4JI2I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji2I00
2NPFA 4B3RE 1XMQI 4AQYE 1N36E 4DR6E 1OJ4A 3T1HE 4DR3I 4JG4A 4I3HA 2ZITA 4X62I 4LF6E 2UUBE 1KKHA 4NXME 1PIEA 2DEJA 3J7AG 5IT9Q 1H7UA 1Z0BA 2VF3A 3ZKBA 4DR4E 4DV7I 2XEXA 4GKJI 4GKKE 4DR2I 2F4VI 4B3SI 4KHPI 4B3ME 3ZZ0A 4EMDA 1NZ0A 1NHHA 1XMOE 3QT7A 4MYTA 1NHIA 4JI1I 1N33E 2E5LI 1RR9A 3CWVA 1IBLI 3B8HA 4PRVA 1XMQE 3H4LA 3LPSA 2A2CA 4DPWA 3OTOI 2VQFI 4DV6I 1Z5BA 4DR3E 1N0UA 5A2QQ 1N32I 4X62E 4OX9I 1IBMI 4DR1I 1J5EE 1HR0I 2J7KA 1DARA 1WUUA 1BKNA 2EFGA 2V2VA 4DR2E 2F4VE 2CZ9A 1FKAE 4B3SE 1S4EA 4JI5I 4RPFA 4JI1E 3PYFA 3B82A 1Z5CA 3LNUA 4XTJA 1N34I 1RREA 3ZKDA 4LF8E 3WU3A 3QT6A 4LF7I 1ZM4A 5BR8I 3OTOE 3JAMC 2VQFE 5LL6R 4DR7I 4OX9E 4WUDA 1IBME 1HR0E 1H7SA 4DV3I 4DUZI 4YY3I 4HACB 2E1RA 3V5RA 2V34A 3ZM7A 1PKPA 4JI5E 1ZM9A 4LF9I 4HYMA 1U2RA 4JI0I 4LF5I 2HHHI 4FW9A 1A6FA 1N34E 4JI8I 4ED4A 1Z0EA 4FN5A 5FLXC 4LF7E 4JI7I 5BR8E 4LF4I 5LMUI 4JI2I 1Z0GA 4DV4E 1I94I 4FWHA 2UU9E 4X65I 4DV3E 4HXZA 4DUZE 4JI3I 4KQVA 3J81Q 3PYGA 4LF9E 4DU8A 2X36A 4PRXA 1HNZE 4JI0E 4LF5E 2HHHE 1FI4A 2V8PA 2HK2A 5FLXQ 3ZZUA 4JI7E 4JI6I 4LF4E 5LMUE 2X7IA 1HNWI 3K17A 4JI2E 4NXNI 1I94E 4X65E 3B78A 4DV7E 1S16A 4GKJE 2UUAI 4KHPE 4JYAI 2V2ZA 4DV1I 4R1FA 1Z0WA 1Z0TA 2E5LE 4DV5I 3QT8A 3J80C 1IBLE 1QZRA 1N0VC 2UXDI 4WUCA 3PYEA 2UXCI 4UT4A 4B3TI 4USKA 4K0KI 1HNWE 4DV6E 4NXNE 1N32E 1B63A 3WU5A 4LFBI 4DXLA 5IWAI 1MG7A 2GS8A 2ZM6I 4HACA 4DR1E 4JV5I 4M1KA 1XNRI 2HFUA 4DV2I 4UTGA 4ZVIA 4MYUA 1HNXI 2UUAE 4B3RI 3K1JA 1MU5A 4DV1E 2BM1A 2AJ4A 2BV3A 1K47A 3PYDA 4NXMI 4DUYI 2UXDE 1XNQI 5IT9C 4DR4I 4K0KE 3JAMQ 3D4JA 1FWLA 1KTVA 4LFBE 1Z5AA 5IWAE 4DR7E 2ZM6E 3T1YI 1ZM2A 4DPUA 4JV5E 1XNRE 4YY3E 2UUCI 4YHHI 1ZXNA 3ZZTA 1KVKA 2R3VA 1HNXE 2UXBI 3M6AA 4DPYA 2VQEI 4Z7YA 2HKEA 4X66I 2DEIA 4DR5I 5A2QC 2LJPA 4JI8E 4DUYE 1J5EI 1H73A 2HFSA 5L3JA 1XNQE 4X64I 3WU4A 4WUBA 1NHJA 1IBKI 1ELOA 3T1YE 1UEKA 1MX0A 4JI3E 3GONA 2UUCE 3F0NA 4YHHE 2UXBE 4LF8I 2ZBKB 5GMEA 2VQEE 4X66E 1H72C 2OI2A 4P7AA 4DR5E 1FJGI 1H74A 4LFCI 1ZM3A 1VISA 4DPXA 4X64E 1EI1A 4DV0I 4JI6E 5LMNI 2BM0A 1IBKE 1ZXMA 3WU6A 4LFAI 4JI4I 3HULA 1EA6A 2A2DA 2HKJA 2V2QA 1PVGA 4DU7A 3J7AM 1N36I 4AQYI 5GMDA 4JYAE 4DR6I 2Q2EB 1Z59A 3T1HI 2HK3A 1FJGE 1Z0CA 4LFCE 4DV4I 4USMA 4DV5E 2UU9I 3J80Q 4LF6I 2UUBI 3LTOA 1XHKA 1Z0VA 2R42A 3V2UC 2UXCE 4DV0E 5LMNE 4B3TE 3J81C 4GKKI 3Q1QA 4HY1A 1FNMA 1KIJA 2WW4A 4B3MI 4Z7CA 1B62A 1FWKA 4LFAE 1HNZI 4JI4E 3QT5A 1XMOI 4PU9A 4DPTA 4FWDA 4URLA 1N33I 4DV2E 4FWGA 4P52A 1D6TA
chains in the Genus database with same CATH superfamily
2NPFA 4B3RE 1XMQI 4AQYE 1N36E 3M85D 4DR6E 1OJ4A 4FW4A 3T1HE 3P76A 4DR3I 4JG4A 5JEAB 4I3HA 2BR2A 3K85A 2CG9A 2Z5BA 2PO2A 2ZITA 4X62I 4LF6E 2UUBE 1KKHA 4NXME 1PIEA 2DEJA 3J7AG 1Y4SA 5IT9Q 1H7UA 1Z0BA 2VF3A 3ZKBA 4DR4E 4DV7I 2XEXA 2Z5EA 3U1YA 4GKJI 4GKKE 4DR2I 2F4VI 1OYPA 4B3SI 4B3ME 4KHPI 2PNZA 3ZZ0A 4EMDA 1NZ0A 1UDSA 1NHHA 5EL9A 4OKGA 1XMOE 3QT7A 4MYTA 1NHIA 3M7ND 3PS1A 4IFDB 1XXEA 2PO1B 2Z5CA 4JI1I 1N33E 2E5LI 1RR9A 4BA1A 3CWVA 1IBLI 3GMEA 3B8HA 4PRVA 1XMQE 3H4LA 3LPSA 2AE8A 1E3PA 1R6LA 2A2CA 4DPWA 3OTOI 2VQFI 4DV6I 4QNKA 1Z5BA 4IZJB 4DR3E 1N0UA 5A2QQ 1N32I 5K36B 2PO0B 4X62E 4OO1B 4OX9I 1IBMI 4DR1I 1J5EE 1HR0I 1UDNA 2J7KA 2O1WA 1DARA 1WUUA 5JEAC 1BKNA 2EFGA 2O1TA 2V2VA 4DR2E 2GO3A 2F4VE 4U3BA 2CZ9A 4NBQA 1FKAE 4B3SE 1S4EA 4JI5I 3NZKA 4FW6A 4RPFA 2C39A 2JE6B 4MQYA 4JI1E 3PYFA 3B82A 1Z5CA 3LNUA 4XTJA 1N34I 3P3EA 1RREA 3ZKDA 4LF8E 3WU3A 2WNRB 3QT6A 1OYSA 2JEBA 4LF7I 1ZM4A 5BR8I 3OTOE 3JAMC 2VQFE 1UDOA 2C37A 5LL6R 4U3DA 4DR7I 4OX9E 4WUDA 1IBME 1HR0E 1H7SA 4DV3I 4DUZI 4YY3I 4HACB 2E1RA 3V5RA 2V34A 5K36C 4BA2A 3ZM7A 1PKPA 3B4TA 4JI5E 1HK7A 1ZM9A 4LF9I 4HYMA 1U2RA 2NN6D 4IFDD 4JI0I 5C0XC 4LF5I 2HHHI 4FW5A 4FW9A 1A6FA 1N34E 4JI8I 4AIMA 4ED4A 1Z0EA 4FN5A 2O1UA 5FLXC 4LF7E 4JI7I 5BR8E 4LF4I 4IZJD 5LMUI 5DRRA 4JI2I 1Z0GA 2NN6E 5K36D 4J3DA 4DV4E 1I94I 4OO1D 4FWHA 2UU9E 4X65I 4DV3E 2WP8B 4HXZA 4DUZE 4JI3I 1RHYA 4KQVA 3J81Q 3L7ZA 3PRYA 3PYGA 3M85G 2NN6F 3GLLA 2NN6A 4LF9E 4IFDF 2F1DA 4DU8A 4IFDA 2X36A 4PRXA 1HNZE 4JI0E 4LCFA 5FWKA 2HHHE 4LF5E 1OYRA 1FI4A 2V8PA 2Z5BB 2HK2A 5FLXQ 1UDQA 3ZZUA 4JI7E 3PS2A 4IZJA 4JI6I 5K36F 4LF4E 5LMUE 5K36A 2X7IA 4LCGA 2PO0A 4GQUA 1HNWI 4IZKB 3K17A 4OO1F 4JI2E 4NXNI 4OO1A 1I94E 2CVEA 4X65E 3M7NG 3B78A 2BA1D 5DNXA 1USVA 4DV7E 2JT2A 1S16A 4BA1B 5C0XB 4MU0A 4GKJE 2O1VA 5EKWA 2UUAI 4KHPE 5DRQA 4JYAI 2V2ZA 3HJCA 4DV1I 2IOPA 4FW3A 4R1FA 1Z0WA 1Z0TA 2E5LE 4DV5I 2WNRA 4N3OA 3QT8A 3J80C 1IBLE 1QZRA 2BA1G 1N0VC 3U1KA 2UXDI 4WUCA 3PYEA 2UXCI 4UT4A 4B3TI 4USKA 4K0KI 1HNWE 3UHMA 4DV6E 4NXNE 5JEAD 4FW7A 1N32E 1B63A 3WU5A 4LFBI 4DXLA 5IWAI 1MG7A 2GS8A 2ZM6I 2C39B 4HACA 1Y60A 2GO4A 4DR1E 4JV5I 4M1KA 1XNRI 2C38B 2HFUA 4DV2I 4UTGA 4ZVIA 4MYUA 1HNXI 2UUAE 4B3RI 3K1JA 5JEAE 1MU5A 1E3HA 4DV1E 2BM1A 2AJ4A 2CGEA 2BV3A 2C37B 1K47A 4MU3A 5DROA 2VESA 3PYDA 4NXMI 4DUYI 2UXDE 1YHCA 2IOQA 1XNQI 2J65A 5IT9C 4DR4I 4K0KE 3JAMQ 3GCMA 5JEAF 3KRNA 5JEAA 3D4JA 1FWLA 1KTVA 4LFBE 1Z5AA 5IWAE 2WP8A 4IFDE 4DR7E 2ZM6E 3T1YI 1ZM2A 4AM3A 4DPUA 4JV5E 1XNRE 4YY3E 2UUCI 5C0XD 4YHHI 1ZXNA 3Q6MA 3ZZTA 1KVKA 2R3VA 1HNXE 2UXBI 2IESA 3M6AA 4AIDA 4DPYA 2VQEI 4Z7YA 2JEAB 5K36E 2HKEA 4X66I 2DEIA 2PO1A 4LOMA 1R6MA 4OO1E 1VI7A 2IERA 4DR5I 5A2QC 2LJPA 4JI8E 3DD6A 2BR2B 4DUYE 1J5EI 4OZEA 5DNLA 2O3ZA 1H73A 2PO2B 2HFSA 5C0XE 3P06A 1YH8A 5L3JA 1XNQE 4IZKA 4X64I 3WU4A 2BA0D 4WUBA 1NHJA 1IBKI 3L7ZB 1Y6ZA 1ELOA 4IS9A 3T1YE 2PNZB 2NN6B 1UEKA 5ELWA 5C0XF 1MX0A 5C0XA 4JI3E 3GONA 2UUCE 3F0NA 4YHHE 1Y5YA 2Z5CB 2UXBE 4LF8I 3CDJA 2ZBKB 5GMEA 2JE6A 2GQ0A 2VQEE 4X66E 2BA0G 3P3CA 1H72C 2OI2A 3CDIA 1USUA 4LCHA 4P7AA 5DRPA 4DR5E 1H74A 1FJGI 4LFCI 1ZM3A 1VISA 4DPXA 4X64E 1EI1A 4QNJA 4DV0I 4JI6E 5LMNI 2BM0A 1IBKE 1ZXMA 4MDTA 3HKMA 3WU6A 4LFAI 2C38A 4JI4I 3HULA 1EA6A 3P3GA 2A2DA 2HKJA 3PS3A 2V2QA 1PVGA 2NN6C 4DU7A 3H1CA 3J7AM 4IFDC 1N36I 4AQYI 5GMDA 2PNLA 4JYAE 4DR6I 2Q2EB 1Z59A 2JEBB 3T1HI 2HK3A 1FJGE 4MU4A 1Z0CA 4LFCE 4MU1A 4DV4I 4USMA 4DV5E 3J80Q 2UU9I 4LF6I 2UUBI 3LTOA 1XHKA 1Z0VA 4ISAA 2R42A 3V2UC 2UXCE 1P42A 4DV0E 5LMNE 4B3TE 2PNMA 2JEAA 3Q6NA 3J81C 4OO1C 4GKKI 3Q1QA 4HY1A 1FNMA 4LPFA 1KIJA 2WW4A 4B3MI 4BA2B 4Z7CA 1B62A 1FWKA 4LFAE 1HNZI 4JI4E 3QT5A 1XMOI 4PU9A 4DPTA 4FWDA 4URLA 1N33I 1Y4UA 4DV2E 4FWGA 4P52A 1D6TA
chains in the Genus database with same CATH topology
2NPFA 4B3RE 1XMQI 4AQYE 1N36E 4DR6E 1OJ4A 3T1HE 4DR3I 4JG4A 4I3HA 3K85A 2CG9A 2Z5BA 2ZITA 4X62I 4LF6E 2UUBE 1KKHA 4NXME 1PIEA 2DEJA 3J7AG 1Y4SA 5IT9Q 1H7UA 1Z0BA 2VF3A 3ZKBA 4DR4E 4DV7I 2XEXA 2Z5EA 4GKJI 4GKKE 4DR2I 2F4VI 4B3SI 4KHPI 4B3ME 3ZZ0A 4EMDA 1NZ0A 1NHHA 1XMOE 3QT7A 4MYTA 1NHIA 2Z5CA 4JI1I 1N33E 2E5LI 1RR9A 3CWVA 1IBLI 3B8HA 4PRVA 1XMQE 3H4LA 3LPSA 2A2CA 4DPWA 3OTOI 2VQFI 4DV6I 1Z5BA 4IZJB 4DR3E 1N0UA 5A2QQ 1N32I 4X62E 4OX9I 1IBMI 4DR1I 1J5EE 1HR0I 2J7KA 2O1WA 1DARA 1WUUA 1BKNA 2EFGA 2O1TA 2V2VA 4DR2E 2F4VE 2CZ9A 1FKAE 4B3SE 1S4EA 4JI5I 4RPFA 4JI1E 3PYFA 3B82A 1Z5CA 3LNUA 4XTJA 1N34I 1RREA 3ZKDA 4LF8E 3WU3A 3QT6A 4LF7I 1ZM4A 5BR8I 3OTOE 3JAMC 2VQFE 5LL6R 4DR7I 4OX9E 4WUDA 1IBME 1HR0E 1H7SA 4DV3I 4DUZI 4YY3I 4HACB 2E1RA 3V5RA 2V34A 3ZM7A 1PKPA 4JI5E 1HK7A 1ZM9A 4LF9I 4HYMA 1U2RA 4JI0I 4LF5I 2HHHI 4FW9A 1A6FA 1N34E 4JI8I 4ED4A 1Z0EA 4FN5A 2O1UA 5FLXC 4LF7E 4JI7I 5BR8E 4LF4I 4IZJD 5LMUI 4JI2I 1Z0GA 4DV4E 1I94I 4FWHA 2UU9E 4X65I 4DV3E 4HXZA 4DUZE 4JI3I 4KQVA 3J81Q 3PRYA 3PYGA 4LF9E 4DU8A 2X36A 4PRXA 1HNZE 4JI0E 5FWKA 2HHHE 4LF5E 1FI4A 2V8PA 2Z5BB 2HK2A 5FLXQ 3ZZUA 4JI7E 4IZJA 4JI6I 4LF4E 5LMUE 2X7IA 1HNWI 4IZKB 3K17A 4JI2E 4NXNI 1I94E 4X65E 3B78A 1USVA 4DV7E 1S16A 4GKJE 2O1VA 2UUAI 4KHPE 4JYAI 2V2ZA 3HJCA 4DV1I 2IOPA 4R1FA 1Z0WA 1Z0TA 2E5LE 4DV5I 4N3OA 3QT8A 3J80C 1IBLE 1QZRA 1N0VC 2UXDI 4WUCA 3PYEA 2UXCI 4UT4A 4B3TI 4USKA 4K0KI 1HNWE 4DV6E 4NXNE 1N32E 1B63A 3WU5A 4LFBI 4DXLA 5IWAI 1MG7A 2GS8A 2ZM6I 4HACA 4DR1E 4JV5I 4M1KA 1XNRI 2HFUA 4DV2I 4UTGA 4ZVIA 4MYUA 1HNXI 2UUAE 4B3RI 3K1JA 1MU5A 4DV1E 2BM1A 2AJ4A 2CGEA 2BV3A 1K47A 3PYDA 4NXMI 4DUYI 2UXDE 2IOQA 1XNQI 5IT9C 4DR4I 4K0KE 3JAMQ 3D4JA 1FWLA 1KTVA 4LFBE 1Z5AA 5IWAE 4DR7E 2ZM6E 3T1YI 1ZM2A 4DPUA 4JV5E 1XNRE 4YY3E 2UUCI 4YHHI 1ZXNA 3Q6MA 3ZZTA 1KVKA 2R3VA 1HNXE 2UXBI 3M6AA 4DPYA 2VQEI 4Z7YA 2HKEA 4X66I 2DEIA 4DR5I 5A2QC 2LJPA 4JI8E 4DUYE 1J5EI 1H73A 2HFSA 3P06A 5L3JA 1XNQE 4IZKA 4X64I 3WU4A 4WUBA 1NHJA 1IBKI 1Y6ZA 1ELOA 3T1YE 1UEKA 1MX0A 4JI3E 3GONA 2UUCE 3F0NA 4YHHE 2Z5CB 2UXBE 4LF8I 2ZBKB 5GMEA 2GQ0A 2VQEE 4X66E 1H72C 2OI2A 1USUA 4P7AA 4DR5E 1FJGI 1H74A 4LFCI 1ZM3A 1VISA 4DPXA 4X64E 1EI1A 4DV0I 4JI6E 5LMNI 2BM0A 1IBKE 1ZXMA 3WU6A 4LFAI 4JI4I 3HULA 1EA6A 2A2DA 2HKJA 2V2QA 1PVGA 4DU7A 3J7AM 1N36I 4AQYI 5GMDA 2PNLA 4JYAE 4DR6I 2Q2EB 1Z59A 3T1HI 2HK3A 1FJGE 1Z0CA 4LFCE 4DV4I 4USMA 4DV5E 3J80Q 2UU9I 4LF6I 2UUBI 3LTOA 1XHKA 1Z0VA 2R42A 3V2UC 2UXCE 4DV0E 5LMNE 4B3TE 2PNMA 3Q6NA 3J81C 4GKKI 3Q1QA 4HY1A 1FNMA 1KIJA 2WW4A 4B3MI 4Z7CA 1B62A 1FWKA 4LFAE 1HNZI 4JI4E 3QT5A 1XMOI 4PU9A 4DPTA 4FWDA 4URLA 1N33I 1Y4UA 4DV2E 4FWGA 4P52A 1D6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NPF A;  4B3R E;  1XMQ I;  4AQY E;  1N36 E;  4DR6 E;  1OJ4 A;  3T1H E;  4DR3 I;  4JG4 A;  4I3H A;  2ZIT A;  4X62 I;  4LF6 E;  2UUB E;  1KKH A;  4NXM E;  1PIE A;  2DEJ A;  3J7A G;  5IT9 Q;  1H7U A;  1Z0B A;  2VF3 A;  3ZKB A;  4DR4 E;  4DV7 I;  2XEX A;  4GKJ I;  4GKK E;  4DR2 I;  2F4V I;  4B3S I;  4KHP I;  4B3M E;  3ZZ0 A;  4EMD A;  1NZ0 A;  1NHH A;  1XMO E;  3QT7 A;  4MYT A;  1NHI A;  4JI1 I;  1N33 E;  2E5L I;  1RR9 A;  3CWV A;  1IBL I;  3B8H A;  4PRV A;  1XMQ E;  3H4L A;  3LPS A;  2A2C A;  4DPW A;  3OTO I;  2VQF I;  4DV6 I;  1Z5B A;  4DR3 E;  1N0U A;  5A2Q Q;  1N32 I;  4X62 E;  4OX9 I;  1IBM I;  4DR1 I;  1J5E E;  1HR0 I;  2J7K A;  1DAR A;  1WUU A;  1BKN A;  2EFG A;  2V2V A;  4DR2 E;  2F4V E;  2CZ9 A;  1FKA E;  4B3S E;  1S4E A;  4JI5 I;  4RPF A;  4JI1 E;  3PYF A;  3B82 A;  1Z5C A;  3LNU A;  4XTJ A;  1N34 I;  1RRE A;  3ZKD A;  4LF8 E;  3WU3 A;  3QT6 A;  4LF7 I;  1ZM4 A;  5BR8 I;  3OTO E;  3JAM C;  2VQF E;  5LL6 R;  4DR7 I;  4OX9 E;  4WUD A;  1IBM E;  1HR0 E;  1H7S A;  4DV3 I;  4DUZ I;  4YY3 I;  4HAC B;  2E1R A;  3V5R A;  2V34 A;  3ZM7 A;  1PKP A;  4JI5 E;  1ZM9 A;  4LF9 I;  4HYM A;  1U2R A;  4JI0 I;  4LF5 I;  2HHH I;  4FW9 A;  1A6F A;  1N34 E;  4JI8 I;  4ED4 A;  1Z0E A;  4FN5 A;  5FLX C;  4LF7 E;  4JI7 I;  5BR8 E;  4LF4 I;  5LMU I;  4JI2 I;  1Z0G A;  4DV4 E;  1I94 I;  4FWH A;  2UU9 E;  4X65 I;  4DV3 E;  4HXZ A;  4DUZ E;  4JI3 I;  4KQV A;  3J81 Q;  3PYG A;  4LF9 E;  4DU8 A;  2X36 A;  4PRX A;  1HNZ E;  4JI0 E;  4LF5 E;  2HHH E;  1FI4 A;  2V8P A;  2HK2 A;  5FLX Q;  3ZZU A;  4JI7 E;  4JI6 I;  4LF4 E;  5LMU E;  2X7I A;  1HNW I;  3K17 A;  4JI2 E;  4NXN I;  1I94 E;  4X65 E;  3B78 A;  4DV7 E;  1S16 A;  4GKJ E;  2UUA I;  4KHP E;  4JYA I;  2V2Z A;  4DV1 I;  4R1F A;  1Z0W A;  1Z0T A;  2E5L E;  4DV5 I;  3QT8 A;  3J80 C;  1IBL E;  1QZR A;  1N0V C;  2UXD I;  4WUC A;  3PYE A;  2UXC I;  4UT4 A;  4B3T I;  4USK A;  4K0K I;  1HNW E;  4DV6 E;  4NXN E;  1N32 E;  1B63 A;  3WU5 A;  4LFB I;  4DXL A;  5IWA I;  1MG7 A;  2GS8 A;  2ZM6 I;  4HAC A;  4DR1 E;  4JV5 I;  4M1K A;  1XNR I;  2HFU A;  4DV2 I;  4UTG A;  4ZVI A;  4MYU A;  1HNX I;  2UUA E;  4B3R I;  3K1J A;  1MU5 A;  4DV1 E;  2BM1 A;  2AJ4 A;  2BV3 A;  1K47 A;  3PYD A;  4NXM I;  4DUY I;  2UXD E;  1XNQ I;  5IT9 C;  4DR4 I;  4K0K E;  3JAM Q;  3D4J A;  1FWL A;  1KTV A;  4LFB E;  1Z5A A;  5IWA E;  4DR7 E;  2ZM6 E;  3T1Y I;  1ZM2 A;  4DPU A;  4JV5 E;  1XNR E;  4YY3 E;  2UUC I;  4YHH I;  1ZXN A;  3ZZT A;  1KVK A;  2R3V A;  1HNX E;  2UXB I;  3M6A A;  4DPY A;  2VQE I;  4Z7Y A;  2HKE A;  4X66 I;  2DEI A;  4DR5 I;  5A2Q C;  2LJP A;  4JI8 E;  4DUY E;  1J5E I;  1H73 A;  2HFS A;  5L3J A;  1XNQ E;  4X64 I;  3WU4 A;  4WUB A;  1NHJ A;  1IBK I;  1ELO A;  3T1Y E;  1UEK A;  1MX0 A;  4JI3 E;  3GON A;  2UUC E;  3F0N A;  4YHH E;  2UXB E;  4LF8 I;  2ZBK B;  5GME A;  2VQE E;  4X66 E;  1H72 C;  2OI2 A;  4P7A A;  4DR5 E;  1FJG I;  1H74 A;  4LFC I;  1ZM3 A;  1VIS A;  4DPX A;  4X64 E;  1EI1 A;  4DV0 I;  4JI6 E;  5LMN I;  2BM0 A;  1IBK E;  1ZXM A;  3WU6 A;  4LFA I;  4JI4 I;  3HUL A;  1EA6 A;  2A2D A;  2HKJ A;  2V2Q A;  1PVG A;  4DU7 A;  3J7A M;  1N36 I;  4AQY I;  5GMD A;  4JYA E;  4DR6 I;  2Q2E B;  1Z59 A;  3T1H I;  2HK3 A;  1FJG E;  1Z0C A;  4LFC E;  4DV4 I;  4USM A;  4DV5 E;  2UU9 I;  3J80 Q;  4LF6 I;  2UUB I;  3LTO A;  1XHK A;  1Z0V A;  2R42 A;  3V2U C;  2UXC E;  4DV0 E;  5LMN E;  4B3T E;  3J81 C;  4GKK I;  3Q1Q A;  4HY1 A;  1FNM A;  1KIJ A;  2WW4 A;  4B3M I;  4Z7C A;  1B62 A;  1FWK A;  4LFA E;  1HNZ I;  4JI4 E;  3QT5 A;  1XMO I;  4PU9 A;  4DPT A;  4FWD A;  4URL A;  1N33 I;  4DV2 E;  4FWG A;  4P52 A;  1D6T A; 
#chains in the Genus database with same CATH topology
 2NPF A;  4B3R E;  1XMQ I;  4AQY E;  1N36 E;  3M85 D;  4DR6 E;  1OJ4 A;  4FW4 A;  3T1H E;  3P76 A;  4DR3 I;  4JG4 A;  5JEA B;  4I3H A;  2BR2 A;  3K85 A;  2CG9 A;  2Z5B A;  2PO2 A;  2ZIT A;  4X62 I;  4LF6 E;  2UUB E;  1KKH A;  4NXM E;  1PIE A;  2DEJ A;  3J7A G;  1Y4S A;  5IT9 Q;  1H7U A;  1Z0B A;  2VF3 A;  3ZKB A;  4DR4 E;  4DV7 I;  2XEX A;  2Z5E A;  3U1Y A;  4GKJ I;  4GKK E;  4DR2 I;  2F4V I;  1OYP A;  4B3S I;  4B3M E;  4KHP I;  2PNZ A;  3ZZ0 A;  4EMD A;  1NZ0 A;  1UDS A;  1NHH A;  5EL9 A;  4OKG A;  1XMO E;  3QT7 A;  4MYT A;  1NHI A;  3M7N D;  3PS1 A;  4IFD B;  1XXE A;  2PO1 B;  2Z5C A;  4JI1 I;  1N33 E;  2E5L I;  1RR9 A;  4BA1 A;  3CWV A;  1IBL I;  3GME A;  3B8H A;  4PRV A;  1XMQ E;  3H4L A;  3LPS A;  2AE8 A;  1E3P A;  1R6L A;  2A2C A;  4DPW A;  3OTO I;  2VQF I;  4DV6 I;  4QNK A;  1Z5B A;  4IZJ B;  4DR3 E;  1N0U A;  5A2Q Q;  1N32 I;  5K36 B;  2PO0 B;  4X62 E;  4OO1 B;  4OX9 I;  1IBM I;  4DR1 I;  1J5E E;  1HR0 I;  1UDN A;  2J7K A;  2O1W A;  1DAR A;  1WUU A;  5JEA C;  1BKN A;  2EFG A;  2O1T A;  2V2V A;  4DR2 E;  2GO3 A;  2F4V E;  4U3B A;  2CZ9 A;  4NBQ A;  1FKA E;  4B3S E;  1S4E A;  4JI5 I;  3NZK A;  4FW6 A;  4RPF A;  2C39 A;  2JE6 B;  4MQY A;  4JI1 E;  3PYF A;  3B82 A;  1Z5C A;  3LNU A;  4XTJ A;  1N34 I;  3P3E A;  1RRE A;  3ZKD A;  4LF8 E;  3WU3 A;  2WNR B;  3QT6 A;  1OYS A;  2JEB A;  4LF7 I;  1ZM4 A;  5BR8 I;  3OTO E;  3JAM C;  2VQF E;  1UDO A;  2C37 A;  5LL6 R;  4U3D A;  4DR7 I;  4OX9 E;  4WUD A;  1IBM E;  1HR0 E;  1H7S A;  4DV3 I;  4DUZ I;  4YY3 I;  4HAC B;  2E1R A;  3V5R A;  2V34 A;  5K36 C;  4BA2 A;  3ZM7 A;  1PKP A;  3B4T A;  4JI5 E;  1HK7 A;  1ZM9 A;  4LF9 I;  4HYM A;  1U2R A;  2NN6 D;  4IFD D;  4JI0 I;  5C0X C;  4LF5 I;  2HHH I;  4FW5 A;  4FW9 A;  1A6F A;  1N34 E;  4JI8 I;  4AIM A;  4ED4 A;  1Z0E A;  4FN5 A;  2O1U A;  5FLX C;  4LF7 E;  4JI7 I;  5BR8 E;  4LF4 I;  4IZJ D;  5LMU I;  5DRR A;  4JI2 I;  1Z0G A;  2NN6 E;  5K36 D;  4J3D A;  4DV4 E;  1I94 I;  4OO1 D;  4FWH A;  2UU9 E;  4X65 I;  4DV3 E;  2WP8 B;  4HXZ A;  4DUZ E;  4JI3 I;  1RHY A;  4KQV A;  3J81 Q;  3L7Z A;  3PRY A;  3PYG A;  3M85 G;  2NN6 F;  3GLL A;  2NN6 A;  4LF9 E;  4IFD F;  2F1D A;  4DU8 A;  4IFD A;  2X36 A;  4PRX A;  1HNZ E;  4JI0 E;  4LCF A;  5FWK A;  2HHH E;  4LF5 E;  1OYR A;  1FI4 A;  2V8P A;  2Z5B B;  2HK2 A;  5FLX Q;  1UDQ A;  3ZZU A;  4JI7 E;  3PS2 A;  4IZJ A;  4JI6 I;  5K36 F;  4LF4 E;  5LMU E;  5K36 A;  2X7I A;  4LCG A;  2PO0 A;  4GQU A;  1HNW I;  4IZK B;  3K17 A;  4OO1 F;  4JI2 E;  4NXN I;  4OO1 A;  1I94 E;  2CVE A;  4X65 E;  3M7N G;  3B78 A;  2BA1 D;  5DNX A;  1USV A;  4DV7 E;  2JT2 A;  1S16 A;  4BA1 B;  5C0X B;  4MU0 A;  4GKJ E;  2O1V A;  5EKW A;  2UUA I;  4KHP E;  5DRQ A;  4JYA I;  2V2Z A;  3HJC A;  4DV1 I;  2IOP A;  4FW3 A;  4R1F A;  1Z0W A;  1Z0T A;  2E5L E;  4DV5 I;  2WNR A;  4N3O A;  3QT8 A;  3J80 C;  1IBL E;  1QZR A;  2BA1 G;  1N0V C;  3U1K A;  2UXD I;  4WUC A;  3PYE A;  2UXC I;  4UT4 A;  4B3T I;  4USK A;  4K0K I;  1HNW E;  3UHM A;  4DV6 E;  4NXN E;  5JEA D;  4FW7 A;  1N32 E;  1B63 A;  3WU5 A;  4LFB I;  4DXL A;  5IWA I;  1MG7 A;  2GS8 A;  2ZM6 I;  2C39 B;  4HAC A;  1Y60 A;  2GO4 A;  4DR1 E;  4JV5 I;  4M1K A;  1XNR I;  2C38 B;  2HFU A;  4DV2 I;  4UTG A;  4ZVI A;  4MYU A;  1HNX I;  2UUA E;  4B3R I;  3K1J A;  5JEA E;  1MU5 A;  1E3H A;  4DV1 E;  2BM1 A;  2AJ4 A;  2CGE A;  2BV3 A;  2C37 B;  1K47 A;  4MU3 A;  5DRO A;  2VES A;  3PYD A;  4NXM I;  4DUY I;  2UXD E;  1YHC A;  2IOQ A;  1XNQ I;  2J65 A;  5IT9 C;  4DR4 I;  4K0K E;  3JAM Q;  3GCM A;  5JEA F;  3KRN A;  5JEA A;  3D4J A;  1FWL A;  1KTV A;  4LFB E;  1Z5A A;  5IWA E;  2WP8 A;  4IFD E;  4DR7 E;  2ZM6 E;  3T1Y I;  1ZM2 A;  4AM3 A;  4DPU A;  4JV5 E;  1XNR E;  4YY3 E;  2UUC I;  5C0X D;  4YHH I;  1ZXN A;  3Q6M A;  3ZZT A;  1KVK A;  2R3V A;  1HNX E;  2UXB I;  2IES A;  3M6A A;  4AID A;  4DPY A;  2VQE I;  4Z7Y A;  2JEA B;  5K36 E;  2HKE A;  4X66 I;  2DEI A;  2PO1 A;  4LOM A;  1R6M A;  4OO1 E;  1VI7 A;  2IER A;  4DR5 I;  5A2Q C;  2LJP A;  4JI8 E;  3DD6 A;  2BR2 B;  4DUY E;  1J5E I;  4OZE A;  5DNL A;  2O3Z A;  1H73 A;  2PO2 B;  2HFS A;  5C0X E;  3P06 A;  1YH8 A;  5L3J A;  1XNQ E;  4IZK A;  4X64 I;  3WU4 A;  2BA0 D;  4WUB A;  1NHJ A;  1IBK I;  3L7Z B;  1Y6Z A;  1ELO A;  4IS9 A;  3T1Y E;  2PNZ B;  2NN6 B;  1UEK A;  5ELW A;  5C0X F;  1MX0 A;  5C0X A;  4JI3 E;  3GON A;  2UUC E;  3F0N A;  4YHH E;  1Y5Y A;  2Z5C B;  2UXB E;  4LF8 I;  3CDJ A;  2ZBK B;  5GME A;  2JE6 A;  2GQ0 A;  2VQE E;  4X66 E;  2BA0 G;  3P3C A;  1H72 C;  2OI2 A;  3CDI A;  1USU A;  4LCH A;  4P7A A;  5DRP A;  4DR5 E;  1H74 A;  1FJG I;  4LFC I;  1ZM3 A;  1VIS A;  4DPX A;  4X64 E;  1EI1 A;  4QNJ A;  4DV0 I;  4JI6 E;  5LMN I;  2BM0 A;  1IBK E;  1ZXM A;  4MDT A;  3HKM A;  3WU6 A;  4LFA I;  2C38 A;  4JI4 I;  3HUL A;  1EA6 A;  3P3G A;  2A2D A;  2HKJ A;  3PS3 A;  2V2Q A;  1PVG A;  2NN6 C;  4DU7 A;  3H1C A;  3J7A M;  4IFD C;  1N36 I;  4AQY I;  5GMD A;  2PNL A;  4JYA E;  4DR6 I;  2Q2E B;  1Z59 A;  2JEB B;  3T1H I;  2HK3 A;  1FJG E;  4MU4 A;  1Z0C A;  4LFC E;  4MU1 A;  4DV4 I;  4USM A;  4DV5 E;  3J80 Q;  2UU9 I;  4LF6 I;  2UUB I;  3LTO A;  1XHK A;  1Z0V A;  4ISA A;  2R42 A;  3V2U C;  2UXC E;  1P42 A;  4DV0 E;  5LMN E;  4B3T E;  2PNM A;  2JEA A;  3Q6N A;  3J81 C;  4OO1 C;  4GKK I;  3Q1Q A;  4HY1 A;  1FNM A;  4LPF A;  1KIJ A;  2WW4 A;  4B3M I;  4BA2 B;  4Z7C A;  1B62 A;  1FWK A;  4LFA E;  1HNZ I;  4JI4 E;  3QT5 A;  1XMO I;  4PU9 A;  4DPT A;  4FWD A;  4URL A;  1N33 I;  1Y4U A;  4DV2 E;  4FWG A;  4P52 A;  1D6T A; 
#chains in the Genus database with same CATH homology
 2NPF A;  4B3R E;  1XMQ I;  4AQY E;  1N36 E;  4DR6 E;  1OJ4 A;  3T1H E;  4DR3 I;  4JG4 A;  4I3H A;  3K85 A;  2CG9 A;  2Z5B A;  2ZIT A;  4X62 I;  4LF6 E;  2UUB E;  1KKH A;  4NXM E;  1PIE A;  2DEJ A;  3J7A G;  1Y4S A;  5IT9 Q;  1H7U A;  1Z0B A;  2VF3 A;  3ZKB A;  4DR4 E;  4DV7 I;  2XEX A;  2Z5E A;  4GKJ I;  4GKK E;  4DR2 I;  2F4V I;  4B3S I;  4KHP I;  4B3M E;  3ZZ0 A;  4EMD A;  1NZ0 A;  1NHH A;  1XMO E;  3QT7 A;  4MYT A;  1NHI A;  2Z5C A;  4JI1 I;  1N33 E;  2E5L I;  1RR9 A;  3CWV A;  1IBL I;  3B8H A;  4PRV A;  1XMQ E;  3H4L A;  3LPS A;  2A2C A;  4DPW A;  3OTO I;  2VQF I;  4DV6 I;  1Z5B A;  4IZJ B;  4DR3 E;  1N0U A;  5A2Q Q;  1N32 I;  4X62 E;  4OX9 I;  1IBM I;  4DR1 I;  1J5E E;  1HR0 I;  2J7K A;  2O1W A;  1DAR A;  1WUU A;  1BKN A;  2EFG A;  2O1T A;  2V2V A;  4DR2 E;  2F4V E;  2CZ9 A;  1FKA E;  4B3S E;  1S4E A;  4JI5 I;  4RPF A;  4JI1 E;  3PYF A;  3B82 A;  1Z5C A;  3LNU A;  4XTJ A;  1N34 I;  1RRE A;  3ZKD A;  4LF8 E;  3WU3 A;  3QT6 A;  4LF7 I;  1ZM4 A;  5BR8 I;  3OTO E;  3JAM C;  2VQF E;  5LL6 R;  4DR7 I;  4OX9 E;  4WUD A;  1IBM E;  1HR0 E;  1H7S A;  4DV3 I;  4DUZ I;  4YY3 I;  4HAC B;  2E1R A;  3V5R A;  2V34 A;  3ZM7 A;  1PKP A;  4JI5 E;  1HK7 A;  1ZM9 A;  4LF9 I;  4HYM A;  1U2R A;  4JI0 I;  4LF5 I;  2HHH I;  4FW9 A;  1A6F A;  1N34 E;  4JI8 I;  4ED4 A;  1Z0E A;  4FN5 A;  2O1U A;  5FLX C;  4LF7 E;  4JI7 I;  5BR8 E;  4LF4 I;  4IZJ D;  5LMU I;  4JI2 I;  1Z0G A;  4DV4 E;  1I94 I;  4FWH A;  2UU9 E;  4X65 I;  4DV3 E;  4HXZ A;  4DUZ E;  4JI3 I;  4KQV A;  3J81 Q;  3PRY A;  3PYG A;  4LF9 E;  4DU8 A;  2X36 A;  4PRX A;  1HNZ E;  4JI0 E;  5FWK A;  2HHH E;  4LF5 E;  1FI4 A;  2V8P A;  2Z5B B;  2HK2 A;  5FLX Q;  3ZZU A;  4JI7 E;  4IZJ A;  4JI6 I;  4LF4 E;  5LMU E;  2X7I A;  1HNW I;  4IZK B;  3K17 A;  4JI2 E;  4NXN I;  1I94 E;  4X65 E;  3B78 A;  1USV A;  4DV7 E;  1S16 A;  4GKJ E;  2O1V A;  2UUA I;  4KHP E;  4JYA I;  2V2Z A;  3HJC A;  4DV1 I;  2IOP A;  4R1F A;  1Z0W A;  1Z0T A;  2E5L E;  4DV5 I;  4N3O A;  3QT8 A;  3J80 C;  1IBL E;  1QZR A;  1N0V C;  2UXD I;  4WUC A;  3PYE A;  2UXC I;  4UT4 A;  4B3T I;  4USK A;  4K0K I;  1HNW E;  4DV6 E;  4NXN E;  1N32 E;  1B63 A;  3WU5 A;  4LFB I;  4DXL A;  5IWA I;  1MG7 A;  2GS8 A;  2ZM6 I;  4HAC A;  4DR1 E;  4JV5 I;  4M1K A;  1XNR I;  2HFU A;  4DV2 I;  4UTG A;  4ZVI A;  4MYU A;  1HNX I;  2UUA E;  4B3R I;  3K1J A;  1MU5 A;  4DV1 E;  2BM1 A;  2AJ4 A;  2CGE A;  2BV3 A;  1K47 A;  3PYD A;  4NXM I;  4DUY I;  2UXD E;  2IOQ A;  1XNQ I;  5IT9 C;  4DR4 I;  4K0K E;  3JAM Q;  3D4J A;  1FWL A;  1KTV A;  4LFB E;  1Z5A A;  5IWA E;  4DR7 E;  2ZM6 E;  3T1Y I;  1ZM2 A;  4DPU A;  4JV5 E;  1XNR E;  4YY3 E;  2UUC I;  4YHH I;  1ZXN A;  3Q6M A;  3ZZT A;  1KVK A;  2R3V A;  1HNX E;  2UXB I;  3M6A A;  4DPY A;  2VQE I;  4Z7Y A;  2HKE A;  4X66 I;  2DEI A;  4DR5 I;  5A2Q C;  2LJP A;  4JI8 E;  4DUY E;  1J5E I;  1H73 A;  2HFS A;  3P06 A;  5L3J A;  1XNQ E;  4IZK A;  4X64 I;  3WU4 A;  4WUB A;  1NHJ A;  1IBK I;  1Y6Z A;  1ELO A;  3T1Y E;  1UEK A;  1MX0 A;  4JI3 E;  3GON A;  2UUC E;  3F0N A;  4YHH E;  2Z5C B;  2UXB E;  4LF8 I;  2ZBK B;  5GME A;  2GQ0 A;  2VQE E;  4X66 E;  1H72 C;  2OI2 A;  1USU A;  4P7A A;  4DR5 E;  1FJG I;  1H74 A;  4LFC I;  1ZM3 A;  1VIS A;  4DPX A;  4X64 E;  1EI1 A;  4DV0 I;  4JI6 E;  5LMN I;  2BM0 A;  1IBK E;  1ZXM A;  3WU6 A;  4LFA I;  4JI4 I;  3HUL A;  1EA6 A;  2A2D A;  2HKJ A;  2V2Q A;  1PVG A;  4DU7 A;  3J7A M;  1N36 I;  4AQY I;  5GMD A;  2PNL A;  4JYA E;  4DR6 I;  2Q2E B;  1Z59 A;  3T1H I;  2HK3 A;  1FJG E;  1Z0C A;  4LFC E;  4DV4 I;  4USM A;  4DV5 E;  3J80 Q;  2UU9 I;  4LF6 I;  2UUB I;  3LTO A;  1XHK A;  1Z0V A;  2R42 A;  3V2U C;  2UXC E;  4DV0 E;  5LMN E;  4B3T E;  2PNM A;  3Q6N A;  3J81 C;  4GKK I;  3Q1Q A;  4HY1 A;  1FNM A;  1KIJ A;  2WW4 A;  4B3M I;  4Z7C A;  1B62 A;  1FWK A;  4LFA E;  1HNZ I;  4JI4 E;  3QT5 A;  1XMO I;  4PU9 A;  4DPT A;  4FWD A;  4URL A;  1N33 I;  1Y4U A;  4DV2 E;  4FWG A;  4P52 A;  1D6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...