4JI3D

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
208
structure length
208
Chain Sequence
GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRPSDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRLDNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQLVIEFYSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 61
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00163 Ribosomal_S4 Ribosomal protein S4/S9 N-terminal domain
D PF01479 S4 S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1050.10 Mainly Alpha Orthogonal Bundle Ribosomal Protein S4 Delta 41; Chain A, domain 1 Ribosomal Protein S4 Delta 41; Chain A, domain 1 4ji3D01
3.10.290.10 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A RNA-binding S4 domain 4ji3D02
4DR7D 1HNZD 4GKKD 1VIOA 5LMND 1XMOD 4DR6D 4LF4D 2UUCD 4X66D 1C06A 1N34D 4DV5D 3DH3A 4JI6D 4NXND 5IWAD 1P9KA 4JYAD 4DR4D 4OUDA 2UUAD 4AQYD 1KSLA 4LF5D 3HP7A 1XNRD 4X65D 4LF6D 2ISTA 2KTLA 1HNXD 1J5ED 4JI5D 4DR3D 1N32D 2UU9D 1I94D 1XMQD 2VQFD 2HHHD 2UXBD 4OX9D 4X62D 2E5LD 4X64D 1IBKD 3KBGA 4B3TD 4DV2D 5LMUD 4LFCD 4JI7D 2F4VD 1DM9A 1IBLD 2ZM6D 4DUZD 4JI3D 4DV3D 4DV0D 1C05A 2UXCD 4DR5D 4NXMD 4YHHD 4LGTA 1N36D 1H3EA 4DR2D 4B3RD 4JI1D 3T1HD 1H3FA 2UUBD 4JI8D 4DV7D 3T1YD 4LF7D 4YY3D 1FKAD 2K6PA 4KHPD 2VQED 1FJGD 4DV6D 4JV5D 4LFBD 4B3MD 1KSKA 4LF8D 4DV4D 4DV1D 4B3SD 1HNWD 1JH3A 5BR8D 4DR1D 1KSVA 4JI0D 1XNQD 4GKJD 4LFAD 4JI4D 4K0KD 4JI2D 1HR0D 3OTOD 4DUYD 2JANA 1N33D 2UXDD 4LF9D 1IBMD
chains in the Genus database with same CATH superfamily
4DR7D 1HNZD 2NVUB 4GKKD 3J81E 1VIOA 5LMND 1XMOD 4DR6D 1Y8XB 4LF4D 2UUCD 4X66D 1C06A 1N34D 4DV5D 3DH3A 4JI6D 4NXND 5IWAD 1P9KA 4JYAD 3JAME 4DR4D 4OUDA 2UUAD 4AQYD 1KSLA 4LF5D 3HP7A 1XNRD 4X65D 4LF6D 2ISTA 2KTLA 4II3A 1HNXD 2I1SA 1J5ED 4JI5D 4DR3D 1N32D 2UU9D 1I94D 3FN1A 1XMQD 2VQFD 2HHHD 2UXBD 5KNLA 1Y8RB 4OX9D 3J80E 4X62D 2E5LD 4X64D 1IBKD 3KBGA 4B3TD 4NNJA 5LL6S 5FLXE 4DV2D 5LMUD 4LFCD 4JI7D 2F4VD 1DM9A 1IBLD 2ZM6D 4DUZD 4JI3D 4DV3D 4DV0D 3KYDB 1C05A 2UXCD 4DR5D 4II2A 3J7AF 4NXMD 4YHHD 3CMMA 4W5VB 1Y8QB 4LGTA 5IT9E 1N36D 1H3EA 2LQ7A 4DR2D 4B3RD 4JI1D 3T1HD 1H3FA 2UUBD 2L3NA 4JI8D 4DV7D 3T1YD 4LF7D 4YY3D 1FKAD 2K6PA 5FQ2B 4KHPD 2VQED 1FJGD 4DV6D 4JV5D 4LFBD 4B3MD 1KSKA 4LF8D 4DV4D 4DV1D 4B3SD 1HNWD 2ZTBA 1JH3A 5BR8D 4DR1D 1KSVA 4JI0D 1XNQD 4GKJD 3KYCB 4LFAD 4JI4D 4K0KD 4JI2D 1HR0D 3OTOD 3ONHA 4DUYD 2JANA 1N33D 2UXDD 4LF9D 3ONGA 5A2QE 1IBMD
chains in the Genus database with same CATH topology
4DR7D 1HNZD 4GKKD 1VIOA 5LMND 1XMOD 4DR6D 4LF4D 2UUCD 4X66D 1C06A 1N34D 4DV5D 3DH3A 4JI6D 4NXND 5IWAD 1P9KA 4JYAD 4DR4D 4OUDA 2UUAD 4AQYD 1KSLA 4LF5D 3HP7A 1XNRD 4X65D 4LF6D 2ISTA 2KTLA 1HNXD 1J5ED 4JI5D 4DR3D 1N32D 2UU9D 1I94D 1XMQD 2VQFD 2HHHD 2UXBD 4OX9D 4X62D 2E5LD 4X64D 1IBKD 3KBGA 4B3TD 4DV2D 5LMUD 4LFCD 4JI7D 2F4VD 1DM9A 1IBLD 2ZM6D 4DUZD 4JI3D 4DV3D 4DV0D 1C05A 2UXCD 4DR5D 4NXMD 4YHHD 4LGTA 1N36D 1H3EA 4DR2D 4B3RD 4JI1D 3T1HD 1H3FA 2UUBD 2L3NA 4JI8D 4DV7D 3T1YD 4LF7D 4YY3D 1FKAD 2K6PA 4KHPD 2VQED 1FJGD 4DV6D 4JV5D 4LFBD 4B3MD 1KSKA 4LF8D 4DV4D 4DV1D 4B3SD 1HNWD 1JH3A 5BR8D 4DR1D 1KSVA 4JI0D 1XNQD 4GKJD 4LFAD 4JI4D 4K0KD 4JI2D 1HR0D 3OTOD 4DUYD 2JANA 1N33D 2UXDD 4LF9D 1IBMD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR7 D;  1HNZ D;  4GKK D;  1VIO A;  5LMN D;  1XMO D;  4DR6 D;  4LF4 D;  2UUC D;  4X66 D;  1C06 A;  1N34 D;  4DV5 D;  3DH3 A;  4JI6 D;  4NXN D;  5IWA D;  1P9K A;  4JYA D;  4DR4 D;  4OUD A;  2UUA D;  4AQY D;  1KSL A;  4LF5 D;  3HP7 A;  1XNR D;  4X65 D;  4LF6 D;  2IST A;  2KTL A;  1HNX D;  1J5E D;  4JI5 D;  4DR3 D;  1N32 D;  2UU9 D;  1I94 D;  1XMQ D;  2VQF D;  2HHH D;  2UXB D;  4OX9 D;  4X62 D;  2E5L D;  4X64 D;  1IBK D;  3KBG A;  4B3T D;  4DV2 D;  5LMU D;  4LFC D;  4JI7 D;  2F4V D;  1DM9 A;  1IBL D;  2ZM6 D;  4DUZ D;  4JI3 D;  4DV3 D;  4DV0 D;  1C05 A;  2UXC D;  4DR5 D;  4NXM D;  4YHH D;  4LGT A;  1N36 D;  1H3E A;  4DR2 D;  4B3R D;  4JI1 D;  3T1H D;  1H3F A;  2UUB D;  4JI8 D;  4DV7 D;  3T1Y D;  4LF7 D;  4YY3 D;  1FKA D;  2K6P A;  4KHP D;  2VQE D;  1FJG D;  4DV6 D;  4JV5 D;  4LFB D;  4B3M D;  1KSK A;  4LF8 D;  4DV4 D;  4DV1 D;  4B3S D;  1HNW D;  1JH3 A;  5BR8 D;  4DR1 D;  1KSV A;  4JI0 D;  1XNQ D;  4GKJ D;  4LFA D;  4JI4 D;  4K0K D;  4JI2 D;  1HR0 D;  3OTO D;  4DUY D;  2JAN A;  1N33 D;  2UXD D;  4LF9 D;  1IBM D; 
#chains in the Genus database with same CATH topology
 4DR7 D;  1HNZ D;  2NVU B;  4GKK D;  3J81 E;  1VIO A;  5LMN D;  1XMO D;  4DR6 D;  1Y8X B;  4LF4 D;  2UUC D;  4X66 D;  1C06 A;  1N34 D;  4DV5 D;  3DH3 A;  4JI6 D;  4NXN D;  5IWA D;  1P9K A;  4JYA D;  3JAM E;  4DR4 D;  4OUD A;  2UUA D;  4AQY D;  1KSL A;  4LF5 D;  3HP7 A;  1XNR D;  4X65 D;  4LF6 D;  2IST A;  2KTL A;  4II3 A;  1HNX D;  2I1S A;  1J5E D;  4JI5 D;  4DR3 D;  1N32 D;  2UU9 D;  1I94 D;  3FN1 A;  1XMQ D;  2VQF D;  2HHH D;  2UXB D;  5KNL A;  1Y8R B;  4OX9 D;  3J80 E;  4X62 D;  2E5L D;  4X64 D;  1IBK D;  3KBG A;  4B3T D;  4NNJ A;  5LL6 S;  5FLX E;  4DV2 D;  5LMU D;  4LFC D;  4JI7 D;  2F4V D;  1DM9 A;  1IBL D;  2ZM6 D;  4DUZ D;  4JI3 D;  4DV3 D;  4DV0 D;  3KYD B;  1C05 A;  2UXC D;  4DR5 D;  4II2 A;  3J7A F;  4NXM D;  4YHH D;  3CMM A;  4W5V B;  1Y8Q B;  4LGT A;  5IT9 E;  1N36 D;  1H3E A;  2LQ7 A;  4DR2 D;  4B3R D;  4JI1 D;  3T1H D;  1H3F A;  2UUB D;  2L3N A;  4JI8 D;  4DV7 D;  3T1Y D;  4LF7 D;  4YY3 D;  1FKA D;  2K6P A;  5FQ2 B;  4KHP D;  2VQE D;  1FJG D;  4DV6 D;  4JV5 D;  4LFB D;  4B3M D;  1KSK A;  4LF8 D;  4DV4 D;  4DV1 D;  4B3S D;  1HNW D;  2ZTB A;  1JH3 A;  5BR8 D;  4DR1 D;  1KSV A;  4JI0 D;  1XNQ D;  4GKJ D;  3KYC B;  4LFA D;  4JI4 D;  4K0K D;  4JI2 D;  1HR0 D;  3OTO D;  3ONH A;  4DUY D;  2JAN A;  1N33 D;  2UXD D;  4LF9 D;  3ONG A;  5A2Q E;  1IBM D; 
#chains in the Genus database with same CATH homology
 4DR7 D;  1HNZ D;  4GKK D;  1VIO A;  5LMN D;  1XMO D;  4DR6 D;  4LF4 D;  2UUC D;  4X66 D;  1C06 A;  1N34 D;  4DV5 D;  3DH3 A;  4JI6 D;  4NXN D;  5IWA D;  1P9K A;  4JYA D;  4DR4 D;  4OUD A;  2UUA D;  4AQY D;  1KSL A;  4LF5 D;  3HP7 A;  1XNR D;  4X65 D;  4LF6 D;  2IST A;  2KTL A;  1HNX D;  1J5E D;  4JI5 D;  4DR3 D;  1N32 D;  2UU9 D;  1I94 D;  1XMQ D;  2VQF D;  2HHH D;  2UXB D;  4OX9 D;  4X62 D;  2E5L D;  4X64 D;  1IBK D;  3KBG A;  4B3T D;  4DV2 D;  5LMU D;  4LFC D;  4JI7 D;  2F4V D;  1DM9 A;  1IBL D;  2ZM6 D;  4DUZ D;  4JI3 D;  4DV3 D;  4DV0 D;  1C05 A;  2UXC D;  4DR5 D;  4NXM D;  4YHH D;  4LGT A;  1N36 D;  1H3E A;  4DR2 D;  4B3R D;  4JI1 D;  3T1H D;  1H3F A;  2UUB D;  2L3N A;  4JI8 D;  4DV7 D;  3T1Y D;  4LF7 D;  4YY3 D;  1FKA D;  2K6P A;  4KHP D;  2VQE D;  1FJG D;  4DV6 D;  4JV5 D;  4LFB D;  4B3M D;  1KSK A;  4LF8 D;  4DV4 D;  4DV1 D;  4B3S D;  1HNW D;  1JH3 A;  5BR8 D;  4DR1 D;  1KSV A;  4JI0 D;  1XNQ D;  4GKJ D;  4LFA D;  4JI4 D;  4K0K D;  4JI2 D;  1HR0 D;  3OTO D;  4DUY D;  2JAN A;  1N33 D;  2UXD D;  4LF9 D;  1IBM D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...