4JI2T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4ji2T00
4LF4T 4DV2T 2UU9T 2UUCT 4DV1T 4LFCT 1N34T 1IBMT 1HNWT 2VQET 4X62T 4DUYT 1HNXT 4GKJT 4X64T 4DR7T 3T1HT 4JI1T 4JI3T 4JI4T 2UXCT 1XNQT 2UXBT 1I94T 4B3ST 4GKKT 5LMNT 4LFAT 4JYAT 4LF8T 4DR6T 4OX9T 1N36T 1N32T 4DV5T 4DV4T 2UUAT 4DR2T 4B3MT 1IBLT 4JV5T 4LF7T 1XMQT 4JI0T 1HR0T 4LFBT 4X66T 4DV6T 2UXDT 4JI5T 4YY3T 4JI6T 4DUZT 1J5ET 4YHHT 4B3RT 4DR5T 4DV7T 1XNRT 4DV3T 4X65T 2HHHT 4KHPT 4DR4T 5IWAT 4K0KT 5BR8T 2E5LT 2F4VT 1IBKT 4LF6T 1N33T 4B3TT 4JI2T 1FJGT 4DR3T 3T1YT 3OTOT 2VQFT 4AQYT 4NXMT 4JI7T 4NXNT 4LF9T 4JI8T 5LMUT 1XMOT 4DR1T 4LF5T 4DV0T 2ZM6T 1HNZT 2UUBT
chains in the Genus database with same CATH superfamily
4H63V 2XZEA 1QUUA 4K0UA 5AQFB 3Q5XA 1T98A 4PJLA 4ERRA 3UT5E 2CXDA 2IAKA 2VVNA 5EK3A 5KDMC 2V7MA 2X51A 2UXBT 2HN2A 4MFRA 4IE7A 2VKHA 1XDOA 4LF8T 2FBWA 4ILUA 3UUMA 3J7Yq 2VKOA 1L0VA 2BG9C 3CQXC 5HXRA 4IE5A 4AKGA 2E2AA 2ZLYA 3RYFE 3ZN1B 4QXCB 4B3RT 4P09A 4DV7T 1WCRA 4QH5A 2X68A 1WYCA 3UU4A 5FXVA 3L8RA 3V5UA 2XQYA 2CHOA 2L8KA 1EZ3A 3AA6B 3ZT7A 3RF1A 2BKPA 2FJBA 4EYUA 3TLTA 3PUGA 2DL1A 2X9YA 2NOXA 3B57A 2KWHA 2BG9E 3AE1A 4MBQA 2V5DA 1KNPA 4CQIA 3PUVF 2XUEA 2UUCT 3CQGB 3P4PA 1WR6A 3QB5K 2WS3A 5L2LA 5JDLA 2X9WA 4ZS3A 3HKDE 4IIJE 4B6XA 3RC3A 2BVMA 4X62T 3N9MA 5JREA 2CCQA 4JI1T 5F5WA 4KP3C 2A72A 4BAYB 1HFAA 2KSRA 2CBJA 2Y48B 3DTOA 2N2NA 4DR2T 4B3MT 2I0MA 3NZQA 2UXNB 1HX1B 4IT4A 2FJAA 3BQLA 5ABFB 1HTJF 1YW0A 4AISA 3VKGA 3C51A 3ZMSB 5LP6E 2XQ8A 5JDNA 2CA5A 1VCSA 3KBTA 2P9BA 3UU8A 4CN4A 3AXJA 3MZKB 3AEDA 3O4XE 2MTQA 3AE3A 4ADZA 4PK6A 2MYSA 2VL8A 4EEBA 1WYBA 3E0ZA 5DQWA 1XWMA 2IW5B 4CI3B 5FP3A 4E7SA 3PJAJ 1KF6A 2LKGA 3IA3A 3SS1A 4U7YA 1G73A 2VURA 2B76A 4ZXLA 4JI7T 5JRCA 2V1DB 4WBOA 5LBQB 3PUQA 3L3PA 2WSSV 2UU9T 2EHOD 2JQ9A 3S4UA 1ZEEA 1YQ3A 5A1LA 2IHR1 4DO0A 3AE5A 2WWUA 3AE2A 3E22E 1S94A 4A98A 3BQKA 2LOSA 4DBQA 5HXCA 3UUXB 2X66A 3AEAA 3ZC1A 3AB3B 4IGUA 2IC6A 4ZI3D 4U2ZA 4G63A 3ZN0B 5C8YE 3F57A 3ZSTA 4LMLA 2K24A 3W15B 3MKDA 3HKCE 3AAEB 3VRAA 5LGTB 4O8SA 4TNVA 5LOVE 4AKIA 4M1PA 2XQ3A 4HFIA 3AECA 2PBIA 3UQ7A 1HG5A 2CXLA 3M3ZB 3DP7A 4I50E 4DMVA 3U3IA 2V6YA 3I9WA 3ZCJA 3PURA 3B13A 2H88A 3QC9A 2WY2A 3QUJA 5CFBA 4AQFA 1IZNB 2ODVA 2BKOA 1WFDA 2CWYA 4A97A 2JPFA 5J2UE 1E2AA 3EDUA 4I0UA 3V5SA 1CHUA 2V7JA 5L4EA 2SPCA 4Q25A 4KHZF 5KMGP 3K3NA 4UF0B 4KMCA 2J1DG 5JDMA 1U4QA 1WR0A 4UIGA 5EZYE 5KXJA 3N5LA 1H7CA 2JMHA 4ISTA 1LVKA 5L3FB 3AVRA 2Q9QC 1HNXT 4YJ3E 2PFVA 4DR7T 5FL1A 3CWZB 4YHJA 4U3CA 5AQGB 4O4HE 1YQ4A 3IBPA 3RX6A 2CLYC 3K8PC 5LGNB 1N36T 2WDQA 5AQNB 4IL9A 2E9XC 1HG2A 3AA7B 1DU2A 4PJJA 4HWFA 1S35A 3NVOA 3WI3A 2CPTA 2W2UA 4U7IA 3ZSSA 3ZEFB 1BR4A 4DR5T 3N2KE 4A5XA 5ABEA 3J9X1 1D0XA 3F31A 4X65T 2BVLA 2LE8A 4KHPT 4OHFA 5JR9C 4HFVA 2YK0A 2F4VT 2XQ7A 1UX4A 3RQUA 3UFEA 3IEEA 2CBIA 3EAMA 5GONE 4BJMA 1MIYA 4HWHA 1B7TA 4HTEA 2KZ7B 5LBMA 4CN1A 5AQKB 2Y8DA 2YEVC 3ETVA 2CEAA 4NXMT 5FYMA 4NXNT 2MBGA 4CZZB 3MJXA 3KV5A 1YXRA 2ZM6T 5HWYA 5AQRB 2WBLA 4UR9A 4IDOA 4PK5A 2KT9A 1MNDA 2V26A 3ZT5A 3PUWF 2XQAA 2M6BA 1ZKEA 4O4IE 5FVLA 2V7IA 3QOFA 4P0AA 1HNWT 1MIVA 4L9IA 4UVCB 1X9BA 1M7KA 2XM2A 2L9QA 3FBLA 4IE6A 4ZZCA 3AE6A 2CM0A 3X1DA 4HN9A 2OLTA 3FZMB 4KX6A 2DWGA 4WNKA 4Z8XA 5AQUB 2K48A 3CPZA 4O4LE 4HFHA 5AQHB 4GYRA 4JI0T 1HR0T 5C3JA 2CRBA 4DV6T 4HFDA 3PDYA 4BJNA 1SUMB 3LK3B 4GYSA 5JDFA 4HE8A 1NAFA 1J5WA 3HKEE 3SFEA 4AXPA 5IYZE 2JRKA 3P4RA 3TKLB 2K5BB 5LA6E 3UFGA 4UELA 2H89A 4AQYT 1KNZA 3RRWA 5HEUA 3PUSA 4LF9T 3AVSA 2BKNA 2EHOC 5CB4E 2J47A 4YLHA 2BS4A 3O1JA 3QK6A 4TZ4C 1D0YA 3HR0A 3QB5A 2M6IA 2V6XA 3VU7H 5BMVE 4EYYR 2X67A 4ZI3C 4PFPA 3A8YC 2KINB 4UXNB 3VRBA 1OEDB 4OX9T 3Q5EA 3E08A 5DJQC 3ZYMA 2BZBA 1SHZC 5J2TE 1MMNA 3N2GE 3P8CD 4TWDA 1R8IA 2LM9A 1HX8A 1NENA 2ZM8A 2Q9QD 3GMIA 4PNIA 5JDHA 3RIUC 1CUNA 2JMKA 5F8PA 5CA1E 4ZHQE 2KXPB 4WW0A 4DR4T 2L3LA 4EGWA 2E9XD 3KINB 1YKHB 1ZHCA 2B1EA 2CWOA 5LG3A 4TV9E 4COFA 3ZMVB 2BG9B 1W9RA 1YKEB 2BBJA 4LF5T 3GWHA 4IDQA 2UUBT 4XAXB 4H9NC 1UCUA 5LHGB 3RLFF 3RKGA 2XAFB 4AKRB 4E7ZA 2VWAA 4X1KE 1XDPA 3EDVA 1UK5A 2X9XA 5J1GA 5M4YA 3PV0F 1FMWA 2K9AA 4LMKA 2NTYA 2NW8A 4LMJA 4AIUA 1QLBA 4WYVA 5ABFA 4TX5A 4H9PC 3P4SA 3M65A 3TLSA 4ZI7E 2RPAA 1NWMX 4ILBA 4TV8E 3UQ4A 4CI2B 4HFCA 1Z8UA 1J5ET 4YHHT 2W00A 5LNKA 3ABVA 3ZYKA 3VHLA 5JVDE 2E5LT 3P7IA 1VCTA 2MPKA 4LF6T 2ZM0A 1OXZA 1SA0E 4DR3T 4QXHB 2XTLA 4G2AA 3P4WA 2LHNA 5LMUT 1XMOT 3C98B 3KV9A 5L47A 3JC6C 3UU3A 4LF4T 5JDQA 2LSKA 2N1GA 3MK7C 4DV1T 4LFCT 3ZC0A 1IBMT 3OYXA 1WRDA 3N9QA 4IL4A 5FXZA 4DUYT 4N78D 3RPUA 1LKXA 5JDGA 3PU8A 2E5VA 3R6NA 4L0RA 2WCAA 5HYAA 2FJDA 1NEKA 3AEFA 5FVKA 1E7PA 5TAOA 2OV9A 3N9NA 2V8SV 3H3MA 2WB5A 5AQVB 3NKZA 3HA4A 3F2EA 1T8BA 3Q9DA 2XAHB 3O1IA 5LHHB 4UEMA 3SOLA 4WZXA 4DUZT 1D1AA 5CA0E 4HEAA 4YSZA 2AE9A 2WQYA 2D2SA 3GN5B 4K0KT 2KLQA 4EEDA 2ACZA 4PJNA 4KUMB 3CX6B 4ZS2A 2D0UA 2WDVA 5ADXL 4Z90A 4JI2T 3MACA 4I55E 3T1YT 3C64A 3OTOT 4QKNA 4DBRA 3NRXA 4XBFB 3U78A 4QX7B 4JI8T 5IHYA 2GK9A 1AJ3A 2NR4A 3EUHA 1VRBA 4UF0A 2CE7A 4GOUA 3RHWA 3KVAA 4CXXA 3LBXB 2NW9A 5L3BB 2XSAA 3RYHE 3FXDB 4TUYE 2XPKA 2VQET 2H7OA 4ASKA 3ONLC 3ANWB 4ILAA 4O2BE 3C4ZA 4AI6A 3K1SA 2C5IT 2NTXA 4DR6T 4PJMA 4EXTA 2XM1A 3Q5WA 4NUVA 1G8XA 4XZCA 4O4JE 2LRKA 4YY3T 2LSJA 2W63A 5HEOA 2A3DA 2Q9QB 4YFSA 3HL6A 1D1CA 5IWAT 3ZMZB 4JEUB 2QYWA 4HFBA 1IBKT 2A2FX 2JQHA 1FIOA 1Y01A 2CLYB 1N33T 3CIRA 4YSXA 4YT0A 4QWNB 4EIWA 2E9XB 4A56A 5FL0A 4UV8B 5HCMA 5L3EB 1ZV4X 3ZYLA 4YTPA 1LRZA 2DHRA 3OJAA 2XSBA 4X20E 1WLXA 2WU2A 4IE0A 4GKJT 5JR9B 2V7KA 5HEHA 2D5UA 2ZMAA 4HFEA 1W0AA 3ZLIA 4JI4T 3PUZF 2LM2A 4ZOLE 3B5MA 3JC6D 1IJ6A 5H6RB 4LFAT 2NW7A 3Q5DA 4DV5T 3NZPA 2LHRA 1IBLT 4F6RC 3UUBA 3HI2A 3EHZA 2DCFA 4EV6A 2NWBA 3KFWX 1V9DA 4EAHA 2W0GA 2VL0A 2AXDS 4TNWA 3AE9A 2QA7A 2UXDT 1MNEA 5LB7B 3LDQB 2RA1A 4CXWA 2K3WA 5AQLB 3GA8A 5HXSA 1UX5A 3JAEA 3MXZA 2W62A 3AAAB 5L4HA 2C5JA 3CVRA 4BA9A 2WU5A 5FY0A 3AE8A 4IE4A 1M62A 4EZ4A 5ABHA 3KV6A 1Z0PA 1T7SA 2X9HA 3EVYA 4IDPA 5L3GB 5AQOB 2LSYA 2KWIB 3AA1B 3AEEA 2YU2A 2LEHA 4MHCA 1N34T 5LG4A 5CGMA 4Z91A 4YTNA 2YDRA 4X64T 3T1HT 3ZMUB 3FBZA 2CHNA 4AKLA 3N9PA 4C91A 2ES0A 3KBUA 4EB6E 2HN1A 1OEDA 1N32T 3I0OA 3OPCA 3WAKA 3ZJ2A 2CXFA 3VR9A 1XZYA 3VKHA 2EHOB 3VR8A 3FB2A 5AQQB 2WAUA 4OYJA 3DJBA 2YDSA 5HXHA 3RYIE 1VOMA 2D9DA 4L5GA 2WP9A 3SRZA 5HCJA 1IJ5A 4DVDA 5AQSB 2WM9A 3RIUA 3AA0B 3Q2MA 5ETWA 4NIQA 2KNDA 2XQ6A 5LYJE 3NRYA 5HAXA 2D0TA 1X79A 4ILCA 5LGUB 3SFDA 4U2YA 2BG9A 1I6ZA 1US7B 2LJLA 4TWFA 4EZHA 2DWKA 4HGAA 4PK4A 4JBWF 1OEDE 4IREA 1D0ZA 3L09A 4X1YE 4QX8B 5CJ5A 3CX8B 3C50A 2QGSA 3ZCIA 4V1Av 2XAGB 2OA5A 5LXTE 5LCYA 4CN6A 4GKKT 1O3XA 3FZKB 2XHEB 3ONXA 3AE7A 1OWAA 2C5KT 2N9DA 3ZMTB 4CXYA 4X1IE 5FXWA 2J62A 1MIWA 1UGOA 4LF7T 2W4XA 4YTMA 1MMAA 3CK6A 4JI5T 5HWXA 2YN6A 4OFZA 2LOPA 3QNUA 5FY1A 2HPLA 5L3DB 2H3RA 4I4TE 4DV3T 5FXXA 3ZJ1A 4QH1A 3UU5A 5F3JA 4H63H 5IUXA 5BR8T 1JNZA 5DQVA 4PFOA 2PJQA 3CMLA 2XQ4A 3PUAA 4QHOA 2ACXA 4GIWA 5L3CB 4JUYA 4IDZA 2ZM2A 2I6HA 3O9XA 2VQFT 3UU6A 5FKYA 1E1HB 3LJCA 4DV0T 1D1BA 3LG7A 1BR1A 2XQ5A 1BR2A 3FZHB 2ODUA 2LKHA 2MOZA 2Y6XA 2KMFA 4QH4A 2J4GA 2XY8B 1UUSA 1ZP0A 4GK5E 2UXCT 4PW8A 2JQQA 5AFUL 2Z6EA 1MMDA 3UUNA 4FJOA 3TLVA 4PAGA 4DV4T 2YDQA 4FI5A 2VKJA 2LT3A 3FZLB 2WZHA 5DABA 2IDOB 3A5XA 2C0SA 5AQJB 3NWIA 2A9UA 1YD8G 4YJ2E 1QSDA 4YXDA 2IMLA 2WMOA 3AXJB 2W66A 3GN5A 5ABGA 3UULA 3JAFA 5AQTB 2VKDA 5AQPB 4UVAB 1BR0A 3H3AA 5KX5E 4OYKA 2VB6A 2BBHA 4CI1B 1JNRA 2QRXA 4DMWA 3P4QA 3PUYF 1LVFA 3JADA 3I9YA 3N9LA 1FEWA 3KV4A 3BQIA 1HNZT 2XAJB 5JRCB 3RKOA 5FNVE 4ZI2D 2UXXB 3LBXA 3FHNA 4UV9B 3PTRB 4MALA 2XASB 3ONJA 3ZKRA 3RGLA 5JQGE 3ANWA 4P1NA 2IIUA 3D0TA 3KDSE 2VK9A 3RIFA 4B3ST 2XJ7A 3C4WA 5LMNT 3SWHA 2IUBA 1SE7A 3NBXX 4IDNA 5JH7E 4X5TA 3AEBA 4I43B 4C90A 2UUAT 3RH3A 4MLKA 2XAQB 5HEJA 4GK0E 4AKHA 3ETUA 4ISSA 2I59A 2BS2A 4EOZB 2R6GF 2YOEA 4YSYA 2Q9QA 5EK4A 2BS3A 4AQFC 4U74A 4HWIB 5C2TA 4IHJE 1UURA 4TWHA 2V6YB 2FJEA 2WWVA 1KK7A 4P0BA 5FMNA 2YINA 5HEGA 2W67A 1KEYA 3RI5A 3ESLA 2E9XA 3PE0A 3R84B 4DR1T 3K3QC 1HF8A 5LJMA 3IHRA 4DV2T 3RC8A 3N2OA 5HXEA 4DNDA 1HS7A 4U72A 4HWDA 2LSGA 3JCFA 5JR9A 1W0BA 4NUUA 1GQEA 5E0OA 1W09A 3PJAA 3RRCA 3ZPOA 3AE4A 1I94T 2NP9A 3BK9A 3KVBA 2CMRA 2DLRA 3CKDA 3OVUA 3RQWA 1IAPA 2JJ9A 2V5CA 4U31A 2YKSA 3I0QA 3G06A 3LK2B 2LSIA 4AQGA 2PG8A 4X66T 3FZFB 3LSVA 2HPJA 2VASA 4U33A 1KFYA 2QVAA 1T72A 1XNRT 4HWCA 3PU3A 5AQIB 5LHIB 3LK42 2X0LB 3MA9A 3C4XA 3N9OA 1ZOYA 3T8OA 3H37A 2VVSA 3FXEB 2WDRA 3P50A 5H6QB 4B3TT 4O2AE 4KBMB 2JIWA 1FJGT 2M67A 3K3OA 3HKBE 3OYZA 2DI4A 4ZEYA 3OBVE 3A7MA 1U5PA 3EI0A 2WZIA 4H9SE 5AQMB 3O1HA 3TLUA 1FMVA 2WMNA 2LRLA 4UVBB 4ANJA 3L39A 4JI3T 1XNQT 3PUXF 4H9OC 2DNXA 4F8HA 2V7LA 4JYAT 3EABA 5LJNA 3AEGA 2YU1A 4OK0A 2XQ9A 4HKAA 4H9RC 2IC9A 2EHOA 1MMGA 4JV5T 3WAJA 2JQKA 1XMQT 2W61A 2HH7A 4LFBT 3I1AA 4NPPA 2LLYA 3OKQA 4JEHB 3RYCE 4JI6T 3CQCB 2BDEA 2E8IA 2H7VC 2MAWA 2PTFA 5FY7A 3RIAA 4J2CA 3AAIA 2HHHT 4DIDB 2X0HA 1J1JA 4TN7B 1Y64B 4JLEA 3UTKA 4KI0F 2X0YA 5JTGA 5J0ZA 4ZZBA 4H9QC 1KNRA 2G0UA 1OEDC 4WBNE 3ZT6A 1HCIA 3LFMA 3CX7B 3IF8B 2FUPA 4ZI2C 4QXBB 5EK2A 2RP4A 3TLWA
chains in the Genus database with same CATH topology
4LF4T 4DV2T 2UU9T 2UUCT 4DV1T 4LFCT 1N34T 1IBMT 1HNWT 2VQET 4X62T 4DUYT 1HNXT 4GKJT 4X64T 4DR7T 3T1HT 4JI1T 4JI3T 4JI4T 2UXCT 1XNQT 2UXBT 1I94T 4B3ST 4GKKT 5LMNT 4LFAT 4JYAT 4LF8T 4DR6T 4OX9T 1N36T 1N32T 4DV5T 4DV4T 2UUAT 4DR2T 4B3MT 1IBLT 4JV5T 4LF7T 1XMQT 4JI0T 1HR0T 4LFBT 4X66T 4DV6T 2UXDT 4JI5T 4YY3T 4JI6T 4DUZT 1J5ET 4YHHT 4B3RT 4DR5T 4DV7T 1XNRT 4DV3T 4X65T 2HHHT 4KHPT 4DR4T 5IWAT 4K0KT 5BR8T 2E5LT 2F4VT 1IBKT 4LF6T 1N33T 4B3TT 4JI2T 1FJGT 4DR3T 3T1YT 3OTOT 2VQFT 4AQYT 4NXMT 4JI7T 4NXNT 4LF9T 4JI8T 5LMUT 1XMOT 4DR1T 4LF5T 4DV0T 2ZM6T 1HNZT 2UUBT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF4 T;  4DV2 T;  2UU9 T;  2UUC T;  4DV1 T;  4LFC T;  1N34 T;  1IBM T;  1HNW T;  2VQE T;  4X62 T;  4DUY T;  1HNX T;  4GKJ T;  4X64 T;  4DR7 T;  3T1H T;  4JI1 T;  4JI3 T;  4JI4 T;  2UXC T;  1XNQ T;  2UXB T;  1I94 T;  4B3S T;  4GKK T;  5LMN T;  4LFA T;  4JYA T;  4LF8 T;  4DR6 T;  4OX9 T;  1N36 T;  1N32 T;  4DV5 T;  4DV4 T;  2UUA T;  4DR2 T;  4B3M T;  1IBL T;  4JV5 T;  4LF7 T;  1XMQ T;  4JI0 T;  1HR0 T;  4LFB T;  4X66 T;  4DV6 T;  2UXD T;  4JI5 T;  4YY3 T;  4JI6 T;  4DUZ T;  1J5E T;  4YHH T;  4B3R T;  4DR5 T;  4DV7 T;  1XNR T;  4DV3 T;  4X65 T;  2HHH T;  4KHP T;  4DR4 T;  5IWA T;  4K0K T;  5BR8 T;  2E5L T;  2F4V T;  1IBK T;  4LF6 T;  1N33 T;  4B3T T;  4JI2 T;  1FJG T;  4DR3 T;  3T1Y T;  3OTO T;  2VQF T;  4AQY T;  4NXM T;  4JI7 T;  4NXN T;  4LF9 T;  4JI8 T;  5LMU T;  1XMO T;  4DR1 T;  4LF5 T;  4DV0 T;  2ZM6 T;  1HNZ T;  2UUB T; 
#chains in the Genus database with same CATH topology
 4H63 V;  2XZE A;  1QUU A;  4K0U A;  5AQF B;  3Q5X A;  1T98 A;  4PJL A;  4ERR A;  3UT5 E;  2CXD A;  2IAK A;  2VVN A;  5EK3 A;  5KDM C;  2V7M A;  2X51 A;  2UXB T;  2HN2 A;  4MFR A;  4IE7 A;  2VKH A;  1XDO A;  4LF8 T;  2FBW A;  4ILU A;  3UUM A;  3J7Y q;  2VKO A;  1L0V A;  2BG9 C;  3CQX C;  5HXR A;  4IE5 A;  4AKG A;  2E2A A;  2ZLY A;  3RYF E;  3ZN1 B;  4QXC B;  4B3R T;  4P09 A;  4DV7 T;  1WCR A;  4QH5 A;  2X68 A;  1WYC A;  3UU4 A;  5FXV A;  3L8R A;  3V5U A;  2XQY A;  2CHO A;  2L8K A;  1EZ3 A;  3AA6 B;  3ZT7 A;  3RF1 A;  2BKP A;  2FJB A;  4EYU A;  3TLT A;  3PUG A;  2DL1 A;  2X9Y A;  2NOX A;  3B57 A;  2KWH A;  2BG9 E;  3AE1 A;  4MBQ A;  2V5D A;  1KNP A;  4CQI A;  3PUV F;  2XUE A;  2UUC T;  3CQG B;  3P4P A;  1WR6 A;  3QB5 K;  2WS3 A;  5L2L A;  5JDL A;  2X9W A;  4ZS3 A;  3HKD E;  4IIJ E;  4B6X A;  3RC3 A;  2BVM A;  4X62 T;  3N9M A;  5JRE A;  2CCQ A;  4JI1 T;  5F5W A;  4KP3 C;  2A72 A;  4BAY B;  1HFA A;  2KSR A;  2CBJ A;  2Y48 B;  3DTO A;  2N2N A;  4DR2 T;  4B3M T;  2I0M A;  3NZQ A;  2UXN B;  1HX1 B;  4IT4 A;  2FJA A;  3BQL A;  5ABF B;  1HTJ F;  1YW0 A;  4AIS A;  3VKG A;  3C51 A;  3ZMS B;  5LP6 E;  2XQ8 A;  5JDN A;  2CA5 A;  1VCS A;  3KBT A;  2P9B A;  3UU8 A;  4CN4 A;  3AXJ A;  3MZK B;  3AED A;  3O4X E;  2MTQ A;  3AE3 A;  4ADZ A;  4PK6 A;  2MYS A;  2VL8 A;  4EEB A;  1WYB A;  3E0Z A;  5DQW A;  1XWM A;  2IW5 B;  4CI3 B;  5FP3 A;  4E7S A;  3PJA J;  1KF6 A;  2LKG A;  3IA3 A;  3SS1 A;  4U7Y A;  1G73 A;  2VUR A;  2B76 A;  4ZXL A;  4JI7 T;  5JRC A;  2V1D B;  4WBO A;  5LBQ B;  3PUQ A;  3L3P A;  2WSS V;  2UU9 T;  2EHO D;  2JQ9 A;  3S4U A;  1ZEE A;  1YQ3 A;  5A1L A;  2IHR 1;  4DO0 A;  3AE5 A;  2WWU A;  3AE2 A;  3E22 E;  1S94 A;  4A98 A;  3BQK A;  2LOS A;  4DBQ A;  5HXC A;  3UUX B;  2X66 A;  3AEA A;  3ZC1 A;  3AB3 B;  4IGU A;  2IC6 A;  4ZI3 D;  4U2Z A;  4G63 A;  3ZN0 B;  5C8Y E;  3F57 A;  3ZST A;  4LML A;  2K24 A;  3W15 B;  3MKD A;  3HKC E;  3AAE B;  3VRA A;  5LGT B;  4O8S A;  4TNV A;  5LOV E;  4AKI A;  4M1P A;  2XQ3 A;  4HFI A;  3AEC A;  2PBI A;  3UQ7 A;  1HG5 A;  2CXL A;  3M3Z B;  3DP7 A;  4I50 E;  4DMV A;  3U3I A;  2V6Y A;  3I9W A;  3ZCJ A;  3PUR A;  3B13 A;  2H88 A;  3QC9 A;  2WY2 A;  3QUJ A;  5CFB A;  4AQF A;  1IZN B;  2ODV A;  2BKO A;  1WFD A;  2CWY A;  4A97 A;  2JPF A;  5J2U E;  1E2A A;  3EDU A;  4I0U A;  3V5S A;  1CHU A;  2V7J A;  5L4E A;  2SPC A;  4Q25 A;  4KHZ F;  5KMG P;  3K3N A;  4UF0 B;  4KMC A;  2J1D G;  5JDM A;  1U4Q A;  1WR0 A;  4UIG A;  5EZY E;  5KXJ A;  3N5L A;  1H7C A;  2JMH A;  4IST A;  1LVK A;  5L3F B;  3AVR A;  2Q9Q C;  1HNX T;  4YJ3 E;  2PFV A;  4DR7 T;  5FL1 A;  3CWZ B;  4YHJ A;  4U3C A;  5AQG B;  4O4H E;  1YQ4 A;  3IBP A;  3RX6 A;  2CLY C;  3K8P C;  5LGN B;  1N36 T;  2WDQ A;  5AQN B;  4IL9 A;  2E9X C;  1HG2 A;  3AA7 B;  1DU2 A;  4PJJ A;  4HWF A;  1S35 A;  3NVO A;  3WI3 A;  2CPT A;  2W2U A;  4U7I A;  3ZSS A;  3ZEF B;  1BR4 A;  4DR5 T;  3N2K E;  4A5X A;  5ABE A;  3J9X 1;  1D0X A;  3F31 A;  4X65 T;  2BVL A;  2LE8 A;  4KHP T;  4OHF A;  5JR9 C;  4HFV A;  2YK0 A;  2F4V T;  2XQ7 A;  1UX4 A;  3RQU A;  3UFE A;  3IEE A;  2CBI A;  3EAM A;  5GON E;  4BJM A;  1MIY A;  4HWH A;  1B7T A;  4HTE A;  2KZ7 B;  5LBM A;  4CN1 A;  5AQK B;  2Y8D A;  2YEV C;  3ETV A;  2CEA A;  4NXM T;  5FYM A;  4NXN T;  2MBG A;  4CZZ B;  3MJX A;  3KV5 A;  1YXR A;  2ZM6 T;  5HWY A;  5AQR B;  2WBL A;  4UR9 A;  4IDO A;  4PK5 A;  2KT9 A;  1MND A;  2V26 A;  3ZT5 A;  3PUW F;  2XQA A;  2M6B A;  1ZKE A;  4O4I E;  5FVL A;  2V7I A;  3QOF A;  4P0A A;  1HNW T;  1MIV A;  4L9I A;  4UVC B;  1X9B A;  1M7K A;  2XM2 A;  2L9Q A;  3FBL A;  4IE6 A;  4ZZC A;  3AE6 A;  2CM0 A;  3X1D A;  4HN9 A;  2OLT A;  3FZM B;  4KX6 A;  2DWG A;  4WNK A;  4Z8X A;  5AQU B;  2K48 A;  3CPZ A;  4O4L E;  4HFH A;  5AQH B;  4GYR A;  4JI0 T;  1HR0 T;  5C3J A;  2CRB A;  4DV6 T;  4HFD A;  3PDY A;  4BJN A;  1SUM B;  3LK3 B;  4GYS A;  5JDF A;  4HE8 A;  1NAF A;  1J5W A;  3HKE E;  3SFE A;  4AXP A;  5IYZ E;  2JRK A;  3P4R A;  3TKL B;  2K5B B;  5LA6 E;  3UFG A;  4UEL A;  2H89 A;  4AQY T;  1KNZ A;  3RRW A;  5HEU A;  3PUS A;  4LF9 T;  3AVS A;  2BKN A;  2EHO C;  5CB4 E;  2J47 A;  4YLH A;  2BS4 A;  3O1J A;  3QK6 A;  4TZ4 C;  1D0Y A;  3HR0 A;  3QB5 A;  2M6I A;  2V6X A;  3VU7 H;  5BMV E;  4EYY R;  2X67 A;  4ZI3 C;  4PFP A;  3A8Y C;  2KIN B;  4UXN B;  3VRB A;  1OED B;  4OX9 T;  3Q5E A;  3E08 A;  5DJQ C;  3ZYM A;  2BZB A;  1SHZ C;  5J2T E;  1MMN A;  3N2G E;  3P8C D;  4TWD A;  1R8I A;  2LM9 A;  1HX8 A;  1NEN A;  2ZM8 A;  2Q9Q D;  3GMI A;  4PNI A;  5JDH A;  3RIU C;  1CUN A;  2JMK A;  5F8P A;  5CA1 E;  4ZHQ E;  2KXP B;  4WW0 A;  4DR4 T;  2L3L A;  4EGW A;  2E9X D;  3KIN B;  1YKH B;  1ZHC A;  2B1E A;  2CWO A;  5LG3 A;  4TV9 E;  4COF A;  3ZMV B;  2BG9 B;  1W9R A;  1YKE B;  2BBJ A;  4LF5 T;  3GWH A;  4IDQ A;  2UUB T;  4XAX B;  4H9N C;  1UCU A;  5LHG B;  3RLF F;  3RKG A;  2XAF B;  4AKR B;  4E7Z A;  2VWA A;  4X1K E;  1XDP A;  3EDV A;  1UK5 A;  2X9X A;  5J1G A;  5M4Y A;  3PV0 F;  1FMW A;  2K9A A;  4LMK A;  2NTY A;  2NW8 A;  4LMJ A;  4AIU A;  1QLB A;  4WYV A;  5ABF A;  4TX5 A;  4H9P C;  3P4S A;  3M65 A;  3TLS A;  4ZI7 E;  2RPA A;  1NWM X;  4ILB A;  4TV8 E;  3UQ4 A;  4CI2 B;  4HFC A;  1Z8U A;  1J5E T;  4YHH T;  2W00 A;  5LNK A;  3ABV A;  3ZYK A;  3VHL A;  5JVD E;  2E5L T;  3P7I A;  1VCT A;  2MPK A;  4LF6 T;  2ZM0 A;  1OXZ A;  1SA0 E;  4DR3 T;  4QXH B;  2XTL A;  4G2A A;  3P4W A;  2LHN A;  5LMU T;  1XMO T;  3C98 B;  3KV9 A;  5L47 A;  3JC6 C;  3UU3 A;  4LF4 T;  5JDQ A;  2LSK A;  2N1G A;  3MK7 C;  4DV1 T;  4LFC T;  3ZC0 A;  1IBM T;  3OYX A;  1WRD A;  3N9Q A;  4IL4 A;  5FXZ A;  4DUY T;  4N78 D;  3RPU A;  1LKX A;  5JDG A;  3PU8 A;  2E5V A;  3R6N A;  4L0R A;  2WCA A;  5HYA A;  2FJD A;  1NEK A;  3AEF A;  5FVK A;  1E7P A;  5TAO A;  2OV9 A;  3N9N A;  2V8S V;  3H3M A;  2WB5 A;  5AQV B;  3NKZ A;  3HA4 A;  3F2E A;  1T8B A;  3Q9D A;  2XAH B;  3O1I A;  5LHH B;  4UEM A;  3SOL A;  4WZX A;  4DUZ T;  1D1A A;  5CA0 E;  4HEA A;  4YSZ A;  2AE9 A;  2WQY A;  2D2S A;  3GN5 B;  4K0K T;  2KLQ A;  4EED A;  2ACZ A;  4PJN A;  4KUM B;  3CX6 B;  4ZS2 A;  2D0U A;  2WDV A;  5ADX L;  4Z90 A;  4JI2 T;  3MAC A;  4I55 E;  3T1Y T;  3C64 A;  3OTO T;  4QKN A;  4DBR A;  3NRX A;  4XBF B;  3U78 A;  4QX7 B;  4JI8 T;  5IHY A;  2GK9 A;  1AJ3 A;  2NR4 A;  3EUH A;  1VRB A;  4UF0 A;  2CE7 A;  4GOU A;  3RHW A;  3KVA A;  4CXX A;  3LBX B;  2NW9 A;  5L3B B;  2XSA A;  3RYH E;  3FXD B;  4TUY E;  2XPK A;  2VQE T;  2H7O A;  4ASK A;  3ONL C;  3ANW B;  4ILA A;  4O2B E;  3C4Z A;  4AI6 A;  3K1S A;  2C5I T;  2NTX A;  4DR6 T;  4PJM A;  4EXT A;  2XM1 A;  3Q5W A;  4NUV A;  1G8X A;  4XZC A;  4O4J E;  2LRK A;  4YY3 T;  2LSJ A;  2W63 A;  5HEO A;  2A3D A;  2Q9Q B;  4YFS A;  3HL6 A;  1D1C A;  5IWA T;  3ZMZ B;  4JEU B;  2QYW A;  4HFB A;  1IBK T;  2A2F X;  2JQH A;  1FIO A;  1Y01 A;  2CLY B;  1N33 T;  3CIR A;  4YSX A;  4YT0 A;  4QWN B;  4EIW A;  2E9X B;  4A56 A;  5FL0 A;  4UV8 B;  5HCM A;  5L3E B;  1ZV4 X;  3ZYL A;  4YTP A;  1LRZ A;  2DHR A;  3OJA A;  2XSB A;  4X20 E;  1WLX A;  2WU2 A;  4IE0 A;  4GKJ T;  5JR9 B;  2V7K A;  5HEH A;  2D5U A;  2ZMA A;  4HFE A;  1W0A A;  3ZLI A;  4JI4 T;  3PUZ F;  2LM2 A;  4ZOL E;  3B5M A;  3JC6 D;  1IJ6 A;  5H6R B;  4LFA T;  2NW7 A;  3Q5D A;  4DV5 T;  3NZP A;  2LHR A;  1IBL T;  4F6R C;  3UUB A;  3HI2 A;  3EHZ A;  2DCF A;  4EV6 A;  2NWB A;  3KFW X;  1V9D A;  4EAH A;  2W0G A;  2VL0 A;  2AXD S;  4TNW A;  3AE9 A;  2QA7 A;  2UXD T;  1MNE A;  5LB7 B;  3LDQ B;  2RA1 A;  4CXW A;  2K3W A;  5AQL B;  3GA8 A;  5HXS A;  1UX5 A;  3JAE A;  3MXZ A;  2W62 A;  3AAA B;  5L4H A;  2C5J A;  3CVR A;  4BA9 A;  2WU5 A;  5FY0 A;  3AE8 A;  4IE4 A;  1M62 A;  4EZ4 A;  5ABH A;  3KV6 A;  1Z0P A;  1T7S A;  2X9H A;  3EVY A;  4IDP A;  5L3G B;  5AQO B;  2LSY A;  2KWI B;  3AA1 B;  3AEE A;  2YU2 A;  2LEH A;  4MHC A;  1N34 T;  5LG4 A;  5CGM A;  4Z91 A;  4YTN A;  2YDR A;  4X64 T;  3T1H T;  3ZMU B;  3FBZ A;  2CHN A;  4AKL A;  3N9P A;  4C91 A;  2ES0 A;  3KBU A;  4EB6 E;  2HN1 A;  1OED A;  1N32 T;  3I0O A;  3OPC A;  3WAK A;  3ZJ2 A;  2CXF A;  3VR9 A;  1XZY A;  3VKH A;  2EHO B;  3VR8 A;  3FB2 A;  5AQQ B;  2WAU A;  4OYJ A;  3DJB A;  2YDS A;  5HXH A;  3RYI E;  1VOM A;  2D9D A;  4L5G A;  2WP9 A;  3SRZ A;  5HCJ A;  1IJ5 A;  4DVD A;  5AQS B;  2WM9 A;  3RIU A;  3AA0 B;  3Q2M A;  5ETW A;  4NIQ A;  2KND A;  2XQ6 A;  5LYJ E;  3NRY A;  5HAX A;  2D0T A;  1X79 A;  4ILC A;  5LGU B;  3SFD A;  4U2Y A;  2BG9 A;  1I6Z A;  1US7 B;  2LJL A;  4TWF A;  4EZH A;  2DWK A;  4HGA A;  4PK4 A;  4JBW F;  1OED E;  4IRE A;  1D0Z A;  3L09 A;  4X1Y E;  4QX8 B;  5CJ5 A;  3CX8 B;  3C50 A;  2QGS A;  3ZCI A;  4V1A v;  2XAG B;  2OA5 A;  5LXT E;  5LCY A;  4CN6 A;  4GKK T;  1O3X A;  3FZK B;  2XHE B;  3ONX A;  3AE7 A;  1OWA A;  2C5K T;  2N9D A;  3ZMT B;  4CXY A;  4X1I E;  5FXW A;  2J62 A;  1MIW A;  1UGO A;  4LF7 T;  2W4X A;  4YTM A;  1MMA A;  3CK6 A;  4JI5 T;  5HWX A;  2YN6 A;  4OFZ A;  2LOP A;  3QNU A;  5FY1 A;  2HPL A;  5L3D B;  2H3R A;  4I4T E;  4DV3 T;  5FXX A;  3ZJ1 A;  4QH1 A;  3UU5 A;  5F3J A;  4H63 H;  5IUX A;  5BR8 T;  1JNZ A;  5DQV A;  4PFO A;  2PJQ A;  3CML A;  2XQ4 A;  3PUA A;  4QHO A;  2ACX A;  4GIW A;  5L3C B;  4JUY A;  4IDZ A;  2ZM2 A;  2I6H A;  3O9X A;  2VQF T;  3UU6 A;  5FKY A;  1E1H B;  3LJC A;  4DV0 T;  1D1B A;  3LG7 A;  1BR1 A;  2XQ5 A;  1BR2 A;  3FZH B;  2ODU A;  2LKH A;  2MOZ A;  2Y6X A;  2KMF A;  4QH4 A;  2J4G A;  2XY8 B;  1UUS A;  1ZP0 A;  4GK5 E;  2UXC T;  4PW8 A;  2JQQ A;  5AFU L;  2Z6E A;  1MMD A;  3UUN A;  4FJO A;  3TLV A;  4PAG A;  4DV4 T;  2YDQ A;  4FI5 A;  2VKJ A;  2LT3 A;  3FZL B;  2WZH A;  5DAB A;  2IDO B;  3A5X A;  2C0S A;  5AQJ B;  3NWI A;  2A9U A;  1YD8 G;  4YJ2 E;  1QSD A;  4YXD A;  2IML A;  2WMO A;  3AXJ B;  2W66 A;  3GN5 A;  5ABG A;  3UUL A;  3JAF A;  5AQT B;  2VKD A;  5AQP B;  4UVA B;  1BR0 A;  3H3A A;  5KX5 E;  4OYK A;  2VB6 A;  2BBH A;  4CI1 B;  1JNR A;  2QRX A;  4DMW A;  3P4Q A;  3PUY F;  1LVF A;  3JAD A;  3I9Y A;  3N9L A;  1FEW A;  3KV4 A;  3BQI A;  1HNZ T;  2XAJ B;  5JRC B;  3RKO A;  5FNV E;  4ZI2 D;  2UXX B;  3LBX A;  3FHN A;  4UV9 B;  3PTR B;  4MAL A;  2XAS B;  3ONJ A;  3ZKR A;  3RGL A;  5JQG E;  3ANW A;  4P1N A;  2IIU A;  3D0T A;  3KDS E;  2VK9 A;  3RIF A;  4B3S T;  2XJ7 A;  3C4W A;  5LMN T;  3SWH A;  2IUB A;  1SE7 A;  3NBX X;  4IDN A;  5JH7 E;  4X5T A;  3AEB A;  4I43 B;  4C90 A;  2UUA T;  3RH3 A;  4MLK A;  2XAQ B;  5HEJ A;  4GK0 E;  4AKH A;  3ETU A;  4ISS A;  2I59 A;  2BS2 A;  4EOZ B;  2R6G F;  2YOE A;  4YSY A;  2Q9Q A;  5EK4 A;  2BS3 A;  4AQF C;  4U74 A;  4HWI B;  5C2T A;  4IHJ E;  1UUR A;  4TWH A;  2V6Y B;  2FJE A;  2WWV A;  1KK7 A;  4P0B A;  5FMN A;  2YIN A;  5HEG A;  2W67 A;  1KEY A;  3RI5 A;  3ESL A;  2E9X A;  3PE0 A;  3R84 B;  4DR1 T;  3K3Q C;  1HF8 A;  5LJM A;  3IHR A;  4DV2 T;  3RC8 A;  3N2O A;  5HXE A;  4DND A;  1HS7 A;  4U72 A;  4HWD A;  2LSG A;  3JCF A;  5JR9 A;  1W0B A;  4NUU A;  1GQE A;  5E0O A;  1W09 A;  3PJA A;  3RRC A;  3ZPO A;  3AE4 A;  1I94 T;  2NP9 A;  3BK9 A;  3KVB A;  2CMR A;  2DLR A;  3CKD A;  3OVU A;  3RQW A;  1IAP A;  2JJ9 A;  2V5C A;  4U31 A;  2YKS A;  3I0Q A;  3G06 A;  3LK2 B;  2LSI A;  4AQG A;  2PG8 A;  4X66 T;  3FZF B;  3LSV A;  2HPJ A;  2VAS A;  4U33 A;  1KFY A;  2QVA A;  1T72 A;  1XNR T;  4HWC A;  3PU3 A;  5AQI B;  5LHI B;  3LK4 2;  2X0L B;  3MA9 A;  3C4X A;  3N9O A;  1ZOY A;  3T8O A;  3H37 A;  2VVS A;  3FXE B;  2WDR A;  3P50 A;  5H6Q B;  4B3T T;  4O2A E;  4KBM B;  2JIW A;  1FJG T;  2M67 A;  3K3O A;  3HKB E;  3OYZ A;  2DI4 A;  4ZEY A;  3OBV E;  3A7M A;  1U5P A;  3EI0 A;  2WZI A;  4H9S E;  5AQM B;  3O1H A;  3TLU A;  1FMV A;  2WMN A;  2LRL A;  4UVB B;  4ANJ A;  3L39 A;  4JI3 T;  1XNQ T;  3PUX F;  4H9O C;  2DNX A;  4F8H A;  2V7L A;  4JYA T;  3EAB A;  5LJN A;  3AEG A;  2YU1 A;  4OK0 A;  2XQ9 A;  4HKA A;  4H9R C;  2IC9 A;  2EHO A;  1MMG A;  4JV5 T;  3WAJ A;  2JQK A;  1XMQ T;  2W61 A;  2HH7 A;  4LFB T;  3I1A A;  4NPP A;  2LLY A;  3OKQ A;  4JEH B;  3RYC E;  4JI6 T;  3CQC B;  2BDE A;  2E8I A;  2H7V C;  2MAW A;  2PTF A;  5FY7 A;  3RIA A;  4J2C A;  3AAI A;  2HHH T;  4DID B;  2X0H A;  1J1J A;  4TN7 B;  1Y64 B;  4JLE A;  3UTK A;  4KI0 F;  2X0Y A;  5JTG A;  5J0Z A;  4ZZB A;  4H9Q C;  1KNR A;  2G0U A;  1OED C;  4WBN E;  3ZT6 A;  1HCI A;  3LFM A;  3CX7 B;  3IF8 B;  2FUP A;  4ZI2 C;  4QXB B;  5EK2 A;  2RP4 A;  3TLW A; 
#chains in the Genus database with same CATH homology
 4LF4 T;  4DV2 T;  2UU9 T;  2UUC T;  4DV1 T;  4LFC T;  1N34 T;  1IBM T;  1HNW T;  2VQE T;  4X62 T;  4DUY T;  1HNX T;  4GKJ T;  4X64 T;  4DR7 T;  3T1H T;  4JI1 T;  4JI3 T;  4JI4 T;  2UXC T;  1XNQ T;  2UXB T;  1I94 T;  4B3S T;  4GKK T;  5LMN T;  4LFA T;  4JYA T;  4LF8 T;  4DR6 T;  4OX9 T;  1N36 T;  1N32 T;  4DV5 T;  4DV4 T;  2UUA T;  4DR2 T;  4B3M T;  1IBL T;  4JV5 T;  4LF7 T;  1XMQ T;  4JI0 T;  1HR0 T;  4LFB T;  4X66 T;  4DV6 T;  2UXD T;  4JI5 T;  4YY3 T;  4JI6 T;  4DUZ T;  1J5E T;  4YHH T;  4B3R T;  4DR5 T;  4DV7 T;  1XNR T;  4DV3 T;  4X65 T;  2HHH T;  4KHP T;  4DR4 T;  5IWA T;  4K0K T;  5BR8 T;  2E5L T;  2F4V T;  1IBK T;  4LF6 T;  1N33 T;  4B3T T;  4JI2 T;  1FJG T;  4DR3 T;  3T1Y T;  3OTO T;  2VQF T;  4AQY T;  4NXM T;  4JI7 T;  4NXN T;  4LF9 T;  4JI8 T;  5LMU T;  1XMO T;  4DR1 T;  4LF5 T;  4DV0 T;  2ZM6 T;  1HNZ T;  2UUB T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...