4JI2T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4ji2T00
1HR0T 4DR6T 4LF4T 4DR3T 4DV3T 4X65T 4NXNT 4YHHT 4DR5T 1FJGT 4LF6T 4AQYT 1XNQT 4GKKT 1XMQT 4DUZT 1XMOT 4DR2T 1HNXT 4DR7T 4JI7T 4NXMT 4LF5T 1N32T 1IBKT 4JI4T 4DUYT 2VQET 1HNZT 2VQFT 4LFAT 4LF8T 4JI5T 4JI6T 4OX9T 3T1YT 5LMUT 4B3ST 3OTOT 3T1HT 4X62T 4DV4T 5BR8T 2UUCT 4JYAT 2F4VT 4LFBT 4B3RT 1N33T 1N36T 4DV2T 4KHPT 4DV6T 4LFCT 1HNWT 4X64T 4JI8T 1IBLT 1J5ET 2UXDT 5IWAT 2UUAT 4JV5T 2HHHT 4B3TT 1XNRT 2ZM6T 4DR4T 4K0KT 2E5LT 2UXBT 4GKJT 2UXCT 4DR1T 1I94T 4B3MT 4LF7T 2UUBT 4JI2T 4YY3T 4JI0T 4DV5T 4JI3T 4X66T 4DV7T 4LF9T 5LMNT 1N34T 4DV0T 2UU9T 4DV1T 4JI1T 1IBMT
chains in the Genus database with same CATH superfamily
4TZ4C 3AE8A 4MHCA 2CXFA 3AEDA 2XQ7A 1MNDA 3J9X1 4DNDA 3HKCE 2LOPA 2VVNA 4E7SA 2W00A 4J2CA 2E5VA 5DQWA 3AE4A 1G8XA 2XQ9A 2LM9A 3CQXC 3PJAJ 4HN9A 3ONLC 1IJ6A 2EHOD 1O3XA 2NWBA 2HPLA 3KV9A 4F8HA 5AQSB 4A97A 3PUZF 4YHHT 3G06A 3RYFE 3P4QA 4KMCA 3WI3A 3EVYA 2KMFA 2JIWA 2L9QA 3UQ7A 3ZKRA 3P4PA 3TLTA 2CXDA 3AE2A 4AQYT 5L3CB 5E0OA 3UFGA 3UULA 3Q9DA 3B57A 3RI5A 4EOZB 3EUHA 2V6YA 1L0VA 3LK3B 2WM9A 5FNVE 2M6IA 4B6XA 1XMOT 2AXDS 4DR7T 5AQPB 3AA7B 2MYSA 3LK2B 4COFA 4DVDA 4HFVA 5EK4A 2JJ9A 4JI7T 2WDVA 3JCFA 3Q5DA 1I6ZA 4EEBA 5AQGB 2Q9QC 1Y64B 1ZV4X 3CPZA 5ABGA 2XQYA 4C91A 5C3JA 1W0AA 5JDNA 3VHLA 2QVAA 3L8RA 2K5BB 5HWYA 4I0UA 2YU1A 2QYWA 2EHOB 4LFAT 3IHRA 4HWCA 2CXLA 4I4TE 1XZYA 4JI5T 3AAEB 5EZYE 5FXXA 3UU8A 3ANWA 4OX9T 2WZHA 1FIOA 3K8PC 2WAUA 2XQ8A 3MA9A 4B3ST 2J1DG 4LMLA 4WZXA 3OTOT 3RHWA 3RQUA 1LRZA 3ONJA 4CZZB 3H37A 4X62T 2BS4A 2JMHA 3AE3A 5L3GB 3FZMB 3CVRA 2D0UA 1MMNA 2CM0A 3LBXB 4O4LE 3TLSA 4JEHB 3VRAA 2PJQA 1H7CA 2YOEA 4O4JE 1WRDA 3HR0A 1MIWA 3PE0A 3PUYF 3W15B 4LFBT 3N2OA 4IDZA 5L4HA 3RC3A 3PDYA 4BA9A 2LT3A 2RA1A 4ZXLA 2WMNA 4ZI7E 1W9RA 2YEVC 3LFMA 1KNPA 1WR6A 1N36T 3ETVA 2J62A 3AE5A 3N9QA 5HEJA 5LG3A 1KEYA 2BZBA 4ILCA 2QRXA 4PJJA 4M1PA 4E7ZA 4KHPT 4EZ4A 3KBTA 1BR1A 1KF6A 5LHIB 2W66A 3AA0B 4HFDA 1D1CA 4AQGA 4IE4A 3T8OA 3UUNA 4I55E 3V5SA 3K3OA 2CRBA 3CIRA 3ZC1A 2XM1A 3UUXB 4X64T 1ZEEA 4AXPA 3I9YA 3R84B 1IBLT 3RIUA 5DABA 3VU7H 3KV6A 4A98A 5LGUB 3F31A 4IDOA 3OYXA 5CA0E 4IDNA 4X1KE 1SE7A 4WNKA 4IDPA 5AFUL 4KI0F 4U3CA 5AQLB 5ETWA 4CI3B 1IZNB 2SPCA 2M67A 2Q9QA 3ZSSA 4YHJA 3UT5E 3RGLA 3AE1A 5TAOA 3HI2A 2KNDA 4BJMA 2CBJA 3ZT7A 3PUWF 2UXBT 2JQHA 1YKHB 1D1BA 5AQUB 2UXCT 5DQVA 3CX7B 3JAFA 4IIJE 2CPTA 4GIWA 1MMAA 2K9AA 4X20E 4QH4A 3SFDA 5JDLA 4FI5A 2WU5A 2CMRA 4H9PC 3I0QA 4HWHA 2W4XA 4CN4A 1OXZA 3MACA 2MTQA 4UEMA 5FXZA 3ZLIA 4JI0T 5KX5E 2FJDA 3KDSE 2IDOB 2BG9A 2LSYA 4AQFA 4DV5T 5LBMA 4TV9E 4ERRA 3BQLA 1Z0PA 2NW7A 2KSRA 1US7B 2RPAA 4IT4A 2XAQB 4TWFA 5AQTB 3V5UA 4ASKA 3U3IA 3PTRB 3RYHE 3E0ZA 3TLWA 1HG2A 4YTPA 2CA5A 2R6GF 1VCTA 3C98B 1OEDB 2LKGA 3GMIA 3I1AA 3QC9A 3GN5A 5F5WA 1HR0T 4LF4T 2K3WA 4UXNB 2BG9C 4UVAB 1JNRA 4IREA 5AQQB 5HXEA 2H7OA 1QUUA 2KLQA 3A8YC 3C4XA 4ILBA 1X9BA 2VK9A 4OK0A 2XSAA 5JQGE 2QA7A 1S35A 3AXJA 4HWDA 4Q25A 1VOMA 2JQ9A 2RP4A 4PK6A 3ZYKA 4CQIA 4EAHA 4DV3T 2VWAA 2XAFB 4IGUA 5HYAA 3A5XA 4O4HE 1NAFA 1WCRA 3UU3A 4DBRA 5LGNB 3RC8A 3HKDE 4IE0A 2XZEA 1BR0A 1YXRA 5L2LA 1FJGT 2CWOA 4HE8A 2ACXA 1XNQT 2PBIA 2XM2A 5FY7A 2E9XC 1HF8A 4ZS3A 3R6NA 3AEBA 4CN6A 2C5KT 1R8IA 1HCIA 4QX7B 3ZMUB 3NBXX 2KWHA 1X79A 4UVCB 3P7IA 4DBQA 4LF5T 1N32T 4U2YA 3VKHA 2X68A 2Y6XA 3MXZA 4GYSA 3U78A 3UU5A 5JDFA 2XUEA 4JI4T 3N5LA 1SUMB 4IHJE 4DUYT 5L3BB 3PU8A 2WDRA 4FJOA 4Z90A 5EK3A 3RKOA 2VQET 1LKXA 2IUBA 3KFWX 2C5JA 3LK42 4NUUA 4LF8T 3O9XA 2K48A 4JI6T 1XDPA 2JRKA 3IEEA 3T1YT 3CWZB 2ACZA 2NW8A 2V6YB 3N2GE 5J2TE 5AQRB 4AI6A 2IC6A 4QXHB 1QSDA 2FUPA 2MAWA 3EHZA 1YW0A 2H88A 4YLHA 2YN6A 5AQVB 5LBQB 5LNKA 4DV4T 2J4GA 4EGWA 5AQFB 3WAJA 1ZOYA 2BBJA 1NENA 4O2BE 2A72A 3P4WA 3VR8A 2PG8A 3PUGA 1FMVA 2BKOA 2WZIA 3JAEA 3QOFA 5AQMB 1T7SA 5AQHB 5AQOB 2Y48B 2VURA 3CMLA 1KNRA 4IE5A 4H9NC 2V7KA 4QH1A 4XZCA 1BR4A 1D0YA 4K0UA 2WY2A 3ZT6A 2YU2A 4LMKA 4U7YA 3AA6B 4UF0B 1HG5A 4KP3C 4TNWA 2BS2A 4YXDA 4UELA 3N2KE 4DV6T 2LSKA 1G73A 2IMLA 2FJAA 4PAGA 1YQ3A 5A1LA 3EAMA 3AEAA 1OEDC 1Z8UA 3ETUA 3L3PA 4OYKA 4UR9A 2WSSV 4ZHQE 3AB3B 1B7TA 5LOVE 4HFCA 3AE6A 4O8SA 4YSZA 2KXPB 1M7KA 2EHOA 2JQKA 3ABVA 4U33A 2JMKA 3SFEA 2XJ7A 3CX8B 3FBZA 5LYJE 5FVLA 2XHEB 5IWAT 3JC6C 3QB5A 5LP6E 5J2UE 1WYCA 2HHHT 3C4ZA 3BQKA 4HGAA 5ADXL 3QNUA 4QH5A 1AJ3A 1YKEB 2VKDA 1T8BA 5AQKB 3GA8A 3KVAA 4HFHA 3RH3A 4DO0A 4B3TT 4ISTA 5JDQA 1WYBA 4CXYA 2WDQA 2DI4A 4JLEA 2E9XB 4ANJA 4K0KT 5JRCB 2IW5B 2E5LT 4O2AE 4EZHA 5M4YA 4QXBB 3N9PA 3QUJA 5HXCA 4U7IA 4DIDB 3UTKA 4ZOLE 5LJMA 4U2ZA 2UUBT 3CKDA 3PU3A 4G2AA 4L9IA 2NP9A 4HEAA 2DLRA 5C8YE 1W09A 3P8CD 4JI2T 5L3EB 4IL4A 2H3RA 3ESLA 4NIQA 4NUVA 2LRLA 2XSBA 2W2UA 1YD8G 2VKOA 2X0HA 2JQQA 3EDUA 3OVUA 4X1IE 3L39A 5FXVA 5HCMA 2N9DA 3ZMZB 2L3LA 4AKIA 5AQIB 3RYIE 3TLUA 2X9HA 3QK6A 2DCFA 4KX6A 4GK0E 4YT0A 3RIFA 5LXTE 2A9UA 3Q5XA 2W63A 5ABFA 1IBMT 4MBQA 2H7VC 3N9MA 2QGSA 2V7LA 4TN7B 4UVBB 2VKHA 4A5XA 4H9QC 2BKPA 5ABHA 4MFRA 5CFBA 2B76A 4G63A 3WAKA 2BDEA 1KK7A 1VRBA 3SOLA 4ILUA 5LJNA 4HTEA 1LVKA 3NRXA 3RIAA 2IIUA 4X65T 2CWYA 1ZKEA 2N1GA 3IF8B 2HPJA 3HKEE 2V8SV 4YTMA 4UV8B 2WS3A 4WBOA 1W0BA 4NXNT 3O1IA 5FL1A 1WFDA 2B1EA 2LSGA 3UFEA 2YDRA 3JC6D 2LKHA 4GOUA 1BR2A 4DMVA 2V7JA 4I50E 4EEDA 5LHGB 4LF6T 2V5CA 4IDQA 1FEWA 5LG4A 1MMDA 2W67A 2ZM8A 3NVOA 2BG9E 3OJAA 4OYJA 4YFSA 4DR2T 2X9WA 5HXHA 4ZZBA 1HNXT 2NR4A 1HX1B 1HFAA 2ES0A 2X67A 3FHNA 3UQ4A 3EDVA 3HKBE 4UIGA 3E22E 5JREA 5H6RB 3K3QC 3ZMSB 3OYZA 3EABA 5FXWA 4AKLA 3ZCJA 4DMWA 2FBWA 3AE7A 3P4SA 5FYMA 5HEHA 2E8IA 2H89A 5L3FB 1IJ5A 1WLXA 2LOSA 3AEEA 3PUAA 5IUXA 2VQFT 2D2SA 2DWGA 4AISA 1HNZT 1D0ZA 3LJCA 3D0TA 2LHRA 2P9BA 3N9OA 3BK9A 4ISSA 4OHFA 4CI2B 4HKAA 4MALA 2WBLA 3OKQA 4C90A 4EYYR 2BVMA 4EYUA 4L0RA 3PJAA 5IYZE 1T72A 2CE7A 2X0LB 4ZI2D 3I9WA 3SWHA 5HXSA 3AE9A 1UURA 1S94A 3FZLB 2UUCT 3N9LA 3PUQA 4JYAT 4QXCB 1NEKA 3ZN0B 4JUYA 2ZMAA 2OV9A 2VKJA 2YDQA 2KZ7B 3ZMVB 5KXJA 1IAPA 2X9XA 4LMJA 4YJ3E 2DHRA 3IA3A 3E08A 2FJBA 2VL0A 3KV4A 1OWAA 4HFIA 1HTJF 4CXXA 2HN1A 4DV2T 3RRWA 2V1DB 3B13A 3P50A 4P0AA 2X66A 5FY0A 4ADZA 4YJ2E 3PUSA 2D0TA 3JADA 2NOXA 3CQCB 2E9XA 5JRCA 4LFCT 4TUYE 3VRBA 1JNZA 1HNWT 4PJNA 3PURA 1ZHCA 5GONE 2BKNA 2J47A 2ODUA 2CBIA 2E9XD 2HH7A 1SA0E 2W61A 3M65A 3CX6B 1YQ4A 3UU4A 3LSVA 2WP9A 4PK4A 3RLFF 3O1HA 3SRZA 2HN2A 4WYVA 3ZC0A 2VB6A 2UXDT 2LSJA 3NRYA 1MNEA 2CLYB 2YK0A 2D9DA 4JV5T 1WR0A 2LSIA 4EIWA 2DL1A 2MOZA 5FL0A 3ZSTA 2WWUA 3C64A 3BQIA 3AVRA 5FMNA 5HWXA 2LJLA 2IC9A 4NPPA 2VL8A 1XNRT 1DU2A 4H63V 2WB5A 3NZQA 5JH7E 5HCJA 5JR9C 4CXWA 3DJBA 4MLKA 4PNIA 3FXEB 3NZPA 2V7MA 5FP3A 5EK2A 1E7PA 4CI1B 2BS3A 3AVSA 4HWFA 3ZEFB 2MPKA 4DR1T 1NWMX 1OEDA 2XAJB 3F2EA 3UU6A 3ZMTB 3PUXF 5JDGA 2E2AA 2ZM0A 5HXRA 4H63H 2ZLYA 4GYRA 3H3MA 5JDHA 4CN1A 1UUSA 4WBNE 2C0SA 4YY3T 2WCAA 2XY8B 2WU2A 3O4XE 4AQFC 2CHOA 2A2FX 4JI3T 1UGOA 2LE8A 4EB6E 4OFZA 2N2NA 4X66T 3ZPOA 4IL9A 1J5WA 2V6XA 2Y8DA 5JR9B 1GQEA 2NTYA 3C4WA 4TV8E 4LF9T 2M6BA 1XDOA 2XASB 3N9NA 2UXXB 5H6QB 2XPKA 2I6HA 3UUBA 1N34T 4ZS2A 3DP7A 5BMVE 2I59A 4DV0T 3LBXA 2CLYC 5DJQC 5JR9A 2Z6EA 4DR6T 3RQWA 4TX5A 5HEGA 3AAIA 3UUMA 3ZCIA 4DR3T 1CUNA 3OBVE 1U5PA 3Q5WA 2NW9A 3Q5EA 1HS7A 3K3NA 3K1SA 4N78D 3ZYLA 1E1HB 2YINA 3HL6A 4X5TA 3ZT5A 4DV1T 2G0UA 1ZP0A 2KINB 3FZKB 3LG7A 4U74A 4Z8XA 3NKZA 4V1Av 5HEUA 4DR5T 2YDSA 4UF0A 3ZJ1A 4PFOA 2A3DA 3NWIA 4TWDA 1KNZA 2FJEA 1XWMA 4AIUA 4ZI2C 2LM2A 1XMQT 4GKKT 4PFPA 4DUZT 2OA5A 3MK7C 5L3DB 3PV0F 3AAAB 3FB2A 4YTNA 5F3JA 4AKGA 3M3ZB 2XQ4A 2LRKA 1UCUA 4U31A 2VVSA 3AEFA 3RRCA 3HA4A 4AKRB 4BJNA 4NXMT 4YSYA 3ZYMA 3FZHB 2IAKA 3AXJB 3KINB 3J7Yq 2X51A 4KUMB 1IBKT 2ZM2A 3PUVF 2WWVA 4EV6A 4B3RT 2L8KA 4U72A 4UV9B 4PW8A 1MMGA 4YSXA 2V26A 5KDMC 2W0GA 1SHZC 5LMUT 4TNVA 3RYCE 5F8PA 5AQJB 5CA1E 1U4QA 5LCYA 1KFYA 4IE6A 3T1HT 3S4UA 4WW0A 3MZKB 4JEUB 5FKYA 2W62A 4P0BA 4JBWF 5BR8T 3C50A 4H9RC 1J1JA 3MJXA 3O1JA 5L4EA 2KT9A 4HFEA 5C2TA 3ANWB 2F4VT 3RKGA 5J1GA 2DNXA 1HX8A 1UX4A 3F57A 3KBUA 4ZEYA 1D0XA 4TWHA 5LGTB 2LHNA 1FMWA 5HAXA 3QB5K 1OEDE 4L5GA 4QWNB 1D1AA 2BVLA 4ILAA 4KBMB 2YKSA 2Q9QD 4XAXB 1M62A 5LA6E 2V5DA 3FXDB 2XQ6A 5ABFB 4ZZCA 3H3AA 3X1DA 5LHHB 4QKNA 4PJLA 2PTFA 3MKDA 3VR9A 3RX6A 3SS1A 1Y01A 3DTOA 3TLVA 1N33T 4JI8T 1EZ3A 1CHUA 2DWKA 4PK5A 5KMGP 4AKHA 1VCSA 3AECA 1MIVA 4A56A 2D5UA 1J5ET 1UX5A 2BBHA 4I43B 2I0MA 2UXNB 4GK5E 5ABEA 2WQYA 2WMOA 5HEOA 1LVFA 3GWHA 3KV5A 3LDQB 4X1YE 2UUAT 4F6RC 5JTGA 4QX8B 3GN5B 2X0YA 3OPCA 3P4RA 2LLYA 2PFVA 2X9YA 3FZFB 4KHZF 5LB7B 4PJMA 5AQNB 5JDMA 4XBFB 5JVDE 4QHOA 3ZN1B 4HFBA 4P09A 5FY1A 3ONXA 3RPUA 2ZM6T 2VASA 4DR4T 2XTLA 3B5MA 3RIUC 4H9OC 2K24A 4ZI3D 2ODVA 2XAHB 3I0OA 2XQ5A 4HWIB 4O4IE 3ZJ2A 4P1NA 1QLBA 2LEHA 5CJ5A 2BG9B 3KVBA 2AE9A 3RF1A 4GKJT 3Q2MA 1V9DA 3CK6A 3EI0A 2V7IA 4IE7A 1I94T 3VKGA 4B3MT 2XQAA 4LF7T 2MBGA 3AEGA 4BAYB 2KWIB 2NTXA 4EXTA 2CCQA 5L47A 5J0ZA 2XAGB 3IBPA 2GK9A 4Z91A 5IHYA 4H9SE 3C51A 1UK5A 2XQ3A 2CHNA 1E2AA 3L09A 1T98A 2C5IT 2Q9QB 4DV7T 5FVKA 1MIYA 5CGMA 5LMNT 3TKLB 5CB4E 3AA1B 3FBLA 3CQGB 2CEAA 2JPFA 4ZI3C 2IHR1 2UU9T 2EHOC 2OLTA 3A7MA 4JI1T
chains in the Genus database with same CATH topology
1HR0T 4DR6T 4LF4T 4DR3T 4DV3T 4X65T 4NXNT 4YHHT 4DR5T 1FJGT 4LF6T 4AQYT 1XNQT 4GKKT 1XMQT 4DUZT 1XMOT 4DR2T 1HNXT 4DR7T 4JI7T 4NXMT 4LF5T 1N32T 1IBKT 4JI4T 4DUYT 2VQET 1HNZT 2VQFT 4LFAT 4LF8T 4JI5T 4JI6T 4OX9T 3T1YT 5LMUT 4B3ST 3OTOT 3T1HT 4X62T 4DV4T 5BR8T 2UUCT 4JYAT 2F4VT 4LFBT 4B3RT 1N33T 1N36T 4DV2T 4KHPT 4DV6T 4LFCT 1HNWT 4X64T 4JI8T 1IBLT 1J5ET 2UXDT 5IWAT 2UUAT 4JV5T 2HHHT 4B3TT 1XNRT 2ZM6T 4DR4T 4K0KT 2E5LT 2UXBT 4GKJT 2UXCT 4DR1T 1I94T 4B3MT 4LF7T 2UUBT 4JI2T 4YY3T 4JI0T 4DV5T 4JI3T 4X66T 4DV7T 4LF9T 5LMNT 1N34T 4DV0T 2UU9T 4DV1T 4JI1T 1IBMT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HR0 T;  4DR6 T;  4LF4 T;  4DR3 T;  4DV3 T;  4X65 T;  4NXN T;  4YHH T;  4DR5 T;  1FJG T;  4LF6 T;  4AQY T;  1XNQ T;  4GKK T;  1XMQ T;  4DUZ T;  1XMO T;  4DR2 T;  1HNX T;  4DR7 T;  4JI7 T;  4NXM T;  4LF5 T;  1N32 T;  1IBK T;  4JI4 T;  4DUY T;  2VQE T;  1HNZ T;  2VQF T;  4LFA T;  4LF8 T;  4JI5 T;  4JI6 T;  4OX9 T;  3T1Y T;  5LMU T;  4B3S T;  3OTO T;  3T1H T;  4X62 T;  4DV4 T;  5BR8 T;  2UUC T;  4JYA T;  2F4V T;  4LFB T;  4B3R T;  1N33 T;  1N36 T;  4DV2 T;  4KHP T;  4DV6 T;  4LFC T;  1HNW T;  4X64 T;  4JI8 T;  1IBL T;  1J5E T;  2UXD T;  5IWA T;  2UUA T;  4JV5 T;  2HHH T;  4B3T T;  1XNR T;  2ZM6 T;  4DR4 T;  4K0K T;  2E5L T;  2UXB T;  4GKJ T;  2UXC T;  4DR1 T;  1I94 T;  4B3M T;  4LF7 T;  2UUB T;  4JI2 T;  4YY3 T;  4JI0 T;  4DV5 T;  4JI3 T;  4X66 T;  4DV7 T;  4LF9 T;  5LMN T;  1N34 T;  4DV0 T;  2UU9 T;  4DV1 T;  4JI1 T;  1IBM T; 
#chains in the Genus database with same CATH topology
 4TZ4 C;  3AE8 A;  4MHC A;  2CXF A;  3AED A;  2XQ7 A;  1MND A;  3J9X 1;  4DND A;  3HKC E;  2LOP A;  2VVN A;  4E7S A;  2W00 A;  4J2C A;  2E5V A;  5DQW A;  3AE4 A;  1G8X A;  2XQ9 A;  2LM9 A;  3CQX C;  3PJA J;  4HN9 A;  3ONL C;  1IJ6 A;  2EHO D;  1O3X A;  2NWB A;  2HPL A;  3KV9 A;  4F8H A;  5AQS B;  4A97 A;  3PUZ F;  4YHH T;  3G06 A;  3RYF E;  3P4Q A;  4KMC A;  3WI3 A;  3EVY A;  2KMF A;  2JIW A;  2L9Q A;  3UQ7 A;  3ZKR A;  3P4P A;  3TLT A;  2CXD A;  3AE2 A;  4AQY T;  5L3C B;  5E0O A;  3UFG A;  3UUL A;  3Q9D A;  3B57 A;  3RI5 A;  4EOZ B;  3EUH A;  2V6Y A;  1L0V A;  3LK3 B;  2WM9 A;  5FNV E;  2M6I A;  4B6X A;  1XMO T;  2AXD S;  4DR7 T;  5AQP B;  3AA7 B;  2MYS A;  3LK2 B;  4COF A;  4DVD A;  4HFV A;  5EK4 A;  2JJ9 A;  4JI7 T;  2WDV A;  3JCF A;  3Q5D A;  1I6Z A;  4EEB A;  5AQG B;  2Q9Q C;  1Y64 B;  1ZV4 X;  3CPZ A;  5ABG A;  2XQY A;  4C91 A;  5C3J A;  1W0A A;  5JDN A;  3VHL A;  2QVA A;  3L8R A;  2K5B B;  5HWY A;  4I0U A;  2YU1 A;  2QYW A;  2EHO B;  4LFA T;  3IHR A;  4HWC A;  2CXL A;  4I4T E;  1XZY A;  4JI5 T;  3AAE B;  5EZY E;  5FXX A;  3UU8 A;  3ANW A;  4OX9 T;  2WZH A;  1FIO A;  3K8P C;  2WAU A;  2XQ8 A;  3MA9 A;  4B3S T;  2J1D G;  4LML A;  4WZX A;  3OTO T;  3RHW A;  3RQU A;  1LRZ A;  3ONJ A;  4CZZ B;  3H37 A;  4X62 T;  2BS4 A;  2JMH A;  3AE3 A;  5L3G B;  3FZM B;  3CVR A;  2D0U A;  1MMN A;  2CM0 A;  3LBX B;  4O4L E;  3TLS A;  4JEH B;  3VRA A;  2PJQ A;  1H7C A;  2YOE A;  4O4J E;  1WRD A;  3HR0 A;  1MIW A;  3PE0 A;  3PUY F;  3W15 B;  4LFB T;  3N2O A;  4IDZ A;  5L4H A;  3RC3 A;  3PDY A;  4BA9 A;  2LT3 A;  2RA1 A;  4ZXL A;  2WMN A;  4ZI7 E;  1W9R A;  2YEV C;  3LFM A;  1KNP A;  1WR6 A;  1N36 T;  3ETV A;  2J62 A;  3AE5 A;  3N9Q A;  5HEJ A;  5LG3 A;  1KEY A;  2BZB A;  4ILC A;  2QRX A;  4PJJ A;  4M1P A;  4E7Z A;  4KHP T;  4EZ4 A;  3KBT A;  1BR1 A;  1KF6 A;  5LHI B;  2W66 A;  3AA0 B;  4HFD A;  1D1C A;  4AQG A;  4IE4 A;  3T8O A;  3UUN A;  4I55 E;  3V5S A;  3K3O A;  2CRB A;  3CIR A;  3ZC1 A;  2XM1 A;  3UUX B;  4X64 T;  1ZEE A;  4AXP A;  3I9Y A;  3R84 B;  1IBL T;  3RIU A;  5DAB A;  3VU7 H;  3KV6 A;  4A98 A;  5LGU B;  3F31 A;  4IDO A;  3OYX A;  5CA0 E;  4IDN A;  4X1K E;  1SE7 A;  4WNK A;  4IDP A;  5AFU L;  4KI0 F;  4U3C A;  5AQL B;  5ETW A;  4CI3 B;  1IZN B;  2SPC A;  2M67 A;  2Q9Q A;  3ZSS A;  4YHJ A;  3UT5 E;  3RGL A;  3AE1 A;  5TAO A;  3HI2 A;  2KND A;  4BJM A;  2CBJ A;  3ZT7 A;  3PUW F;  2UXB T;  2JQH A;  1YKH B;  1D1B A;  5AQU B;  2UXC T;  5DQV A;  3CX7 B;  3JAF A;  4IIJ E;  2CPT A;  4GIW A;  1MMA A;  2K9A A;  4X20 E;  4QH4 A;  3SFD A;  5JDL A;  4FI5 A;  2WU5 A;  2CMR A;  4H9P C;  3I0Q A;  4HWH A;  2W4X A;  4CN4 A;  1OXZ A;  3MAC A;  2MTQ A;  4UEM A;  5FXZ A;  3ZLI A;  4JI0 T;  5KX5 E;  2FJD A;  3KDS E;  2IDO B;  2BG9 A;  2LSY A;  4AQF A;  4DV5 T;  5LBM A;  4TV9 E;  4ERR A;  3BQL A;  1Z0P A;  2NW7 A;  2KSR A;  1US7 B;  2RPA A;  4IT4 A;  2XAQ B;  4TWF A;  5AQT B;  3V5U A;  4ASK A;  3U3I A;  3PTR B;  3RYH E;  3E0Z A;  3TLW A;  1HG2 A;  4YTP A;  2CA5 A;  2R6G F;  1VCT A;  3C98 B;  1OED B;  2LKG A;  3GMI A;  3I1A A;  3QC9 A;  3GN5 A;  5F5W A;  1HR0 T;  4LF4 T;  2K3W A;  4UXN B;  2BG9 C;  4UVA B;  1JNR A;  4IRE A;  5AQQ B;  5HXE A;  2H7O A;  1QUU A;  2KLQ A;  3A8Y C;  3C4X A;  4ILB A;  1X9B A;  2VK9 A;  4OK0 A;  2XSA A;  5JQG E;  2QA7 A;  1S35 A;  3AXJ A;  4HWD A;  4Q25 A;  1VOM A;  2JQ9 A;  2RP4 A;  4PK6 A;  3ZYK A;  4CQI A;  4EAH A;  4DV3 T;  2VWA A;  2XAF B;  4IGU A;  5HYA A;  3A5X A;  4O4H E;  1NAF A;  1WCR A;  3UU3 A;  4DBR A;  5LGN B;  3RC8 A;  3HKD E;  4IE0 A;  2XZE A;  1BR0 A;  1YXR A;  5L2L A;  1FJG T;  2CWO A;  4HE8 A;  2ACX A;  1XNQ T;  2PBI A;  2XM2 A;  5FY7 A;  2E9X C;  1HF8 A;  4ZS3 A;  3R6N A;  3AEB A;  4CN6 A;  2C5K T;  1R8I A;  1HCI A;  4QX7 B;  3ZMU B;  3NBX X;  2KWH A;  1X79 A;  4UVC B;  3P7I A;  4DBQ A;  4LF5 T;  1N32 T;  4U2Y A;  3VKH A;  2X68 A;  2Y6X A;  3MXZ A;  4GYS A;  3U78 A;  3UU5 A;  5JDF A;  2XUE A;  4JI4 T;  3N5L A;  1SUM B;  4IHJ E;  4DUY T;  5L3B B;  3PU8 A;  2WDR A;  4FJO A;  4Z90 A;  5EK3 A;  3RKO A;  2VQE T;  1LKX A;  2IUB A;  3KFW X;  2C5J A;  3LK4 2;  4NUU A;  4LF8 T;  3O9X A;  2K48 A;  4JI6 T;  1XDP A;  2JRK A;  3IEE A;  3T1Y T;  3CWZ B;  2ACZ A;  2NW8 A;  2V6Y B;  3N2G E;  5J2T E;  5AQR B;  4AI6 A;  2IC6 A;  4QXH B;  1QSD A;  2FUP A;  2MAW A;  3EHZ A;  1YW0 A;  2H88 A;  4YLH A;  2YN6 A;  5AQV B;  5LBQ B;  5LNK A;  4DV4 T;  2J4G A;  4EGW A;  5AQF B;  3WAJ A;  1ZOY A;  2BBJ A;  1NEN A;  4O2B E;  2A72 A;  3P4W A;  3VR8 A;  2PG8 A;  3PUG A;  1FMV A;  2BKO A;  2WZI A;  3JAE A;  3QOF A;  5AQM B;  1T7S A;  5AQH B;  5AQO B;  2Y48 B;  2VUR A;  3CML A;  1KNR A;  4IE5 A;  4H9N C;  2V7K A;  4QH1 A;  4XZC A;  1BR4 A;  1D0Y A;  4K0U A;  2WY2 A;  3ZT6 A;  2YU2 A;  4LMK A;  4U7Y A;  3AA6 B;  4UF0 B;  1HG5 A;  4KP3 C;  4TNW A;  2BS2 A;  4YXD A;  4UEL A;  3N2K E;  4DV6 T;  2LSK A;  1G73 A;  2IML A;  2FJA A;  4PAG A;  1YQ3 A;  5A1L A;  3EAM A;  3AEA A;  1OED C;  1Z8U A;  3ETU A;  3L3P A;  4OYK A;  4UR9 A;  2WSS V;  4ZHQ E;  3AB3 B;  1B7T A;  5LOV E;  4HFC A;  3AE6 A;  4O8S A;  4YSZ A;  2KXP B;  1M7K A;  2EHO A;  2JQK A;  3ABV A;  4U33 A;  2JMK A;  3SFE A;  2XJ7 A;  3CX8 B;  3FBZ A;  5LYJ E;  5FVL A;  2XHE B;  5IWA T;  3JC6 C;  3QB5 A;  5LP6 E;  5J2U E;  1WYC A;  2HHH T;  3C4Z A;  3BQK A;  4HGA A;  5ADX L;  3QNU A;  4QH5 A;  1AJ3 A;  1YKE B;  2VKD A;  1T8B A;  5AQK B;  3GA8 A;  3KVA A;  4HFH A;  3RH3 A;  4DO0 A;  4B3T T;  4IST A;  5JDQ A;  1WYB A;  4CXY A;  2WDQ A;  2DI4 A;  4JLE A;  2E9X B;  4ANJ A;  4K0K T;  5JRC B;  2IW5 B;  2E5L T;  4O2A E;  4EZH A;  5M4Y A;  4QXB B;  3N9P A;  3QUJ A;  5HXC A;  4U7I A;  4DID B;  3UTK A;  4ZOL E;  5LJM A;  4U2Z A;  2UUB T;  3CKD A;  3PU3 A;  4G2A A;  4L9I A;  2NP9 A;  4HEA A;  2DLR A;  5C8Y E;  1W09 A;  3P8C D;  4JI2 T;  5L3E B;  4IL4 A;  2H3R A;  3ESL A;  4NIQ A;  4NUV A;  2LRL A;  2XSB A;  2W2U A;  1YD8 G;  2VKO A;  2X0H A;  2JQQ A;  3EDU A;  3OVU A;  4X1I E;  3L39 A;  5FXV A;  5HCM A;  2N9D A;  3ZMZ B;  2L3L A;  4AKI A;  5AQI B;  3RYI E;  3TLU A;  2X9H A;  3QK6 A;  2DCF A;  4KX6 A;  4GK0 E;  4YT0 A;  3RIF A;  5LXT E;  2A9U A;  3Q5X A;  2W63 A;  5ABF A;  1IBM T;  4MBQ A;  2H7V C;  3N9M A;  2QGS A;  2V7L A;  4TN7 B;  4UVB B;  2VKH A;  4A5X A;  4H9Q C;  2BKP A;  5ABH A;  4MFR A;  5CFB A;  2B76 A;  4G63 A;  3WAK A;  2BDE A;  1KK7 A;  1VRB A;  3SOL A;  4ILU A;  5LJN A;  4HTE A;  1LVK A;  3NRX A;  3RIA A;  2IIU A;  4X65 T;  2CWY A;  1ZKE A;  2N1G A;  3IF8 B;  2HPJ A;  3HKE E;  2V8S V;  4YTM A;  4UV8 B;  2WS3 A;  4WBO A;  1W0B A;  4NXN T;  3O1I A;  5FL1 A;  1WFD A;  2B1E A;  2LSG A;  3UFE A;  2YDR A;  3JC6 D;  2LKH A;  4GOU A;  1BR2 A;  4DMV A;  2V7J A;  4I50 E;  4EED A;  5LHG B;  4LF6 T;  2V5C A;  4IDQ A;  1FEW A;  5LG4 A;  1MMD A;  2W67 A;  2ZM8 A;  3NVO A;  2BG9 E;  3OJA A;  4OYJ A;  4YFS A;  4DR2 T;  2X9W A;  5HXH A;  4ZZB A;  1HNX T;  2NR4 A;  1HX1 B;  1HFA A;  2ES0 A;  2X67 A;  3FHN A;  3UQ4 A;  3EDV A;  3HKB E;  4UIG A;  3E22 E;  5JRE A;  5H6R B;  3K3Q C;  3ZMS B;  3OYZ A;  3EAB A;  5FXW A;  4AKL A;  3ZCJ A;  4DMW A;  2FBW A;  3AE7 A;  3P4S A;  5FYM A;  5HEH A;  2E8I A;  2H89 A;  5L3F B;  1IJ5 A;  1WLX A;  2LOS A;  3AEE A;  3PUA A;  5IUX A;  2VQF T;  2D2S A;  2DWG A;  4AIS A;  1HNZ T;  1D0Z A;  3LJC A;  3D0T A;  2LHR A;  2P9B A;  3N9O A;  3BK9 A;  4ISS A;  4OHF A;  4CI2 B;  4HKA A;  4MAL A;  2WBL A;  3OKQ A;  4C90 A;  4EYY R;  2BVM A;  4EYU A;  4L0R A;  3PJA A;  5IYZ E;  1T72 A;  2CE7 A;  2X0L B;  4ZI2 D;  3I9W A;  3SWH A;  5HXS A;  3AE9 A;  1UUR A;  1S94 A;  3FZL B;  2UUC T;  3N9L A;  3PUQ A;  4JYA T;  4QXC B;  1NEK A;  3ZN0 B;  4JUY A;  2ZMA A;  2OV9 A;  2VKJ A;  2YDQ A;  2KZ7 B;  3ZMV B;  5KXJ A;  1IAP A;  2X9X A;  4LMJ A;  4YJ3 E;  2DHR A;  3IA3 A;  3E08 A;  2FJB A;  2VL0 A;  3KV4 A;  1OWA A;  4HFI A;  1HTJ F;  4CXX A;  2HN1 A;  4DV2 T;  3RRW A;  2V1D B;  3B13 A;  3P50 A;  4P0A A;  2X66 A;  5FY0 A;  4ADZ A;  4YJ2 E;  3PUS A;  2D0T A;  3JAD A;  2NOX A;  3CQC B;  2E9X A;  5JRC A;  4LFC T;  4TUY E;  3VRB A;  1JNZ A;  1HNW T;  4PJN A;  3PUR A;  1ZHC A;  5GON E;  2BKN A;  2J47 A;  2ODU A;  2CBI A;  2E9X D;  2HH7 A;  1SA0 E;  2W61 A;  3M65 A;  3CX6 B;  1YQ4 A;  3UU4 A;  3LSV A;  2WP9 A;  4PK4 A;  3RLF F;  3O1H A;  3SRZ A;  2HN2 A;  4WYV A;  3ZC0 A;  2VB6 A;  2UXD T;  2LSJ A;  3NRY A;  1MNE A;  2CLY B;  2YK0 A;  2D9D A;  4JV5 T;  1WR0 A;  2LSI A;  4EIW A;  2DL1 A;  2MOZ A;  5FL0 A;  3ZST A;  2WWU A;  3C64 A;  3BQI A;  3AVR A;  5FMN A;  5HWX A;  2LJL A;  2IC9 A;  4NPP A;  2VL8 A;  1XNR T;  1DU2 A;  4H63 V;  2WB5 A;  3NZQ A;  5JH7 E;  5HCJ A;  5JR9 C;  4CXW A;  3DJB A;  4MLK A;  4PNI A;  3FXE B;  3NZP A;  2V7M A;  5FP3 A;  5EK2 A;  1E7P A;  4CI1 B;  2BS3 A;  3AVS A;  4HWF A;  3ZEF B;  2MPK A;  4DR1 T;  1NWM X;  1OED A;  2XAJ B;  3F2E A;  3UU6 A;  3ZMT B;  3PUX F;  5JDG A;  2E2A A;  2ZM0 A;  5HXR A;  4H63 H;  2ZLY A;  4GYR A;  3H3M A;  5JDH A;  4CN1 A;  1UUS A;  4WBN E;  2C0S A;  4YY3 T;  2WCA A;  2XY8 B;  2WU2 A;  3O4X E;  4AQF C;  2CHO A;  2A2F X;  4JI3 T;  1UGO A;  2LE8 A;  4EB6 E;  4OFZ A;  2N2N A;  4X66 T;  3ZPO A;  4IL9 A;  1J5W A;  2V6X A;  2Y8D A;  5JR9 B;  1GQE A;  2NTY A;  3C4W A;  4TV8 E;  4LF9 T;  2M6B A;  1XDO A;  2XAS B;  3N9N A;  2UXX B;  5H6Q B;  2XPK A;  2I6H A;  3UUB A;  1N34 T;  4ZS2 A;  3DP7 A;  5BMV E;  2I59 A;  4DV0 T;  3LBX A;  2CLY C;  5DJQ C;  5JR9 A;  2Z6E A;  4DR6 T;  3RQW A;  4TX5 A;  5HEG A;  3AAI A;  3UUM A;  3ZCI A;  4DR3 T;  1CUN A;  3OBV E;  1U5P A;  3Q5W A;  2NW9 A;  3Q5E A;  1HS7 A;  3K3N A;  3K1S A;  4N78 D;  3ZYL A;  1E1H B;  2YIN A;  3HL6 A;  4X5T A;  3ZT5 A;  4DV1 T;  2G0U A;  1ZP0 A;  2KIN B;  3FZK B;  3LG7 A;  4U74 A;  4Z8X A;  3NKZ A;  4V1A v;  5HEU A;  4DR5 T;  2YDS A;  4UF0 A;  3ZJ1 A;  4PFO A;  2A3D A;  3NWI A;  4TWD A;  1KNZ A;  2FJE A;  1XWM A;  4AIU A;  4ZI2 C;  2LM2 A;  1XMQ T;  4GKK T;  4PFP A;  4DUZ T;  2OA5 A;  3MK7 C;  5L3D B;  3PV0 F;  3AAA B;  3FB2 A;  4YTN A;  5F3J A;  4AKG A;  3M3Z B;  2XQ4 A;  2LRK A;  1UCU A;  4U31 A;  2VVS A;  3AEF A;  3RRC A;  3HA4 A;  4AKR B;  4BJN A;  4NXM T;  4YSY A;  3ZYM A;  3FZH B;  2IAK A;  3AXJ B;  3KIN B;  3J7Y q;  2X51 A;  4KUM B;  1IBK T;  2ZM2 A;  3PUV F;  2WWV A;  4EV6 A;  4B3R T;  2L8K A;  4U72 A;  4UV9 B;  4PW8 A;  1MMG A;  4YSX A;  2V26 A;  5KDM C;  2W0G A;  1SHZ C;  5LMU T;  4TNV A;  3RYC E;  5F8P A;  5AQJ B;  5CA1 E;  1U4Q A;  5LCY A;  1KFY A;  4IE6 A;  3T1H T;  3S4U A;  4WW0 A;  3MZK B;  4JEU B;  5FKY A;  2W62 A;  4P0B A;  4JBW F;  5BR8 T;  3C50 A;  4H9R C;  1J1J A;  3MJX A;  3O1J A;  5L4E A;  2KT9 A;  4HFE A;  5C2T A;  3ANW B;  2F4V T;  3RKG A;  5J1G A;  2DNX A;  1HX8 A;  1UX4 A;  3F57 A;  3KBU A;  4ZEY A;  1D0X A;  4TWH A;  5LGT B;  2LHN A;  1FMW A;  5HAX A;  3QB5 K;  1OED E;  4L5G A;  4QWN B;  1D1A A;  2BVL A;  4ILA A;  4KBM B;  2YKS A;  2Q9Q D;  4XAX B;  1M62 A;  5LA6 E;  2V5D A;  3FXD B;  2XQ6 A;  5ABF B;  4ZZC A;  3H3A A;  3X1D A;  5LHH B;  4QKN A;  4PJL A;  2PTF A;  3MKD A;  3VR9 A;  3RX6 A;  3SS1 A;  1Y01 A;  3DTO A;  3TLV A;  1N33 T;  4JI8 T;  1EZ3 A;  1CHU A;  2DWK A;  4PK5 A;  5KMG P;  4AKH A;  1VCS A;  3AEC A;  1MIV A;  4A56 A;  2D5U A;  1J5E T;  1UX5 A;  2BBH A;  4I43 B;  2I0M A;  2UXN B;  4GK5 E;  5ABE A;  2WQY A;  2WMO A;  5HEO A;  1LVF A;  3GWH A;  3KV5 A;  3LDQ B;  4X1Y E;  2UUA T;  4F6R C;  5JTG A;  4QX8 B;  3GN5 B;  2X0Y A;  3OPC A;  3P4R A;  2LLY A;  2PFV A;  2X9Y A;  3FZF B;  4KHZ F;  5LB7 B;  4PJM A;  5AQN B;  5JDM A;  4XBF B;  5JVD E;  4QHO A;  3ZN1 B;  4HFB A;  4P09 A;  5FY1 A;  3ONX A;  3RPU A;  2ZM6 T;  2VAS A;  4DR4 T;  2XTL A;  3B5M A;  3RIU C;  4H9O C;  2K24 A;  4ZI3 D;  2ODV A;  2XAH B;  3I0O A;  2XQ5 A;  4HWI B;  4O4I E;  3ZJ2 A;  4P1N A;  1QLB A;  2LEH A;  5CJ5 A;  2BG9 B;  3KVB A;  2AE9 A;  3RF1 A;  4GKJ T;  3Q2M A;  1V9D A;  3CK6 A;  3EI0 A;  2V7I A;  4IE7 A;  1I94 T;  3VKG A;  4B3M T;  2XQA A;  4LF7 T;  2MBG A;  3AEG A;  4BAY B;  2KWI B;  2NTX A;  4EXT A;  2CCQ A;  5L47 A;  5J0Z A;  2XAG B;  3IBP A;  2GK9 A;  4Z91 A;  5IHY A;  4H9S E;  3C51 A;  1UK5 A;  2XQ3 A;  2CHN A;  1E2A A;  3L09 A;  1T98 A;  2C5I T;  2Q9Q B;  4DV7 T;  5FVK A;  1MIY A;  5CGM A;  5LMN T;  3TKL B;  5CB4 E;  3AA1 B;  3FBL A;  3CQG B;  2CEA A;  2JPF A;  4ZI3 C;  2IHR 1;  2UU9 T;  2EHO C;  2OLT A;  3A7M A;  4JI1 T; 
#chains in the Genus database with same CATH homology
 1HR0 T;  4DR6 T;  4LF4 T;  4DR3 T;  4DV3 T;  4X65 T;  4NXN T;  4YHH T;  4DR5 T;  1FJG T;  4LF6 T;  4AQY T;  1XNQ T;  4GKK T;  1XMQ T;  4DUZ T;  1XMO T;  4DR2 T;  1HNX T;  4DR7 T;  4JI7 T;  4NXM T;  4LF5 T;  1N32 T;  1IBK T;  4JI4 T;  4DUY T;  2VQE T;  1HNZ T;  2VQF T;  4LFA T;  4LF8 T;  4JI5 T;  4JI6 T;  4OX9 T;  3T1Y T;  5LMU T;  4B3S T;  3OTO T;  3T1H T;  4X62 T;  4DV4 T;  5BR8 T;  2UUC T;  4JYA T;  2F4V T;  4LFB T;  4B3R T;  1N33 T;  1N36 T;  4DV2 T;  4KHP T;  4DV6 T;  4LFC T;  1HNW T;  4X64 T;  4JI8 T;  1IBL T;  1J5E T;  2UXD T;  5IWA T;  2UUA T;  4JV5 T;  2HHH T;  4B3T T;  1XNR T;  2ZM6 T;  4DR4 T;  4K0K T;  2E5L T;  2UXB T;  4GKJ T;  2UXC T;  4DR1 T;  1I94 T;  4B3M T;  4LF7 T;  2UUB T;  4JI2 T;  4YY3 T;  4JI0 T;  4DV5 T;  4JI3 T;  4X66 T;  4DV7 T;  4LF9 T;  5LMN T;  1N34 T;  4DV0 T;  2UU9 T;  4DV1 T;  4JI1 T;  1IBM T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...