4JI2T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4ji2T00
2UXDT 3OTOT 4X66T 4DR7T 4JI2T 4JI5T 4LFAT 4DR5T 4GKKT 1HNZT 1XNQT 2E5LT 4JI1T 4NXMT 4DV3T 5LMNT 1I94T 4JI4T 1XNRT 4GKJT 4YY3T 2UXCT 1XMOT 4JI8T 4DUYT 1XMQT 4DR1T 4DR4T 4LF7T 4DR3T 4DUZT 4B3RT 4DR2T 4DV6T 4LF4T 5BR8T 4B3MT 4JI6T 1N36T 4LFCT 4X65T 2F4VT 4JYAT 1HR0T 4DV0T 4JI7T 4LF9T 2VQET 3T1YT 1IBLT 4B3ST 4B3TT 2ZM6T 4X64T 4JI0T 1N34T 3T1HT 4DV4T 2UUAT 2UUCT 4DV2T 4LF5T 4AQYT 4DV1T 1J5ET 4YHHT 5IWAT 1HNWT 4X62T 4LF8T 4LF6T 4OX9T 1HNXT 2UXBT 4DV7T 4DV5T 1FJGT 1IBMT 4KHPT 4K0KT 1N32T 2UUBT 2UU9T 5LMUT 1IBKT 4NXNT 2HHHT 4JV5T 4LFBT 1N33T 2VQFT 4DR6T 4JI3T
chains in the Genus database with same CATH superfamily
4O2AE 3PE0A 2XASB 4WZXA 2LLYA 4AQFA 2YEVC 2VL0A 4OHFA 5ETWA 4YSYA 2FJBA 3DP7A 4P09A 1ZV4X 4ZZBA 1UGOA 2VB6A 2VWAA 2WU5A 2XUEA 3DTOA 4IDOA 5FXWA 4BAYB 5FY1A 5FXVA 3GN5A 4GKKT 1T8BA 1J1JA 2V26A 3V5UA 3H3MA 2JQHA 4JI1T 3ZC1A 4ZEYA 4DV3T 2HN2A 3AA1B 5EZYE 5LMNT 5LXTE 4JI4T 1YQ4A 2W62A 3AEGA 2IC6A 3E08A 5AQLB 2W4XA 4GKJT 3VKGA 3MZKB 2YU2A 1S94A 1QUUA 2D9DA 2NP9A 5HXCA 3R6NA 3AEEA 4U7YA 3ZC0A 4P1NA 4EEBA 3L09A 2IIUA 2LSJA 1QSDA 2BVLA 3IA3A 3NVOA 3P4PA 4LMJA 2N2NA 3KV6A 1XMQT 3JAFA 4HFIA 1W9RA 4LF7T 4HTEA 4DBQA 3UU6A 1YW0A 4TV8E 5HEOA 1LVKA 5LYJE 3FB2A 3UUXB 1FMVA 1T7SA 3C50A 4C90A 1WRDA 3KBTA 3WI3A 2XQ6A 3SWHA 1KFYA 1HG2A 1W0AA 3UTKA 5LCYA 4B3RT 3TLSA 4IHJE 3UU3A 5LBMA 2PJQA 5JDFA 4U31A 2BDEA 3KBUA 2CWOA 5ABFA 1XDOA 3LJCA 1XDPA 4UIGA 2KSRA 3K8PC 3CPZA 3EUHA 2Z6EA 5F8PA 4DBRA 3S4UA 2WP9A 2CHNA 3GMIA 2PBIA 3ETVA 2XQ3A 3ZN1B 2CBIA 5FVKA 5FY0A 3ZMTB 1IZNB 2E9XC 5J2TE 3N5LA 4I0UA 4HFCA 4KX6A 2CXFA 4OFZA 4YSXA 3QOFA 2F4VT 2NR4A 2Q9QD 2H88A 3LK42 4IE6A 4TN7B 2PG8A 1OWAA 4TNVA 4JYAT 5DQWA 3N9OA 4ILAA 4JI7T 5J2UE 3T8OA 1SA0E 1NENA 3A8YC 4CN4A 2IUBA 2LOSA 3NRYA 1NAFA 2V7MA 3N2OA 2N1GA 3GWHA 1Y01A 4EIWA 1UK5A 3NZQA 4LFBT 3ONJA 3EABA 2XAJB 4UF0A 2EHOD 1WCRA 3E0ZA 4ZHQE 5HYAA 5L2LA 3O9XA 1WR0A 2BBJA 2JMKA 2E8IA 3AEFA 4EYYR 5AQHB 4AKRB 3ZJ2A 3ZT7A 4F8HA 4I55E 4H63H 4O4LE 5FVLA 3TLUA 5L3DB 1E7PA 1N34T 5HWXA 2XQ5A 2UUCT 3JC6D 2DWGA 2JIWA 3PU3A 3OYZA 4U33A 3ZYLA 1WYCA 5AQOB 3U3IA 4TUYE 3F2EA 2LOPA 3L8RA 4DMWA 5L3GB 4DV2T 3QK6A 5L3CB 1U5PA 3AA6B 4CI2B 4EZ4A 4H63V 1KK7A 3AE2A 2ZLYA 3B57A 4QWNB 1J5ET 4X20E 3PDYA 2HPJA 3TLWA 3N9NA 5AQSB 3N2GE 3PV0F 3RLFF 3UUMA 3W15B 4YJ2E 1HNWT 4UXNB 4X62T 4YHJA 4QXCB 4LF8T 4NPPA 1SE7A 3N9PA 4OX9T 3CMLA 4X1KE 1HNXT 3UUNA 4O4IE 2LE8A 2QYWA 4I50E 4CZZB 3ZT6A 1HS7A 4DV5T 1IBMT 2X9WA 4KHPT 3ABVA 4K0KT 5L3EB 3UQ4A 3K3NA 3AE8A 3BQKA 5CFBA 2VL8A 3D0TA 3M3ZB 3KVBA 4Z8XA 1HX1B 4PK5A 2XJ7A 2DI4A 4V1Av 4NXNT 2C5KT 3NRXA 2Y48B 3KVAA 5HEUA 2K3WA 2YKSA 5FL0A 1LRZA 4JV5T 2YOEA 2I6HA 1N33T 1WFDA 3L3PA 3AA7B 3CK6A 4PJJA 3RHWA 2WS3A 3SFDA 4JI3T 4GYRA 1IAPA 4E7ZA 4P0AA 2UU9T 2JRKA 4L9IA 5JTGA 3U78A 3RX6A 2UXDT 4IL9A 2XQYA 3QC9A 3OTOT 2CEAA 1HFAA 3C4ZA 3KDSE 3LBXB 2XQ8A 3F31A 1Z8UA 2D0UA 5CJ5A 3I9YA 4UELA 1HCIA 2K9AA 3DJBA 4JI2T 3AA0B 1EZ3A 4LFAT 2YDSA 2JQKA 3A7MA 1MMNA 2QGSA 1LVFA 2BG9B 2A9UA 5HEJA 3P4WA 4O4HE 5ABHA 3ZPOA 2JQ9A 5JVDE 4EAHA 1I94T 3RRWA 3L39A 4TX5A 2ZM0A 1HTJF 2LJLA 4CN1A 1UCUA 1WLXA 1W0BA 1WR6A 2XQ4A 3EAMA 5AQGB 2W2UA 3UT5E 1S35A 4DNDA 4CQIA 2CA5A 3OVUA 3KFWX 2V7LA 3VR8A 2WAUA 2HN1A 4DUYT 1OEDB 2X67A 2WDQA 2WSSV 3ESLA 2V7KA 4ZOLE 2G0UA 3NKZA 2L3LA 4HFEA 4DR1T 4BJMA 1L0VA 4EGWA 4MLKA 2RP4A 4NUUA 4QKNA 2X9HA 5J1GA 2E9XA 1YKEB 2FBWA 3RQWA 5C2TA 2VKJA 4QX7B 4DR3T 2J47A 2A2FX 4CI1B 2WDVA 3I1AA 2RA1A 1MIVA 3C98B 5AQJB 2BG9C 1BR1A 2LEHA 2L9QA 3VRBA 3HKCE 1E1HB 2DLRA 2BG9E 2Y8DA 2BG9A 3MXZA 4HFHA 3RKGA 5LGTB 3A5XA 5FY7A 5BR8T 2D5UA 5LJNA 4AIUA 3CVRA 5LA6E 5AFUL 1JNZA 3AE1A 4PNIA 5KMGP 5LGNB 1D1BA 4X1YE 2J4GA 3C4WA 4I4TE 4TWFA 2Q9QA 4CI3B 5TAOA 4EXTA 4B3MT 3OPCA 5JDHA 2Q9QC 2V8SV 2KINB 2CBJA 4TWHA 4WYVA 3P7IA 3PURA 5F3JA 4TNWA 3F57A 4F6RC 2I59A 2M67A 1KNRA 2X0YA 2KWIB 2X9XA 4HKAA 4WBOA 3ZSTA 2W00A 2MOZA 3FZLB 4AISA 2E5VA 1HR0T 2LHNA 5AQIB 3PUXF 3RYIE 2M6BA 1VRBA 4U2YA 3FZFB 3ETUA 3O1HA 5HCJA 5L3BB 4ZS2A 2W66A 4QXBB 2EHOC 3PUAA 3SFEA 2YDQA 2NTYA 3MKDA 3VR9A 1NEKA 3TLTA 5FKYA 4B3ST 2CRBA 1KEYA 2CLYB 5AQFB 2VVNA 2XM1A 5AQVB 2V7JA 3AECA 3Q5EA 4HWFA 4IE4A 4PK4A 2ZM6T 2HPLA 1H7CA 2LSYA 3ONLC 3E22E 1OEDA 4DV4T 1OEDC 2PFVA 3OKQA 2I0MA 1DU2A 2WCAA 2XAGB 1MNDA 3KV9A 4AKIA 3RRCA 4BJNA 1XZYA 5CB4E 2B76A 4WBNE 3LFMA 5FXXA 2BS3A 2WZHA 3BK9A 4J2CA 3OYXA 1Y64B 4HWDA 2DCFA 4JEUB 1HX8A 2BKNA 4OK0A 5L4EA 1XWMA 2AXDS 3ZMVB 2VKHA 5LBQB 5H6QB 1FEWA 3TKLB 4X1IE 4KBMB 3NWIA 5F5WA 4X64T 3RIFA 3SOLA 3AB3B 2JMHA 4GK0E 2X66A 4IDNA 2FJDA 4EEDA 3ANWA 3OBVE 4U7IA 3RIUA 2CXLA 3RPUA 3RYCE 2A72A 4DV7T 1X79A 2D2SA 4PAGA 3ZKRA 4KUMB 4N78D 5HAXA 2ODUA 1N32T 2IMLA 5HEGA 1I6ZA 3ZMZB 4CXXA 4UF0B 4H9QC 4FJOA 3N2KE 1B7TA 1WYBA 1YD8G 2W63A 4HWHA 4IDZA 4PJNA 4PK6A 5ABGA 2HHHT 4AI6A 2CPTA 3C51A 4HGAA 3KV5A 2QVAA 4JLEA 3KINB 3VU7H 5J0ZA 3FHNA 4HN9A 3AAEB 4IT4A 1UX4A 5IHYA 4BA9A 3Q5XA 4YTNA 5JQGE 2DNXA 2LT3A 2LM9A 2WDRA 2CHOA 2X0HA 2XZEA 4EZHA 4O8SA 3SRZA 2BKPA 1J5WA 3FZKB 1US7B 4YSZA 2LRKA 4IE7A 2HH7A 2JJ9A 3LSVA 1YKHB 4X66T 4EYUA 4DR7T 2QRXA 4XAXB 4EOZB 3FZMB 1V9DA 3K1SA 3IF8B 2LSGA 3SS1A 1XNQT 4NXMT 4UEMA 5EK4A 4IE5A 2XSBA 3AE5A 1XNRT 4JEHB 2WY2A 2NW8A 4IL4A 3G06A 3LBXA 4YY3T 3VKHA 2C5IT 3AE6A 2XSAA 3CX6B 4TV9E 2X68A 3O1IA 4YLHA 5DQVA 2MBGA 5CA0E 3HR0A 5L3FB 1XMOT 5KDMC 3RIUC 1MNEA 4ANJA 2BZBA 3Q9DA 4DR4T 4PFPA 3CX8B 2VASA 2MYSA 2WQYA 3B5MA 4H9OC 5HCMA 2CM0A 3GA8A 2V6XA 2NWBA 3CQGB 5JDMA 5FMNA 3PUGA 4DUZT 2V7IA 3PUQA 2OA5A 3P4RA 2MTQA 2R6GF 1M7KA 4G63A 4AQGA 2NTXA 5HXSA 3MJXA 4DV6T 4ILBA 5BMVE 4LF4T 2DHRA 2EHOA 3RC3A 3RC8A 5HWYA 2L8KA 4MHCA 4X5TA 4E7SA 3LG7A 3MA9A 5L4HA 3LDQB 3UFEA 3ZMSB 2VKDA 2BKOA 4JI6T 3VRAA 1AJ3A 3I0QA 1ZHCA 4O2BE 3IEEA 4YXDA 4UV9B 1D1AA 3MK7C 1MMAA 4X65T 1ZKEA 4MBQA 2K24A 3RQUA 4YFSA 1UURA 3JAEA 3JADA 5AQMB 3RF1A 4DV0T 3FZHB 3EVYA 4Z90A 4A5XA 2DWKA 3NZPA 1SUMB 5HXRA 2ZMAA 3TLVA 2YU1A 2M6IA 4CXWA 1OEDE 3T1YT 3MACA 3AXJA 5LJMA 4U74A 1D0XA 2IC9A 4H9RC 5C3JA 1VCTA 1HG5A 2AE9A 4XZCA 3FXDB 1FMWA 3AEAA 4B3TT 2EHOB 3CX7B 4HFBA 2LRLA 5LP6E 4M1PA 3CQCB 4A97A 2K5BB 4JI0T 2H7VC 4GK5E 4PFOA 5LHGB 3T1HT 1G73A 2J62A 3Q5DA 5AQUB 5JR9A 5KXJA 3P4SA 1MMGA 4G2AA 5AQKB 3PJAA 3QB5A 4AQYT 2FJAA 4JBWF 5LNKA 5JREA 5FXZA 4MFRA 1U4QA 2H7OA 1NWMX 2VVSA 4ZI2C 3EI0A 3Q5WA 4QH5A 3RYHE 4UVAB 3PUZF 2W0GA 4OYJA 1CUNA 2C0SA 4Q25A 2WZIA 3QB5K 4A98A 3RKOA 3I0OA 2CXDA 4QHOA 5DABA 5KX5E 3AXJB 4MALA 3RGLA 3X1DA 2KLQA 3O4XE 1LKXA 5IWAT 2E2AA 1D0ZA 5JH7E 4XBFB 5LG3A 2YINA 4LF6T 1YQ3A 4ADZA 3HKEE 1E2AA 3P4QA 4WNKA 5FNVE 2NW9A 2XPKA 4DIDB 2UXBT 3PJAJ 2X51A 5JDNA 2KMFA 4TZ4C 1FIOA 1W09A 1KNPA 3PUSA 3ZCJA 2WWUA 4B6XA 1MIYA 3AE9A 4PJMA 2FJEA 5LHHB 5JRCB 2WMNA 4IGUA 2XAHB 3H37A 2KZ7B 2V5DA 3AE7A 2BVMA 4PJLA 3ZYMA 1IBKT 2K48A 4YTMA 3AE4A 3ONXA 2X0LB 2PTFA 2Y6XA 4UVCB 2WU2A 3B13A 1BR2A 3CKDA 4TWDA 5LOVE 3ZEFB 2XY8B 2VQFT 4GYSA 4DR6T 4YTPA 3RI5A 4CN6A 5JDGA 2RPAA 3FXEB 2C5JA 4ZS3A 5IYZE 5JDLA 3C4XA 4KI0F 3V5SA 3UFGA 3UU8A 2CMRA 2H3RA 2W67A 2UXNB 4QH1A 5AQPB 1CHUA 1Z0PA 2VK9A 3WAKA 5M4YA 4ILCA 4QX8B 3K3QC 2XAQB 3OJAA 4GOUA 4HWIB 5JR9B 2ACXA 3IBPA 4JI5T 3UU4A 4COFA 5EK2A 4DR5T 4H9SE 4KHZF 4JUYA 2W61A 3UUBA 3HI2A 1HNZT 3PU8A 4L5GA 5JRCA 2B1EA 3H3AA 4H9NC 4AXPA 5JDQA 2J1DG 2E5LT 2YK0A 2LKHA 4DVDA 4ZXLA 4IDPA 2XQ9A 3CWZB 3CQXC 2WM9A 4HFVA 1ZOYA 3R84B 3NBXX 3P50A 1UX5A 2UXCT 2QA7A 2D0TA 2ODVA 1ZEEA 3N9QA 4ILUA 4JI8T 3UU5A 4QXHB 5AQRB 4DMVA 2SPCA 1R8IA 2YDRA 4ISSA 5ABFB 4OYKA 2LKGA 3UULA 3LK2B 2KWHA 3AAIA 4GIWA 1OXZA 1ZP0A 2WBLA 3EHZA 4H9PC 4HFDA 3HKDE 4QH4A 5DJQC 5GONE 5A1LA 1IJ5A 4IDQA 3UQ7A 2YN6A 3AE3A 4AKLA 3PUVF 2VURA 4K0UA 3BQLA 4P0BA 3FBLA 1T98A 2V6YA 5FP3A 5LHIB 3ZYKA 2CCQA 3EDUA 2LHRA 3RH3A 2X9YA 1IJ6A 2ZM2A 4KP3C 4U3CA 4AQFC 2XM2A 5CGMA 5FL1A 2OV9A 1VOMA 3BQIA 5CA1E 2IAKA 2DL1A 1X9BA 4NIQA 5ADXL 1MMDA 1N36T 2CE7A 5EK3A 4LFCT 2N9DA 2A3DA 1YXRA 2KNDA 2WB5A 4LMLA 4ZI3C 2LM2A 4O4JE 2GK9A 2Q9QB 5ABEA 3AAAB 3M65A 2MPKA 3ZN0B 3I9WA 2E9XD 4ZI3D 4ZZCA 4ERRA 3K3OA 3ZCIA 4LMKA 3ANWB 3J9X1 2WMOA 4PW8A 5FYMA 3N9LA 4LF9T 2VQET 2UXXB 2NOXA 4HWCA 3O1JA 2BS2A 2KT9A 3AVSA 4AKGA 1G8XA 2JPFA 3Q2MA 1IBLT 3ZSSA 4KMCA 2LSIA 3QNUA 4IREA 2ACZA 2BBHA 4UV8B 5LB7B 2XQAA 3LK3B 4EB6E 4CXYA 2V1DB 3HA4A 5L47A 3GN5B 4Z91A 2CLYC 3RYFE 1GQEA 3EDVA 1T72A 3FBZA 1BR4A 2MAWA 2VKOA 3JCFA 2P9BA 2FUPA 2NW7A 2XHEB 3P8CD 4HEAA 4IIJE 5AQNB 3VHLA 5HXHA 5LG4A 3J7Yq 2UUAT 4UR9A 5E0OA 4ZI2D 3AEBA 4ZI7E 2IHR1 4LF5T 5AQTB 2KXPB 2ES0A 3JC6C 4C91A 2CWYA 2XQ7A 4DV1T 3C64A 2H89A 1QLBA 1UUSA 3QUJA 4WW0A 1HF8A 4AKHA 3HL6A 4YHHT 3AEDA 3ZLIA 2IDOB 3PTRB 5H6RB 4DR2T 5HEHA 3RIAA 3ZT5A 3PUWF 4DO0A 1JNRA 1MIWA 5C8YE 4EV6A 4FI5A 4YT0A 4YJ3E 3WAJA 1VCSA 4HE8A 2WWVA 5IUXA 1D0YA 4ASKA 2V5CA 2IW5B 2BS4A 1FJGT 2LSKA 3CIRA 4U2ZA 5JR9C 2ZM8A 1O3XA 4U72A 2V6YB 4ISTA 3ZMUB 4A56A 5LGUB 2OLTA 2UUBT 1KNZA 4IE0A 5LMUT 1M62A 4NUVA 2XAFB 3AVRA 3PUYF 3HKBE 2XTLA 4I43B 5AQQB 2E9XB 5HXEA 1KF6A 1SHZC 3IHRA 3N9MA 3ZJ1A 3KV4A 4L0RA 1D1CA 1BR0A 4UVBB 2JQQA
chains in the Genus database with same CATH topology
2UXDT 3OTOT 4X66T 4DR7T 4JI2T 4JI5T 4LFAT 4DR5T 4GKKT 1HNZT 1XNQT 2E5LT 4JI1T 4NXMT 4DV3T 5LMNT 1I94T 4JI4T 1XNRT 4GKJT 4YY3T 2UXCT 1XMOT 4JI8T 4DUYT 1XMQT 4DR1T 4DR4T 4LF7T 4DR3T 4DUZT 4B3RT 4DR2T 4DV6T 4LF4T 5BR8T 4B3MT 4JI6T 1N36T 4LFCT 4X65T 2F4VT 4JYAT 1HR0T 4DV0T 4JI7T 4LF9T 2VQET 3T1YT 1IBLT 4B3ST 4B3TT 2ZM6T 4X64T 4JI0T 1N34T 3T1HT 4DV4T 2UUAT 2UUCT 4DV2T 4LF5T 4AQYT 4DV1T 1J5ET 4YHHT 5IWAT 1HNWT 4X62T 4LF8T 4LF6T 4OX9T 1HNXT 2UXBT 4DV7T 4DV5T 1FJGT 1IBMT 4KHPT 4K0KT 1N32T 2UUBT 2UU9T 5LMUT 1IBKT 4NXNT 2HHHT 4JV5T 4LFBT 1N33T 2VQFT 4DR6T 4JI3T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXD T;  3OTO T;  4X66 T;  4DR7 T;  4JI2 T;  4JI5 T;  4LFA T;  4DR5 T;  4GKK T;  1HNZ T;  1XNQ T;  2E5L T;  4JI1 T;  4NXM T;  4DV3 T;  5LMN T;  1I94 T;  4JI4 T;  1XNR T;  4GKJ T;  4YY3 T;  2UXC T;  1XMO T;  4JI8 T;  4DUY T;  1XMQ T;  4DR1 T;  4DR4 T;  4LF7 T;  4DR3 T;  4DUZ T;  4B3R T;  4DR2 T;  4DV6 T;  4LF4 T;  5BR8 T;  4B3M T;  4JI6 T;  1N36 T;  4LFC T;  4X65 T;  2F4V T;  4JYA T;  1HR0 T;  4DV0 T;  4JI7 T;  4LF9 T;  2VQE T;  3T1Y T;  1IBL T;  4B3S T;  4B3T T;  2ZM6 T;  4X64 T;  4JI0 T;  1N34 T;  3T1H T;  4DV4 T;  2UUA T;  2UUC T;  4DV2 T;  4LF5 T;  4AQY T;  4DV1 T;  1J5E T;  4YHH T;  5IWA T;  1HNW T;  4X62 T;  4LF8 T;  4LF6 T;  4OX9 T;  1HNX T;  2UXB T;  4DV7 T;  4DV5 T;  1FJG T;  1IBM T;  4KHP T;  4K0K T;  1N32 T;  2UUB T;  2UU9 T;  5LMU T;  1IBK T;  4NXN T;  2HHH T;  4JV5 T;  4LFB T;  1N33 T;  2VQF T;  4DR6 T;  4JI3 T; 
#chains in the Genus database with same CATH topology
 4O2A E;  3PE0 A;  2XAS B;  4WZX A;  2LLY A;  4AQF A;  2YEV C;  2VL0 A;  4OHF A;  5ETW A;  4YSY A;  2FJB A;  3DP7 A;  4P09 A;  1ZV4 X;  4ZZB A;  1UGO A;  2VB6 A;  2VWA A;  2WU5 A;  2XUE A;  3DTO A;  4IDO A;  5FXW A;  4BAY B;  5FY1 A;  5FXV A;  3GN5 A;  4GKK T;  1T8B A;  1J1J A;  2V26 A;  3V5U A;  3H3M A;  2JQH A;  4JI1 T;  3ZC1 A;  4ZEY A;  4DV3 T;  2HN2 A;  3AA1 B;  5EZY E;  5LMN T;  5LXT E;  4JI4 T;  1YQ4 A;  2W62 A;  3AEG A;  2IC6 A;  3E08 A;  5AQL B;  2W4X A;  4GKJ T;  3VKG A;  3MZK B;  2YU2 A;  1S94 A;  1QUU A;  2D9D A;  2NP9 A;  5HXC A;  3R6N A;  3AEE A;  4U7Y A;  3ZC0 A;  4P1N A;  4EEB A;  3L09 A;  2IIU A;  2LSJ A;  1QSD A;  2BVL A;  3IA3 A;  3NVO A;  3P4P A;  4LMJ A;  2N2N A;  3KV6 A;  1XMQ T;  3JAF A;  4HFI A;  1W9R A;  4LF7 T;  4HTE A;  4DBQ A;  3UU6 A;  1YW0 A;  4TV8 E;  5HEO A;  1LVK A;  5LYJ E;  3FB2 A;  3UUX B;  1FMV A;  1T7S A;  3C50 A;  4C90 A;  1WRD A;  3KBT A;  3WI3 A;  2XQ6 A;  3SWH A;  1KFY A;  1HG2 A;  1W0A A;  3UTK A;  5LCY A;  4B3R T;  3TLS A;  4IHJ E;  3UU3 A;  5LBM A;  2PJQ A;  5JDF A;  4U31 A;  2BDE A;  3KBU A;  2CWO A;  5ABF A;  1XDO A;  3LJC A;  1XDP A;  4UIG A;  2KSR A;  3K8P C;  3CPZ A;  3EUH A;  2Z6E A;  5F8P A;  4DBR A;  3S4U A;  2WP9 A;  2CHN A;  3GMI A;  2PBI A;  3ETV A;  2XQ3 A;  3ZN1 B;  2CBI A;  5FVK A;  5FY0 A;  3ZMT B;  1IZN B;  2E9X C;  5J2T E;  3N5L A;  4I0U A;  4HFC A;  4KX6 A;  2CXF A;  4OFZ A;  4YSX A;  3QOF A;  2F4V T;  2NR4 A;  2Q9Q D;  2H88 A;  3LK4 2;  4IE6 A;  4TN7 B;  2PG8 A;  1OWA A;  4TNV A;  4JYA T;  5DQW A;  3N9O A;  4ILA A;  4JI7 T;  5J2U E;  3T8O A;  1SA0 E;  1NEN A;  3A8Y C;  4CN4 A;  2IUB A;  2LOS A;  3NRY A;  1NAF A;  2V7M A;  3N2O A;  2N1G A;  3GWH A;  1Y01 A;  4EIW A;  1UK5 A;  3NZQ A;  4LFB T;  3ONJ A;  3EAB A;  2XAJ B;  4UF0 A;  2EHO D;  1WCR A;  3E0Z A;  4ZHQ E;  5HYA A;  5L2L A;  3O9X A;  1WR0 A;  2BBJ A;  2JMK A;  2E8I A;  3AEF A;  4EYY R;  5AQH B;  4AKR B;  3ZJ2 A;  3ZT7 A;  4F8H A;  4I55 E;  4H63 H;  4O4L E;  5FVL A;  3TLU A;  5L3D B;  1E7P A;  1N34 T;  5HWX A;  2XQ5 A;  2UUC T;  3JC6 D;  2DWG A;  2JIW A;  3PU3 A;  3OYZ A;  4U33 A;  3ZYL A;  1WYC A;  5AQO B;  3U3I A;  4TUY E;  3F2E A;  2LOP A;  3L8R A;  4DMW A;  5L3G B;  4DV2 T;  3QK6 A;  5L3C B;  1U5P A;  3AA6 B;  4CI2 B;  4EZ4 A;  4H63 V;  1KK7 A;  3AE2 A;  2ZLY A;  3B57 A;  4QWN B;  1J5E T;  4X20 E;  3PDY A;  2HPJ A;  3TLW A;  3N9N A;  5AQS B;  3N2G E;  3PV0 F;  3RLF F;  3UUM A;  3W15 B;  4YJ2 E;  1HNW T;  4UXN B;  4X62 T;  4YHJ A;  4QXC B;  4LF8 T;  4NPP A;  1SE7 A;  3N9P A;  4OX9 T;  3CML A;  4X1K E;  1HNX T;  3UUN A;  4O4I E;  2LE8 A;  2QYW A;  4I50 E;  4CZZ B;  3ZT6 A;  1HS7 A;  4DV5 T;  1IBM T;  2X9W A;  4KHP T;  3ABV A;  4K0K T;  5L3E B;  3UQ4 A;  3K3N A;  3AE8 A;  3BQK A;  5CFB A;  2VL8 A;  3D0T A;  3M3Z B;  3KVB A;  4Z8X A;  1HX1 B;  4PK5 A;  2XJ7 A;  2DI4 A;  4V1A v;  4NXN T;  2C5K T;  3NRX A;  2Y48 B;  3KVA A;  5HEU A;  2K3W A;  2YKS A;  5FL0 A;  1LRZ A;  4JV5 T;  2YOE A;  2I6H A;  1N33 T;  1WFD A;  3L3P A;  3AA7 B;  3CK6 A;  4PJJ A;  3RHW A;  2WS3 A;  3SFD A;  4JI3 T;  4GYR A;  1IAP A;  4E7Z A;  4P0A A;  2UU9 T;  2JRK A;  4L9I A;  5JTG A;  3U78 A;  3RX6 A;  2UXD T;  4IL9 A;  2XQY A;  3QC9 A;  3OTO T;  2CEA A;  1HFA A;  3C4Z A;  3KDS E;  3LBX B;  2XQ8 A;  3F31 A;  1Z8U A;  2D0U A;  5CJ5 A;  3I9Y A;  4UEL A;  1HCI A;  2K9A A;  3DJB A;  4JI2 T;  3AA0 B;  1EZ3 A;  4LFA T;  2YDS A;  2JQK A;  3A7M A;  1MMN A;  2QGS A;  1LVF A;  2BG9 B;  2A9U A;  5HEJ A;  3P4W A;  4O4H E;  5ABH A;  3ZPO A;  2JQ9 A;  5JVD E;  4EAH A;  1I94 T;  3RRW A;  3L39 A;  4TX5 A;  2ZM0 A;  1HTJ F;  2LJL A;  4CN1 A;  1UCU A;  1WLX A;  1W0B A;  1WR6 A;  2XQ4 A;  3EAM A;  5AQG B;  2W2U A;  3UT5 E;  1S35 A;  4DND A;  4CQI A;  2CA5 A;  3OVU A;  3KFW X;  2V7L A;  3VR8 A;  2WAU A;  2HN1 A;  4DUY T;  1OED B;  2X67 A;  2WDQ A;  2WSS V;  3ESL A;  2V7K A;  4ZOL E;  2G0U A;  3NKZ A;  2L3L A;  4HFE A;  4DR1 T;  4BJM A;  1L0V A;  4EGW A;  4MLK A;  2RP4 A;  4NUU A;  4QKN A;  2X9H A;  5J1G A;  2E9X A;  1YKE B;  2FBW A;  3RQW A;  5C2T A;  2VKJ A;  4QX7 B;  4DR3 T;  2J47 A;  2A2F X;  4CI1 B;  2WDV A;  3I1A A;  2RA1 A;  1MIV A;  3C98 B;  5AQJ B;  2BG9 C;  1BR1 A;  2LEH A;  2L9Q A;  3VRB A;  3HKC E;  1E1H B;  2DLR A;  2BG9 E;  2Y8D A;  2BG9 A;  3MXZ A;  4HFH A;  3RKG A;  5LGT B;  3A5X A;  5FY7 A;  5BR8 T;  2D5U A;  5LJN A;  4AIU A;  3CVR A;  5LA6 E;  5AFU L;  1JNZ A;  3AE1 A;  4PNI A;  5KMG P;  5LGN B;  1D1B A;  4X1Y E;  2J4G A;  3C4W A;  4I4T E;  4TWF A;  2Q9Q A;  4CI3 B;  5TAO A;  4EXT A;  4B3M T;  3OPC A;  5JDH A;  2Q9Q C;  2V8S V;  2KIN B;  2CBJ A;  4TWH A;  4WYV A;  3P7I A;  3PUR A;  5F3J A;  4TNW A;  3F57 A;  4F6R C;  2I59 A;  2M67 A;  1KNR A;  2X0Y A;  2KWI B;  2X9X A;  4HKA A;  4WBO A;  3ZST A;  2W00 A;  2MOZ A;  3FZL B;  4AIS A;  2E5V A;  1HR0 T;  2LHN A;  5AQI B;  3PUX F;  3RYI E;  2M6B A;  1VRB A;  4U2Y A;  3FZF B;  3ETU A;  3O1H A;  5HCJ A;  5L3B B;  4ZS2 A;  2W66 A;  4QXB B;  2EHO C;  3PUA A;  3SFE A;  2YDQ A;  2NTY A;  3MKD A;  3VR9 A;  1NEK A;  3TLT A;  5FKY A;  4B3S T;  2CRB A;  1KEY A;  2CLY B;  5AQF B;  2VVN A;  2XM1 A;  5AQV B;  2V7J A;  3AEC A;  3Q5E A;  4HWF A;  4IE4 A;  4PK4 A;  2ZM6 T;  2HPL A;  1H7C A;  2LSY A;  3ONL C;  3E22 E;  1OED A;  4DV4 T;  1OED C;  2PFV A;  3OKQ A;  2I0M A;  1DU2 A;  2WCA A;  2XAG B;  1MND A;  3KV9 A;  4AKI A;  3RRC A;  4BJN A;  1XZY A;  5CB4 E;  2B76 A;  4WBN E;  3LFM A;  5FXX A;  2BS3 A;  2WZH A;  3BK9 A;  4J2C A;  3OYX A;  1Y64 B;  4HWD A;  2DCF A;  4JEU B;  1HX8 A;  2BKN A;  4OK0 A;  5L4E A;  1XWM A;  2AXD S;  3ZMV B;  2VKH A;  5LBQ B;  5H6Q B;  1FEW A;  3TKL B;  4X1I E;  4KBM B;  3NWI A;  5F5W A;  4X64 T;  3RIF A;  3SOL A;  3AB3 B;  2JMH A;  4GK0 E;  2X66 A;  4IDN A;  2FJD A;  4EED A;  3ANW A;  3OBV E;  4U7I A;  3RIU A;  2CXL A;  3RPU A;  3RYC E;  2A72 A;  4DV7 T;  1X79 A;  2D2S A;  4PAG A;  3ZKR A;  4KUM B;  4N78 D;  5HAX A;  2ODU A;  1N32 T;  2IML A;  5HEG A;  1I6Z A;  3ZMZ B;  4CXX A;  4UF0 B;  4H9Q C;  4FJO A;  3N2K E;  1B7T A;  1WYB A;  1YD8 G;  2W63 A;  4HWH A;  4IDZ A;  4PJN A;  4PK6 A;  5ABG A;  2HHH T;  4AI6 A;  2CPT A;  3C51 A;  4HGA A;  3KV5 A;  2QVA A;  4JLE A;  3KIN B;  3VU7 H;  5J0Z A;  3FHN A;  4HN9 A;  3AAE B;  4IT4 A;  1UX4 A;  5IHY A;  4BA9 A;  3Q5X A;  4YTN A;  5JQG E;  2DNX A;  2LT3 A;  2LM9 A;  2WDR A;  2CHO A;  2X0H A;  2XZE A;  4EZH A;  4O8S A;  3SRZ A;  2BKP A;  1J5W A;  3FZK B;  1US7 B;  4YSZ A;  2LRK A;  4IE7 A;  2HH7 A;  2JJ9 A;  3LSV A;  1YKH B;  4X66 T;  4EYU A;  4DR7 T;  2QRX A;  4XAX B;  4EOZ B;  3FZM B;  1V9D A;  3K1S A;  3IF8 B;  2LSG A;  3SS1 A;  1XNQ T;  4NXM T;  4UEM A;  5EK4 A;  4IE5 A;  2XSB A;  3AE5 A;  1XNR T;  4JEH B;  2WY2 A;  2NW8 A;  4IL4 A;  3G06 A;  3LBX A;  4YY3 T;  3VKH A;  2C5I T;  3AE6 A;  2XSA A;  3CX6 B;  4TV9 E;  2X68 A;  3O1I A;  4YLH A;  5DQV A;  2MBG A;  5CA0 E;  3HR0 A;  5L3F B;  1XMO T;  5KDM C;  3RIU C;  1MNE A;  4ANJ A;  2BZB A;  3Q9D A;  4DR4 T;  4PFP A;  3CX8 B;  2VAS A;  2MYS A;  2WQY A;  3B5M A;  4H9O C;  5HCM A;  2CM0 A;  3GA8 A;  2V6X A;  2NWB A;  3CQG B;  5JDM A;  5FMN A;  3PUG A;  4DUZ T;  2V7I A;  3PUQ A;  2OA5 A;  3P4R A;  2MTQ A;  2R6G F;  1M7K A;  4G63 A;  4AQG A;  2NTX A;  5HXS A;  3MJX A;  4DV6 T;  4ILB A;  5BMV E;  4LF4 T;  2DHR A;  2EHO A;  3RC3 A;  3RC8 A;  5HWY A;  2L8K A;  4MHC A;  4X5T A;  4E7S A;  3LG7 A;  3MA9 A;  5L4H A;  3LDQ B;  3UFE A;  3ZMS B;  2VKD A;  2BKO A;  4JI6 T;  3VRA A;  1AJ3 A;  3I0Q A;  1ZHC A;  4O2B E;  3IEE A;  4YXD A;  4UV9 B;  1D1A A;  3MK7 C;  1MMA A;  4X65 T;  1ZKE A;  4MBQ A;  2K24 A;  3RQU A;  4YFS A;  1UUR A;  3JAE A;  3JAD A;  5AQM B;  3RF1 A;  4DV0 T;  3FZH B;  3EVY A;  4Z90 A;  4A5X A;  2DWK A;  3NZP A;  1SUM B;  5HXR A;  2ZMA A;  3TLV A;  2YU1 A;  2M6I A;  4CXW A;  1OED E;  3T1Y T;  3MAC A;  3AXJ A;  5LJM A;  4U74 A;  1D0X A;  2IC9 A;  4H9R C;  5C3J A;  1VCT A;  1HG5 A;  2AE9 A;  4XZC A;  3FXD B;  1FMW A;  3AEA A;  4B3T T;  2EHO B;  3CX7 B;  4HFB A;  2LRL A;  5LP6 E;  4M1P A;  3CQC B;  4A97 A;  2K5B B;  4JI0 T;  2H7V C;  4GK5 E;  4PFO A;  5LHG B;  3T1H T;  1G73 A;  2J62 A;  3Q5D A;  5AQU B;  5JR9 A;  5KXJ A;  3P4S A;  1MMG A;  4G2A A;  5AQK B;  3PJA A;  3QB5 A;  4AQY T;  2FJA A;  4JBW F;  5LNK A;  5JRE A;  5FXZ A;  4MFR A;  1U4Q A;  2H7O A;  1NWM X;  2VVS A;  4ZI2 C;  3EI0 A;  3Q5W A;  4QH5 A;  3RYH E;  4UVA B;  3PUZ F;  2W0G A;  4OYJ A;  1CUN A;  2C0S A;  4Q25 A;  2WZI A;  3QB5 K;  4A98 A;  3RKO A;  3I0O A;  2CXD A;  4QHO A;  5DAB A;  5KX5 E;  3AXJ B;  4MAL A;  3RGL A;  3X1D A;  2KLQ A;  3O4X E;  1LKX A;  5IWA T;  2E2A A;  1D0Z A;  5JH7 E;  4XBF B;  5LG3 A;  2YIN A;  4LF6 T;  1YQ3 A;  4ADZ A;  3HKE E;  1E2A A;  3P4Q A;  4WNK A;  5FNV E;  2NW9 A;  2XPK A;  4DID B;  2UXB T;  3PJA J;  2X51 A;  5JDN A;  2KMF A;  4TZ4 C;  1FIO A;  1W09 A;  1KNP A;  3PUS A;  3ZCJ A;  2WWU A;  4B6X A;  1MIY A;  3AE9 A;  4PJM A;  2FJE A;  5LHH B;  5JRC B;  2WMN A;  4IGU A;  2XAH B;  3H37 A;  2KZ7 B;  2V5D A;  3AE7 A;  2BVM A;  4PJL A;  3ZYM A;  1IBK T;  2K48 A;  4YTM A;  3AE4 A;  3ONX A;  2X0L B;  2PTF A;  2Y6X A;  4UVC B;  2WU2 A;  3B13 A;  1BR2 A;  3CKD A;  4TWD A;  5LOV E;  3ZEF B;  2XY8 B;  2VQF T;  4GYS A;  4DR6 T;  4YTP A;  3RI5 A;  4CN6 A;  5JDG A;  2RPA A;  3FXE B;  2C5J A;  4ZS3 A;  5IYZ E;  5JDL A;  3C4X A;  4KI0 F;  3V5S A;  3UFG A;  3UU8 A;  2CMR A;  2H3R A;  2W67 A;  2UXN B;  4QH1 A;  5AQP B;  1CHU A;  1Z0P A;  2VK9 A;  3WAK A;  5M4Y A;  4ILC A;  4QX8 B;  3K3Q C;  2XAQ B;  3OJA A;  4GOU A;  4HWI B;  5JR9 B;  2ACX A;  3IBP A;  4JI5 T;  3UU4 A;  4COF A;  5EK2 A;  4DR5 T;  4H9S E;  4KHZ F;  4JUY A;  2W61 A;  3UUB A;  3HI2 A;  1HNZ T;  3PU8 A;  4L5G A;  5JRC A;  2B1E A;  3H3A A;  4H9N C;  4AXP A;  5JDQ A;  2J1D G;  2E5L T;  2YK0 A;  2LKH A;  4DVD A;  4ZXL A;  4IDP A;  2XQ9 A;  3CWZ B;  3CQX C;  2WM9 A;  4HFV A;  1ZOY A;  3R84 B;  3NBX X;  3P50 A;  1UX5 A;  2UXC T;  2QA7 A;  2D0T A;  2ODV A;  1ZEE A;  3N9Q A;  4ILU A;  4JI8 T;  3UU5 A;  4QXH B;  5AQR B;  4DMV A;  2SPC A;  1R8I A;  2YDR A;  4ISS A;  5ABF B;  4OYK A;  2LKG A;  3UUL A;  3LK2 B;  2KWH A;  3AAI A;  4GIW A;  1OXZ A;  1ZP0 A;  2WBL A;  3EHZ A;  4H9P C;  4HFD A;  3HKD E;  4QH4 A;  5DJQ C;  5GON E;  5A1L A;  1IJ5 A;  4IDQ A;  3UQ7 A;  2YN6 A;  3AE3 A;  4AKL A;  3PUV F;  2VUR A;  4K0U A;  3BQL A;  4P0B A;  3FBL A;  1T98 A;  2V6Y A;  5FP3 A;  5LHI B;  3ZYK A;  2CCQ A;  3EDU A;  2LHR A;  3RH3 A;  2X9Y A;  1IJ6 A;  2ZM2 A;  4KP3 C;  4U3C A;  4AQF C;  2XM2 A;  5CGM A;  5FL1 A;  2OV9 A;  1VOM A;  3BQI A;  5CA1 E;  2IAK A;  2DL1 A;  1X9B A;  4NIQ A;  5ADX L;  1MMD A;  1N36 T;  2CE7 A;  5EK3 A;  4LFC T;  2N9D A;  2A3D A;  1YXR A;  2KND A;  2WB5 A;  4LML A;  4ZI3 C;  2LM2 A;  4O4J E;  2GK9 A;  2Q9Q B;  5ABE A;  3AAA B;  3M65 A;  2MPK A;  3ZN0 B;  3I9W A;  2E9X D;  4ZI3 D;  4ZZC A;  4ERR A;  3K3O A;  3ZCI A;  4LMK A;  3ANW B;  3J9X 1;  2WMO A;  4PW8 A;  5FYM A;  3N9L A;  4LF9 T;  2VQE T;  2UXX B;  2NOX A;  4HWC A;  3O1J A;  2BS2 A;  2KT9 A;  3AVS A;  4AKG A;  1G8X A;  2JPF A;  3Q2M A;  1IBL T;  3ZSS A;  4KMC A;  2LSI A;  3QNU A;  4IRE A;  2ACZ A;  2BBH A;  4UV8 B;  5LB7 B;  2XQA A;  3LK3 B;  4EB6 E;  4CXY A;  2V1D B;  3HA4 A;  5L47 A;  3GN5 B;  4Z91 A;  2CLY C;  3RYF E;  1GQE A;  3EDV A;  1T72 A;  3FBZ A;  1BR4 A;  2MAW A;  2VKO A;  3JCF A;  2P9B A;  2FUP A;  2NW7 A;  2XHE B;  3P8C D;  4HEA A;  4IIJ E;  5AQN B;  3VHL A;  5HXH A;  5LG4 A;  3J7Y q;  2UUA T;  4UR9 A;  5E0O A;  4ZI2 D;  3AEB A;  4ZI7 E;  2IHR 1;  4LF5 T;  5AQT B;  2KXP B;  2ES0 A;  3JC6 C;  4C91 A;  2CWY A;  2XQ7 A;  4DV1 T;  3C64 A;  2H89 A;  1QLB A;  1UUS A;  3QUJ A;  4WW0 A;  1HF8 A;  4AKH A;  3HL6 A;  4YHH T;  3AED A;  3ZLI A;  2IDO B;  3PTR B;  5H6R B;  4DR2 T;  5HEH A;  3RIA A;  3ZT5 A;  3PUW F;  4DO0 A;  1JNR A;  1MIW A;  5C8Y E;  4EV6 A;  4FI5 A;  4YT0 A;  4YJ3 E;  3WAJ A;  1VCS A;  4HE8 A;  2WWV A;  5IUX A;  1D0Y A;  4ASK A;  2V5C A;  2IW5 B;  2BS4 A;  1FJG T;  2LSK A;  3CIR A;  4U2Z A;  5JR9 C;  2ZM8 A;  1O3X A;  4U72 A;  2V6Y B;  4IST A;  3ZMU B;  4A56 A;  5LGU B;  2OLT A;  2UUB T;  1KNZ A;  4IE0 A;  5LMU T;  1M62 A;  4NUV A;  2XAF B;  3AVR A;  3PUY F;  3HKB E;  2XTL A;  4I43 B;  5AQQ B;  2E9X B;  5HXE A;  1KF6 A;  1SHZ C;  3IHR A;  3N9M A;  3ZJ1 A;  3KV4 A;  4L0R A;  1D1C A;  1BR0 A;  4UVB B;  2JQQ A; 
#chains in the Genus database with same CATH homology
 2UXD T;  3OTO T;  4X66 T;  4DR7 T;  4JI2 T;  4JI5 T;  4LFA T;  4DR5 T;  4GKK T;  1HNZ T;  1XNQ T;  2E5L T;  4JI1 T;  4NXM T;  4DV3 T;  5LMN T;  1I94 T;  4JI4 T;  1XNR T;  4GKJ T;  4YY3 T;  2UXC T;  1XMO T;  4JI8 T;  4DUY T;  1XMQ T;  4DR1 T;  4DR4 T;  4LF7 T;  4DR3 T;  4DUZ T;  4B3R T;  4DR2 T;  4DV6 T;  4LF4 T;  5BR8 T;  4B3M T;  4JI6 T;  1N36 T;  4LFC T;  4X65 T;  2F4V T;  4JYA T;  1HR0 T;  4DV0 T;  4JI7 T;  4LF9 T;  2VQE T;  3T1Y T;  1IBL T;  4B3S T;  4B3T T;  2ZM6 T;  4X64 T;  4JI0 T;  1N34 T;  3T1H T;  4DV4 T;  2UUA T;  2UUC T;  4DV2 T;  4LF5 T;  4AQY T;  4DV1 T;  1J5E T;  4YHH T;  5IWA T;  1HNW T;  4X62 T;  4LF8 T;  4LF6 T;  4OX9 T;  1HNX T;  2UXB T;  4DV7 T;  4DV5 T;  1FJG T;  1IBM T;  4KHP T;  4K0K T;  1N32 T;  2UUB T;  2UU9 T;  5LMU T;  1IBK T;  4NXN T;  2HHH T;  4JV5 T;  4LFB T;  1N33 T;  2VQF T;  4DR6 T;  4JI3 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...