4JI3I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 29
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji3I00
4B3RI 1Z0EA 3PYDA 5IWAI 1QZRA 4JI5E 5LL6R 1Z0VA 4JI1E 3K17A 4LF4E 4JI5I 4JI0E 1RR9A 4JI1I 2X7IA 2OI2A 4DPTA 1H7UA 1N33E 4LF4I 4JI0I 1MX0A 3F0NA 2CZ9A 4DXLA 4PRXA 2UU9E 4P52A 4WUDA 2R42A 2V2ZA 3B82A 4JI2E 1H73A 4DV2E 2UXBE 4X64E 4DR1E 2UU9I 4DR3E 1ZM4A 4LF6E 4JI2I 3GONA 4P7AA 4DV2I 2UXBI 4X64I 3J81Q 4DR1I 4DR3I 4R1FA 4NXNE 3PYGA 4LF6I 4DPWA 3JAMC 1N0VC 2HK3A 4NXNI 2AJ4A 2HKEA 4JI6E 3WU4A 2V8PA 1NZ0A 4DV7E 3WU6A 1WUUA 3K1JA 4YY3E 3V5RA 2V2QA 5IT9Q 4JI6I 4WUBA 4DV7I 1XNRI 4GKJE 3J80Q 4ED4A 2UUAE 4YY3I 4PU9A 4DU7A 4ZVIA 1ZXNA 4KQVA 4B3ME 4DV4E 2BM1A 4GKJI 3OTOE 4DUZE 2UXCE 5GMEA 4FWHA 1XMQE 2ZBKB 2NPFA 1HR0E 4B3MI 4DV4I 2UXDE 1ZM3A 3OTOI 4B3TE 2A2CA 4DUZI 4XTJA 2UXCI 1XMQI 2ZITA 1HR0I 3CWVA 2UXDI 1Z0GA 1ZM2A 4B3TI 4JYAE 2VQFE 1S16A 4Z7CA 4KHPE 1HNWE 3J81C 4JYAI 2VQFI 1HNWI 4KHPI 1Z0CA 1FWKA 3Q1QA 4MYTA 5A2QC 1EI1A 2E1RA 4LF8E 2VQEE 3ZZUA 1I94E 1B62A 1HNZE 5IT9C 3ZZ0A 3B78A 4LF8I 2VQEI 2J7KA 1I94I 3LPSA 3J80C 2XEXA 5LMUI 5GMDA 2HHHE 1HNZI 3PYEA 2ZM6E 4FW9A 1FKAE 1IBME 3ZKDA 2HHHI 1S4EA 1DARA 2UUCE 2ZM6I 4M1KA 4K0KE 3ZM7A 1IBMI 3ZZTA 1MG7A 2UUCI 5BR8E 4K0KI 1NHHA 1XNRE 1PVGA 2BM0A 2HK2A 1N32E 4I3HA 3J7AG 4DUYE 5BR8I 1KIJA 3T1YE 1FNMA 4DV1E 1N32I 1N0UA 2X36A 4DUYI 4DV6E 5LMNE 2E5LE 2BV3A 1U2RA 4DR5E 3T1YI 2VF3A 2R3VA 4JI3E 4JV5E 4PRVA 1H72C 4DV1I 4X65E 4DV6I 5LMNI 2E5LI 4DR5I 1FJGE 4JI3I 4JV5I 1ZXMA 4FN5A 1XMOE 4X65I 4JG4A 1XNQE 4NXME 1H7SA 1Z59A 1FJGI 1KTVA 3QT8A 2V2VA 4URLA 1XMOI 4JI4E 2LJPA 3LTOA 1XNQI 4NXMI 4X62E 4USKA 4Z7YA 1HNXE 3LNUA 3T1HE 4JI4I 5L3JA 4DR7E 3QT5A 1OJ4A 2WW4A 4X62I 3HULA 1BKNA 4AQYE 5FLXQ 1HNXI 3T1HI 4JI7E 4DR7I 3H4LA 1ZM9A 4LFCE 2F4VE 4AQYI 4JI7I 5LMUE 4LFBE 1KVKA 1D6TA 4LFCI 4X66E 4HACB 4FWGA 2Q2EB 2F4VI 1NHJA 1IBLE 2EFGA 4HYMA 3QT7A 4DR4E 4B3SE 4GKKE 2HFUA 4LFBI 4DPYA 3M6AA 4X66I 1N36E 4EMDA 2A2DA 1IBLI 3B8HA 3WU5A 1Z0BA 1MU5A 4DR4I 4B3SI 4LF5E 4GKKI 1A6FA 1N33I 1Z0TA 1N36I 4OX9E 4HACA 1FI4A 4RPFA 4JI8E 3V2UC 4USMA 1J5EE 1EA6A 4LF5I 4YHHE 1IBKE 4LFAE 1Z5BA 4OX9I 4JI8I 4LF7E 1J5EI 4UTGA 3D4JA 1Z5CA 4YHHI 1Z0WA 1FWLA 2HFSA 1IBKI 4LFAI 4LF9E 4HY1A 4LF7I 1NHIA 1PKPA 1UEKA 5A2QQ 4WUCA 4LF9I 3QT6A 4DPUA 1KKHA 5FLXC 1Z5AA 3ZKBA 3J7AM 2DEJA 1RREA 1PIEA 4FWDA 4DV0E 4DR6E 3WU3A 4DV5E 4DPXA 1VISA 1K47A 1XHKA 1B63A 1H74A 4DV0I 4DR6I 4DR2E 2UUAI 1ELOA 4DV3E 1N34E 4DV5I 3PYFA 3JAMQ 2GS8A 2V34A 2DEIA 4MYUA 2UUBE 4DR2I 4UT4A 4DU8A 4DV3I 4B3RE 5IWAE 1N34I 2UUBI 2HKJA 4HXZA
chains in the Genus database with same CATH superfamily
4B3RI 1Z0EA 3PYDA 5IWAI 1QZRA 4JI5E 5LL6R 4ISAA 1Z0VA 4JI1E 3K17A 4LCFA 4LF4E 4JI5I 2O1WA 4JI0E 4OZEA 1RR9A 4JI1I 2X7IA 2OI2A 4DPTA 1H7UA 1N33E 4OO1C 4LF4I 4JI0I 1MX0A 3F0NA 2CZ9A 4DXLA 3P3EA 4PRXA 2UU9E 4LCHA 4P52A 4BA2B 4WUDA 2R42A 4LPFA 2V2ZA 3B82A 4JI2E 1H73A 4DV2E 2UXBE 4X64E 4DR1E 2UU9I 4DR3E 3KRNA 1USVA 2Z5EA 5DRRA 3U1YA 1ZM4A 4LF6E 4JI2I 3GONA 3GLLA 4P7AA 4DV2I 2UXBI 4X64I 3J81Q 2JEAB 4DR1I 4DR3I 5JEAC 1E3PA 4BA2A 4R1FA 4NXNE 3UHMA 3H1CA 5DRQA 1UDNA 3PYGA 4FW6A 4IFDD 4LF6I 4DPWA 3JAMC 1N0VC 2C37B 4OO1F 2HK3A 4NXNI 2AJ4A 2HKEA 4LCGA 4JI6E 3WU4A 2V8PA 1NZ0A 4DV7E 4BA1B 2JEAA 4IS9A 3DD6A 1WUUA 3WU6A 3M7NG 2C38B 3K1JA 4N3OA 4YY3E 3V5RA 2V2QA 5IT9Q 4JI6I 4OO1B 4WUBA 5DNXA 4DV7I 1XNRI 2C37A 4GKJE 3J80Q 4ED4A 2UUAE 4YY3I 4PU9A 4DU7A 4ZVIA 5JEAF 1ZXNA 4KQVA 4B3ME 4DV4E 2BM1A 4BA1A 4GKJI 4IZJD 3OTOE 2C38A 5DROA 4DUZE 2UXCE 5GMEA 4FWHA 2BA0D 1XMQE 3P06A 2ZBKB 4OO1E 2GQ0A 4OO1A 2NPFA 1HR0E 4B3MI 1VI7A 4DV4I 1HK7A 2UXDE 1ZM3A 3OTOI 4B3TE 5JEAB 2A2CA 4DUZI 3L7ZA 4XTJA 1UDOA 2UXCI 2WP8B 1XMQI 2ZITA 1HR0I 3CWVA 4MQYA 4QNJA 2UXDI 5DNLA 1Z0GA 1ZM2A 4B3TI 4U3BA 4JYAE 1UDSA 2VQFE 5C0XC 1S16A 3P76A 2Z5CB 4Z7CA 4KHPE 1HNWE 1Y60A 3J81C 4JYAI 5JEAE 5JEAA 2VQFI 2WP8A 4IZJB 5K36C 4LOMA 1HNWI 4KHPI 1Z0CA 3U1KA 1FWKA 3Q1QA 4MYTA 5A2QC 2CG9A 2Z5CA 1EI1A 1E3HA 2E1RA 4LF8E 2VQEE 3ZZUA 1I94E 1B62A 4AM3A 1HNZE 5IT9C 3ZZ0A 4IZJA 3B78A 3PS2A 4OKGA 4LF8I 2VQEI 5C0XF 2J7KA 1I94I 3LPSA 3J80C 4OO1D 2XEXA 5LMUI 5GMDA 2HHHE 2O1VA 2IOPA 1R6MA 3PYEA 1HNZI 4AIMA 3M85G 5ELWA 1RHYA 2CGEA 2ZM6E 4FW9A 3HJCA 3PS3A 1FKAE 1IBME 3ZKDA 5EL9A 5K36F 2PNLA 2BA1D 2HHHI 1S4EA 5C0XB 1DARA 2BA0G 2Z5BB 2O1UA 2UUCE 2ZM6I 4M1KA 4K0KE 3ZM7A 1IBMI 3P3CA 3GCMA 3ZZTA 1MG7A 1OYRA 2UUCI 1Y6ZA 5JEAD 5K36B 5BR8E 2AE8A 4K0KI 1NHHA 3P3GA 1XNRE 1XXEA 1PVGA 2BM0A 3GMEA 5C0XE 2HK2A 1N32E 5C0XA 4I3HA 3J7AG 4DUYE 2Z5BA 2PNMA 4MU1A 5BR8I 1KIJA 3CDJA 1USUA 4FW3A 3T1YE 2NN6C 2F1DA 3L7ZB 1FNMA 2PO0B 4DV1E 1N32I 1N0UA 2X36A 4DUYI 4DV6E 5LMNE 2E5LE 5K36E 5K36A 2BV3A 1U2RA 4DR5E 3T1YI 2PO2B 2VF3A 2R3VA 5EKWA 4JI3E 4JV5E 4PRVA 1H72C 1Y5YA 5DRPA 4DV1I 4X65E 2JEBB 4DV6I 2NN6D 5LMNI 2E5LI 4FW7A 2GO3A 4DR5I 1FJGE 4JI3I 4JV5I 5FWKA 1ZXMA 4FN5A 1XMOE 2PO0A 3NZKA 4U3DA 4X65I 4JG4A 1XNQE 4NXME 1H7SA 1Z59A 2JT2A 1FJGI 2PO2A 1KTVA 3QT8A 3B4TA 2V2VA 4URLA 1XMOI 4JI4E 1Y4SA 2NN6F 2LJPA 3LTOA 2JEBA 4FW4A 4NXMI 1XNQI 4X62E 4USKA 4Z7YA 1HNXE 3LNUA 3T1HE 2IERA 4JI4I 5L3JA 4DR7E 2BA1G 3QT5A 1OJ4A 2WW4A 4X62I 3HULA 1BKNA 4AQYE 5C0XD 5FLXQ 2NN6B 1HNXI 3T1HI 2IOQA 4JI7E 4DR7I 3H4LA 1ZM9A 2O3ZA 4LFCE 2F4VE 4AQYI 4GQUA 2CVEA 4AIDA 4JI7I 5K36D 5LMUE 4LFBE 1KVKA 1D6TA 1OYSA 4IZKB 4LFCI 4X66E 4HACB 2IESA 4FWGA 2Q2EB 2WNRB 2F4VI 1NHJA 3CDIA 2EFGA 3K85A 1IBLE 2NN6E 4HYMA 3QT7A 2NN6A 4DR4E 2BR2B 4B3SE 4GKKE 2HFUA 4LFBI 3M6AA 4DPYA 4X66I 1N36E 4EMDA 2A2DA 1IBLI 3B8HA 3WU5A 1Z0BA 1MU5A 4DR4I 4B3SI 4LF5E 4GKKI 1A6FA 4MU4A 1N33I 1Z0TA 1N36I 4OX9E 1Y4UA 4IZKA 4J3DA 4HACA 1FI4A 2WNRA 4RPFA 4JI8E 3V2UC 4IFDC 4USMA 1J5EE 4MU0A 1EA6A 4LF5I 2BR2A 3PS1A 4YHHE 1IBKE 4LFAE 1Z5BA 1UDQA 4OX9I 4JI8I 4LF7E 3Q6NA 1J5EI 4UTGA 3D4JA 1Z5CA 4YHHI 1Z0WA 1FWLA 2HFSA 1IBKI 4LFAI 4NBQA 1YHCA 4LF9E 4HY1A 4LF7I 4QNKA 1NHIA 1PKPA 1R6LA 1UEKA 5A2QQ 4WUCA 4LF9I 3QT6A 1OYPA 4DPUA 1KKHA 5FLXC 1Z5AA 2JE6B 2J65A 3ZKBA 2PNZB 3J7AM 4IFDF 2DEJA 2C39B 1RREA 3PRYA 1PIEA 4FWDA 3Q6MA 4DV0E 4DR6E 3WU3A 3M85D 2O1TA 4DV5E 4DPXA 1VISA 1K47A 2PO1B 1XHKA 4IFDB 1B63A 1H74A 4DV0I 3HKMA 4DR6I 4DR2E 2UUAI 1ELOA 2JE6A 4DV3E 2PNZA 1P42A 4FW5A 1N34E 4DV5I 3PYFA 3JAMQ 2GS8A 2C39A 4MDTA 2V34A 2DEIA 4MYUA 2UUBE 4DR2I 4UT4A 4DU8A 4DV3I 4B3RE 5IWAE 1N34I 4MU3A 2VESA 1YH8A 2UUBI 2HKJA 2PO1A 3M7ND 4IFDE 4IFDA 4HXZA 2GO4A
chains in the Genus database with same CATH topology
4B3RI 1Z0EA 3PYDA 5IWAI 1QZRA 4JI5E 5LL6R 1Z0VA 4JI1E 3K17A 4LF4E 4JI5I 2O1WA 4JI0E 1RR9A 4JI1I 2X7IA 2OI2A 4DPTA 1H7UA 1N33E 4LF4I 4JI0I 1MX0A 3F0NA 2CZ9A 4DXLA 4PRXA 2UU9E 4P52A 4WUDA 2R42A 2V2ZA 3B82A 4JI2E 1H73A 4DV2E 2UXBE 4X64E 4DR1E 2UU9I 4DR3E 1USVA 2Z5EA 1ZM4A 4LF6E 4JI2I 3GONA 4P7AA 4DV2I 2UXBI 4X64I 3J81Q 4DR1I 4DR3I 4R1FA 4NXNE 3PYGA 4LF6I 4DPWA 3JAMC 1N0VC 2HK3A 4NXNI 2AJ4A 2HKEA 4JI6E 3WU4A 2V8PA 1NZ0A 4DV7E 3WU6A 1WUUA 3K1JA 4N3OA 4YY3E 3V5RA 2V2QA 5IT9Q 4JI6I 4WUBA 4DV7I 1XNRI 4GKJE 3J80Q 4ED4A 2UUAE 4YY3I 4PU9A 4DU7A 4ZVIA 1ZXNA 4KQVA 4B3ME 4DV4E 2BM1A 4GKJI 4IZJD 3OTOE 4DUZE 2UXCE 5GMEA 4FWHA 1XMQE 3P06A 2ZBKB 2GQ0A 2NPFA 1HR0E 4B3MI 4DV4I 1HK7A 2UXDE 1ZM3A 3OTOI 4B3TE 2A2CA 4DUZI 4XTJA 2UXCI 1XMQI 2ZITA 1HR0I 3CWVA 2UXDI 1Z0GA 1ZM2A 4B3TI 4JYAE 2VQFE 1S16A 2Z5CB 4Z7CA 4KHPE 1HNWE 3J81C 4JYAI 2VQFI 4IZJB 1HNWI 4KHPI 1Z0CA 1FWKA 3Q1QA 4MYTA 5A2QC 2CG9A 2Z5CA 1EI1A 2E1RA 4LF8E 2VQEE 3ZZUA 1I94E 1B62A 1HNZE 5IT9C 3ZZ0A 4IZJA 3B78A 4LF8I 2VQEI 2J7KA 1I94I 3LPSA 3J80C 2XEXA 5LMUI 5GMDA 2HHHE 2O1VA 2IOPA 1HNZI 3PYEA 2CGEA 2ZM6E 4FW9A 3HJCA 1FKAE 1IBME 3ZKDA 2PNLA 2HHHI 1S4EA 1DARA 2Z5BB 2O1UA 2UUCE 2ZM6I 4M1KA 4K0KE 3ZM7A 1IBMI 3ZZTA 1MG7A 2UUCI 1Y6ZA 5BR8E 4K0KI 1NHHA 1XNRE 1PVGA 2BM0A 2HK2A 1N32E 4I3HA 3J7AG 4DUYE 2Z5BA 2PNMA 5BR8I 1KIJA 1USUA 3T1YE 1FNMA 4DV1E 1N32I 1N0UA 2X36A 4DUYI 4DV6E 5LMNE 2E5LE 2BV3A 1U2RA 4DR5E 3T1YI 2VF3A 2R3VA 4JI3E 4JV5E 4PRVA 1H72C 4DV1I 4X65E 4DV6I 5LMNI 2E5LI 4DR5I 1FJGE 4JI3I 4JV5I 5FWKA 1ZXMA 4FN5A 1XMOE 4X65I 4JG4A 1XNQE 4NXME 1H7SA 1Z59A 1FJGI 1KTVA 3QT8A 2V2VA 4URLA 1XMOI 4JI4E 1Y4SA 2LJPA 3LTOA 1XNQI 4NXMI 4X62E 4USKA 4Z7YA 1HNXE 3LNUA 3T1HE 4JI4I 5L3JA 4DR7E 3QT5A 1OJ4A 2WW4A 4X62I 3HULA 1BKNA 4AQYE 5FLXQ 1HNXI 3T1HI 2IOQA 4JI7E 4DR7I 3H4LA 1ZM9A 4LFCE 2F4VE 4AQYI 4JI7I 5LMUE 4LFBE 1KVKA 1D6TA 4LFCI 4IZKB 4X66E 4HACB 4FWGA 2Q2EB 2F4VI 1NHJA 3K85A 2EFGA 1IBLE 4HYMA 3QT7A 4DR4E 4B3SE 4GKKE 2HFUA 4LFBI 4DPYA 3M6AA 4X66I 1N36E 4EMDA 2A2DA 1IBLI 3B8HA 3WU5A 1Z0BA 1MU5A 4DR4I 4B3SI 4LF5E 4GKKI 1A6FA 1N33I 1Z0TA 1N36I 4OX9E 1Y4UA 4IZKA 4HACA 1FI4A 4RPFA 4JI8E 3V2UC 4USMA 1J5EE 1EA6A 4LF5I 4YHHE 1IBKE 4LFAE 1Z5BA 4OX9I 4JI8I 4LF7E 3Q6NA 1J5EI 4UTGA 3D4JA 1Z5CA 4YHHI 1Z0WA 1FWLA 2HFSA 1IBKI 4LFAI 4LF9E 4HY1A 4LF7I 1NHIA 1PKPA 1UEKA 5A2QQ 4WUCA 4LF9I 3QT6A 4DPUA 1KKHA 5FLXC 1Z5AA 3ZKBA 3J7AM 2DEJA 1RREA 3PRYA 1PIEA 4FWDA 3Q6MA 4DV0E 4DR6E 3WU3A 2O1TA 4DV5E 4DPXA 1VISA 1K47A 1XHKA 1B63A 1H74A 4DV0I 4DR6I 4DR2E 2UUAI 1ELOA 4DV3E 1N34E 4DV5I 3PYFA 3JAMQ 2GS8A 2V34A 2DEIA 4MYUA 2UUBE 4DR2I 4UT4A 4DU8A 4DV3I 4B3RE 5IWAE 1N34I 2UUBI 2HKJA 4HXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3R I;  1Z0E A;  3PYD A;  5IWA I;  1QZR A;  4JI5 E;  5LL6 R;  1Z0V A;  4JI1 E;  3K17 A;  4LF4 E;  4JI5 I;  4JI0 E;  1RR9 A;  4JI1 I;  2X7I A;  2OI2 A;  4DPT A;  1H7U A;  1N33 E;  4LF4 I;  4JI0 I;  1MX0 A;  3F0N A;  2CZ9 A;  4DXL A;  4PRX A;  2UU9 E;  4P52 A;  4WUD A;  2R42 A;  2V2Z A;  3B82 A;  4JI2 E;  1H73 A;  4DV2 E;  2UXB E;  4X64 E;  4DR1 E;  2UU9 I;  4DR3 E;  1ZM4 A;  4LF6 E;  4JI2 I;  3GON A;  4P7A A;  4DV2 I;  2UXB I;  4X64 I;  3J81 Q;  4DR1 I;  4DR3 I;  4R1F A;  4NXN E;  3PYG A;  4LF6 I;  4DPW A;  3JAM C;  1N0V C;  2HK3 A;  4NXN I;  2AJ4 A;  2HKE A;  4JI6 E;  3WU4 A;  2V8P A;  1NZ0 A;  4DV7 E;  3WU6 A;  1WUU A;  3K1J A;  4YY3 E;  3V5R A;  2V2Q A;  5IT9 Q;  4JI6 I;  4WUB A;  4DV7 I;  1XNR I;  4GKJ E;  3J80 Q;  4ED4 A;  2UUA E;  4YY3 I;  4PU9 A;  4DU7 A;  4ZVI A;  1ZXN A;  4KQV A;  4B3M E;  4DV4 E;  2BM1 A;  4GKJ I;  3OTO E;  4DUZ E;  2UXC E;  5GME A;  4FWH A;  1XMQ E;  2ZBK B;  2NPF A;  1HR0 E;  4B3M I;  4DV4 I;  2UXD E;  1ZM3 A;  3OTO I;  4B3T E;  2A2C A;  4DUZ I;  4XTJ A;  2UXC I;  1XMQ I;  2ZIT A;  1HR0 I;  3CWV A;  2UXD I;  1Z0G A;  1ZM2 A;  4B3T I;  4JYA E;  2VQF E;  1S16 A;  4Z7C A;  4KHP E;  1HNW E;  3J81 C;  4JYA I;  2VQF I;  1HNW I;  4KHP I;  1Z0C A;  1FWK A;  3Q1Q A;  4MYT A;  5A2Q C;  1EI1 A;  2E1R A;  4LF8 E;  2VQE E;  3ZZU A;  1I94 E;  1B62 A;  1HNZ E;  5IT9 C;  3ZZ0 A;  3B78 A;  4LF8 I;  2VQE I;  2J7K A;  1I94 I;  3LPS A;  3J80 C;  2XEX A;  5LMU I;  5GMD A;  2HHH E;  1HNZ I;  3PYE A;  2ZM6 E;  4FW9 A;  1FKA E;  1IBM E;  3ZKD A;  2HHH I;  1S4E A;  1DAR A;  2UUC E;  2ZM6 I;  4M1K A;  4K0K E;  3ZM7 A;  1IBM I;  3ZZT A;  1MG7 A;  2UUC I;  5BR8 E;  4K0K I;  1NHH A;  1XNR E;  1PVG A;  2BM0 A;  2HK2 A;  1N32 E;  4I3H A;  3J7A G;  4DUY E;  5BR8 I;  1KIJ A;  3T1Y E;  1FNM A;  4DV1 E;  1N32 I;  1N0U A;  2X36 A;  4DUY I;  4DV6 E;  5LMN E;  2E5L E;  2BV3 A;  1U2R A;  4DR5 E;  3T1Y I;  2VF3 A;  2R3V A;  4JI3 E;  4JV5 E;  4PRV A;  1H72 C;  4DV1 I;  4X65 E;  4DV6 I;  5LMN I;  2E5L I;  4DR5 I;  1FJG E;  4JI3 I;  4JV5 I;  1ZXM A;  4FN5 A;  1XMO E;  4X65 I;  4JG4 A;  1XNQ E;  4NXM E;  1H7S A;  1Z59 A;  1FJG I;  1KTV A;  3QT8 A;  2V2V A;  4URL A;  1XMO I;  4JI4 E;  2LJP A;  3LTO A;  1XNQ I;  4NXM I;  4X62 E;  4USK A;  4Z7Y A;  1HNX E;  3LNU A;  3T1H E;  4JI4 I;  5L3J A;  4DR7 E;  3QT5 A;  1OJ4 A;  2WW4 A;  4X62 I;  3HUL A;  1BKN A;  4AQY E;  5FLX Q;  1HNX I;  3T1H I;  4JI7 E;  4DR7 I;  3H4L A;  1ZM9 A;  4LFC E;  2F4V E;  4AQY I;  4JI7 I;  5LMU E;  4LFB E;  1KVK A;  1D6T A;  4LFC I;  4X66 E;  4HAC B;  4FWG A;  2Q2E B;  2F4V I;  1NHJ A;  1IBL E;  2EFG A;  4HYM A;  3QT7 A;  4DR4 E;  4B3S E;  4GKK E;  2HFU A;  4LFB I;  4DPY A;  3M6A A;  4X66 I;  1N36 E;  4EMD A;  2A2D A;  1IBL I;  3B8H A;  3WU5 A;  1Z0B A;  1MU5 A;  4DR4 I;  4B3S I;  4LF5 E;  4GKK I;  1A6F A;  1N33 I;  1Z0T A;  1N36 I;  4OX9 E;  4HAC A;  1FI4 A;  4RPF A;  4JI8 E;  3V2U C;  4USM A;  1J5E E;  1EA6 A;  4LF5 I;  4YHH E;  1IBK E;  4LFA E;  1Z5B A;  4OX9 I;  4JI8 I;  4LF7 E;  1J5E I;  4UTG A;  3D4J A;  1Z5C A;  4YHH I;  1Z0W A;  1FWL A;  2HFS A;  1IBK I;  4LFA I;  4LF9 E;  4HY1 A;  4LF7 I;  1NHI A;  1PKP A;  1UEK A;  5A2Q Q;  4WUC A;  4LF9 I;  3QT6 A;  4DPU A;  1KKH A;  5FLX C;  1Z5A A;  3ZKB A;  3J7A M;  2DEJ A;  1RRE A;  1PIE A;  4FWD A;  4DV0 E;  4DR6 E;  3WU3 A;  4DV5 E;  4DPX A;  1VIS A;  1K47 A;  1XHK A;  1B63 A;  1H74 A;  4DV0 I;  4DR6 I;  4DR2 E;  2UUA I;  1ELO A;  4DV3 E;  1N34 E;  4DV5 I;  3PYF A;  3JAM Q;  2GS8 A;  2V34 A;  2DEI A;  4MYU A;  2UUB E;  4DR2 I;  4UT4 A;  4DU8 A;  4DV3 I;  4B3R E;  5IWA E;  1N34 I;  2UUB I;  2HKJ A;  4HXZ A; 
#chains in the Genus database with same CATH topology
 4B3R I;  1Z0E A;  3PYD A;  5IWA I;  1QZR A;  4JI5 E;  5LL6 R;  4ISA A;  1Z0V A;  4JI1 E;  3K17 A;  4LCF A;  4LF4 E;  4JI5 I;  2O1W A;  4JI0 E;  4OZE A;  1RR9 A;  4JI1 I;  2X7I A;  2OI2 A;  4DPT A;  1H7U A;  1N33 E;  4OO1 C;  4LF4 I;  4JI0 I;  1MX0 A;  3F0N A;  2CZ9 A;  4DXL A;  3P3E A;  4PRX A;  2UU9 E;  4LCH A;  4P52 A;  4BA2 B;  4WUD A;  2R42 A;  4LPF A;  2V2Z A;  3B82 A;  4JI2 E;  1H73 A;  4DV2 E;  2UXB E;  4X64 E;  4DR1 E;  2UU9 I;  4DR3 E;  3KRN A;  1USV A;  2Z5E A;  5DRR A;  3U1Y A;  1ZM4 A;  4LF6 E;  4JI2 I;  3GON A;  3GLL A;  4P7A A;  4DV2 I;  2UXB I;  4X64 I;  3J81 Q;  2JEA B;  4DR1 I;  4DR3 I;  5JEA C;  1E3P A;  4BA2 A;  4R1F A;  4NXN E;  3UHM A;  3H1C A;  5DRQ A;  1UDN A;  3PYG A;  4FW6 A;  4IFD D;  4LF6 I;  4DPW A;  3JAM C;  1N0V C;  2C37 B;  4OO1 F;  2HK3 A;  4NXN I;  2AJ4 A;  2HKE A;  4LCG A;  4JI6 E;  3WU4 A;  2V8P A;  1NZ0 A;  4DV7 E;  4BA1 B;  2JEA A;  4IS9 A;  3DD6 A;  1WUU A;  3WU6 A;  3M7N G;  2C38 B;  3K1J A;  4N3O A;  4YY3 E;  3V5R A;  2V2Q A;  5IT9 Q;  4JI6 I;  4OO1 B;  4WUB A;  5DNX A;  4DV7 I;  1XNR I;  2C37 A;  4GKJ E;  3J80 Q;  4ED4 A;  2UUA E;  4YY3 I;  4PU9 A;  4DU7 A;  4ZVI A;  5JEA F;  1ZXN A;  4KQV A;  4B3M E;  4DV4 E;  2BM1 A;  4BA1 A;  4GKJ I;  4IZJ D;  3OTO E;  2C38 A;  5DRO A;  4DUZ E;  2UXC E;  5GME A;  4FWH A;  2BA0 D;  1XMQ E;  3P06 A;  2ZBK B;  4OO1 E;  2GQ0 A;  4OO1 A;  2NPF A;  1HR0 E;  4B3M I;  1VI7 A;  4DV4 I;  1HK7 A;  2UXD E;  1ZM3 A;  3OTO I;  4B3T E;  5JEA B;  2A2C A;  4DUZ I;  3L7Z A;  4XTJ A;  1UDO A;  2UXC I;  2WP8 B;  1XMQ I;  2ZIT A;  1HR0 I;  3CWV A;  4MQY A;  4QNJ A;  2UXD I;  5DNL A;  1Z0G A;  1ZM2 A;  4B3T I;  4U3B A;  4JYA E;  1UDS A;  2VQF E;  5C0X C;  1S16 A;  3P76 A;  2Z5C B;  4Z7C A;  4KHP E;  1HNW E;  1Y60 A;  3J81 C;  4JYA I;  5JEA E;  5JEA A;  2VQF I;  2WP8 A;  4IZJ B;  5K36 C;  4LOM A;  1HNW I;  4KHP I;  1Z0C A;  3U1K A;  1FWK A;  3Q1Q A;  4MYT A;  5A2Q C;  2CG9 A;  2Z5C A;  1EI1 A;  1E3H A;  2E1R A;  4LF8 E;  2VQE E;  3ZZU A;  1I94 E;  1B62 A;  4AM3 A;  1HNZ E;  5IT9 C;  3ZZ0 A;  4IZJ A;  3B78 A;  3PS2 A;  4OKG A;  4LF8 I;  2VQE I;  5C0X F;  2J7K A;  1I94 I;  3LPS A;  3J80 C;  4OO1 D;  2XEX A;  5LMU I;  5GMD A;  2HHH E;  2O1V A;  2IOP A;  1R6M A;  3PYE A;  1HNZ I;  4AIM A;  3M85 G;  5ELW A;  1RHY A;  2CGE A;  2ZM6 E;  4FW9 A;  3HJC A;  3PS3 A;  1FKA E;  1IBM E;  3ZKD A;  5EL9 A;  5K36 F;  2PNL A;  2BA1 D;  2HHH I;  1S4E A;  5C0X B;  1DAR A;  2BA0 G;  2Z5B B;  2O1U A;  2UUC E;  2ZM6 I;  4M1K A;  4K0K E;  3ZM7 A;  1IBM I;  3P3C A;  3GCM A;  3ZZT A;  1MG7 A;  1OYR A;  2UUC I;  1Y6Z A;  5JEA D;  5K36 B;  5BR8 E;  2AE8 A;  4K0K I;  1NHH A;  3P3G A;  1XNR E;  1XXE A;  1PVG A;  2BM0 A;  3GME A;  5C0X E;  2HK2 A;  1N32 E;  5C0X A;  4I3H A;  3J7A G;  4DUY E;  2Z5B A;  2PNM A;  4MU1 A;  5BR8 I;  1KIJ A;  3CDJ A;  1USU A;  4FW3 A;  3T1Y E;  2NN6 C;  2F1D A;  3L7Z B;  1FNM A;  2PO0 B;  4DV1 E;  1N32 I;  1N0U A;  2X36 A;  4DUY I;  4DV6 E;  5LMN E;  2E5L E;  5K36 E;  5K36 A;  2BV3 A;  1U2R A;  4DR5 E;  3T1Y I;  2PO2 B;  2VF3 A;  2R3V A;  5EKW A;  4JI3 E;  4JV5 E;  4PRV A;  1H72 C;  1Y5Y A;  5DRP A;  4DV1 I;  4X65 E;  2JEB B;  4DV6 I;  2NN6 D;  5LMN I;  2E5L I;  4FW7 A;  2GO3 A;  4DR5 I;  1FJG E;  4JI3 I;  4JV5 I;  5FWK A;  1ZXM A;  4FN5 A;  1XMO E;  2PO0 A;  3NZK A;  4U3D A;  4X65 I;  4JG4 A;  1XNQ E;  4NXM E;  1H7S A;  1Z59 A;  2JT2 A;  1FJG I;  2PO2 A;  1KTV A;  3QT8 A;  3B4T A;  2V2V A;  4URL A;  1XMO I;  4JI4 E;  1Y4S A;  2NN6 F;  2LJP A;  3LTO A;  2JEB A;  4FW4 A;  4NXM I;  1XNQ I;  4X62 E;  4USK A;  4Z7Y A;  1HNX E;  3LNU A;  3T1H E;  2IER A;  4JI4 I;  5L3J A;  4DR7 E;  2BA1 G;  3QT5 A;  1OJ4 A;  2WW4 A;  4X62 I;  3HUL A;  1BKN A;  4AQY E;  5C0X D;  5FLX Q;  2NN6 B;  1HNX I;  3T1H I;  2IOQ A;  4JI7 E;  4DR7 I;  3H4L A;  1ZM9 A;  2O3Z A;  4LFC E;  2F4V E;  4AQY I;  4GQU A;  2CVE A;  4AID A;  4JI7 I;  5K36 D;  5LMU E;  4LFB E;  1KVK A;  1D6T A;  1OYS A;  4IZK B;  4LFC I;  4X66 E;  4HAC B;  2IES A;  4FWG A;  2Q2E B;  2WNR B;  2F4V I;  1NHJ A;  3CDI A;  2EFG A;  3K85 A;  1IBL E;  2NN6 E;  4HYM A;  3QT7 A;  2NN6 A;  4DR4 E;  2BR2 B;  4B3S E;  4GKK E;  2HFU A;  4LFB I;  3M6A A;  4DPY A;  4X66 I;  1N36 E;  4EMD A;  2A2D A;  1IBL I;  3B8H A;  3WU5 A;  1Z0B A;  1MU5 A;  4DR4 I;  4B3S I;  4LF5 E;  4GKK I;  1A6F A;  4MU4 A;  1N33 I;  1Z0T A;  1N36 I;  4OX9 E;  1Y4U A;  4IZK A;  4J3D A;  4HAC A;  1FI4 A;  2WNR A;  4RPF A;  4JI8 E;  3V2U C;  4IFD C;  4USM A;  1J5E E;  4MU0 A;  1EA6 A;  4LF5 I;  2BR2 A;  3PS1 A;  4YHH E;  1IBK E;  4LFA E;  1Z5B A;  1UDQ A;  4OX9 I;  4JI8 I;  4LF7 E;  3Q6N A;  1J5E I;  4UTG A;  3D4J A;  1Z5C A;  4YHH I;  1Z0W A;  1FWL A;  2HFS A;  1IBK I;  4LFA I;  4NBQ A;  1YHC A;  4LF9 E;  4HY1 A;  4LF7 I;  4QNK A;  1NHI A;  1PKP A;  1R6L A;  1UEK A;  5A2Q Q;  4WUC A;  4LF9 I;  3QT6 A;  1OYP A;  4DPU A;  1KKH A;  5FLX C;  1Z5A A;  2JE6 B;  2J65 A;  3ZKB A;  2PNZ B;  3J7A M;  4IFD F;  2DEJ A;  2C39 B;  1RRE A;  3PRY A;  1PIE A;  4FWD A;  3Q6M A;  4DV0 E;  4DR6 E;  3WU3 A;  3M85 D;  2O1T A;  4DV5 E;  4DPX A;  1VIS A;  1K47 A;  2PO1 B;  1XHK A;  4IFD B;  1B63 A;  1H74 A;  4DV0 I;  3HKM A;  4DR6 I;  4DR2 E;  2UUA I;  1ELO A;  2JE6 A;  4DV3 E;  2PNZ A;  1P42 A;  4FW5 A;  1N34 E;  4DV5 I;  3PYF A;  3JAM Q;  2GS8 A;  2C39 A;  4MDT A;  2V34 A;  2DEI A;  4MYU A;  2UUB E;  4DR2 I;  4UT4 A;  4DU8 A;  4DV3 I;  4B3R E;  5IWA E;  1N34 I;  4MU3 A;  2VES A;  1YH8 A;  2UUB I;  2HKJ A;  2PO1 A;  3M7N D;  4IFD E;  4IFD A;  4HXZ A;  2GO4 A; 
#chains in the Genus database with same CATH homology
 4B3R I;  1Z0E A;  3PYD A;  5IWA I;  1QZR A;  4JI5 E;  5LL6 R;  1Z0V A;  4JI1 E;  3K17 A;  4LF4 E;  4JI5 I;  2O1W A;  4JI0 E;  1RR9 A;  4JI1 I;  2X7I A;  2OI2 A;  4DPT A;  1H7U A;  1N33 E;  4LF4 I;  4JI0 I;  1MX0 A;  3F0N A;  2CZ9 A;  4DXL A;  4PRX A;  2UU9 E;  4P52 A;  4WUD A;  2R42 A;  2V2Z A;  3B82 A;  4JI2 E;  1H73 A;  4DV2 E;  2UXB E;  4X64 E;  4DR1 E;  2UU9 I;  4DR3 E;  1USV A;  2Z5E A;  1ZM4 A;  4LF6 E;  4JI2 I;  3GON A;  4P7A A;  4DV2 I;  2UXB I;  4X64 I;  3J81 Q;  4DR1 I;  4DR3 I;  4R1F A;  4NXN E;  3PYG A;  4LF6 I;  4DPW A;  3JAM C;  1N0V C;  2HK3 A;  4NXN I;  2AJ4 A;  2HKE A;  4JI6 E;  3WU4 A;  2V8P A;  1NZ0 A;  4DV7 E;  3WU6 A;  1WUU A;  3K1J A;  4N3O A;  4YY3 E;  3V5R A;  2V2Q A;  5IT9 Q;  4JI6 I;  4WUB A;  4DV7 I;  1XNR I;  4GKJ E;  3J80 Q;  4ED4 A;  2UUA E;  4YY3 I;  4PU9 A;  4DU7 A;  4ZVI A;  1ZXN A;  4KQV A;  4B3M E;  4DV4 E;  2BM1 A;  4GKJ I;  4IZJ D;  3OTO E;  4DUZ E;  2UXC E;  5GME A;  4FWH A;  1XMQ E;  3P06 A;  2ZBK B;  2GQ0 A;  2NPF A;  1HR0 E;  4B3M I;  4DV4 I;  1HK7 A;  2UXD E;  1ZM3 A;  3OTO I;  4B3T E;  2A2C A;  4DUZ I;  4XTJ A;  2UXC I;  1XMQ I;  2ZIT A;  1HR0 I;  3CWV A;  2UXD I;  1Z0G A;  1ZM2 A;  4B3T I;  4JYA E;  2VQF E;  1S16 A;  2Z5C B;  4Z7C A;  4KHP E;  1HNW E;  3J81 C;  4JYA I;  2VQF I;  4IZJ B;  1HNW I;  4KHP I;  1Z0C A;  1FWK A;  3Q1Q A;  4MYT A;  5A2Q C;  2CG9 A;  2Z5C A;  1EI1 A;  2E1R A;  4LF8 E;  2VQE E;  3ZZU A;  1I94 E;  1B62 A;  1HNZ E;  5IT9 C;  3ZZ0 A;  4IZJ A;  3B78 A;  4LF8 I;  2VQE I;  2J7K A;  1I94 I;  3LPS A;  3J80 C;  2XEX A;  5LMU I;  5GMD A;  2HHH E;  2O1V A;  2IOP A;  1HNZ I;  3PYE A;  2CGE A;  2ZM6 E;  4FW9 A;  3HJC A;  1FKA E;  1IBM E;  3ZKD A;  2PNL A;  2HHH I;  1S4E A;  1DAR A;  2Z5B B;  2O1U A;  2UUC E;  2ZM6 I;  4M1K A;  4K0K E;  3ZM7 A;  1IBM I;  3ZZT A;  1MG7 A;  2UUC I;  1Y6Z A;  5BR8 E;  4K0K I;  1NHH A;  1XNR E;  1PVG A;  2BM0 A;  2HK2 A;  1N32 E;  4I3H A;  3J7A G;  4DUY E;  2Z5B A;  2PNM A;  5BR8 I;  1KIJ A;  1USU A;  3T1Y E;  1FNM A;  4DV1 E;  1N32 I;  1N0U A;  2X36 A;  4DUY I;  4DV6 E;  5LMN E;  2E5L E;  2BV3 A;  1U2R A;  4DR5 E;  3T1Y I;  2VF3 A;  2R3V A;  4JI3 E;  4JV5 E;  4PRV A;  1H72 C;  4DV1 I;  4X65 E;  4DV6 I;  5LMN I;  2E5L I;  4DR5 I;  1FJG E;  4JI3 I;  4JV5 I;  5FWK A;  1ZXM A;  4FN5 A;  1XMO E;  4X65 I;  4JG4 A;  1XNQ E;  4NXM E;  1H7S A;  1Z59 A;  1FJG I;  1KTV A;  3QT8 A;  2V2V A;  4URL A;  1XMO I;  4JI4 E;  1Y4S A;  2LJP A;  3LTO A;  1XNQ I;  4NXM I;  4X62 E;  4USK A;  4Z7Y A;  1HNX E;  3LNU A;  3T1H E;  4JI4 I;  5L3J A;  4DR7 E;  3QT5 A;  1OJ4 A;  2WW4 A;  4X62 I;  3HUL A;  1BKN A;  4AQY E;  5FLX Q;  1HNX I;  3T1H I;  2IOQ A;  4JI7 E;  4DR7 I;  3H4L A;  1ZM9 A;  4LFC E;  2F4V E;  4AQY I;  4JI7 I;  5LMU E;  4LFB E;  1KVK A;  1D6T A;  4LFC I;  4IZK B;  4X66 E;  4HAC B;  4FWG A;  2Q2E B;  2F4V I;  1NHJ A;  3K85 A;  2EFG A;  1IBL E;  4HYM A;  3QT7 A;  4DR4 E;  4B3S E;  4GKK E;  2HFU A;  4LFB I;  4DPY A;  3M6A A;  4X66 I;  1N36 E;  4EMD A;  2A2D A;  1IBL I;  3B8H A;  3WU5 A;  1Z0B A;  1MU5 A;  4DR4 I;  4B3S I;  4LF5 E;  4GKK I;  1A6F A;  1N33 I;  1Z0T A;  1N36 I;  4OX9 E;  1Y4U A;  4IZK A;  4HAC A;  1FI4 A;  4RPF A;  4JI8 E;  3V2U C;  4USM A;  1J5E E;  1EA6 A;  4LF5 I;  4YHH E;  1IBK E;  4LFA E;  1Z5B A;  4OX9 I;  4JI8 I;  4LF7 E;  3Q6N A;  1J5E I;  4UTG A;  3D4J A;  1Z5C A;  4YHH I;  1Z0W A;  1FWL A;  2HFS A;  1IBK I;  4LFA I;  4LF9 E;  4HY1 A;  4LF7 I;  1NHI A;  1PKP A;  1UEK A;  5A2Q Q;  4WUC A;  4LF9 I;  3QT6 A;  4DPU A;  1KKH A;  5FLX C;  1Z5A A;  3ZKB A;  3J7A M;  2DEJ A;  1RRE A;  3PRY A;  1PIE A;  4FWD A;  3Q6M A;  4DV0 E;  4DR6 E;  3WU3 A;  2O1T A;  4DV5 E;  4DPX A;  1VIS A;  1K47 A;  1XHK A;  1B63 A;  1H74 A;  4DV0 I;  4DR6 I;  4DR2 E;  2UUA I;  1ELO A;  4DV3 E;  1N34 E;  4DV5 I;  3PYF A;  3JAM Q;  2GS8 A;  2V34 A;  2DEI A;  4MYU A;  2UUB E;  4DR2 I;  4UT4 A;  4DU8 A;  4DV3 I;  4B3R E;  5IWA E;  1N34 I;  2UUB I;  2HKJ A;  4HXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...