4JI2T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4ji2T00
1HNZT 1N36T 1HNXT 1HR0T 3T1YT 4JI4T 4JI6T 4OX9T 1N32T 1N33T 4DR7T 4B3RT 1XMQT 4DV7T 4X65T 4B3ST 4LF5T 1HNWT 2UU9T 4DV2T 4JI2T 4JI1T 4GKKT 1XNRT 5IWAT 3T1HT 4NXNT 5LMNT 1XNQT 4DV1T 4YY3T 2HHHT 4B3MT 4JV5T 4JI5T 2VQFT 4LF4T 1N34T 2E5LT 4KHPT 4JI0T 2UUAT 4LF6T 4JI8T 1IBMT 4LF7T 4DR4T 4LFCT 4DV5T 4B3TT 1IBKT 2UXCT 2F4VT 4DR1T 4GKJT 4LF9T 2UUBT 4JYAT 1I94T 4DV0T 5BR8T 4AQYT 4X66T 2ZM6T 4DR6T 4DV3T 4DUYT 1IBLT 4DV6T 4LF8T 4DR2T 4JI7T 2VQET 4DUZT 1FJGT 4K0KT 4DR5T 4JI3T 1XMOT 4NXMT 4DV4T 5LMUT 2UUCT 4X62T 4X64T 4DR3T 4YHHT 4LFBT 2UXBT 2UXDT 1J5ET 4LFAT 3OTOT
chains in the Genus database with same CATH superfamily
1N36T 4MALA 2KWHA 1KNRA 4JLEA 1HX1B 2WDVA 1XWMA 4OX9T 2X66A 1NAFA 1E1HB 1UGOA 4HWDA 5C8YE 4EIWA 3UUMA 1XMQT 3IA3A 5FL0A 4HEAA 5KX5E 2HN1A 1E2AA 4H63H 3M65A 3UU3A 2QGSA 4ZI3D 3KFWX 3LJCA 4HWHA 4GOUA 2M67A 1D1BA 2XUEA 3F31A 2A9UA 3E22E 4ZZBA 4JI0T 2V26A 5L3BB 1IBKT 2BKOA 4BA9A 2XQ5A 3P4SA 4IIJE 3KDSE 4DV0T 3UU4A 4IT4A 2V7IA 4YJ3E 4MLKA 4DUZT 4K0KT 2A2FX 3MZKB 4DR5T 4I55E 3VU7H 4QH5A 4DV4T 2N1GA 3HI2A 4KP3C 1KEYA 2V8SV 2CBIA 3CX6B 2WS3A 2R6GF 3S4UA 1HNXT 1OEDE 5JDFA 4HWIB 2LRLA 3HA4A 4X1KE 2JQKA 4DR7T 2FUPA 1XZYA 5ETWA 1BR2A 5LCYA 3V5SA 1HTJF 1MIVA 3EVYA 4ZHQE 4JUYA 5ABEA 5CB4E 4I0UA 4ILUA 5AQFB 3MJXA 3SS1A 4DV1T 2HHHT 3GN5B 3CK6A 2X0LB 1G8XA 5LGUB 2VKJA 5JRCA 2E9XB 4LFCT 3AE5A 2BBHA 5FXWA 3ABVA 3FZMB 4U3CA 4DBQA 2J4GA 4N78D 4IREA 2I6HA 3AE9A 3AEBA 3LFMA 3RRWA 3PUZF 1HFAA 4DR2T 4PK4A 3TLTA 5L3EB 2LHRA 5DJQC 4IL4A 5JREA 2K24A 2V5DA 2DCFA 1ZEEA 2BKNA 3RQWA 4GK5E 4ILBA 5AQLB 4FJOA 3PE0A 2KZ7B 3O9XA 2FBWA 2RP4A 3ZC0A 3CQCB 3UFGA 2CMRA 3I9WA 4Z8XA 4IL9A 2XTLA 5LG4A 2DHRA 4FI5A 1T8BA 3ZN0B 4HFVA 3G06A 2W62A 1UUSA 3ETVA 1WYCA 3FB2A 5LHHB 3JAEA 4YTNA 3QK6A 2WM9A 1WR6A 3I0QA 4AISA 2VL0A 2XM1A 2BDEA 3IEEA 5E0OA 1N34T 3OBVE 1XDPA 1FMVA 4OYJA 5LG3A 4O4LE 3LBXA 2DNXA 2UUBT 2NW9A 1I94T 1L0VA 1MMAA 2YN6A 4ZS2A 4YTPA 3PJAJ 4YSXA 5HXEA 3QNUA 5J2TE 5AQTB 5JVDE 2VASA 5LYJE 4ZXLA 2Q9QC 4TV9E 1Y64B 4PJNA 4PK6A 3LK42 5M4YA 3ZSTA 2IW5B 4HFDA 4NUUA 4IDNA 5LMUT 1HG2A 2E9XD 4H9PC 1OEDC 1SA0E 4P09A 1Z0PA 2ZLYA 2D0UA 2UXBT 4IE6A 2CLYB 2IHR1 2UXDT 5HEHA 1J5ET 3AE7A 1OEDA 3EHZA 5L3DB 4IDPA 2XPKA 3AEFA 5L47A 2DWKA 2IUBA 2YEVC 5LJMA 3FXEB 2Y6XA 3RH3A 3K3QC 4CN6A 4EZHA 5L3CB 2WZIA 5HWYA 1T72A 5KXJA 2LSIA 2XJ7A 1UX4A 2DL1A 4UIGA 3WAJA 2EHOB 2ACZA 3GMIA 2AXDS 2OLTA 4KHPT 4F8HA 2X9XA 3JC6C 4DR4T 5JDGA 3PUVF 3VRBA 3PUYF 2HN2A 5BR8T 5EK3A 5CFBA 3OYXA 2K5BB 5LOVE 4HFHA 4DR6T 4PFPA 2E9XA 4J2CA 4U2ZA 3CPZA 3OYZA 2V7JA 5CGMA 1W9RA 2W00A 4C90A 2Y48B 3N2GE 1HG5A 5AQIB 3KV4A 2I0MA 5JDMA 4U74A 4EGWA 5HCMA 2VWAA 3Q5EA 3V5UA 3SFDA 3O4XE 4PK5A 3RIAA 4X1YE 3PV0F 2WWUA 3ZYLA 2ZM8A 1X9BA 1NEKA 3Q5XA 5JTGA 2A72A 1WYBA 2KT9A 3FZFB 1UK5A 2WQYA 4JI2T 4HGAA 1I6ZA 4XZCA 3D0TA 2J47A 3ZT7A 4ZI2C 3ZCIA 5CJ5A 4KX6A 4NXNT 5LMNT 3B13A 3PUWF 2J1DG 4B3MT 5HAXA 3TLWA 1KF6A 3RC8A 1IJ5A 5JR9B 1JNZA 3RRCA 3MXZA 2IC6A 5AQRB 3ZCJA 2UUAT 4CXXA 5FYMA 2ES0A 2BVLA 2UXXB 3MK7C 3UQ7A 2H88A 3B57A 3N2OA 4LF8T 2QVAA 4HKAA 2IAKA 4OFZA 3ZEFB 4GYRA 3AE2A 5ADXL 3AE8A 1MMDA 2C5KT 3EDVA 2EHOD 2W66A 3UT5E 4ILAA 4TWFA 5EZYE 1MIYA 4X5TA 4ZZCA 1O3XA 4IE7A 3CX8B 4BJNA 4JEHB 2DLRA 4CN4A 2W4XA 4ISTA 3T8OA 4PJLA 2V6YA 3T1YT 2WU5A 5F5WA 3ZYKA 1ZP0A 3CKDA 3K3OA 2LOPA 5FXXA 3UU5A 4ZS3A 3ESLA 3MKDA 1VCSA 5FVKA 5EK2A 4B3ST 1HNWT 3PUXF 2PFVA 1LVKA 3RI5A 3C51A 5LP6E 2LOSA 3RPUA 4AI6A 4PW8A 3UTKA 3U78A 4ZOLE 5ABHA 5FKYA 4U7IA 3VR8A 4QHOA 2W63A 3NZPA 3P50A 2WZHA 4I4TE 3N5LA 1IBMT 1QUUA 5LHGB 2LKHA 2RA1A 4B3TT 3PUGA 3PTRB 4LMJA 4DR1T 2L9QA 5TAOA 2UXNB 3ZLIA 2KSRA 2ZMAA 3CVRA 4PFOA 2LM2A 4AQYT 4ZI7E 4HFIA 1D1CA 2LSJA 4V1Av 1VOMA 3KV5A 4AKIA 4B6XA 2NTYA 4DIDB 5AQPB 2D0TA 3MACA 3UUXB 3ZMVB 5AFUL 3RKGA 1D0YA 4UVAB 4IGUA 4IE0A 2FJBA 4WNKA 1MNEA 1SUMB 2LHNA 4LFBT 2CXLA 3ZKRA 3C64A 4EZ4A 1HNZT 2PG8A 1SE7A 5IUXA 4UVCB 3R84B 2Q9QB 4PJMA 5JQGE 4TWHA 4MHCA 3WAKA 3FXDB 5JDHA 3QB5K 4I43B 2XZEA 4YHJA 3HR0A 3F57A 5IWAT 4ZI3C 2JPFA 3KBUA 3DJBA 2MOZA 3T1HT 2DI4A 4ILCA 1KNPA 3KV6A 2BS3A 4UEMA 2XAFB 4X20E 1UX5A 4UVBB 3N9PA 3P4RA 3GWHA 4NUVA 1MIWA 1NENA 4QH1A 3RX6A 3ZJ1A 2CA5A 5FMNA 3N9OA 4WBNE 3TLSA 4JYAT 5KDMC 5JR9A 3H3AA 5GONE 2YU2A 4DV3T 1IBLT 2W67A 4U2YA 2HPLA 3EABA 1ZV4X 4IE4A 3UQ4A 4HWCA 4PJJA 4EAHA 2QA7A 4JI3T 4ADZA 4NXMT 3DP7A 3HL6A 3ANWA 4E7ZA 5J1GA 1W09A 3AXJB 2HH7A 1NWMX 3AE6A 3AA0B 3P7IA 2H7OA 4M1PA 2X0YA 4JI6T 1G73A 2IC9A 3BQLA 4XAXB 4CI1B 4B3RT 4EYYR 4CI2B 4YSZA 4A97A 2LSYA 3IF8B 4BJMA 3RYHE 2BG9B 3CX7B 4XBFB 5AQKB 1US7B 2ACXA 2G0UA 3HKDE 3Q9DA 3SWHA 2M6BA 2WMOA 5HXSA 2C5IT 2LE8A 2BZBA 4MBQA 1WLXA 2XSBA 4QXHB 2P9BA 2BS4A 4WW0A 3O1JA 2C5JA 3ZT5A 4U31A 4WYVA 4ZEYA 4X1IE 3MA9A 3ONXA 3PUSA 4TZ4C 5FP3A 2ZM6T 1QLBA 4DMWA 2XAQB 5FY1A 2AE9A 4NPPA 3QUJA 2LLYA 4TV8E 2Z6EA 2V6XA 3BQIA 2X68A 3CMLA 4UF0B 2YU1A 4O8SA 3ZSSA 4G63A 4LMKA 3LG7A 4DR3T 1S35A 3EUHA 2YKSA 3N9QA 3RIUA 3OTOT 4DMVA 3UU6A 4HFBA 4X65T 2NWBA 2FJAA 4QX7B 4CN1A 4GKKT 5FY0A 2LEHA 4AKRB 2XQAA 5HWXA 3ZMSB 3AAAB 1VCTA 2VVNA 3FBLA 5L4HA 5HEJA 2VL8A 4AKLA 3HKEE 4QKNA 4KBMB 2SPCA 5LB7B 3OPCA 4OYKA 1M62A 3M3ZB 2WSSV 1Z8UA 3KBTA 5JH7E 2VK9A 5FNVE 2CXFA 3L09A 2KLQA 2H7VC 3OKQA 1YW0A 2XAJB 2XY8B 1CHUA 4H9SE 3AEAA 3NKZA 5HEOA 4DVDA 2CHOA 3AA6B 3FZLB 3PURA 2V7MA 4DO0A 3EDUA 1HS7A 2XQ4A 4L9IA 3SFEA 2ODVA 3GN5A 4QWNB 2E9XC 3Q5WA 4HFCA 5LHIB 5HEGA 3JAFA 2LT3A 2V5CA 4O4HE 4LFAT 4JBWF 1YQ4A 5ABGA 4HFEA 2X51A 3EAMA 1HR0T 4JI4T 2CXDA 2H3RA 4KUMB 5ABFB 2JMHA 1WFDA 2A3DA 3B5MA 2XQ8A 4CZZB 3VHLA 2KXPB 4IHJE 3LDQB 5AQHB 1BR4A 4HTEA 2XAHB 1U5PA 2BBJA 2LM9A 1YD8G 2OV9A 2IMLA 1HF8A 4Q25A 3AE3A 3P4WA 2HPJA 3IBPA 2MAWA 3KV9A 3RC3A 3AVRA 2CBJA 4TX5A 5LBQB 1QSDA 4IDOA 4EEBA 4JI7T 5A1LA 4CI3B 5FVLA 5F8PA 5C3JA 4H9OC 2NW7A 4Z91A 2E2AA 3P4QA 3HKCE 1H7CA 2NW8A 3TLUA 2JIWA 3I0OA 1EZ3A 5J0ZA 5AQVB 3UUBA 3K8PC 3PU8A 4YLHA 4DBRA 5JRCB 2MYSA 2YDQA 5AQMB 2XQ9A 4WZXA 4H63V 4YSYA 3PUAA 3RQUA 4IDQA 1B7TA 2K3WA 3A5XA 1HX8A 2K9AA 2FJEA 3J7Yq 5F3JA 2CLYC 5LXTE 3AAIA 3O1HA 4H9RC 2NP9A 3RLFF 3CQGB 2B76A 2V7KA 4YJ2E 3UULA 3NWIA 4EB6E 4ANJA 3N9LA 2CRBA 3LK2B 4CXWA 2YK0A 2LJLA 3BQKA 4COFA 2MTQA 4L5GA 4P0AA 3ZPOA 2EHOC 1GQEA 1FJGT 3OVUA 2WWVA 1D0XA 2OA5A 2EHOA 5IYZE 2UUCT 1W0BA 2KNDA 2CE7A 3Q2MA 3ONJA 1V9DA 2XHEB 3ZMUB 3VR9A 3EI0A 2YOEA 3CWZB 4A5XA 4UR9A 3P4PA 3ZN1B 5L3FB 2WCAA 4AIUA 2LSKA 5FXZA 1UURA 4YXDA 3LBXB 5HXCA 3FZKB 2LKGA 2CHNA 1YKEB 5LGTB 3FZHB 4O2BE 4EYUA 2IIUA 4UELA 5L3GB 4K0UA 2X9YA 4PAGA 1SHZC 2ODUA 3L8RA 2BS2A 5ABFA 2WU2A 5FY7A 3C4ZA 4AKHA 3C50A 3X1DA 2RPAA 2VQFT 1R8IA 2XAGB 1E7PA 4EXTA 4JI8T 4I50E 5HXHA 4LF7T 1X79A 5L4EA 1LRZA 1OEDB 5LBMA 4JEUB 3AE4A 1IAPA 2D5UA 3F2EA 1CUNA 4DUYT 2XM2A 5AQOB 4DV6T 2VB6A 2VQET 5JDNA 3CQXC 2QRXA 3IHRA 5FXVA 2PJQA 1MMNA 5JR9C 1S94A 1U4QA 4EEDA 2I59A 2B1EA 5AQNB 2LRKA 4X64T 3L39A 3JADA 4TN7B 4YHHT 5KMGP 2V7LA 4HN9A 1HCIA 4ERRA 2CCQA 1WRDA 2H89A 4OK0A 5DQWA 2BVMA 4YT0A 3U3IA 1KK7A 3L3PA 1ZHCA 1KNZA 4H9QC 2L8KA 1AJ3A 1J5WA 2ZM2A 3VKHA 2JMKA 4ASKA 2XASB 2NR4A 4PNIA 3W15B 4LMLA 4TWDA 5CA1E 5HCJA 3PU3A 3VRAA 3AEGA 4U72A 3AVSA 1OXZA 1DU2A 3AB3B 4YY3T 4AQFC 3H37A 3I9YA 4KMCA 4L0RA 2Y8DA 1LKXA 3C4XA 2YDRA 3C4WA 5AQJB 4U7YA 4CXYA 4AQFA 2X67A 2XQ7A 4KI0F 1ZOYA 2PTFA 2UXCT 4GKJT 2E8IA 2CWYA 2XQ3A 4X66T 2KINB 2WDRA 2BG9E 3ETUA 2C0SA 2Q9QD 2YINA 3PDYA 3QB5A 5J2UE 4P1NA 3AE1A 5H6RB 1XMOT 2FJDA 4TNVA 2JQ9A 5HEUA 4P0BA 1OWAA 3FBZA 5HYAA 3RKOA 4G2AA 3ZMZB 3ZT6A 2D9DA 4AKGA 5FL1A 1T98A 3NVOA 1Y01A 3NRXA 4YTMA 1VRBA 3RIUC 4O2AE 2WDQA 5H6QB 4YFSA 4DV2T 4A98A 4C91A 2D2SA 2W2UA 2LSGA 4EV6A 4WBOA 1FEWA 1XNQT 3GA8A 3RYIE 4QXBB 4JI5T 5AQSB 2CPTA 2E5LT 5IHYA 5LGNB 2WMNA 4LF6T 1D0ZA 5LJNA 4DV5T 3LK3B 3JC6D 3SRZA 1IJ6A 2Q9QA 3A7MA 4LF9T 2NTXA 4KHZF 3BK9A 1ZKEA 3KINB 2WBLA 4AXPA 2V6YB 4GK0E 2VURA 4UV9B 4A56A 1YKHB 3TKLB 3ZMTB 4IE5A 3N9NA 3RGLA 5AQGB 2NOXA 3K1SA 3K3NA 4UV8B 2M6IA 3ZJ2A 2J62A 1D1AA 4OHFA 1BR1A 3I1AA 3UU8A 1W0AA 3KVBA 3AEDA 5LA6E 2WP9A 2DWGA 2BKPA 2KMFA 4ISSA 5JDLA 3PJAA 3A8YC 4HE8A 4IDZA 3HKBE 1N32T 1LVFA 3CIRA 2MBGA 2N9DA 4O4JE 3AAEB 2X9HA 4DV7T 4QH4A 4LF5T 4HWFA 1YXRA 4QXCB 2VKDA 4NIQA 2W0GA 5HXRA 1XNRT 2CM0A 3ZC1A 2VVSA 5DABA 1WR0A 2GK9A 2V1DB 4EOZB 3ONLC 3LSVA 2WB5A 4ZI2D 2XQ6A 3NRYA 2KWIB 2L3LA 3R6NA 3AXJA 3RHWA 3FHNA 3Q5DA 3RYCE 5BMVE 2XSAA 4CQIA 2BG9C 3VKGA 2K48A 3RIFA 2N2NA 2JQHA 4MFRA 5L2LA 3JCFA 3N9MA 2BG9A 4E7SA 3O1IA 1XDOA 2CEAA 3RYFE 2YDSA 1M7KA 4TNWA 2MPKA 4O4IE 2PBIA 5CA0E 4X62T 3QOFA 5JDQA 3ZYMA 2VKHA 1T7SA 3DTOA 1MNDA 5AQQB 2JRKA 3H3MA 2CWOA 1UCUA 3J9X1 3E08A 3RF1A 4AQGA 1N33T 3WI3A 1FIOA 1KFYA 2UU9T 3NBXX 4BAYB 3AA7B 3KVAA 4JI1T 4F6RC 5EK4A 1FMWA 3TLVA 1IZNB 4GYSA 4H9NC 4UF0A 2X9WA 4GIWA 3C98B 4JV5T 4LF4T 1BR0A 2JJ9A 3E0ZA 5DQVA 4TUYE 3ANWB 5LNKA 5AQUB 4QX8B 2F4VT 3AECA 4DNDA 3OJAA 3PUQA 2X0HA 1J1JA 5C2TA 3UUNA 2JQQA 2WAUA 2WY2A 3SOLA 1WCRA 4U33A 2ZM0A 4Z90A 1YQ3A 2E5VA 2QYWA 3N2KE 2VKOA 3P8CD 2W61A 1MMGA 3NZQA 3UFEA 4UXNB 1JNRA 3AA1B 2XQYA 3AEEA 2IDOB 3QC9A
chains in the Genus database with same CATH topology
1HNZT 1N36T 1HNXT 1HR0T 3T1YT 4JI4T 4JI6T 4OX9T 1N32T 1N33T 4DR7T 4B3RT 1XMQT 4DV7T 4X65T 4B3ST 4LF5T 1HNWT 2UU9T 4DV2T 4JI2T 4JI1T 4GKKT 1XNRT 5IWAT 3T1HT 4NXNT 5LMNT 1XNQT 4DV1T 4YY3T 2HHHT 4B3MT 4JV5T 4JI5T 2VQFT 4LF4T 1N34T 2E5LT 4KHPT 4JI0T 2UUAT 4LF6T 4JI8T 1IBMT 4LF7T 4DR4T 4LFCT 4DV5T 4B3TT 1IBKT 2UXCT 2F4VT 4DR1T 4GKJT 4LF9T 2UUBT 4JYAT 1I94T 4DV0T 5BR8T 4AQYT 4X66T 2ZM6T 4DR6T 4DV3T 4DUYT 1IBLT 4DV6T 4LF8T 4DR2T 4JI7T 2VQET 4DUZT 1FJGT 4K0KT 4DR5T 4JI3T 1XMOT 4NXMT 4DV4T 5LMUT 2UUCT 4X62T 4X64T 4DR3T 4YHHT 4LFBT 2UXBT 2UXDT 1J5ET 4LFAT 3OTOT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNZ T;  1N36 T;  1HNX T;  1HR0 T;  3T1Y T;  4JI4 T;  4JI6 T;  4OX9 T;  1N32 T;  1N33 T;  4DR7 T;  4B3R T;  1XMQ T;  4DV7 T;  4X65 T;  4B3S T;  4LF5 T;  1HNW T;  2UU9 T;  4DV2 T;  4JI2 T;  4JI1 T;  4GKK T;  1XNR T;  5IWA T;  3T1H T;  4NXN T;  5LMN T;  1XNQ T;  4DV1 T;  4YY3 T;  2HHH T;  4B3M T;  4JV5 T;  4JI5 T;  2VQF T;  4LF4 T;  1N34 T;  2E5L T;  4KHP T;  4JI0 T;  2UUA T;  4LF6 T;  4JI8 T;  1IBM T;  4LF7 T;  4DR4 T;  4LFC T;  4DV5 T;  4B3T T;  1IBK T;  2UXC T;  2F4V T;  4DR1 T;  4GKJ T;  4LF9 T;  2UUB T;  4JYA T;  1I94 T;  4DV0 T;  5BR8 T;  4AQY T;  4X66 T;  2ZM6 T;  4DR6 T;  4DV3 T;  4DUY T;  1IBL T;  4DV6 T;  4LF8 T;  4DR2 T;  4JI7 T;  2VQE T;  4DUZ T;  1FJG T;  4K0K T;  4DR5 T;  4JI3 T;  1XMO T;  4NXM T;  4DV4 T;  5LMU T;  2UUC T;  4X62 T;  4X64 T;  4DR3 T;  4YHH T;  4LFB T;  2UXB T;  2UXD T;  1J5E T;  4LFA T;  3OTO T; 
#chains in the Genus database with same CATH topology
 1N36 T;  4MAL A;  2KWH A;  1KNR A;  4JLE A;  1HX1 B;  2WDV A;  1XWM A;  4OX9 T;  2X66 A;  1NAF A;  1E1H B;  1UGO A;  4HWD A;  5C8Y E;  4EIW A;  3UUM A;  1XMQ T;  3IA3 A;  5FL0 A;  4HEA A;  5KX5 E;  2HN1 A;  1E2A A;  4H63 H;  3M65 A;  3UU3 A;  2QGS A;  4ZI3 D;  3KFW X;  3LJC A;  4HWH A;  4GOU A;  2M67 A;  1D1B A;  2XUE A;  3F31 A;  2A9U A;  3E22 E;  4ZZB A;  4JI0 T;  2V26 A;  5L3B B;  1IBK T;  2BKO A;  4BA9 A;  2XQ5 A;  3P4S A;  4IIJ E;  3KDS E;  4DV0 T;  3UU4 A;  4IT4 A;  2V7I A;  4YJ3 E;  4MLK A;  4DUZ T;  4K0K T;  2A2F X;  3MZK B;  4DR5 T;  4I55 E;  3VU7 H;  4QH5 A;  4DV4 T;  2N1G A;  3HI2 A;  4KP3 C;  1KEY A;  2V8S V;  2CBI A;  3CX6 B;  2WS3 A;  2R6G F;  3S4U A;  1HNX T;  1OED E;  5JDF A;  4HWI B;  2LRL A;  3HA4 A;  4X1K E;  2JQK A;  4DR7 T;  2FUP A;  1XZY A;  5ETW A;  1BR2 A;  5LCY A;  3V5S A;  1HTJ F;  1MIV A;  3EVY A;  4ZHQ E;  4JUY A;  5ABE A;  5CB4 E;  4I0U A;  4ILU A;  5AQF B;  3MJX A;  3SS1 A;  4DV1 T;  2HHH T;  3GN5 B;  3CK6 A;  2X0L B;  1G8X A;  5LGU B;  2VKJ A;  5JRC A;  2E9X B;  4LFC T;  3AE5 A;  2BBH A;  5FXW A;  3ABV A;  3FZM B;  4U3C A;  4DBQ A;  2J4G A;  4N78 D;  4IRE A;  2I6H A;  3AE9 A;  3AEB A;  3LFM A;  3RRW A;  3PUZ F;  1HFA A;  4DR2 T;  4PK4 A;  3TLT A;  5L3E B;  2LHR A;  5DJQ C;  4IL4 A;  5JRE A;  2K24 A;  2V5D A;  2DCF A;  1ZEE A;  2BKN A;  3RQW A;  4GK5 E;  4ILB A;  5AQL B;  4FJO A;  3PE0 A;  2KZ7 B;  3O9X A;  2FBW A;  2RP4 A;  3ZC0 A;  3CQC B;  3UFG A;  2CMR A;  3I9W A;  4Z8X A;  4IL9 A;  2XTL A;  5LG4 A;  2DHR A;  4FI5 A;  1T8B A;  3ZN0 B;  4HFV A;  3G06 A;  2W62 A;  1UUS A;  3ETV A;  1WYC A;  3FB2 A;  5LHH B;  3JAE A;  4YTN A;  3QK6 A;  2WM9 A;  1WR6 A;  3I0Q A;  4AIS A;  2VL0 A;  2XM1 A;  2BDE A;  3IEE A;  5E0O A;  1N34 T;  3OBV E;  1XDP A;  1FMV A;  4OYJ A;  5LG3 A;  4O4L E;  3LBX A;  2DNX A;  2UUB T;  2NW9 A;  1I94 T;  1L0V A;  1MMA A;  2YN6 A;  4ZS2 A;  4YTP A;  3PJA J;  4YSX A;  5HXE A;  3QNU A;  5J2T E;  5AQT B;  5JVD E;  2VAS A;  5LYJ E;  4ZXL A;  2Q9Q C;  4TV9 E;  1Y64 B;  4PJN A;  4PK6 A;  3LK4 2;  5M4Y A;  3ZST A;  2IW5 B;  4HFD A;  4NUU A;  4IDN A;  5LMU T;  1HG2 A;  2E9X D;  4H9P C;  1OED C;  1SA0 E;  4P09 A;  1Z0P A;  2ZLY A;  2D0U A;  2UXB T;  4IE6 A;  2CLY B;  2IHR 1;  2UXD T;  5HEH A;  1J5E T;  3AE7 A;  1OED A;  3EHZ A;  5L3D B;  4IDP A;  2XPK A;  3AEF A;  5L47 A;  2DWK A;  2IUB A;  2YEV C;  5LJM A;  3FXE B;  2Y6X A;  3RH3 A;  3K3Q C;  4CN6 A;  4EZH A;  5L3C B;  2WZI A;  5HWY A;  1T72 A;  5KXJ A;  2LSI A;  2XJ7 A;  1UX4 A;  2DL1 A;  4UIG A;  3WAJ A;  2EHO B;  2ACZ A;  3GMI A;  2AXD S;  2OLT A;  4KHP T;  4F8H A;  2X9X A;  3JC6 C;  4DR4 T;  5JDG A;  3PUV F;  3VRB A;  3PUY F;  2HN2 A;  5BR8 T;  5EK3 A;  5CFB A;  3OYX A;  2K5B B;  5LOV E;  4HFH A;  4DR6 T;  4PFP A;  2E9X A;  4J2C A;  4U2Z A;  3CPZ A;  3OYZ A;  2V7J A;  5CGM A;  1W9R A;  2W00 A;  4C90 A;  2Y48 B;  3N2G E;  1HG5 A;  5AQI B;  3KV4 A;  2I0M A;  5JDM A;  4U74 A;  4EGW A;  5HCM A;  2VWA A;  3Q5E A;  3V5U A;  3SFD A;  3O4X E;  4PK5 A;  3RIA A;  4X1Y E;  3PV0 F;  2WWU A;  3ZYL A;  2ZM8 A;  1X9B A;  1NEK A;  3Q5X A;  5JTG A;  2A72 A;  1WYB A;  2KT9 A;  3FZF B;  1UK5 A;  2WQY A;  4JI2 T;  4HGA A;  1I6Z A;  4XZC A;  3D0T A;  2J47 A;  3ZT7 A;  4ZI2 C;  3ZCI A;  5CJ5 A;  4KX6 A;  4NXN T;  5LMN T;  3B13 A;  3PUW F;  2J1D G;  4B3M T;  5HAX A;  3TLW A;  1KF6 A;  3RC8 A;  1IJ5 A;  5JR9 B;  1JNZ A;  3RRC A;  3MXZ A;  2IC6 A;  5AQR B;  3ZCJ A;  2UUA T;  4CXX A;  5FYM A;  2ES0 A;  2BVL A;  2UXX B;  3MK7 C;  3UQ7 A;  2H88 A;  3B57 A;  3N2O A;  4LF8 T;  2QVA A;  4HKA A;  2IAK A;  4OFZ A;  3ZEF B;  4GYR A;  3AE2 A;  5ADX L;  3AE8 A;  1MMD A;  2C5K T;  3EDV A;  2EHO D;  2W66 A;  3UT5 E;  4ILA A;  4TWF A;  5EZY E;  1MIY A;  4X5T A;  4ZZC A;  1O3X A;  4IE7 A;  3CX8 B;  4BJN A;  4JEH B;  2DLR A;  4CN4 A;  2W4X A;  4IST A;  3T8O A;  4PJL A;  2V6Y A;  3T1Y T;  2WU5 A;  5F5W A;  3ZYK A;  1ZP0 A;  3CKD A;  3K3O A;  2LOP A;  5FXX A;  3UU5 A;  4ZS3 A;  3ESL A;  3MKD A;  1VCS A;  5FVK A;  5EK2 A;  4B3S T;  1HNW T;  3PUX F;  2PFV A;  1LVK A;  3RI5 A;  3C51 A;  5LP6 E;  2LOS A;  3RPU A;  4AI6 A;  4PW8 A;  3UTK A;  3U78 A;  4ZOL E;  5ABH A;  5FKY A;  4U7I A;  3VR8 A;  4QHO A;  2W63 A;  3NZP A;  3P50 A;  2WZH A;  4I4T E;  3N5L A;  1IBM T;  1QUU A;  5LHG B;  2LKH A;  2RA1 A;  4B3T T;  3PUG A;  3PTR B;  4LMJ A;  4DR1 T;  2L9Q A;  5TAO A;  2UXN B;  3ZLI A;  2KSR A;  2ZMA A;  3CVR A;  4PFO A;  2LM2 A;  4AQY T;  4ZI7 E;  4HFI A;  1D1C A;  2LSJ A;  4V1A v;  1VOM A;  3KV5 A;  4AKI A;  4B6X A;  2NTY A;  4DID B;  5AQP B;  2D0T A;  3MAC A;  3UUX B;  3ZMV B;  5AFU L;  3RKG A;  1D0Y A;  4UVA B;  4IGU A;  4IE0 A;  2FJB A;  4WNK A;  1MNE A;  1SUM B;  2LHN A;  4LFB T;  2CXL A;  3ZKR A;  3C64 A;  4EZ4 A;  1HNZ T;  2PG8 A;  1SE7 A;  5IUX A;  4UVC B;  3R84 B;  2Q9Q B;  4PJM A;  5JQG E;  4TWH A;  4MHC A;  3WAK A;  3FXD B;  5JDH A;  3QB5 K;  4I43 B;  2XZE A;  4YHJ A;  3HR0 A;  3F57 A;  5IWA T;  4ZI3 C;  2JPF A;  3KBU A;  3DJB A;  2MOZ A;  3T1H T;  2DI4 A;  4ILC A;  1KNP A;  3KV6 A;  2BS3 A;  4UEM A;  2XAF B;  4X20 E;  1UX5 A;  4UVB B;  3N9P A;  3P4R A;  3GWH A;  4NUV A;  1MIW A;  1NEN A;  4QH1 A;  3RX6 A;  3ZJ1 A;  2CA5 A;  5FMN A;  3N9O A;  4WBN E;  3TLS A;  4JYA T;  5KDM C;  5JR9 A;  3H3A A;  5GON E;  2YU2 A;  4DV3 T;  1IBL T;  2W67 A;  4U2Y A;  2HPL A;  3EAB A;  1ZV4 X;  4IE4 A;  3UQ4 A;  4HWC A;  4PJJ A;  4EAH A;  2QA7 A;  4JI3 T;  4ADZ A;  4NXM T;  3DP7 A;  3HL6 A;  3ANW A;  4E7Z A;  5J1G A;  1W09 A;  3AXJ B;  2HH7 A;  1NWM X;  3AE6 A;  3AA0 B;  3P7I A;  2H7O A;  4M1P A;  2X0Y A;  4JI6 T;  1G73 A;  2IC9 A;  3BQL A;  4XAX B;  4CI1 B;  4B3R T;  4EYY R;  4CI2 B;  4YSZ A;  4A97 A;  2LSY A;  3IF8 B;  4BJM A;  3RYH E;  2BG9 B;  3CX7 B;  4XBF B;  5AQK B;  1US7 B;  2ACX A;  2G0U A;  3HKD E;  3Q9D A;  3SWH A;  2M6B A;  2WMO A;  5HXS A;  2C5I T;  2LE8 A;  2BZB A;  4MBQ A;  1WLX A;  2XSB A;  4QXH B;  2P9B A;  2BS4 A;  4WW0 A;  3O1J A;  2C5J A;  3ZT5 A;  4U31 A;  4WYV A;  4ZEY A;  4X1I E;  3MA9 A;  3ONX A;  3PUS A;  4TZ4 C;  5FP3 A;  2ZM6 T;  1QLB A;  4DMW A;  2XAQ B;  5FY1 A;  2AE9 A;  4NPP A;  3QUJ A;  2LLY A;  4TV8 E;  2Z6E A;  2V6X A;  3BQI A;  2X68 A;  3CML A;  4UF0 B;  2YU1 A;  4O8S A;  3ZSS A;  4G63 A;  4LMK A;  3LG7 A;  4DR3 T;  1S35 A;  3EUH A;  2YKS A;  3N9Q A;  3RIU A;  3OTO T;  4DMV A;  3UU6 A;  4HFB A;  4X65 T;  2NWB A;  2FJA A;  4QX7 B;  4CN1 A;  4GKK T;  5FY0 A;  2LEH A;  4AKR B;  2XQA A;  5HWX A;  3ZMS B;  3AAA B;  1VCT A;  2VVN A;  3FBL A;  5L4H A;  5HEJ A;  2VL8 A;  4AKL A;  3HKE E;  4QKN A;  4KBM B;  2SPC A;  5LB7 B;  3OPC A;  4OYK A;  1M62 A;  3M3Z B;  2WSS V;  1Z8U A;  3KBT A;  5JH7 E;  2VK9 A;  5FNV E;  2CXF A;  3L09 A;  2KLQ A;  2H7V C;  3OKQ A;  1YW0 A;  2XAJ B;  2XY8 B;  1CHU A;  4H9S E;  3AEA A;  3NKZ A;  5HEO A;  4DVD A;  2CHO A;  3AA6 B;  3FZL B;  3PUR A;  2V7M A;  4DO0 A;  3EDU A;  1HS7 A;  2XQ4 A;  4L9I A;  3SFE A;  2ODV A;  3GN5 A;  4QWN B;  2E9X C;  3Q5W A;  4HFC A;  5LHI B;  5HEG A;  3JAF A;  2LT3 A;  2V5C A;  4O4H E;  4LFA T;  4JBW F;  1YQ4 A;  5ABG A;  4HFE A;  2X51 A;  3EAM A;  1HR0 T;  4JI4 T;  2CXD A;  2H3R A;  4KUM B;  5ABF B;  2JMH A;  1WFD A;  2A3D A;  3B5M A;  2XQ8 A;  4CZZ B;  3VHL A;  2KXP B;  4IHJ E;  3LDQ B;  5AQH B;  1BR4 A;  4HTE A;  2XAH B;  1U5P A;  2BBJ A;  2LM9 A;  1YD8 G;  2OV9 A;  2IML A;  1HF8 A;  4Q25 A;  3AE3 A;  3P4W A;  2HPJ A;  3IBP A;  2MAW A;  3KV9 A;  3RC3 A;  3AVR A;  2CBJ A;  4TX5 A;  5LBQ B;  1QSD A;  4IDO A;  4EEB A;  4JI7 T;  5A1L A;  4CI3 B;  5FVL A;  5F8P A;  5C3J A;  4H9O C;  2NW7 A;  4Z91 A;  2E2A A;  3P4Q A;  3HKC E;  1H7C A;  2NW8 A;  3TLU A;  2JIW A;  3I0O A;  1EZ3 A;  5J0Z A;  5AQV B;  3UUB A;  3K8P C;  3PU8 A;  4YLH A;  4DBR A;  5JRC B;  2MYS A;  2YDQ A;  5AQM B;  2XQ9 A;  4WZX A;  4H63 V;  4YSY A;  3PUA A;  3RQU A;  4IDQ A;  1B7T A;  2K3W A;  3A5X A;  1HX8 A;  2K9A A;  2FJE A;  3J7Y q;  5F3J A;  2CLY C;  5LXT E;  3AAI A;  3O1H A;  4H9R C;  2NP9 A;  3RLF F;  3CQG B;  2B76 A;  2V7K A;  4YJ2 E;  3UUL A;  3NWI A;  4EB6 E;  4ANJ A;  3N9L A;  2CRB A;  3LK2 B;  4CXW A;  2YK0 A;  2LJL A;  3BQK A;  4COF A;  2MTQ A;  4L5G A;  4P0A A;  3ZPO A;  2EHO C;  1GQE A;  1FJG T;  3OVU A;  2WWV A;  1D0X A;  2OA5 A;  2EHO A;  5IYZ E;  2UUC T;  1W0B A;  2KND A;  2CE7 A;  3Q2M A;  3ONJ A;  1V9D A;  2XHE B;  3ZMU B;  3VR9 A;  3EI0 A;  2YOE A;  3CWZ B;  4A5X A;  4UR9 A;  3P4P A;  3ZN1 B;  5L3F B;  2WCA A;  4AIU A;  2LSK A;  5FXZ A;  1UUR A;  4YXD A;  3LBX B;  5HXC A;  3FZK B;  2LKG A;  2CHN A;  1YKE B;  5LGT B;  3FZH B;  4O2B E;  4EYU A;  2IIU A;  4UEL A;  5L3G B;  4K0U A;  2X9Y A;  4PAG A;  1SHZ C;  2ODU A;  3L8R A;  2BS2 A;  5ABF A;  2WU2 A;  5FY7 A;  3C4Z A;  4AKH A;  3C50 A;  3X1D A;  2RPA A;  2VQF T;  1R8I A;  2XAG B;  1E7P A;  4EXT A;  4JI8 T;  4I50 E;  5HXH A;  4LF7 T;  1X79 A;  5L4E A;  1LRZ A;  1OED B;  5LBM A;  4JEU B;  3AE4 A;  1IAP A;  2D5U A;  3F2E A;  1CUN A;  4DUY T;  2XM2 A;  5AQO B;  4DV6 T;  2VB6 A;  2VQE T;  5JDN A;  3CQX C;  2QRX A;  3IHR A;  5FXV A;  2PJQ A;  1MMN A;  5JR9 C;  1S94 A;  1U4Q A;  4EED A;  2I59 A;  2B1E A;  5AQN B;  2LRK A;  4X64 T;  3L39 A;  3JAD A;  4TN7 B;  4YHH T;  5KMG P;  2V7L A;  4HN9 A;  1HCI A;  4ERR A;  2CCQ A;  1WRD A;  2H89 A;  4OK0 A;  5DQW A;  2BVM A;  4YT0 A;  3U3I A;  1KK7 A;  3L3P A;  1ZHC A;  1KNZ A;  4H9Q C;  2L8K A;  1AJ3 A;  1J5W A;  2ZM2 A;  3VKH A;  2JMK A;  4ASK A;  2XAS B;  2NR4 A;  4PNI A;  3W15 B;  4LML A;  4TWD A;  5CA1 E;  5HCJ A;  3PU3 A;  3VRA A;  3AEG A;  4U72 A;  3AVS A;  1OXZ A;  1DU2 A;  3AB3 B;  4YY3 T;  4AQF C;  3H37 A;  3I9Y A;  4KMC A;  4L0R A;  2Y8D A;  1LKX A;  3C4X A;  2YDR A;  3C4W A;  5AQJ B;  4U7Y A;  4CXY A;  4AQF A;  2X67 A;  2XQ7 A;  4KI0 F;  1ZOY A;  2PTF A;  2UXC T;  4GKJ T;  2E8I A;  2CWY A;  2XQ3 A;  4X66 T;  2KIN B;  2WDR A;  2BG9 E;  3ETU A;  2C0S A;  2Q9Q D;  2YIN A;  3PDY A;  3QB5 A;  5J2U E;  4P1N A;  3AE1 A;  5H6R B;  1XMO T;  2FJD A;  4TNV A;  2JQ9 A;  5HEU A;  4P0B A;  1OWA A;  3FBZ A;  5HYA A;  3RKO A;  4G2A A;  3ZMZ B;  3ZT6 A;  2D9D A;  4AKG A;  5FL1 A;  1T98 A;  3NVO A;  1Y01 A;  3NRX A;  4YTM A;  1VRB A;  3RIU C;  4O2A E;  2WDQ A;  5H6Q B;  4YFS A;  4DV2 T;  4A98 A;  4C91 A;  2D2S A;  2W2U A;  2LSG A;  4EV6 A;  4WBO A;  1FEW A;  1XNQ T;  3GA8 A;  3RYI E;  4QXB B;  4JI5 T;  5AQS B;  2CPT A;  2E5L T;  5IHY A;  5LGN B;  2WMN A;  4LF6 T;  1D0Z A;  5LJN A;  4DV5 T;  3LK3 B;  3JC6 D;  3SRZ A;  1IJ6 A;  2Q9Q A;  3A7M A;  4LF9 T;  2NTX A;  4KHZ F;  3BK9 A;  1ZKE A;  3KIN B;  2WBL A;  4AXP A;  2V6Y B;  4GK0 E;  2VUR A;  4UV9 B;  4A56 A;  1YKH B;  3TKL B;  3ZMT B;  4IE5 A;  3N9N A;  3RGL A;  5AQG B;  2NOX A;  3K1S A;  3K3N A;  4UV8 B;  2M6I A;  3ZJ2 A;  2J62 A;  1D1A A;  4OHF A;  1BR1 A;  3I1A A;  3UU8 A;  1W0A A;  3KVB A;  3AED A;  5LA6 E;  2WP9 A;  2DWG A;  2BKP A;  2KMF A;  4ISS A;  5JDL A;  3PJA A;  3A8Y C;  4HE8 A;  4IDZ A;  3HKB E;  1N32 T;  1LVF A;  3CIR A;  2MBG A;  2N9D A;  4O4J E;  3AAE B;  2X9H A;  4DV7 T;  4QH4 A;  4LF5 T;  4HWF A;  1YXR A;  4QXC B;  2VKD A;  4NIQ A;  2W0G A;  5HXR A;  1XNR T;  2CM0 A;  3ZC1 A;  2VVS A;  5DAB A;  1WR0 A;  2GK9 A;  2V1D B;  4EOZ B;  3ONL C;  3LSV A;  2WB5 A;  4ZI2 D;  2XQ6 A;  3NRY A;  2KWI B;  2L3L A;  3R6N A;  3AXJ A;  3RHW A;  3FHN A;  3Q5D A;  3RYC E;  5BMV E;  2XSA A;  4CQI A;  2BG9 C;  3VKG A;  2K48 A;  3RIF A;  2N2N A;  2JQH A;  4MFR A;  5L2L A;  3JCF A;  3N9M A;  2BG9 A;  4E7S A;  3O1I A;  1XDO A;  2CEA A;  3RYF E;  2YDS A;  1M7K A;  4TNW A;  2MPK A;  4O4I E;  2PBI A;  5CA0 E;  4X62 T;  3QOF A;  5JDQ A;  3ZYM A;  2VKH A;  1T7S A;  3DTO A;  1MND A;  5AQQ B;  2JRK A;  3H3M A;  2CWO A;  1UCU A;  3J9X 1;  3E08 A;  3RF1 A;  4AQG A;  1N33 T;  3WI3 A;  1FIO A;  1KFY A;  2UU9 T;  3NBX X;  4BAY B;  3AA7 B;  3KVA A;  4JI1 T;  4F6R C;  5EK4 A;  1FMW A;  3TLV A;  1IZN B;  4GYS A;  4H9N C;  4UF0 A;  2X9W A;  4GIW A;  3C98 B;  4JV5 T;  4LF4 T;  1BR0 A;  2JJ9 A;  3E0Z A;  5DQV A;  4TUY E;  3ANW B;  5LNK A;  5AQU B;  4QX8 B;  2F4V T;  3AEC A;  4DND A;  3OJA A;  3PUQ A;  2X0H A;  1J1J A;  5C2T A;  3UUN A;  2JQQ A;  2WAU A;  2WY2 A;  3SOL A;  1WCR A;  4U33 A;  2ZM0 A;  4Z90 A;  1YQ3 A;  2E5V A;  2QYW A;  3N2K E;  2VKO A;  3P8C D;  2W61 A;  1MMG A;  3NZQ A;  3UFE A;  4UXN B;  1JNR A;  3AA1 B;  2XQY A;  3AEE A;  2IDO B;  3QC9 A; 
#chains in the Genus database with same CATH homology
 1HNZ T;  1N36 T;  1HNX T;  1HR0 T;  3T1Y T;  4JI4 T;  4JI6 T;  4OX9 T;  1N32 T;  1N33 T;  4DR7 T;  4B3R T;  1XMQ T;  4DV7 T;  4X65 T;  4B3S T;  4LF5 T;  1HNW T;  2UU9 T;  4DV2 T;  4JI2 T;  4JI1 T;  4GKK T;  1XNR T;  5IWA T;  3T1H T;  4NXN T;  5LMN T;  1XNQ T;  4DV1 T;  4YY3 T;  2HHH T;  4B3M T;  4JV5 T;  4JI5 T;  2VQF T;  4LF4 T;  1N34 T;  2E5L T;  4KHP T;  4JI0 T;  2UUA T;  4LF6 T;  4JI8 T;  1IBM T;  4LF7 T;  4DR4 T;  4LFC T;  4DV5 T;  4B3T T;  1IBK T;  2UXC T;  2F4V T;  4DR1 T;  4GKJ T;  4LF9 T;  2UUB T;  4JYA T;  1I94 T;  4DV0 T;  5BR8 T;  4AQY T;  4X66 T;  2ZM6 T;  4DR6 T;  4DV3 T;  4DUY T;  1IBL T;  4DV6 T;  4LF8 T;  4DR2 T;  4JI7 T;  2VQE T;  4DUZ T;  1FJG T;  4K0K T;  4DR5 T;  4JI3 T;  1XMO T;  4NXM T;  4DV4 T;  5LMU T;  2UUC T;  4X62 T;  4X64 T;  4DR3 T;  4YHH T;  4LFB T;  2UXB T;  2UXD T;  1J5E T;  4LFA T;  3OTO T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...