4JI2I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 22
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji2I00
2WW4A 4DR7I 1RR9A 4DU8A 1N36I 2UUCE 4DR3I 4NXME 1N0VC 4GKKE 2VQFI 2A2CA 4DV7E 4X64I 4B3ME 5LMUI 5A2QQ 1J5EE 3WU3A 2X36A 4MYTA 2UXDI 2Q2EB 4PU9A 1RREA 4JI8I 4K0KI 1N36E 4DV1I 1ZM9A 1PIEA 4GKKI 1H73A 3B78A 1Z0GA 1N34E 3V5RA 3T1YE 1Z5AA 3OTOI 2GS8A 1XMQE 2BM0A 2V2QA 4USKA 4DV5I 2CZ9A 4NXNE 4LFAI 3PYDA 2V2VA 4X64E 1DARA 4AQYI 3WU5A 1IBMI 2HKEA 1D6TA 4DR1I 3CWVA 4DV1E 4I3HA 4B3TE 1NZ0A 1Z0WA 4DV6E 5LMNI 2UU9E 1FNMA 3M6AA 4YHHI 3WU4A 1KVKA 4B3MI 1ZM2A 1Z0EA 4HXZA 1N34I 1IBLE 5GMEA 4USMA 4DV4I 4EMDA 3LTOA 4LF8I 2BV3A 1Z0TA 2DEJA 1H7SA 3F0NA 4MYUA 4JI5E 2R42A 2HFUA 1QZRA 2UUCI 4B3TI 3QT8A 1S16A 1UEKA 1NHHA 3GONA 2UUAE 4X66E 1KTVA 4DV3E 3J80Q 4B3RI 2VQEE 3JAMQ 5IWAE 2V8PA 3LNUA 4DPUA 1HNZI 1FWLA 4P7AA 2HFSA 1IBKI 4X65I 3H4LA 5BR8I 4LF9E 1XNRE 1S4EA 4JI4I 1FWKA 4YHHE 1HR0I 1ZXMA 4DR7E 4FWHA 3PYFA 2UUAI 2V2ZA 3ZKDA 4DUYE 1B62A 1I94I 4HYMA 2E5LI 4DV5E 4LFBI 1U2RA 4JI6E 4LF5E 4JI2I 4HY1A 1HNWI 4HACA 2XEXA 3ZZTA 1Z5BA 1OJ4A 1PVGA 2ZITA 5GMDA 3QT6A 3J7AG 2LJPA 1H74A 4KHPI 1ZM4A 2HKJA 4DU7A 3K1JA 1I94E 3K17A 1Z5CA 1H7UA 2VQEI 4JYAE 3QT5A 4LF5I 4ZVIA 5LMUE 4LFAE 4Z7CA 1IBME 4HACB 2HK2A 1K47A 2UXDE 1N0UA 1B63A 2VQFE 2UXCE 4DV7I 4JV5E 2ZM6E 1HNXE 1N32E 4LFCE 2EFGA 4PRXA 4WUDA 4NXMI 4JI7E 4FN5A 3QT7A 2ZBKB 3B8HA 3JAMC 4OX9E 4JI8E 3J80C 1MX0A 1FKAE 3ZKBA 1XMOE 4NXNI 4B3SE 4LF4E 1ELOA 4M1KA 4YY3E 4JV5I 4DPYA 4JI1E 1VISA 3HULA 3PYEA 4XTJA 4JI7I 3T1YI 1XMQI 4LF6I 4JI0I 1MG7A 2UUBI 1IBLI 2A2DA 1Z0CA 1FJGI 1N32I 2NPFA 4P52A 5A2QC 3ZM7A 4OX9I 2V34A 1XMOI 2UXBE 4DR5E 1ZXNA 4DR2E 1NHJA 3V2UC 4DR4I 3T1HI 4X65E 1Z0VA 4DPTA 2ZM6I 4DUZI 4X66I 4DV3I 4FWDA 4LFCI 2HK3A 5IWAI 2X7IA 4DV2E 4UT4A 2BM1A 1XNQE 1J5EI 1XHKA 1N33E 4GKJE 4JI3I 2E5LE 4LF7E 1FI4A 2OI2A 4DV0I 4DR6E 1HNZE 4DUZE 1ZM3A 5BR8E 3J81Q 1HNXI 4DR4E 4FW9A 2DEIA 3T1HE 3Q1QA 1KIJA 4JI6I 1A6FA 5FLXQ 4GKJI 4X62E 3D4JA 4LF6E 5L3JA 4JYAI 1Z59A 4DUYI 4DR1E 4LFBE 1H72C 4B3SI 4LF4I 5LMNE 2UU9I 1N33I 1HNWE 4KHPE 4YY3I 2E1RA 4JI5I 3ZZUA 4DV4E 4WUCA 4X62I 4LF8E 4B3RE 5IT9C 4PRVA 4JI3E 4LF7I 2UXBI 2HHHI 3B82A 2R3VA 4DV0E 4LF9I 4DR6I 1BKNA 4DV6I 4JI1I 2UXCI 1XNRI 1MU5A 4DV2I 4DR3E 1NHIA 1HR0E 2HHHE 4WUBA 4JI0E 2AJ4A 4DR5I 1IBKE 3PYGA 4Z7YA 2F4VI 3ZZ0A 3J81C 5IT9Q 2UUBE 4JI4E 4DPXA 1EI1A 1KKHA 4K0KE 4R1FA 2VF3A 4ED4A 4KQVA 3WU6A 4JG4A 4FWGA 2J7KA 1XNQI 1Z0BA 1PKPA 3LPSA 4JI2E 5LL6R 1FJGE 4RPFA 4DXLA 3J7AM 4DPWA 5FLXC 1WUUA 4UTGA 1EA6A 4AQYE 4DR2I 2F4VE 3OTOE 4URLA
chains in the Genus database with same CATH superfamily
3U1YA 2WW4A 4DR7I 1RR9A 3P76A 4DU8A 1N36I 2UUCE 4DR3I 4NXME 1N0VC 5EKWA 4GKKE 2VQFI 2A2CA 1YHCA 4DV7E 4X64I 4B3ME 3PRYA 5LMUI 1YH8A 2NN6C 5A2QQ 1J5EE 3WU3A 2X36A 4MYTA 4MU0A 2UXDI 4OO1E 2Z5EA 2Q2EB 4PU9A 3PS2A 5JEAD 1RREA 3PS1A 4JI8I 4FW5A 4K0KI 1RHYA 3HJCA 1N36E 4DV1I 1ZM9A 1HK7A 5C0XF 1PIEA 2JEAB 2Z5CB 2GO4A 4GKKI 1H73A 4GQUA 3B78A 1Z0GA 2GO3A 1N34E 2O3ZA 3V5RA 3T1YE 1Z5AA 3OTOI 2GS8A 1XMQE 2BM0A 1UDNA 2V2QA 4USKA 2JE6A 4DV5I 2CZ9A 4NXNE 4LFAI 3PYDA 2V2VA 4X64E 1DARA 4AQYI 3L7ZB 3WU5A 1IBMI 2HKEA 3UHMA 1D6TA 4DR1I 3CWVA 4DV1E 4I3HA 4B3TE 1NZ0A 1Z0WA 2C39B 4DV6E 1Y6ZA 5LMNI 2UU9E 1FNMA 3M6AA 4YHHI 3WU4A 1KVKA 4B3MI 2PNZA 1ZM2A 1Z0EA 3M85G 4HXZA 1N34I 4AM3A 3P3CA 2C38B 4MU3A 1IBLE 4BA2A 1OYSA 3M85D 5GMEA 4USMA 4DV4I 4EMDA 3LTOA 4MQYA 4LF8I 2BV3A 1Z0TA 2DEJA 1H7SA 3F0NA 4MYUA 4JI5E 2R42A 2HFUA 1QZRA 3M7NG 5DROA 2UUCI 4B3TI 3QT8A 1USUA 5K36F 1S16A 1UEKA 1NHHA 3GONA 2UUAE 4X66E 1KTVA 4DV3E 1UDSA 4AIMA 3J80Q 4B3RI 2VQEE 2WP8A 3JAMQ 5IWAE 2V8PA 3LNUA 4IFDE 4BA2B 4DPUA 1HNZI 1FWLA 4P7AA 2GQ0A 2HFSA 1IBKI 4X65I 3H4LA 5BR8I 4LF9E 2PNMA 1S4EA 1XNRE 4JI4I 1FWKA 4YHHE 1HR0I 4IFDC 1ZXMA 2BA1D 2C37A 4DR7E 4FWHA 4FW3A 3PYFA 2UUAI 4J3DA 2V2ZA 3ZKDA 4DUYE 1B62A 1I94I 4HYMA 5C0XB 4DV5E 2E5LI 4IFDD 4LFBI 1U2RA 4JI6E 5K36B 4LF5E 4JI2I 3P3GA 4HY1A 1HNWI 4HACA 4ISAA 3ZZTA 2XEXA 1Z5BA 2AE8A 4OO1F 1OJ4A 5DRQA 2PO2A 1PVGA 3Q6MA 1Y5YA 2ZITA 5GMDA 4IZJD 1OYRA 3QT6A 3J7AG 3P06A 2LJPA 1H74A 4KHPI 2C39A 1ZM4A 2HKJA 4DU7A 3K1JA 4IFDF 1R6LA 1I94E 2WNRB 1Z5CA 3K17A 1H7UA 2VQEI 2NN6D 4JYAE 3QT5A 3M7ND 5DRRA 4U3BA 4IZJB 4LF5I 4ZVIA 5LMUE 2CG9A 5JEAB 5C0XA 4N3OA 4LFAE 4FW6A 2IOQA 4Z7CA 1IBME 4HACB 2HK2A 4LOMA 1K47A 2J65A 2UXDE 3GLLA 1N0UA 1B63A 2VQFE 2PO2B 2F1DA 2PNZB 2UXCE 4DV7I 4JV5E 1E3PA 2ZM6E 1HNXE 1N32E 3U1KA 5C0XC 4LFCE 4LCFA 2EFGA 4PRXA 4WUDA 4NXMI 4JI7E 4FN5A 3GCMA 3QT7A 2PO1A 2ZBKB 3B8HA 3JAMC 4OX9E 4JI8E 3HKMA 3J80C 1MX0A 1FKAE 3ZKBA 2NN6F 1XMOE 4IFDB 4NXNI 4B3SE 4LF4E 2O1WA 1ELOA 4M1KA 4YY3E 4JV5I 4FW4A 4DPYA 1E3HA 1VISA 4JI1E 3HULA 2JT2A 3PYEA 2BR2B 2Z5BB 4XTJA 4JI7I 4OO1A 3T1YI 1XMQI 4LF6I 4JI0I 2PO1B 1MG7A 2UUBI 4QNKA 1IBLI 2A2DA 1Z0CA 5JEAE 2C37B 2IOPA 1FJGI 4LCGA 5C0XE 1N32I 2CGEA 4IZJA 4P52A 2NPFA 3H1CA 5A2QC 1R6MA 3ZM7A 4OX9I 2V34A 4LPFA 1XMOI 2UXBE 4DR5E 1ZXNA 2O1VA 4DR2E 1NHJA 3V2UC 4DR4I 4QNJA 3T1HI 4X65E 1Z0VA 2BA0G 5K36A 4DPTA 2ZM6I 4DUZI 4X66I 5JEAF 4DV3I 1XXEA 2PO0B 2JEBA 4MDTA 1USVA 4FWDA 4LFCI 2HK3A 5IWAI 2X7IA 4DV2E 4UT4A 2BM1A 4LCHA 1XNQE 1J5EI 5JEAC 1XHKA 1N33E 4GKJE 4JI3I 4OO1D 3Q6NA 1OYPA 4U3DA 2E5LE 4LF7E 3PS3A 1FI4A 3P3EA 2JEAA 3L7ZA 2OI2A 3CDJA 5FWKA 4DV0I 4DR6E 1HNZE 4DUZE 1ZM3A 1Y4UA 5BR8E 4IFDA 3J81Q 5K36E 1HNXI 2BA0D 4DR4E 2O1TA 3B4TA 2DEIA 3NZKA 4FW9A 3T1HE 2NN6B 3Q1QA 1KIJA 4JI6I 1A6FA 5FLXQ 4GKJI 4X62E 3D4JA 4LF6E 5L3JA 4OKGA 1UDOA 4JYAI 4NBQA 1Z59A 4DUYI 4DR1E 4LFBE 1H72C 5ELWA 4B3SI 4LF4I 5LMNE 3CDIA 2UU9I 1N33I 1HNWE 4KHPE 4YY3I 2E1RA 5DRPA 4JI5I 4FW7A 3K85A 3ZZUA 4DV4E 4MU1A 5C0XD 2JE6B 4AIDA 4IZKA 4WUCA 4X62I 2CVEA 4LF8E 2PNLA 4B3RE 3DD6A 5IT9C 4PRVA 2BA1G 4JI3E 2VESA 5JEAA 4LF7I 2UXBI 2HHHI 3B82A 5DNXA 2R3VA 4DV0E 4LF9I 4DR6I 1BKNA 2Z5CA 3GMEA 4OO1B 2JEBB 4OZEA 4DV6I 4MU4A 1P42A 5DNLA 5K36D 4JI1I 2UXCI 1XNRI 1MU5A 1VI7A 5EL9A 2IESA 4IZKB 4DV2I 4DR3E 1NHIA 1Y60A 1HR0E 2HHHE 4WUBA 1Y4SA 4JI0E 2AJ4A 4DR5I 1IBKE 3PYGA 4Z7YA 2F4VI 3ZZ0A 3J81C 5IT9Q 2UUBE 4DPXA 4JI4E 4BA1B 1EI1A 3KRNA 2PO0A 4OO1C 1KKHA 4K0KE 2BR2A 2Z5BA 4R1FA 1UDQA 5K36C 2VF3A 2WP8B 4ED4A 2C38A 4KQVA 3WU6A 4JG4A 4FWGA 4IS9A 2J7KA 1XNQI 1Z0BA 1PKPA 2WNRA 3LPSA 4JI2E 5LL6R 1FJGE 2O1UA 4RPFA 4DXLA 2NN6E 3J7AM 4DPWA 5FLXC 1WUUA 4UTGA 1EA6A 4BA1A 4AQYE 2IERA 2NN6A 4DR2I 2F4VE 3OTOE 4URLA
chains in the Genus database with same CATH topology
2WW4A 4DR7I 1RR9A 4DU8A 1N36I 2UUCE 4DR3I 4NXME 1N0VC 4GKKE 2VQFI 2A2CA 4DV7E 4X64I 4B3ME 3PRYA 5LMUI 5A2QQ 1J5EE 3WU3A 2X36A 4MYTA 2UXDI 2Z5EA 2Q2EB 4PU9A 1RREA 4JI8I 4K0KI 3HJCA 1N36E 4DV1I 1ZM9A 1HK7A 1PIEA 2Z5CB 4GKKI 1H73A 3B78A 1Z0GA 1N34E 3V5RA 3T1YE 1Z5AA 3OTOI 2GS8A 1XMQE 2BM0A 2V2QA 4USKA 4DV5I 2CZ9A 4NXNE 4LFAI 3PYDA 2V2VA 4X64E 1DARA 4AQYI 3WU5A 1IBMI 2HKEA 1D6TA 4DR1I 3CWVA 4DV1E 4I3HA 4B3TE 1NZ0A 1Z0WA 4DV6E 1Y6ZA 5LMNI 2UU9E 1FNMA 3M6AA 4YHHI 3WU4A 1KVKA 4B3MI 1ZM2A 1Z0EA 4HXZA 1N34I 1IBLE 5GMEA 4USMA 4DV4I 4EMDA 3LTOA 4LF8I 2BV3A 1Z0TA 2DEJA 1H7SA 3F0NA 4MYUA 4JI5E 2R42A 2HFUA 1QZRA 2UUCI 4B3TI 3QT8A 1USUA 1S16A 1UEKA 1NHHA 3GONA 2UUAE 4X66E 1KTVA 4DV3E 3J80Q 4B3RI 2VQEE 3JAMQ 5IWAE 2V8PA 3LNUA 4DPUA 1HNZI 1FWLA 4P7AA 2GQ0A 2HFSA 1IBKI 4X65I 3H4LA 5BR8I 4LF9E 2PNMA 1S4EA 1XNRE 4JI4I 1FWKA 4YHHE 1HR0I 1ZXMA 4DR7E 4FWHA 3PYFA 2UUAI 2V2ZA 3ZKDA 4DUYE 1B62A 1I94I 4HYMA 2E5LI 4DV5E 4LFBI 1U2RA 4JI6E 4LF5E 4JI2I 4HY1A 1HNWI 4HACA 2XEXA 3ZZTA 1Z5BA 1OJ4A 1PVGA 3Q6MA 2ZITA 5GMDA 4IZJD 3QT6A 3J7AG 3P06A 2LJPA 1H74A 4KHPI 1ZM4A 2HKJA 4DU7A 3K1JA 1I94E 3K17A 1Z5CA 1H7UA 2VQEI 4JYAE 3QT5A 4LF5I 4IZJB 4ZVIA 5LMUE 2CG9A 4N3OA 4LFAE 2IOQA 4Z7CA 1IBME 4HACB 2HK2A 1K47A 2UXDE 1N0UA 1B63A 2VQFE 2UXCE 4DV7I 4JV5E 2ZM6E 1HNXE 1N32E 4LFCE 2EFGA 4PRXA 4WUDA 4NXMI 4JI7E 4FN5A 3QT7A 2ZBKB 3B8HA 3JAMC 4OX9E 4JI8E 3J80C 1MX0A 1FKAE 3ZKBA 1XMOE 4NXNI 4B3SE 4LF4E 2O1WA 1ELOA 4M1KA 4YY3E 4JV5I 4DPYA 1VISA 4JI1E 3HULA 3PYEA 2Z5BB 4XTJA 4JI7I 3T1YI 1XMQI 4LF6I 4JI0I 1MG7A 2UUBI 1IBLI 2A2DA 1Z0CA 2IOPA 1FJGI 1N32I 2CGEA 4IZJA 4P52A 2NPFA 5A2QC 3ZM7A 4OX9I 2V34A 1XMOI 2UXBE 4DR5E 1ZXNA 2O1VA 4DR2E 1NHJA 3V2UC 4DR4I 3T1HI 4X65E 1Z0VA 4DPTA 2ZM6I 4DUZI 4X66I 4DV3I 1USVA 4FWDA 4LFCI 2HK3A 5IWAI 2X7IA 4DV2E 4UT4A 2BM1A 1XNQE 1J5EI 1XHKA 1N33E 4GKJE 4JI3I 3Q6NA 2E5LE 4LF7E 1FI4A 2OI2A 4DV0I 5FWKA 4DR6E 1HNZE 4DUZE 1ZM3A 1Y4UA 5BR8E 3J81Q 1HNXI 4DR4E 2O1TA 4FW9A 2DEIA 3T1HE 3Q1QA 1KIJA 4JI6I 1A6FA 5FLXQ 4GKJI 4X62E 3D4JA 4LF6E 5L3JA 4JYAI 1Z59A 4DUYI 4DR1E 4LFBE 1H72C 4B3SI 4LF4I 5LMNE 2UU9I 1N33I 1HNWE 4KHPE 4YY3I 2E1RA 4JI5I 3K85A 3ZZUA 4DV4E 4IZKA 4WUCA 4X62I 4LF8E 2PNLA 4B3RE 5IT9C 4PRVA 4JI3E 4LF7I 2UXBI 2HHHI 3B82A 2R3VA 4DV0E 4LF9I 4DR6I 1BKNA 2Z5CA 4DV6I 4JI1I 2UXCI 1XNRI 1MU5A 4IZKB 4DV2I 4DR3E 1NHIA 1HR0E 2HHHE 4WUBA 1Y4SA 4JI0E 1IBKE 2AJ4A 4DR5I 3PYGA 4Z7YA 2F4VI 3ZZ0A 3J81C 5IT9Q 2UUBE 4DPXA 4JI4E 1EI1A 1KKHA 4K0KE 2Z5BA 4R1FA 2VF3A 4ED4A 4KQVA 3WU6A 4JG4A 4FWGA 2J7KA 1XNQI 1Z0BA 1PKPA 3LPSA 4JI2E 5LL6R 1FJGE 2O1UA 4RPFA 4DXLA 3J7AM 4DPWA 5FLXC 1WUUA 4UTGA 1EA6A 4AQYE 4DR2I 2F4VE 3OTOE 4URLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WW4 A;  4DR7 I;  1RR9 A;  4DU8 A;  1N36 I;  2UUC E;  4DR3 I;  4NXM E;  1N0V C;  4GKK E;  2VQF I;  2A2C A;  4DV7 E;  4X64 I;  4B3M E;  5LMU I;  5A2Q Q;  1J5E E;  3WU3 A;  2X36 A;  4MYT A;  2UXD I;  2Q2E B;  4PU9 A;  1RRE A;  4JI8 I;  4K0K I;  1N36 E;  4DV1 I;  1ZM9 A;  1PIE A;  4GKK I;  1H73 A;  3B78 A;  1Z0G A;  1N34 E;  3V5R A;  3T1Y E;  1Z5A A;  3OTO I;  2GS8 A;  1XMQ E;  2BM0 A;  2V2Q A;  4USK A;  4DV5 I;  2CZ9 A;  4NXN E;  4LFA I;  3PYD A;  2V2V A;  4X64 E;  1DAR A;  4AQY I;  3WU5 A;  1IBM I;  2HKE A;  1D6T A;  4DR1 I;  3CWV A;  4DV1 E;  4I3H A;  4B3T E;  1NZ0 A;  1Z0W A;  4DV6 E;  5LMN I;  2UU9 E;  1FNM A;  3M6A A;  4YHH I;  3WU4 A;  1KVK A;  4B3M I;  1ZM2 A;  1Z0E A;  4HXZ A;  1N34 I;  1IBL E;  5GME A;  4USM A;  4DV4 I;  4EMD A;  3LTO A;  4LF8 I;  2BV3 A;  1Z0T A;  2DEJ A;  1H7S A;  3F0N A;  4MYU A;  4JI5 E;  2R42 A;  2HFU A;  1QZR A;  2UUC I;  4B3T I;  3QT8 A;  1S16 A;  1UEK A;  1NHH A;  3GON A;  2UUA E;  4X66 E;  1KTV A;  4DV3 E;  3J80 Q;  4B3R I;  2VQE E;  3JAM Q;  5IWA E;  2V8P A;  3LNU A;  4DPU A;  1HNZ I;  1FWL A;  4P7A A;  2HFS A;  1IBK I;  4X65 I;  3H4L A;  5BR8 I;  4LF9 E;  1XNR E;  1S4E A;  4JI4 I;  1FWK A;  4YHH E;  1HR0 I;  1ZXM A;  4DR7 E;  4FWH A;  3PYF A;  2UUA I;  2V2Z A;  3ZKD A;  4DUY E;  1B62 A;  1I94 I;  4HYM A;  2E5L I;  4DV5 E;  4LFB I;  1U2R A;  4JI6 E;  4LF5 E;  4JI2 I;  4HY1 A;  1HNW I;  4HAC A;  2XEX A;  3ZZT A;  1Z5B A;  1OJ4 A;  1PVG A;  2ZIT A;  5GMD A;  3QT6 A;  3J7A G;  2LJP A;  1H74 A;  4KHP I;  1ZM4 A;  2HKJ A;  4DU7 A;  3K1J A;  1I94 E;  3K17 A;  1Z5C A;  1H7U A;  2VQE I;  4JYA E;  3QT5 A;  4LF5 I;  4ZVI A;  5LMU E;  4LFA E;  4Z7C A;  1IBM E;  4HAC B;  2HK2 A;  1K47 A;  2UXD E;  1N0U A;  1B63 A;  2VQF E;  2UXC E;  4DV7 I;  4JV5 E;  2ZM6 E;  1HNX E;  1N32 E;  4LFC E;  2EFG A;  4PRX A;  4WUD A;  4NXM I;  4JI7 E;  4FN5 A;  3QT7 A;  2ZBK B;  3B8H A;  3JAM C;  4OX9 E;  4JI8 E;  3J80 C;  1MX0 A;  1FKA E;  3ZKB A;  1XMO E;  4NXN I;  4B3S E;  4LF4 E;  1ELO A;  4M1K A;  4YY3 E;  4JV5 I;  4DPY A;  4JI1 E;  1VIS A;  3HUL A;  3PYE A;  4XTJ A;  4JI7 I;  3T1Y I;  1XMQ I;  4LF6 I;  4JI0 I;  1MG7 A;  2UUB I;  1IBL I;  2A2D A;  1Z0C A;  1FJG I;  1N32 I;  2NPF A;  4P52 A;  5A2Q C;  3ZM7 A;  4OX9 I;  2V34 A;  1XMO I;  2UXB E;  4DR5 E;  1ZXN A;  4DR2 E;  1NHJ A;  3V2U C;  4DR4 I;  3T1H I;  4X65 E;  1Z0V A;  4DPT A;  2ZM6 I;  4DUZ I;  4X66 I;  4DV3 I;  4FWD A;  4LFC I;  2HK3 A;  5IWA I;  2X7I A;  4DV2 E;  4UT4 A;  2BM1 A;  1XNQ E;  1J5E I;  1XHK A;  1N33 E;  4GKJ E;  4JI3 I;  2E5L E;  4LF7 E;  1FI4 A;  2OI2 A;  4DV0 I;  4DR6 E;  1HNZ E;  4DUZ E;  1ZM3 A;  5BR8 E;  3J81 Q;  1HNX I;  4DR4 E;  4FW9 A;  2DEI A;  3T1H E;  3Q1Q A;  1KIJ A;  4JI6 I;  1A6F A;  5FLX Q;  4GKJ I;  4X62 E;  3D4J A;  4LF6 E;  5L3J A;  4JYA I;  1Z59 A;  4DUY I;  4DR1 E;  4LFB E;  1H72 C;  4B3S I;  4LF4 I;  5LMN E;  2UU9 I;  1N33 I;  1HNW E;  4KHP E;  4YY3 I;  2E1R A;  4JI5 I;  3ZZU A;  4DV4 E;  4WUC A;  4X62 I;  4LF8 E;  4B3R E;  5IT9 C;  4PRV A;  4JI3 E;  4LF7 I;  2UXB I;  2HHH I;  3B82 A;  2R3V A;  4DV0 E;  4LF9 I;  4DR6 I;  1BKN A;  4DV6 I;  4JI1 I;  2UXC I;  1XNR I;  1MU5 A;  4DV2 I;  4DR3 E;  1NHI A;  1HR0 E;  2HHH E;  4WUB A;  4JI0 E;  2AJ4 A;  4DR5 I;  1IBK E;  3PYG A;  4Z7Y A;  2F4V I;  3ZZ0 A;  3J81 C;  5IT9 Q;  2UUB E;  4JI4 E;  4DPX A;  1EI1 A;  1KKH A;  4K0K E;  4R1F A;  2VF3 A;  4ED4 A;  4KQV A;  3WU6 A;  4JG4 A;  4FWG A;  2J7K A;  1XNQ I;  1Z0B A;  1PKP A;  3LPS A;  4JI2 E;  5LL6 R;  1FJG E;  4RPF A;  4DXL A;  3J7A M;  4DPW A;  5FLX C;  1WUU A;  4UTG A;  1EA6 A;  4AQY E;  4DR2 I;  2F4V E;  3OTO E;  4URL A; 
#chains in the Genus database with same CATH topology
 3U1Y A;  2WW4 A;  4DR7 I;  1RR9 A;  3P76 A;  4DU8 A;  1N36 I;  2UUC E;  4DR3 I;  4NXM E;  1N0V C;  5EKW A;  4GKK E;  2VQF I;  2A2C A;  1YHC A;  4DV7 E;  4X64 I;  4B3M E;  3PRY A;  5LMU I;  1YH8 A;  2NN6 C;  5A2Q Q;  1J5E E;  3WU3 A;  2X36 A;  4MYT A;  4MU0 A;  2UXD I;  4OO1 E;  2Z5E A;  2Q2E B;  4PU9 A;  3PS2 A;  5JEA D;  1RRE A;  3PS1 A;  4JI8 I;  4FW5 A;  4K0K I;  1RHY A;  3HJC A;  1N36 E;  4DV1 I;  1ZM9 A;  1HK7 A;  5C0X F;  1PIE A;  2JEA B;  2Z5C B;  2GO4 A;  4GKK I;  1H73 A;  4GQU A;  3B78 A;  1Z0G A;  2GO3 A;  1N34 E;  2O3Z A;  3V5R A;  3T1Y E;  1Z5A A;  3OTO I;  2GS8 A;  1XMQ E;  2BM0 A;  1UDN A;  2V2Q A;  4USK A;  2JE6 A;  4DV5 I;  2CZ9 A;  4NXN E;  4LFA I;  3PYD A;  2V2V A;  4X64 E;  1DAR A;  4AQY I;  3L7Z B;  3WU5 A;  1IBM I;  2HKE A;  3UHM A;  1D6T A;  4DR1 I;  3CWV A;  4DV1 E;  4I3H A;  4B3T E;  1NZ0 A;  1Z0W A;  2C39 B;  4DV6 E;  1Y6Z A;  5LMN I;  2UU9 E;  1FNM A;  3M6A A;  4YHH I;  3WU4 A;  1KVK A;  4B3M I;  2PNZ A;  1ZM2 A;  1Z0E A;  3M85 G;  4HXZ A;  1N34 I;  4AM3 A;  3P3C A;  2C38 B;  4MU3 A;  1IBL E;  4BA2 A;  1OYS A;  3M85 D;  5GME A;  4USM A;  4DV4 I;  4EMD A;  3LTO A;  4MQY A;  4LF8 I;  2BV3 A;  1Z0T A;  2DEJ A;  1H7S A;  3F0N A;  4MYU A;  4JI5 E;  2R42 A;  2HFU A;  1QZR A;  3M7N G;  5DRO A;  2UUC I;  4B3T I;  3QT8 A;  1USU A;  5K36 F;  1S16 A;  1UEK A;  1NHH A;  3GON A;  2UUA E;  4X66 E;  1KTV A;  4DV3 E;  1UDS A;  4AIM A;  3J80 Q;  4B3R I;  2VQE E;  2WP8 A;  3JAM Q;  5IWA E;  2V8P A;  3LNU A;  4IFD E;  4BA2 B;  4DPU A;  1HNZ I;  1FWL A;  4P7A A;  2GQ0 A;  2HFS A;  1IBK I;  4X65 I;  3H4L A;  5BR8 I;  4LF9 E;  2PNM A;  1S4E A;  1XNR E;  4JI4 I;  1FWK A;  4YHH E;  1HR0 I;  4IFD C;  1ZXM A;  2BA1 D;  2C37 A;  4DR7 E;  4FWH A;  4FW3 A;  3PYF A;  2UUA I;  4J3D A;  2V2Z A;  3ZKD A;  4DUY E;  1B62 A;  1I94 I;  4HYM A;  5C0X B;  4DV5 E;  2E5L I;  4IFD D;  4LFB I;  1U2R A;  4JI6 E;  5K36 B;  4LF5 E;  4JI2 I;  3P3G A;  4HY1 A;  1HNW I;  4HAC A;  4ISA A;  3ZZT A;  2XEX A;  1Z5B A;  2AE8 A;  4OO1 F;  1OJ4 A;  5DRQ A;  2PO2 A;  1PVG A;  3Q6M A;  1Y5Y A;  2ZIT A;  5GMD A;  4IZJ D;  1OYR A;  3QT6 A;  3J7A G;  3P06 A;  2LJP A;  1H74 A;  4KHP I;  2C39 A;  1ZM4 A;  2HKJ A;  4DU7 A;  3K1J A;  4IFD F;  1R6L A;  1I94 E;  2WNR B;  1Z5C A;  3K17 A;  1H7U A;  2VQE I;  2NN6 D;  4JYA E;  3QT5 A;  3M7N D;  5DRR A;  4U3B A;  4IZJ B;  4LF5 I;  4ZVI A;  5LMU E;  2CG9 A;  5JEA B;  5C0X A;  4N3O A;  4LFA E;  4FW6 A;  2IOQ A;  4Z7C A;  1IBM E;  4HAC B;  2HK2 A;  4LOM A;  1K47 A;  2J65 A;  2UXD E;  3GLL A;  1N0U A;  1B63 A;  2VQF E;  2PO2 B;  2F1D A;  2PNZ B;  2UXC E;  4DV7 I;  4JV5 E;  1E3P A;  2ZM6 E;  1HNX E;  1N32 E;  3U1K A;  5C0X C;  4LFC E;  4LCF A;  2EFG A;  4PRX A;  4WUD A;  4NXM I;  4JI7 E;  4FN5 A;  3GCM A;  3QT7 A;  2PO1 A;  2ZBK B;  3B8H A;  3JAM C;  4OX9 E;  4JI8 E;  3HKM A;  3J80 C;  1MX0 A;  1FKA E;  3ZKB A;  2NN6 F;  1XMO E;  4IFD B;  4NXN I;  4B3S E;  4LF4 E;  2O1W A;  1ELO A;  4M1K A;  4YY3 E;  4JV5 I;  4FW4 A;  4DPY A;  1E3H A;  1VIS A;  4JI1 E;  3HUL A;  2JT2 A;  3PYE A;  2BR2 B;  2Z5B B;  4XTJ A;  4JI7 I;  4OO1 A;  3T1Y I;  1XMQ I;  4LF6 I;  4JI0 I;  2PO1 B;  1MG7 A;  2UUB I;  4QNK A;  1IBL I;  2A2D A;  1Z0C A;  5JEA E;  2C37 B;  2IOP A;  1FJG I;  4LCG A;  5C0X E;  1N32 I;  2CGE A;  4IZJ A;  4P52 A;  2NPF A;  3H1C A;  5A2Q C;  1R6M A;  3ZM7 A;  4OX9 I;  2V34 A;  4LPF A;  1XMO I;  2UXB E;  4DR5 E;  1ZXN A;  2O1V A;  4DR2 E;  1NHJ A;  3V2U C;  4DR4 I;  4QNJ A;  3T1H I;  4X65 E;  1Z0V A;  2BA0 G;  5K36 A;  4DPT A;  2ZM6 I;  4DUZ I;  4X66 I;  5JEA F;  4DV3 I;  1XXE A;  2PO0 B;  2JEB A;  4MDT A;  1USV A;  4FWD A;  4LFC I;  2HK3 A;  5IWA I;  2X7I A;  4DV2 E;  4UT4 A;  2BM1 A;  4LCH A;  1XNQ E;  1J5E I;  5JEA C;  1XHK A;  1N33 E;  4GKJ E;  4JI3 I;  4OO1 D;  3Q6N A;  1OYP A;  4U3D A;  2E5L E;  4LF7 E;  3PS3 A;  1FI4 A;  3P3E A;  2JEA A;  3L7Z A;  2OI2 A;  3CDJ A;  5FWK A;  4DV0 I;  4DR6 E;  1HNZ E;  4DUZ E;  1ZM3 A;  1Y4U A;  5BR8 E;  4IFD A;  3J81 Q;  5K36 E;  1HNX I;  2BA0 D;  4DR4 E;  2O1T A;  3B4T A;  2DEI A;  3NZK A;  4FW9 A;  3T1H E;  2NN6 B;  3Q1Q A;  1KIJ A;  4JI6 I;  1A6F A;  5FLX Q;  4GKJ I;  4X62 E;  3D4J A;  4LF6 E;  5L3J A;  4OKG A;  1UDO A;  4JYA I;  4NBQ A;  1Z59 A;  4DUY I;  4DR1 E;  4LFB E;  1H72 C;  5ELW A;  4B3S I;  4LF4 I;  5LMN E;  3CDI A;  2UU9 I;  1N33 I;  1HNW E;  4KHP E;  4YY3 I;  2E1R A;  5DRP A;  4JI5 I;  4FW7 A;  3K85 A;  3ZZU A;  4DV4 E;  4MU1 A;  5C0X D;  2JE6 B;  4AID A;  4IZK A;  4WUC A;  4X62 I;  2CVE A;  4LF8 E;  2PNL A;  4B3R E;  3DD6 A;  5IT9 C;  4PRV A;  2BA1 G;  4JI3 E;  2VES A;  5JEA A;  4LF7 I;  2UXB I;  2HHH I;  3B82 A;  5DNX A;  2R3V A;  4DV0 E;  4LF9 I;  4DR6 I;  1BKN A;  2Z5C A;  3GME A;  4OO1 B;  2JEB B;  4OZE A;  4DV6 I;  4MU4 A;  1P42 A;  5DNL A;  5K36 D;  4JI1 I;  2UXC I;  1XNR I;  1MU5 A;  1VI7 A;  5EL9 A;  2IES A;  4IZK B;  4DV2 I;  4DR3 E;  1NHI A;  1Y60 A;  1HR0 E;  2HHH E;  4WUB A;  1Y4S A;  4JI0 E;  2AJ4 A;  4DR5 I;  1IBK E;  3PYG A;  4Z7Y A;  2F4V I;  3ZZ0 A;  3J81 C;  5IT9 Q;  2UUB E;  4DPX A;  4JI4 E;  4BA1 B;  1EI1 A;  3KRN A;  2PO0 A;  4OO1 C;  1KKH A;  4K0K E;  2BR2 A;  2Z5B A;  4R1F A;  1UDQ A;  5K36 C;  2VF3 A;  2WP8 B;  4ED4 A;  2C38 A;  4KQV A;  3WU6 A;  4JG4 A;  4FWG A;  4IS9 A;  2J7K A;  1XNQ I;  1Z0B A;  1PKP A;  2WNR A;  3LPS A;  4JI2 E;  5LL6 R;  1FJG E;  2O1U A;  4RPF A;  4DXL A;  2NN6 E;  3J7A M;  4DPW A;  5FLX C;  1WUU A;  4UTG A;  1EA6 A;  4BA1 A;  4AQY E;  2IER A;  2NN6 A;  4DR2 I;  2F4V E;  3OTO E;  4URL A; 
#chains in the Genus database with same CATH homology
 2WW4 A;  4DR7 I;  1RR9 A;  4DU8 A;  1N36 I;  2UUC E;  4DR3 I;  4NXM E;  1N0V C;  4GKK E;  2VQF I;  2A2C A;  4DV7 E;  4X64 I;  4B3M E;  3PRY A;  5LMU I;  5A2Q Q;  1J5E E;  3WU3 A;  2X36 A;  4MYT A;  2UXD I;  2Z5E A;  2Q2E B;  4PU9 A;  1RRE A;  4JI8 I;  4K0K I;  3HJC A;  1N36 E;  4DV1 I;  1ZM9 A;  1HK7 A;  1PIE A;  2Z5C B;  4GKK I;  1H73 A;  3B78 A;  1Z0G A;  1N34 E;  3V5R A;  3T1Y E;  1Z5A A;  3OTO I;  2GS8 A;  1XMQ E;  2BM0 A;  2V2Q A;  4USK A;  4DV5 I;  2CZ9 A;  4NXN E;  4LFA I;  3PYD A;  2V2V A;  4X64 E;  1DAR A;  4AQY I;  3WU5 A;  1IBM I;  2HKE A;  1D6T A;  4DR1 I;  3CWV A;  4DV1 E;  4I3H A;  4B3T E;  1NZ0 A;  1Z0W A;  4DV6 E;  1Y6Z A;  5LMN I;  2UU9 E;  1FNM A;  3M6A A;  4YHH I;  3WU4 A;  1KVK A;  4B3M I;  1ZM2 A;  1Z0E A;  4HXZ A;  1N34 I;  1IBL E;  5GME A;  4USM A;  4DV4 I;  4EMD A;  3LTO A;  4LF8 I;  2BV3 A;  1Z0T A;  2DEJ A;  1H7S A;  3F0N A;  4MYU A;  4JI5 E;  2R42 A;  2HFU A;  1QZR A;  2UUC I;  4B3T I;  3QT8 A;  1USU A;  1S16 A;  1UEK A;  1NHH A;  3GON A;  2UUA E;  4X66 E;  1KTV A;  4DV3 E;  3J80 Q;  4B3R I;  2VQE E;  3JAM Q;  5IWA E;  2V8P A;  3LNU A;  4DPU A;  1HNZ I;  1FWL A;  4P7A A;  2GQ0 A;  2HFS A;  1IBK I;  4X65 I;  3H4L A;  5BR8 I;  4LF9 E;  2PNM A;  1S4E A;  1XNR E;  4JI4 I;  1FWK A;  4YHH E;  1HR0 I;  1ZXM A;  4DR7 E;  4FWH A;  3PYF A;  2UUA I;  2V2Z A;  3ZKD A;  4DUY E;  1B62 A;  1I94 I;  4HYM A;  2E5L I;  4DV5 E;  4LFB I;  1U2R A;  4JI6 E;  4LF5 E;  4JI2 I;  4HY1 A;  1HNW I;  4HAC A;  2XEX A;  3ZZT A;  1Z5B A;  1OJ4 A;  1PVG A;  3Q6M A;  2ZIT A;  5GMD A;  4IZJ D;  3QT6 A;  3J7A G;  3P06 A;  2LJP A;  1H74 A;  4KHP I;  1ZM4 A;  2HKJ A;  4DU7 A;  3K1J A;  1I94 E;  3K17 A;  1Z5C A;  1H7U A;  2VQE I;  4JYA E;  3QT5 A;  4LF5 I;  4IZJ B;  4ZVI A;  5LMU E;  2CG9 A;  4N3O A;  4LFA E;  2IOQ A;  4Z7C A;  1IBM E;  4HAC B;  2HK2 A;  1K47 A;  2UXD E;  1N0U A;  1B63 A;  2VQF E;  2UXC E;  4DV7 I;  4JV5 E;  2ZM6 E;  1HNX E;  1N32 E;  4LFC E;  2EFG A;  4PRX A;  4WUD A;  4NXM I;  4JI7 E;  4FN5 A;  3QT7 A;  2ZBK B;  3B8H A;  3JAM C;  4OX9 E;  4JI8 E;  3J80 C;  1MX0 A;  1FKA E;  3ZKB A;  1XMO E;  4NXN I;  4B3S E;  4LF4 E;  2O1W A;  1ELO A;  4M1K A;  4YY3 E;  4JV5 I;  4DPY A;  1VIS A;  4JI1 E;  3HUL A;  3PYE A;  2Z5B B;  4XTJ A;  4JI7 I;  3T1Y I;  1XMQ I;  4LF6 I;  4JI0 I;  1MG7 A;  2UUB I;  1IBL I;  2A2D A;  1Z0C A;  2IOP A;  1FJG I;  1N32 I;  2CGE A;  4IZJ A;  4P52 A;  2NPF A;  5A2Q C;  3ZM7 A;  4OX9 I;  2V34 A;  1XMO I;  2UXB E;  4DR5 E;  1ZXN A;  2O1V A;  4DR2 E;  1NHJ A;  3V2U C;  4DR4 I;  3T1H I;  4X65 E;  1Z0V A;  4DPT A;  2ZM6 I;  4DUZ I;  4X66 I;  4DV3 I;  1USV A;  4FWD A;  4LFC I;  2HK3 A;  5IWA I;  2X7I A;  4DV2 E;  4UT4 A;  2BM1 A;  1XNQ E;  1J5E I;  1XHK A;  1N33 E;  4GKJ E;  4JI3 I;  3Q6N A;  2E5L E;  4LF7 E;  1FI4 A;  2OI2 A;  4DV0 I;  5FWK A;  4DR6 E;  1HNZ E;  4DUZ E;  1ZM3 A;  1Y4U A;  5BR8 E;  3J81 Q;  1HNX I;  4DR4 E;  2O1T A;  4FW9 A;  2DEI A;  3T1H E;  3Q1Q A;  1KIJ A;  4JI6 I;  1A6F A;  5FLX Q;  4GKJ I;  4X62 E;  3D4J A;  4LF6 E;  5L3J A;  4JYA I;  1Z59 A;  4DUY I;  4DR1 E;  4LFB E;  1H72 C;  4B3S I;  4LF4 I;  5LMN E;  2UU9 I;  1N33 I;  1HNW E;  4KHP E;  4YY3 I;  2E1R A;  4JI5 I;  3K85 A;  3ZZU A;  4DV4 E;  4IZK A;  4WUC A;  4X62 I;  4LF8 E;  2PNL A;  4B3R E;  5IT9 C;  4PRV A;  4JI3 E;  4LF7 I;  2UXB I;  2HHH I;  3B82 A;  2R3V A;  4DV0 E;  4LF9 I;  4DR6 I;  1BKN A;  2Z5C A;  4DV6 I;  4JI1 I;  2UXC I;  1XNR I;  1MU5 A;  4IZK B;  4DV2 I;  4DR3 E;  1NHI A;  1HR0 E;  2HHH E;  4WUB A;  1Y4S A;  4JI0 E;  1IBK E;  2AJ4 A;  4DR5 I;  3PYG A;  4Z7Y A;  2F4V I;  3ZZ0 A;  3J81 C;  5IT9 Q;  2UUB E;  4DPX A;  4JI4 E;  1EI1 A;  1KKH A;  4K0K E;  2Z5B A;  4R1F A;  2VF3 A;  4ED4 A;  4KQV A;  3WU6 A;  4JG4 A;  4FWG A;  2J7K A;  1XNQ I;  1Z0B A;  1PKP A;  3LPS A;  4JI2 E;  5LL6 R;  1FJG E;  2O1U A;  4RPF A;  4DXL A;  3J7A M;  4DPW A;  5FLX C;  1WUU A;  4UTG A;  1EA6 A;  4AQY E;  4DR2 I;  2F4V E;  3OTO E;  4URL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...