N36O 1R6TA 4AQYO 1FKAO 4DR7O 5IWAO 4JI8O 4X62O 4JI1O 4JI7O 4B3RO 1G1XB 2UUAO 4LFAO 5LMNO 5BR8O 4LF4O 1I94O 4DV3O 4LFBO 4DV1O 1F7YA 3OTOO 1IBKO 2UXCO 3SDLA 4GKJO 3O65A 2UUCO 2HHHO 1HNZO 4B3MO 4X64O 1X59A 2DOSA 4JI3O 4DR5O 4YY3O 3J81N 1DK1A 1IBMO 4KHPO 5FLXN 2UXBO 1N33O 4K0KO 4LFCO 1XNRO 1XNQO 5LMUO 2UU9O 2E5LO 1YZBA 4X65O 3M8AA 4JI2O 4JI6O 1HNXO 4DR1O 3JAMN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUB O;  1NS1 A;  5BXZ A;  1N32 O;  4LF7 O;  4OPA A;  5BY1 A;  4NXM O;  4DUY O;  3J80 N;  1D2D A;  4DUZ O;  2VQE O;  3F5T A;  1IBL O;  4OX9 O;  1J5E O;  4GKK O;  4X66 O;  5A2Q N;  4LF8 O;  2FKX A;  1A32 A;  5LL6 Y;  1XMO O;  4DV4 O;  2JRI A;  4DV0 O;  2ZM6 O;  4DV5 O;  4LF9 O;  2ZKO A;  4JI0 O;  4NXN O;  2Z0A A;  4DV6 O;  1XEQ A;  4LF5 O;  3J7A U;  1KUQ A;  2N74 A;  4JI4 O;  2UXD O;  3T1Y O;  4B3S O;  1AB3 A;  3RT3 C;  4A5U B;  1FJG O;  4DR2 O;  4DR3 O;  4B3T O;  3R66 A;  2LW7 A;  1FYJ A;  4JI5 O;  4JV5 O;  4OPH A;  4DR6 O;  1HNW O;  4DV2 O;  2VQF O;  1HR0 O;  4DV7 O;  1XMQ O;  2AGA A;  1N34 O;  1AIL A;  4DR4 O;  5IT9 N;  2F4V O;  1R1B A;  4YHH O;  4LF6 O;  3T1H O;  4JYA O;  2DJV A;  5H5N A;  1N36 O;  1R6T A;  4AQY O;  1FKA O;  4DR7 O;  5IWA O;  4JI8 O;  4X62 O;  4JI1 O;  4JI7 O;  4B3R O;  1G1X B;  2UUA O;  4LFA O;  5LMN O;  5BR8 O;  4LF4 O;  1I94 O;  4DV3 O;  4LFB O;  4DV1 O;  1F7Y A;  3OTO O;  1IBK O;  2UXC O;  3SDL A;  4GKJ O;  3O65 A;  2UUC O;  2HHH O;  1HNZ O;  4B3M O;  4X64 O;  1X59 A;  2DOS A;  4JI3 O;  4DR5 O;  4YY3 O;  3J81 N;  1DK1 A;  1IBM O;  4KHP O;  5FLX N;  2UXB O;  1N33 O;  4K0K O;  4LFC O;  1XNR O;  1XNQ O;  5LMU O;  2UU9 O;  2E5L O;  1YZB A;  4X65 O;  3M8A A;  4JI2 O;  4JI6 O;  1HNX O;  4DR1 O;  3JAM N; 
#chains in the Genus database with same CATH topology
 3K57 A;  4IL6 Z;  4BW5 A;  4X65 B;  1AI5 A;  2GDS A;  2ZDI A;  1M90 W;  4LH6 A;  1VQ4 V;  3IAY A;  1I08 A;  1LUW A;  4JI4 B;  3RN4 A;  3D36 C;  5IYB O;  3HKD A;  1FD9 A;  5KA5 A;  3K5L A;  1SC5 B;  2LO1 A;  4YJ2 A;  2GHY A;  1KEC A;  5B1B B;  1GO3 F;  4NTY A;  1B6Q A;  4TUY A;  1AJN A;  4X20 A;  4XDK A;  2ZKO A;  2HHH B;  4LNU B;  2QM8 A;  1BMF G;  1M57 C;  3N27 A;  3JAS B;  1V54 C;  3RT3 C;  5LHG A;  3JD2 A;  2Y0I A;  3UO2 A;  2HKO A;  3M99 B;  3O9O A;  3IGA C;  3SYA A;  5GON A;  4IT5 A;  1K7D A;  2E75 B;  2AGA A;  1XMQ O;  5LHI A;  5CMU A;  3GB7 C;  2PF4 E;  3CSX A;  2K9P A;  3KCY A;  1VQP V;  4DR4 O;  3L75 H;  3SJA C;  4DW0 A;  1N0N A;  4JAA A;  4IIJ A;  1FXH A;  5LMN O;  4LFA O;  1J5E B;  1Y76 A;  5JQG A;  1DGS A;  3RYI B;  1Y67 A;  2YXL A;  2GTA A;  1OHH G;  3B4S A;  4X8A A;  2UXC O;  1ZSP A;  1Y76 B;  5JQG B;  3MDS A;  1GN3 A;  1ZL8 A;  4JAU A;  3SPC A;  2FTK A;  5KHH A;  2AHY A;  1KU9 A;  3Q4H B;  4YHH B;  1SQP H;  4MW3 A;  1PPJ H;  3BA8 A;  3CCV V;  2DWE C;  1SA0 B;  3Q4H A;  2E5L O;  1CXZ B;  2A0L A;  1M56 C;  4JI2 O;  4O4H B;  3OFN G;  2CGO A;  1Y74 A;  3JAM N;  1GN4 A;  4H0L B;  3OR6 C;  1JCH A;  3ZS8 C;  4NTW A;  2IM9 A;  3G80 A;  3F5T A;  2F4V B;  2Q67 A;  5IJ0 B;  2Y69 C;  1BCC H;  4GUN A;  2P7T C;  4DV0 O;  1WAZ A;  1B04 A;  2VS0 A;  1OCC B;  5LOV A;  2EBO A;  2K1E A;  2OT5 A;  2A9H A;  4QE7 A;  3JAT A;  2CE4 A;  4A5U B;  3ASN C;  3H1K H;  3HKE A;  1BGY H;  2P5O A;  2ZIN A;  1K5Q A;  4MVS A;  3JAT B;  5ITZ B;  5IYC O;  1AR4 A;  2YSU B;  4DV2 O;  3OGI B;  3SPI A;  3DTU B;  4KUM A;  3H9V A;  4RQF A;  2F4V O;  3ZMU A;  3BY6 A;  1IBM B;  1PL0 A;  2PGG A;  1LNQ A;  1SQF A;  3H1L H;  2YUA A;  1MZF A;  1N0J A;  4FLT A;  4DV0 B;  5H5N A;  4DR5 B;  4DR3 B;  3K58 A;  4B3R O;  4GX1 A;  4JI2 B;  2Z5U A;  1MA1 A;  3KZI Z;  4FLU A;  3L71 H;  2A7W A;  1VQK V;  4CH6 A;  4PI2 A;  1F7Y A;  4LH7 A;  5B1A B;  4UCR A;  1JFF B;  2UUC O;  1VIB A;  3CB2 A;  2EUL A;  3L72 H;  3AG3 C;  1SZX A;  4C7U A;  2P67 A;  3AG3 B;  2UXC B;  2LGQ A;  1XI1 A;  4B7K A;  1GM7 A;  4JYB A;  3ZMZ A;  4Q20 A;  5B1N A;  4DUZ B;  5LGT A;  1Y4M A;  4I0X B;  2Y4T A;  5BZB A;  1OCO C;  4X65 O;  3KG2 A;  1CPY A;  4DR1 O;  2JGD B;  2AZ2 A;  2CTR A;  2WPD G;  1VQ8 V;  1XNQ B;  3UKM A;  1EBO A;  1EFR G;  1SET A;  4PA4 A;  4W4K A;  3RVY A;  4JI0 B;  1MAB G;  1BZK A;  2AW9 A;  4U7O A;  4HNA A;  4JI3 B;  4WF9 V;  5J2T A;  1EZV H;  2HJD A;  4Q6G A;  1NQT A;  2H3O A;  4HNA B;  4O4J B;  3ABK C;  4J7Z A;  1DTO A;  3JD1 A;  3JCU Z;  5CA0 A;  5CBH A;  4F6E A;  4PD4 F;  1K34 A;  1SKV A;  5KMG B;  1K73 W;  1WA8 A;  3R66 A;  3IC7 A;  1HR0 O;  2YIB D;  3FB8 C;  4GT1 A;  3ZRX A;  3K5M A;  1OCO B;  2VQE B;  3ABM B;  2LJ2 A;  3CXH F;  1AI6 A;  2EIN B;  1FKA O;  1N36 O;  1R6T A;  4JZ2 A;  2V4D A;  2QWQ B;  2RMK B;  4EKW A;  4FLX A;  4ABM A;  5H2F Z;  1K92 A;  1U97 A;  1WP8 A;  3T1Y B;  1S77 D;  1IDS A;  2EIK C;  4LFB B;  1N8R W;  1WLE A;  3D8C A;  1M4U A;  3GVM A;  3RVZ A;  3KKY A;  3CEI A;  1NKD A;  4J42 A;  4I50 B;  4MVU A;  1MOF A;  1KC8 W;  1VF6 A;  2Y48 A;  3ZJZ A;  4TUY B;  1RP3 B;  3CRC A;  3DGE A;  4WFH A;  1JPX A;  2JEU A;  1ZX3 A;  5D5Q A;  4NXM B;  3N2G A;  3CPW U;  3BAB A;  3AG1 C;  2YC0 A;  4K35 A;  1BL8 A;  4RWU A;  2UUA B;  2PYL A;  2WLL B;  4JI6 B;  5IWA B;  2QWN B;  4X1Y A;  5BXZ A;  1N36 B;  2DYS B;  2XTA A;  5JCO A;  5FL7 G;  4WFA V;  5A2Q N;  2X6B A;  1JMK C;  3QO7 A;  3K5O A;  5LGN A;  1PP9 H;  3E22 A;  1JJ2 U;  1K9M W;  1SQX H;  3E83 A;  5KUM A;  2IU3 A;  5B66 Z;  2YIC A;  1QLE C;  3BCC H;  4F4L A;  4HYO A;  2W6I G;  4AHC A;  2Z0A A;  3I5D A;  4DYL A;  3CC7 V;  4BR6 A;  4FM0 A;  3PN1 A;  4Z2W A;  1LR1 A;  2ITD C;  4BIZ A;  1QBZ A;  2IJH A;  2XAH A;  3FB7 C;  3OAA G;  4FZ0 A;  1PD3 A;  1FYJ A;  1PNL A;  3B2E E;  4DR6 O;  1I7F A;  4CZZ A;  3B8N A;  5KUK A;  1OV9 A;  1QNM A;  3ABU A;  3W7U A;  3L70 H;  2B9Z A;  3T2M A;  2ZDI C;  5CA3 A;  1BQ0 A;  4ASU G;  3ABL C;  2B1G A;  4FMT A;  2Y69 B;  3S3X A;  3JAK B;  3OD4 A;  4EFE A;  4X62 O;  4FLZ A;  1X4T A;  1FFX B;  2KKW A;  4QE9 A;  5FPR A;  4LFB O;  1NZ6 A;  5B3S C;  2GV9 A;  1H2S B;  4DV6 B;  4MTO A;  1N33 B;  2CTQ A;  3H1J H;  5E79 Z;  1ZTE A;  3U0Z A;  4J7K A;  3B77 A;  3CHX A;  1NTK H;  1Q90 D;  3JAR A;  5JH7 B;  1NBM G;  4BIO A;  5LHH A;  1NU1 H;  1F51 A;  2Q9L A;  1W0K G;  3ETQ A;  1IZ3 A;  2Z3Y A;  5LMU O;  3D3I A;  5H9C A;  1HNX O;  4CC6 A;  1TAE A;  1FJG B;  1XNR B;  2Q73 A;  1Y66 A;  4JF3 A;  1G8M A;  4E4E A;  1BSM A;  4X66 O;  1XQ8 A;  4IIJ B;  2WWW A;  1EZJ A;  2KG7 B;  4MW8 A;  2QWO B;  5D5P A;  4DV2 B;  3NXS A;  3D36 A;  2QKC A;  4JYY A;  4U7N A;  4JI0 O;  2BE3 A;  4J9Y B;  3APQ A;  1Q43 A;  1YJN V;  1K33 A;  2BSK B;  4X88 A;  3LDD A;  3B8M A;  1K5S A;  3VQW A;  1M1K W;  1K4C C;  2VWJ A;  1H38 A;  2QA4 V;  2YXH A;  2QJ1 A;  5FNV B;  3AG2 C;  3JAS A;  2HVJ C;  3K04 A;  1Q5O A;  1N34 O;  3GWK C;  5FNV A;  5GTH Z;  3TGU H;  2FB5 A;  1BQZ A;  2JEX A;  4LR3 A;  4KL1 A;  1SQG A;  4X66 B;  3BAA A;  5L3D A;  1P7B A;  4TQD A;  3IFX A;  2X0L A;  4BAY A;  4FK5 C;  5DEC A;  4X64 O;  4B3M O;  2DYR C;  2EIN C;  3ZBH A;  5IY5 B;  4AQY B;  3ETG A;  5L3F A;  3LSS A;  1VQN V;  2M7W A;  1AJQ A;  4GYC B;  5LP6 C;  3OEE G;  4LF8 B;  2FL4 A;  4WCE V;  4K8Z A;  3RW0 A;  3ZRV A;  2OIE A;  1XNR O;  4WFF A;  1PKX A;  1Z2G A;  4FJC C;  2GBO A;  4H13 B;  2MW2 B;  1Z5V A;  1J5E O;  2ITC C;  1HDJ A;  1XMO O;  4CS3 A;  2EIJ B;  4G27 B;  4MVZ A;  1AVM A;  3CCL V;  4O2A A;  4LC1 A;  4PEL A;  2LFS A;  4DR2 B;  3E8H A;  1ENV A;  5EYP A;  1YCI A;  2CK3 G;  3RFR A;  2EZO A;  1KUQ A;  2N74 A;  3E8B A;  2IBZ H;  2A06 H;  3OR7 C;  3CRQ A;  1FJG O;  1P7G A;  3JAW B;  1QU7 A;  1VQ7 V;  1NI8 A;  4DR7 B;  1HNX B;  1XIL A;  1NTZ H;  3G67 A;  4NYK A;  1KD1 W;  1P4R A;  3RYC A;  2JVD A;  3JAW A;  4LFC B;  1S76 D;  1TUE B;  2YI9 A;  4IHJ B;  1Q8I A;  2WA3 A;  4J10 A;  3LDE A;  3OMN B;  3IC9 A;  5IT9 N;  4KHP B;  4LF6 O;  4JAS A;  4J9Z B;  4PHZ A;  4IYH A;  3DXR A;  1W59 A;  3WB0 A;  4L8J A;  4LBE C;  4N23 A;  5KA6 A;  5C93 A;  4DV1 O;  3A0H Z;  5H6R A;  1GKF A;  4LFA B;  1HNZ O;  4TV8 B;  5GTI Z;  2ZT9 B;  3CYO A;  1OJH A;  1PNK A;  4E2L A;  1IBK B;  2P4K A;  4IGG A;  1COW G;  1Q6U A;  1SQQ H;  1JA8 A;  1XMQ B;  5IDJ A;  2RNB A;  4DW1 A;  4JV5 B;  1FFT B;  2DQ0 A;  2VRZ A;  3SYQ A;  2UUB O;  2WSS G;  4I7Z B;  3VQY A;  1NT2 B;  4LF7 O;  4OPA A;  3FAV A;  1XHZ A;  2PUS A;  3VOU A;  2QWR B;  2WLK A;  1V55 B;  5BMV A;  1VQL V;  2WLJ A;  5FPO A;  2CGN A;  5EIB C;  2Q7E A;  2Q7H A;  3FB6 C;  2GUZ B;  2XAQ A;  4GX0 A;  1AI4 A;  4R7C A;  2KSD A;  2ZXW B;  3ABK B;  3T1Y O;  3ABM C;  3TCU A;  4FZ1 A;  1YTF D;  2CUG A;  2P4V A;  4MVQ A;  4AI8 A;  2KQX A;  2RDC A;  5GW7 A;  1K3E A;  4PDM A;  4JV5 O;  3H1I H;  1XHX A;  3F7Y C;  5KMG A;  1FPO A;  1XL4 A;  3I56 V;  3CP1 A;  4R6Z A;  4LNU A;  3VBB A;  5KHG A;  2PI4 A;  4MVR A;  2FYU H;  4YIP A;  4LF7 B;  4ZI7 B;  4JYA O;  1RM1 C;  5B1B C;  4ZKI A;  5L3E A;  1D5N A;  4GLX A;  3VQX A;  1GN2 A;  2QR4 A;  5DN6 G;  4H33 A;  3C90 A;  1KYO F;  1CEZ A;  3O65 A;  1GN6 A;  4O4L A;  4JI3 O;  3BA9 A;  2CH7 A;  3RWR D;  4EB6 A;  1R3L C;  4DK0 A;  4LF6 B;  4CH3 A;  4KHP O;  3OUF A;  1NVP D;  2OCC C;  5HFL A;  2IJJ A;  4MTG A;  4DV7 B;  2ZE8 A;  4ZOL A;  2ZIO A;  3PJS K;  2OTL V;  2UU9 O;  2B1I A;  1PV0 A;  4CC5 A;  2Q68 A;  3STL C;  4DXW A;  3P30 A;  2UUC B;  1NS1 A;  1N32 O;  3AK1 A;  3K9S A;  3CJH B;  4FFK A;  3RBZ A;  4ZI7 A;  2HEP A;  5KX5 A;  1M57 B;  3ML0 A;  1WPX A;  4GKK O;  5GON B;  3RYF A;  4UCS A;  5LL6 Y;  3CJH A;  3OTF A;  2V7Q G;  3W7X A;  4JI8 B;  2ZIM A;  4RQE A;  1M56 B;  4UUJ C;  4H44 B;  2ZM6 O;  1VQ9 V;  3H01 A;  1SF9 A;  2QKA A;  1N4C A;  3CS5 A;  2XAS A;  3G71 V;  1XMO B;  3ZX6 A;  4I55 A;  4NR1 A;  1Y74 B;  3E8F A;  4EEQ A;  1HNW B;  1WNS A;  3APO A;  3CXC U;  4B3T O;  1QVG U;  1S3J A;  4OPH A;  4P30 A;  3NR7 A;  1GM9 A;  2B5U A;  2RN9 A;  3D3Q A;  3OMI B;  4LWS A;  2OYQ A;  2QEX V;  1KB9 F;  3BEH A;  4UCO A;  3K3W A;  5KLV H;  4O2B A;  4UVC A;  3E89 A;  3OW2 U;  2DJV A;  4NB5 A;  4B3T B;  1YF2 A;  4X64 B;  3U10 A;  1S5L Z;  5JJE B;  2P90 A;  1QCE A;  2ADP A;  3LNN A;  3WB1 A;  3HKE B;  4O2B B;  5DM6 V;  2EJR A;  2JS3 A;  2XHB A;  3K06 A;  3E35 A;  3JD0 A;  5LP6 A;  4UXN A;  1QLE B;  1IXB A;  4GX2 A;  4GX5 A;  4DR5 O;  4YY3 O;  1AI7 A;  4YJ3 B;  1VF5 B;  1R3K C;  3DSQ A;  5LP6 B;  5IJ9 A;  2H8P C;  3P3N A;  4UVA A;  1ORQ C;  4J7J A;  3ZCC A;  3JCZ A;  4UV8 A;  1N34 B;  3A8T A;  2ODM A;  4FM2 A;  2LW1 A;  4RUF A;  2F95 B;  5A9G A;  2GTS A;  1JVM A;  3B09 A;  4MT8 A;  4O4J A;  5H6Q A;  1JFF A;  3JSN A;  5LMU B;  4G2K A;  1TVK A;  2HR3 A;  3STZ C;  4QNH B;  1F4N A;  1FAF A;  2UXB B;  3FB5 C;  3FX7 A;  5LMN B;  5EIB D;  3EHB B;  5KHI A;  4LF9 B;  3E86 A;  2PY5 A;  1YHQ V;  4H37 A;  3DXR B;  4NXN O;  1QLN A;  2ZNI A;  2EIL B;  4DV6 O;  3QF7 A;  1XEQ A;  3ZMT A;  2JK5 C;  2P6J A;  4GZR B;  3RYH B;  2RQ6 A;  4UVB A;  2QWP B;  3ETD A;  3ZHS A;  3MD0 A;  4JTA B;  1Z5W A;  2WA4 A;  3B40 A;  1HNW O;  2IJK A;  5EBL C;  3AK3 A;  1EN4 A;  2DYS C;  4I50 A;  3UQ8 A;  3K0G A;  1F4M A;  1Q7Y W;  1FS0 G;  3X2Q C;  2R72 A;  5K1P A;  1NH2 B;  1AR1 B;  3JAL A;  4N21 A;  1P84 F;  4BIU A;  4I0X A;  3T4D A;  3UT5 B;  2DQ3 A;  3ZIA G;  3JAL B;  1WA8 B;  1US6 A;  1K8A W;  2ZCE A;  3UT5 A;  4FFB B;  1OCZ C;  2HHH O;  2ZNJ A;  4MVM A;  2DOS A;  5LBQ A;  5CBF A;  2AHZ A;  4L87 A;  1THZ A;  3ETE A;  4FFB A;  5EC1 C;  2EIM B;  4DR4 B;  1N33 O;  1H2L A;  4GCZ A;  5J2T B;  2YEV A;  5E1A C;  4F6R B;  3QTC A;  4PA7 A;  3A2F A;  3M8A A;  3RYC B;  4JI6 O;  2XAG A;  3AK2 A;  2LQT A;  1RM1 B;  4B7E A;  1VQO V;  3J80 N;  2ZXW C;  3TK1 A;  1VF7 A;  4FM1 A;  4NTX A;  3BVO A;  4JYA B;  5CA1 B;  1YIT V;  1PL4 A;  2C2A A;  4DV5 O;  2VWK A;  2LGW A;  2M6Y A;  4QPK A;  2XAJ A;  2E3C A;  1SQB H;  3F5W C;  4KXR A;  3HR0 A;  1O9G A;  1QVF U;  4WFE A;  3JAK A;  2E74 B;  1MG1 A;  4ICG A;  5EYP B;  1CP9 A;  2PTM A;  1VEW A;  1YTF B;  4I5S A;  3ASO C;  2R9I A;  5EBM C;  3M7M X;  3KCX A;  4XDL A;  3R65 A;  1L0N H;  2Y4U A;  2N05 A;  4X89 A;  3CCS V;  5JCO C;  4TQF A;  1L1F A;  2P06 A;  4X1K B;  4DV5 B;  1HW7 A;  5K1X A;  4DR7 O;  2UUB B;  2QSA A;  1LUV A;  5IWA O;  2HVK C;  2HJF C;  4XDJ A;  1D5A A;  4J80 A;  5TIS Z;  1G1X B;  4GKJ B;  4D7T A;  1V9P A;  3FKS G;  4OXS A;  1ROP A;  4UCT A;  4CS4 A;  4UCV A;  1MMM A;  3L74 H;  5BR8 B;  4GKJ O;  3SPG A;  3H1H H;  4UCU A;  1XUQ A;  5JVD B;  3K79 A;  4U3J B;  5CB4 A;  1E1Q G;  1Q6I A;  4X1I B;  1URF A;  3CME V;  1HNZ B;  3ZHU A;  5IYD O;  2UXB O;  5JWP A;  4TV8 A;  3P32 A;  5L3G A;  1ZUQ A;  1BE3 H;  1IXM A;  1NR7 A;  5F2V O;  1H8H G;  3I55 V;  4X1I A;  4I55 B;  2Q5Z A;  1YZB A;  3UCS C;  2QE7 G;  4Z1M G;  4JI5 B;  2IJI A;  2BSK A;  2WLN A;  3SYC A;  1IUR A;  1M5I A;  4DV1 B;  4ZIB A;  1V54 B;  4WFB V;  5KAF Z;  1U96 A;  2BTQ A;  4LF8 O;  5DED A;  3FAV B;  3SPH A;  2O57 A;  1GRJ A;  2Y0P A;  3A0R A;  1OCR B;  4NVP A;  1OCR C;  5J2U A;  1SA0 A;  4O4L B;  1IBL B;  3S3W A;  1FFX A;  2OTJ V;  1S5H C;  4O4H A;  1UJW B;  3OGC C;  2BTO A;  2XAF A;  1VQ5 V;  1UPG A;  3THO A;  4DR2 O;  2AXT Z;  2QTS A;  1AP6 A;  4DRX B;  2P22 C;  2KG7 A;  2VQF O;  2JJ2 G;  1T5E A;  5IJ0 A;  4DV4 B;  3GWO A;  3HKB A;  2JS5 A;  2F66 C;  2XOK G;  4YJ3 A;  1VP7 A;  4QIW F;  3SYO A;  4DRX A;  4JGS A;  2F23 A;  5EZY A;  1KBH A;  3HKB B;  3ZMV A;  1E1R G;  2BTQ B;  3EFF K;  3ZN1 A;  1QQC A;  1AJP A;  3TJT A;  2JIZ G;  1IX9 A;  4UV9 A;  5IYZ A;  2HP8 A;  4B3S B;  2W0F C;  2IH3 C;  3FD9 A;  5EZY B;  2DMX A;  4DUY B;  3WB2 A;  4LF5 B;  1HWY A;  1H2K A;  4XBF A;  1TVK B;  1KKD A;  2LP7 A;  1NJI W;  3LNM B;  4JTC B;  1H8E G;  3W7W A;  3ABT A;  3JYC A;  1L0L H;  5IY5 C;  3C3S A;  1IBM O;  3WU2 Z;  4B3M B;  3TXS A;  2CH7 B;  4EB6 B;  4K0K O;  2X7R B;  4PDV A;  5B1O A;  2ADQ B;  3BFR A;  2R70 A;  2JJ1 G;  5LOV B;  1WP7 A;  4UFZ A;  3X2Q B;  3CRA A;  4PDR A;  3ZHV A;  3HB3 B;  3RYH A;  2YIB A;  4J11 A;  2UU9 B;  2DN9 A;  1TUB A;  5J9P C;  3W7S A;  3MHS C;  4TSF G;  1XOU A;  2D3O W;  2EIM C;  2L35 A;  1A32 A;  4DV4 O;  1WPB A;  1RSO A;  1TUB B;  3K59 A;  1Q82 W;  2EIJ C;  1WB7 A;  3WG7 C;  1YXB A;  4EFB A;  3HKC B;  1OCC C;  2Q8V A;  3OUS A;  1RPR A;  3HPL C;  5LGU A;  4TT3 G;  3MHH C;  1Q3E A;  4O4I A;  2ZE7 A;  4WBN A;  3SJQ C;  4JYC A;  2ILM A;  2A79 B;  1JJO A;  1GK9 A;  3L73 H;  1AIL A;  2ZR2 A;  1XL6 A;  2ARH A;  1W0J G;  5B1A C;  1R1B A;  1V55 C;  5LYJ A;  4YHH O;  3A0B Z;  2F93 B;  3SYP A;  2F1M A;  3LDC A;  2ZM6 B;  4YY3 B;  2F43 G;  1WJZ A;  2YEV B;  3EXA A;  2EJ7 A;  3W7T A;  1KQS U;  2E5L B;  1I94 O;  4IYI A;  2YXY A;  1B3Q A;  3SDL A;  2NN4 A;  3N2K A;  1X59 A;  4OGQ B;  4MS2 A;  3G6B A;  3QO5 A;  3BRC A;  1BT8 A;  2EZP A;  2EX3 A;  3CRM A;  2GUZ A;  2X6C A;  3ASN B;  4MVO A;  2EIK B;  4I4T A;  2WLH A;  1YJ9 V;  2PZS A;  4DO2 A;  4JAV A;  4TOI A;  1YDX A;  4MSW C;  4X62 B;  3P3P A;  5LYJ B;  1XBL A;  4P9O A;  4FIP C;  4NXM O;  1IBL O;  2QM7 A;  4HAM A;  4PDL A;  5LA6 A;  2W0X A;  3FYI B;  2XUM A;  1L8D A;  1YJW V;  5EK0 A;  5LA6 B;  1R6N A;  4PJ0 Z;  3SGI A;  4PA3 A;  2Q6A A;  4GKK B;  2JGD A;  4JI4 O;  4DV3 B;  2QKS A;  3LSU A;  1O9H A;  1SS3 A;  4LP8 A;  3OM3 B;  4K8X A;  5IE9 A;  1XRE A;  1SZT A;  3CE2 A;  2CTP A;  1JR9 A;  1R73 A;  4U3J A;  3U11 A;  1KMI Z;  2Q4P A;  3EVK A;  2ZE5 A;  1HR0 B;  1AR5 A;  4NKG B;  2Q69 A;  1RFY A;  2YDE A;  3TET A;  3SPJ A;  3HKD B;  1NR1 A;  1Q86 W;  1KP3 A;  2V1D A;  4YJ2 B;  1DF4 A;  3RGB A;  2OCH A;  4ZOL B;  1S72 V;  1R6K A;  2R9R B;  1SQV H;  1ZL8 B;  4RAI A;  4X20 B;  4X9Q A;  4DV3 O;  2OWO A;  1S0V A;  2IU0 A;  3CCM V;  1Y6X A;  4CH4 A;  1OCZ B;  2QM4 A;  2ZQM A;  1IBK O;  2HLD G;  1VMG A;  1BS3 A;  5KX5 B;  1SES A;  3UO3 A;  4QGP A;  1FXK B;  1FXK C;  3J81 N;  1BHA A;  4PV1 B;  1VQ6 V;  4CBC A;  3CMA V;  3ZHT A;  1K4D C;  1ZAU A;  5J2U B;  5EBW C;  3AG1 B;  5L3C A;  1XNQ O;  1EM1 A;  1MZE A;  4FVM A;  4FLV A;  2AZ0 A;  1EN5 A;  5BY1 A;  4HZ3 A;  5C8Y A;  3OT7 A;  4DUZ O;  4FLW A;  2VQE O;  2OCC B;  1R3J C;  4FPP A;  3QVN A;  5JH7 A;  3CCU V;  3CCJ V;  5B3S B;  2JRI A;  3K0D A;  2PYJ A;  3FFQ A;  3E2E A;  4LWS B;  2Q7G A;  1AP5 A;  1GTO A;  4TV9 B;  3C3T A;  1FXK A;  2BOC C;  4OX9 B;  2WLL A;  3ZED A;  1YEW A;  2HG5 C;  1FXV A;  1YVW A;  4FLY A;  4NXN B;  1ARO P;  4DR3 O;  2YI8 A;  2JDI G;  3DC5 A;  5KAI Z;  3RYF B;  2W6J G;  3ICX A;  2GSM B;  3AG2 B;  3TXQ A;  3ZRW B;  4KP4 A;  2DWD C;  3K03 A;  4R50 A;  5KHJ A;  3T4Z A;  1H2G A;  3AEI A;  4PI0 A;  2EIL C;  1I5X A;  2A3Q A;  3T1H O;  1SER A;  1NH2 D;  1OZ0 A;  3QO8 A;  4DR1 B;  4JI1 O;  1GMG A;  3QNE A;  4CS2 A;  3WG7 B;  4LF4 O;  3CCE V;  1WN7 A;  2CAZ C;  3K5N A;  2G38 A;  3WFV A;  1ZWI C;  5EC2 C;  5CBG A;  1I94 B;  3BHP A;  4G28 B;  4TV9 A;  2L6L A;  4KFM A;  2D2C B;  2PI5 A;  3OMA B;  5AG2 A;  3MAQ A;  4AIL C;  2RCV A;  1B06 A;  4D6T H;  4LFC O;  5ITZ A;  1UFI A;  1PNM A;  1ZLZ A;  3ZRW A;  4Z1V A;  4DK1 A;  2QGN A;  3RYI A;  1GH6 A;  2R9A A;  4I9W A;  2WLM A;  4I9Q A;  4DUY O;  5B5E Z;  4B08 A;  1TGO A;  1EN6 A;  1M93 A;  3ABL B;  1YIJ V;  2NR5 A;  4JTD B;  4B3R B;  3JSL A;  1MSW D;  2FML A;  5CN0 A;  2YIA A;  3JD4 A;  4ZBM A;  4LF9 O;  5CA0 B;  3ZHR A;  4LF5 O;  3J7A U;  4MTX A;  2Q0O C;  1F23 A;  3JD3 A;  4UB8 Z;  4B3S O;  3ZHQ A;  1AB3 A;  3ZRS A;  3LSQ A;  2NLJ C;  5HFM A;  2IH1 C;  1KP2 A;  1BHB A;  3LUT B;  4BWA A;  4HBN A;  1DF5 A;  1JX9 A;  4W4L A;  3CCQ V;  3AG7 A;  4UB6 Z;  5LXT A;  4K0K B;  1MSD A;  3IJ4 A;  4RUE A;  5IJ9 B;  2BCC H;  1N32 B;  5LXT B;  4AQY O;  2WLI B;  4I4T B;  4JI8 O;  2E76 B;  2WAM A;  2ZD9 A;  3G6E V;  2ZE6 A;  2QTO A;  1M9N A;  2X6A A;  4WFG A;  2WLI A;  4JZG A;  2CTW A;  2DYR B;  3HKC A;  1JOY A;  1GM8 A;  3FYE B;  3CC4 V;  5IYZ B;  4JI1 B;  1Q81 W;  2YS8 A;  2QDO A;  2N04 A;  2BOB C;  1R3I C;  4IHJ A;  3T1H B;  1RPO A;  3N2G B;  1NVP B;  4TWK A;  2NNU A;  4P9P A;  2MK3 A;  1H2M A;  1I5Y A;  2OIG A;  4P2Z A;  2VQF B;  5JJJ B;  4LF4 B;  4JPR A;  3G4S V;  1Q6H A;  3SJC C;  4PA6 A;  1QR8 A;  3OE7 G;  1KKC A;  4K3A A;  4YIO A;  3E22 B;  1K97 A;  1D2D A;  4OX9 O;  1JQ0 A;  2CDY A;  3CD6 V;  1G6U A;  4RO2 A;  5KHK A;  3BPZ A;  2FKX A;  3ZN0 A;  2ATK C;  2YID A;  2UXX A;  4U3F H;  2DW4 A;  4CH5 A;  3SR2 C;  4F6R A;  4QPJ A;  3ZMS A;  1RSO B;  3OTO B;  5L3B A;  4QJF B;  3F7V C;  1QHT A;  2UXD O;  1MNG A;  3SJB C;  1I0H A;  3T1C A;  2UXN A;  2XND G;  2LW7 A;  4BW9 A;  3K9A A;  4JI5 O;  2XT9 A;  3E8G A;  1PM9 A;  1VQM V;  3CCR V;  4R8C A;  4DV7 O;  1G4Y B;  4O4I B;  1W2B U;  1SRY A;  2KB1 A;  4X1Y B;  4O2A B;  5JVD A;  4WBN B;  5CB4 B;  1HP8 A;  3QG5 A;  4YXW G;  1E79 G;  3CWB H;  4J41 A;  1IVS A;  3CRR A;  4JI7 O;  1VAR A;  3VQV A;  1YI2 V;  1WB8 A;  2UUA O;  1XDC A;  5BR8 O;  2ETN A;  1P49 A;  2HFE C;  3ASO B;  3AG4 B;  1QR9 A;  3JAR B;  2UXD B;  1DLB A;  3OTO O;  2RJZ A;  5C8Y B;  2H94 A;  2JGU A;  3DC6 A;  1GAX A;  1H2N A;  4PA9 A;  3CC2 V;  4MTF A;  1TA8 A;  4ZHQ B;  1YSC A;  3OEH G;  2LFR A;  4D7S A;  5BMV B;  3UM7 A;  1DK1 A;  5CA1 A;  3N2K B;  1S5J A;  4LCU C;  5FLX N;  1J95 A;  4X1K A;  2IW5 A;  1VF6 C;  2DE0 X;  2Q0A A;  4ZHQ A;  3K08 A;  3L9D A;  3AG4 C;  4DR6 B;  1NTM H;  3CX5 F;  5JJN B;  2ZR3 A;  4JI7 B; 
#chains in the Genus database with same CATH homology
 2UUB O;  1NS1 A;  5BXZ A;  1N32 O;  4LF7 O;  4OPA A;  5BY1 A;  4NXM O;  4DUY O;  3J80 N;  1D2D A;  4DUZ O;  2VQE O;  3F5T A;  1IBL O;  4OX9 O;  1J5E O;  4GKK O;  4X66 O;  5A2Q N;  4LF8 O;  2FKX A;  1A32 A;  5LL6 Y;  1XMO O;  4DV4 O;  2JRI A;  4DV0 O;  2ZM6 O;  4DV5 O;  4LF9 O;  2ZKO A;  4JI0 O;  4NXN O;  2Z0A A;  4DV6 O;  1XEQ A;  4LF5 O;  3J7A U;  1KUQ A;  2N74 A;  4JI4 O;  2UXD O;  3T1Y O;  4B3S O;  1AB3 A;  3RT3 C;  4A5U B;  1FJG O;  4DR2 O;  4DR3 O;  4B3T O;  3R66 A;  2LW7 A;  1FYJ A;  4JI5 O;  4JV5 O;  4OPH A;  4DR6 O;  1HNW O;  4DV2 O;  2VQF O;  1HR0 O;  4DV7 O;  1XMQ O;  2AGA A;  1N34 O;  1AIL A;  4DR4 O;  5IT9 N;  2F4V O;  1R1B A;  4YHH O;  4LF6 O;  3T1H O;  4JYA O;  2DJV A;  5H5N A;  1N36 O;  1R6T A;  4AQY O;  1FKA O;  4DR7 O;  5IWA O;  4JI8 O;  4X62 O;  4JI1 O;  4JI7 O;  4B3R O;  1G1X B;  2UUA O;  4LFA O;  5LMN O;  5BR8 O;  4LF4 O;  1I94 O;  4DV3 O;  4LFB O;  4DV1 O;  1F7Y A;  3OTO O;  1IBK O;  2UXC O;  3SDL A;  4GKJ O;  3O65 A;  2UUC O;  2HHH O;  1HNZ O;  4B3M O;  4X64 O;  1X59 A;  2DOS A;  4JI3 O;  4DR5 O;  4YY3 O;  3J81 N;  1DK1 A;  1IBM O;  4KHP O;  5FLX N;  2UXB O;  1N33 O;  4K0K O;  4LFC O;  1XNR O;  1XNQ O;  5LMU O;  2UU9 O;  2E5L O;  1YZB A;  4X65 O;  3M8A A;  4JI2 O;  4JI6 O;  1HNX O;  4DR1 O;  3JAM N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...