4JI3J

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 11
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4ji3J00
4LFBJ 1I94J 5IT9U 2MQ8A 3J80U 4JI8J 4DUYJ 1N33J 2E5LJ 3W1YC 2KVQE 4LF9J 4DUZJ 4HHUA 2ZM6J 5BR8J 4DV2J 4LF8J 2UUCJ 2HHHJ 3R2DJ 4DR2J 4YHHJ 4X64J 2UXBJ 4KY3A 4JI3J 3D3CJ 4LF4J 4NEZA 5LM7E 2F4VJ 1XNQJ 3IMQJ 3T1YJ 2MTLA 4B3SJ 2KL8A 4JI1J 4LF7J 4X62J 2UUAJ 2VQEJ 4DV7J 2MEWA 3J81U 4RJVA 1XMOJ 1N32J 1N34J 4K0KJ 4LFAJ 4JI2J 4LF5J 4B3TJ 4DV3J 4DR6J 4JI5J 2UU9J 1J5EJ 4GKJJ 1IBKJ 3D3BJ 4OX9J 4DV0J 2UXDJ 4PWWA 4DV1J 3OTOJ 4LFCJ 1FJGJ 2UXCJ 4B3MJ 4DV4J 4NXMJ 5LMUJ 2UUBJ 1HNWJ 1XMQJ 4JI7J 5LMNJ 1IBMJ 5FLXU 4LF6J 4JI6J 4DR3J 1HNXJ 4X65J 4JYAJ 4DV5J 4JV5J 5A2QU 4DR5J 4DR1J 4V1Ak 1HNZJ 3J7AN 1XNRJ 3JAMU 4JI4J 1N36J 4JI0J 3T1HJ 4GKKJ 4DR7J 4X66J 4AQYJ 4NEYA 4B3RJ 4DR4J 1HR0J 4KHPJ 5AJ3J 4DV6J 4YY3J 2VQFJ 1IBLJ 5IWAJ 3R2CJ 4KYZA 4NXNJ
chains in the Genus database with same CATH superfamily
1ZPVA 3MAAA 1XEZA 5T7LB 4A48A 1UFWA 1X4EA 2YWHA 4HLBA 1F3FA 1MN9A 1UVLA 2EK1A 7FD1A 3QPIA 3G71S 2IMWP 1R8BA 5B0GA 2AYBA 4LR8A 5H9EJ 2H5EA 2FY1A 1X4FA 4KH0B 3W64A 2CXEA 2MQQA 2FTRA 1UWAA 2A2CA 3LW5C 4C0HA 2DR6A 3KJNB 1YRTA 4A47A 2CFXA 1S1VA 4ANCA 4O4GA 2L9NA 3BYRA 1VQ5S 2RQMA 1OS5A 3MECA 4KPCA 4QWCA 2A6OA 1PYSB 1QTMA 1UJ5A 3AFGA 4EUVA 3T5HA 3S1TA 2JLFA 3SBMA 5IWAF 3GP9A 3OT9A 2JX2A 4FN5A 2VIHA 4ECXA 5F3ZA 2IYIA 1YK9A 2PC6A 3DC2A 2QRRA 1FFWB 4NZ0A 4OV6A 4DI6A 4J9QA 4DL4A 1XNQF 1FRHA 3P3DA 1RT3A 1FXLA 3BSOA 5A8WA 4IFVA 4TU7A 3ENQA 1AFJA 2CJXB 1HNWF 5IC6B 1UW4A 3P49B 2AJ4A 4GVBB 5KFYA 4ECYA 3QBCA 2DH8A 2ZH2A 3MECB 2VU5A 2HRTA 2ASJA 2IBKA 2VH7A 3HMJG 4LFAJ 4OX6A 4DHVA 4AL6A 2ZZMA 3GR1A 4MKYA 1P8GA 2XBPA 3KHRA 1BQMB 4YMEA 2L9WA 5D4OA 4B3TJ 2QG9B 3I0RA 1VBZA 2FC9A 2VA2A 3BGRA 3FC9A 2FHJA 1FWPA 4WK1A 5GAGI 1SUQB 4WJBA 4ZP6A 2LEAA 3KK1B 4ZIWA 4URSA 4ZPBA 1S6QA 3BJYA 1ICEB 1T11A 1VQ6S 1HBOA 1SC3B 1TL1B 4QYRA 3BR9A 2EVZA 3K59A 3KLGA 3NNHA 2XMWA 2M3DA 4UUWA 1FRXA 2WRMA 2D3UA 5MAOA 2VODA 4KHMA 3UFCX 4OQJA 5J2NB 3BQ1A 4B3MJ 4TYBA 1OPZA 4CO1A 3X1LB 3SIPB 3EJMA 1Y4ZB 1E6VB 2BKOA 2OLWA 4L76A 3AD7C 1AZSB 2YNHB 2OGUA 1GT8A 2ZHAA 4IUFA 2VBYA 2Y1RI 2VDHA 4UQGA 4WK3A 3HHDA 4RKUC 5F0UA 5J1EB 2FJDB 2V9KA 3CEDA 4DCJB 1N48A 2PA8D 4Z7YA 1VI7A 4H4MA 2NYHA 2V67A 5DZ6A 1VOMA 1HKAA 4DN9A 3PZPA 2XI2A 4JV5J 3DRSB 3H2UB 4USIA 4CLSA 4DX7A 2CPDA 3Q8SB 1HHQA 1N33F 1T94A 3PYGA 2J7UA 2I1RA 2LYVA 2E5JA 1IKVB 3M8QB 4LSLB 4RLEA 3TRGA 5GMKa 3RRGA 4LF4F 1VQOS 1PCAA 3D68A 3EUNA 5CXTA 1RTZA 1N5YA 3EGZA 3TW0A 2KXFA 1CJUA 2V34A 2BKPA 2QL5B 3CD7A 3N4WA 2X7IA 5BYQA 2UV8G 3TUJC 4ATNA 4B17A 3HFVA 4QPTA 3DNCA 5HK4A 3BDPA 2Y1LB 1VQNS 4H4MB 2NREA 3TUIC 3E8OA 3ZTOA 2VKZG 1KVKA 3LGMA 4M5NA 2K3IA 2LEBA 1GMWD 2C28A 3M6WA 1NJWA 4CT9A 4Q43A 4DR4J 1ZA2B 1UTAA 4I2QA 1AUSL 2KFNA 1HBNA 3ADAC 1F9EB 3MEEB 4DL0C 3UN3A 2R7RA 2LQ5A 4JB8B 3ETOA 3CCRS 2DD8S 1GFWB 1SB6A 3FRZA 3TOQA 1HWJA 6FD1A 4EBCA 2UVVA 1VQPS 3PG9A 2DCUB 4NPOA 3L9ZA 3LPEA 4NCAA 2DGQA 3BS9A 4FPRA 5HL7Q 1VCTA 4F36A 4WU2A 1TL3B 3HULA 3BSNA 2Q43A 3CC7S 1S4FA 4LBPA 2ZUAA 2QLJB 1RTHA 3EVWA 4LF7F 4DDFA 2JJ4D 3IAM9 2UVWA 1FDNA 3G82B 4DPOA 1WG5A 2ZNYA 2L08A 3EICA 4DQRA 1FJEB 1FVQA 5THWA 2R8GA 2R9LA 4QU6A 1NPPA 3M2VA 4C8ZA 3A12A 2BV3A 3NAHA 4IRDA 3KHHA 1NDCA 3JQKA 3QGHA 1WTBA 3W2WA 4FYYB 3JTNA 2F9JA 2COLA 4WE1B 2GA7A 2YH0A 3OR1A 5C2GA 2W9BA 5IC4B 2HVEA 4JI2F 4EYIB 3QRQA 1RWUA 4DV1F 3FRYA 1EQ0A 5KT5A 3C14B 4DS5A 4NL5A 1GTEA 2D7SA 3ENWA 3DLJA 2WONB 2NR0A 1H0HB 4D3GA 3R6LB 4NX9A 3MD3A 5GADI 3MXHP 1S99A 2MTLA 3K8VA 2KL8A 2KRRA 2YX1A 4DQSA 2OUGA 1HARA 1KOHA 2KJWA 3C8YA 4IH6A 3SFUA 3AD9C 3GV7B 9ATCB 2Z57B 1RKIA 2R3VA 1IKXA 3H5SA 2BUNA 2IDEA 4P72A 3HF5A 4TN2A 4ZVPB 5HANA 5M2UA 1Q4RA 1TKZB 2HFVA 2MYFA 2N4DA 3BGFA 4FDFA 1FJCA 1EIYB 1FDDA 1UL3A 1R6VA 3C6TB 3NGUA 4PG4A 5HMWA 3AOCA 4BS2A 3RBXA 5CYJA 1S4EA 1T9XA 3P5BP 4OZ0A 4WIIA 3H90A 1YBAA 1RXOB 2VOOA 2YXLA 2Y9HA 2GO9A 3A3OB 4DV3J 2HRUA 1WSRA 4JI5J 2R7SA 3OTBA 2B9XA 4DL3A 2CYYA 2WVFA 2PSZA 5EHHA 2ATLA 4RW6A 4YS2A 2YWEA 3ZZUA 4D3HA 3CDAA 3UD4P 1ACMB 3PW0A 3QWPA 5D0HA 2JLGA 3RB0A 3KLIB 4DPTA 2J8SA 2ZWPA 4FKXA 5KFIA 3W3SA 3PW2A 3DRPB 1KFDA 2WOMA 4OHXA 1XC9A 4NXNF 1CVJA 3MTKA 2W2QP 3O44A 5LMUJ 4NXMJ 2FLLA 4F2SA 1HNWJ 4PQUA 4WKRA 3PJWA 1U1LA 1D0EA 5LMNJ 2V8DA 2W7OA 5EN1A 2P2CB 1U6FA 2OKQA 1KVJA 1RT6B 4QZVB 1U26A 2MQPA 3POTB 2MZRA 5E41A 1NK0A 1UVNA 2AYGA 4RL1A 1YG0A 1BQNB 4K4TA 4IH7A 2BX6A 3PO4A 2GHPA 4M5DA 3HFKA 1DQ9A 2JDJA 4XDDA 1WNEA 2NSBA 4FPIA 5E33A 5HJYA 1N56A 1K0TA 3LF0A 3FMBA 4OYPA 1GK8A 2NZCA 2IMOA 4O4RA 3OTOF 1Q86T 2GQCA 2GHVC 2E5GA 2N3LA 4CM2A 3G6XA 4B3MF 5CHCB 1TR0A 2JOQA 1LWEA 4YN3B 1T9VA 3TAQA 3M32B 2XM3A 4JI0J 2W2PP 2YKQA 4HH1A 3CJKB 3NLCA 1JJCB 1W25A 1PC4A 4QU7A 2SXLA 2ZDOA 3D4JA 4OYMA 1RKJA 2CQ1A 1TZ0A 2GHWA 2U2FA 3GJTB 4DQQA 1S6QB 3IBCB 4DSEA 2W7AA 2EFQA 2VF3A 2XWXA 3PFEA 4OYBA 2DNYA 5ETKA 1I6JA 4IRKA 4QIWD 1TFWA 3RYLA 4AE5A 3MOZA 2WZ1A 4MK7A 2ZH5A 1SV5A 3TJAA 1UA0A 4A46A 2KYZA 4K4XA 2AQ4A 3HJVA 2HQFA 1JNRB 4Y28C 1TL5A 2DNPA 3N79A 3JYTA 4A4JA 5HN0A 4PYAA 2VFVA 4FXWA 3GE9A 1FKAF 2JVOA 4B3OA 2DGOA 4KGVB 3VQTA 3PR5B 2HHTA 5HMXA 2JC0A 4HHUA 1RQ0A 4WF9Q 4N8NA 4F4ZA 3TEHB 3S01A 1XK8A 5KFSA 2G9OA 2HMIA 3O2IA 3D0HE 2DGWA 1P6TA 2IM3A 4ITSA 4YR2A 2DITA 1L3TA 4PCQA 4LF6F 3R2DJ 1B0PA 2BEFA 1YX2A 3TO8A 4KPYA 1LW0A 2NS1B 3MUVP 4CLTA 2HHVA 4ED8A 3FEZA 2GV1A 3OD2A 5L46A 4ECVA 4LSNA 3OL6A 2LQJA 3JSMB 3GIIA 2H9ZA 2EBEA 5KFVA 4NLTA 4FZVA 3T1YJ 4E0DA 2ZD1B 3AD8C 4N8OA 4ZVRB 1NK6A 4JV2A 2XLKA 3C3LA 5KG1A 2B9YA 3V4IA 4I56A 4DV7F 5A8WB 5IZHA 2VOPA 3UCZP 4K4UA 2FHOB 4DZ6A 3GIMA 5KFLA 2W9CB 4LBIA 2RE1A 1S0OA 2BW2A 2C3MA 2LQ8A 4BHQA 1RK8A 4DR7J 1LW0B 4PR6A 4FF1A 2V50A 1VQ4S 2J5AA 4PG5A 3KXDA 1RSCA 5DG8A 4U8VA 5DQIA 4LSNB 5AE1A 1T05A 5B0BA 5HSPA 2CWXA 2X3DA 2CPEA 3SDEA 3GIKA 4JI2J 3MEDB 2VJUA 2XMVA 1RDRA 2Z58B 2IRXA 4ID5B 5F8GA 1RAEB 1MN7A 3HI9A 5ETQA 1FRLA 1UETA 3AOBA 3D67A 4C3LA 4YUDA 3VAHA 2UU9J 4G3IA 1YJWS 5HROB 5KFUA 2FVCA 2V0NA 1OMSA 5I3UB 5LJ5Y 2P9CA 4X65F 2UXBF 5LXRA 1LWFA 2CIMA 3IWLA 4KO0B 4CM0A 2WK4A 2X1GA 2JEJA 3TZWA 5IFMA 2BANB 2GQQA 3L09A 2O67A 3RTVA 4V19J 1I3OB 1WDDA 2F4VF 1Y7PA 2J8AA 4KJIA 2NCKL 1SL0A 1KVIA 1PJ5A 4V19X 2IM1A 1DURA 1GXLA 3DOKA 3EM1A 2GQ2A 4RW4B 2WSCC 4I6YA 1ZH5A 1K0VA 2KVIA 3TWZA 1KKHA 2RUGA 1M0SA 2B3TB 2WW8A 3CGIA 4QR2A 3GV5B 3NBPB 4DF4A 3MM8B 3CWJA 3R6GB 1UPPA 2AEMA 3FSXA 4P2FA 2VA3A 3L95X 2VD3A 3PACA 3CCUS 1CQMA 4M5JA 3D0GE 3KMQA 5H1SV 1RHJB 2OP5A 3BSCA 4OZNA 5B7WA 1Q7LB 2E5HA 1IJFB 1PAUB 3I82A 1CS4A 1RT4A 3O5TB 2EKYA 2VC0A 3BN7A 2LXFA 4XPCA 4LF9F 2G4BA 3PM9A 3W5ZA 2IAJA 2G2ZA 4KRWA 1R8PA 5IV4A 2GMHA 2VB6A 4ZKAA 5EWGA 2ZWOA 1U09A 2OSRA 3EVOA 4PWDB 2FUG9 2CQ3A 2MZSA 1GH8A 2HNDB 2VICA 2B4VA 4JI4J 1FWKA 1RAIB 3CC2S 3K17A 1YBUA 2WB4A 3EGWB 3FDSA 1F9HA 1B99A 4J9MA 3KYLA 2J6UA 2MPUA 1C0UB 2AF6A 4XK8C 4IOAQ 4RPFA 4NLRA 2VQFJ 2P9GA 2VPXB 3HO1A 3WX4A 2NXUA 4ANEA 1YJNS 5KG2A 1TAQA 3H4DA 1NHVA 4CLLA 1HBUB 2LXUA 3K0JA 2RNEA 2HS4A 3CJ8A 4TNOA 4NLXA 4ZJLA 4ES3A 2BE2A 4CLFA 3ELHA 4K4VA 3IR6B 3QRPA 2K06A 4IG0B 3A4TA 2GIRA 4DFKA 2ZFHA 1FRIA 3QT8A 3K2YA 1JMTA 3A3PB 3PIOQ 2GO8A 2DR9A 1H2TZ 1HPZA 2O1PA 5C25B 2V68A 3PX0A 4NCGB 5J2MB 3CJ0A 3Q89A 1CJTB 1OSDA 4WWSA 2R8JA 3K5LA 4ILLA 2OPPA 1HQEA 3MMAB 1S9EB 4I6AA 3IBFB 4KGXB 4YR3A 2QGFB 3OVSA 2FVSA 1HD0A 2D74B 4CLWA 4NEZA 1RTIA 4DS4A 4ER8A 2J0QD 2F4VJ 1HYSA 1RT1A 1FRJA 2KHCA 4LF1A 4CH1A 3D2WA 3NWGA 2AGPA 3CMES 4B3SJ 4Y65A 2Y3YA 3OSNA 4X2BA 4J9OA 1TAUA 3DLLQ 2ZH6A 3GFZA 4P2MA 3BQ2A 2JNJA 1OSCA 4LREA 1CSJA 2AGOA 3O1LA 2FJAB 4WXOA 3UD3P 2HNZB 1PIEA 1IM4A 1ZM9A 2WB1D 3FQKA 3LP0B 4ECSA 2B8PA 4NA1A 4OHYA 3IBWA 1TP7A 3J81U 5L1KA 3H25A 4QWEA 4DCOB 2W8KA 5KG3A 1Q5YA 2MLXA 4DXLA 1VFJA 3GQCA 1WTFA 3UPFA 3KLHA 2GMJA 2KU7A 1I94F 2HAFA 1JWWA 4OJ1A 4PZVA 5JUMA 5CA5A 2MJUA 3HZEA 4P2SA 5GAHI 4OZ5A 2EFNA 3CF5Q 1KTQA 1WORA 2YKMB 3R5AA 3TR5A 3M6VA 2DXDA 3V81B 4UZCA 3VWSA 4HYKA 3P6YC 4LFCJ 2OD4A 4L3KA 2F8MA 2J7KA 2I9SA 3FCVA 4ZJQA 4F0MA 1S72S 1N54B 3UNYA 1NSAA 3EZUA 4ZCKA 1FNMA 2WVBA 1RYSA 1ZS6A 5B0EA 3MUTP 3TAMB 4YP3A 1NK4A 1IBMJ 5F8LA 1LNQA 3LWLA 4LF5J 2EWHA 3WDOA 1O0PA 2G1HA 1FRKA 4K5RA 3VAFA 3ULHA 5D6GA 2XO6A 3ENAA 3OL8A 1DRZA 3R5JB 1O51A 5A2QU 3KOAA 3V4IB 1IQTA 2QMUB 1CG2A 1JJHA 4AFFA 4ICLA 4AD6A 2QZ8A 3H5XA 1MWZA 2RHQB 3NEKA 1Q7YT 1Q78A 2E1RA 3M8RA 1YJ9S 1T3NA 3M8YA 4DLEA 3QATA 3IA0A 3IRXB 3QMQA 5AXMA 2QSFA 4Y3CA 4WFNQ 3GYXB 5FLXY 3G6YA 2DR8A 3RB3A 3RR8A 4WPAA 4ID5A 4EEYA 1H3DA 3TUPA 4ED4A 2IBOA 3OHAA 5J1EA 5GAHU 2FJEB 3DXBA 4LIWA 3VAJA 3C19A 2OTLS 1N88A 5HROA 3N28A 2QA2A 2QL9B 1NSPA 2AU0A 3NNAA 4URQU 2DT9A 3W63A 3MEKA 2GAHC 4F2RA 2E29A 3IM9A 4QIEA 4IDKA 2MKCA 2DNKA 3DU6A 1SJ4P 1IBLJ 3PR4A 4PKDB 3IRXA 3HM9A 1XMBA 4G1IA 4R25A 4USUA 2RB7A 3UD5A 1RI7A 1TL4A 2C2NA 2VHGA 1T03A 3V2UC 3J7A1 2XHCA 3KJFB 1XQIA 3O6QA 4TYAA 2KI2A 2WBMA 4ZP7A 2BDPA 2EFVA 3NGKA 2HWHA 1I94J 4DV0F 1WG4A 4B3OB 2DHAA 2FHKA 3I96A 2KFYA 5HBMB 2HK3A 1N33J 1JB0C 1SJ1A 2ACYA 4F4XA 2E5LJ 1TKDA 1A9NB 2OPQB 1FX4A 1HBNB 5F3TA 3UN5A 4B3TF 3LGHA 1T9WA 2HNYA 1U49A 3PO5A 3R5DA 3D0IE 4BCAA 4K5SA 1HNIB 1S0MA 4ENOA 3UDCA 2XSFA 5E3RA 3CCWA 5JJBA 1DY3A 1F3VA 3EDRB 3ONQA 3MZIA 5KT7A 3BO3A 3DLEA 2HHPA 4F7VA 1B70B 4J9KA 1VQKS 2DIUA 1IKWA 3CDBA 5F0WA 1VBXA 2B9EA 2V2ZA 1K9MT 5EWFA 1DJ0A 3WC2A 1IR1A 3MPYA 4PRFA 2VZ9A 1S6UA 1WEXA 4QCLA 3RJMB 5LOQA 2M70A 1L3UA 4ZPWR 5H9FK 2J9EA 4MH8A 2E66A 3W2WB 2PEHA 3VZHA 4RUCA 1RWWB 5E2QA 5BXIA 3OR1B 2ZEJA 3T1HF 1T9YA 2DNGA 2FB0A 5G0RA 4FYVB 4NMLA 3Q8PB 1CJKB 3D6FB 4XAKA 4OI4A 2D3OR 1NK9A 1URRA 1VGYA 2BJDA 3FMWA 5K20B 2DGSA 1NZAA 4DR6J 3PRVA 2OFHX 3TP2A 3HPOA 2X51A 1JLCA 3QFWA 3B6BA 2F3JA 4HR2A 4IG0A 4NZ6A 2R7VA 5C2CA 4HHHA 2BQ3A 1AA1B 1MWYA 4JUZA 5F9LA 1S7IA 2IHR1 2MJNA 3NXZA 4EWTA 3RBEA 2E5IA 5DM7Q 1FJGJ 1BC6A 1CULA 1VK3A 4OYWA 1IBMF 1TK0A 5AE3A 3K58A 2R8KA 2OPPB 2NSCA 3MMAA 4I68A 2QEXS 4X84A 2CNOB 2C3OA 1WUUA 3BGLA 3FVYA 1TK5A 2P8IA 1FF2A 1YI2S 2KT5A 4OJHA 1GNKA 4M63A 3ZTPA 3V5RA 1SJFA 2MHNA 2V8GA 3I0SA 5C5JA 1UW9A 1U1MA 2YNFA 4WFAQ 3PW5A 1HI1A 4C8OA 3NCPA 1YLXA 4LFAF 3KJVA 3SV3A 4B9NA 2QMXA 2IC3B 3CJ2A 4KV8A 3KK3B 2Y8YA 1K47A 4ZDNA 5CD4H 3N6NA 2GNKA 2KRBA 2NUUG 2E1PA 2FZGB 1NK5A 3KUEA 1OIAA 4IG3A 3DLKA 1NO8A 3Q8UA 3U1NA 1E6YB 4LRCA 4AXJA 1D3WA 4I4BA 3CMAS 4CO3A 5F9NA 1R0AA 2CJBA 3PNIA 2YKOA 4PQUB 1AT1B 4LRAA 2Z56B 4OI1A 2H4YB 3VGTA 2YNFB 2GCFA 4C8NA 4Q45A 1ZPWX 1FHTA 1BWEA 1WC6A 2MQOA 1MLAA 3N5BA 4WP8A 3ZZZA 3RB4A 1TKTA 1UVJA 4B3RJ 4WFYA 1V3RA 4K59A 4ZPTR 4DR3F 5CYQA 1RWPB 2CQ0A 3LANA 4DEZA 1GX6A 4K8RA 2HVIA 3ILJA 5CABA 4DL6A 4WP3A 3NP5A 1REGX 1PAEX 5CH7B 4UOHA 1NCLA 2CRLA 4O4GB 4OFZA 1IWGA 4JV0A 1YDLA 4USMA 4UZBA 3Q0AA 3KHLA 3W7BA 4O3PA 3L7OA 5LSLA 1WKJA 3H7HB 3N6LA 3MM7A 4OZ2A 2IRUA 3GMGA 3Q8VA 4K0KF 3ICLA 3K5PA 2DTJA 3OFGA 2IJNA 1HBMA 1JXEA 1SJRA 1FFSB 1WI6A 4EK2A 3OUYA 1QVGR 1GMUA 4U95A 3QAEA 2BVZA 4MFBA 1RAJA 2CPZA 3PIPQ 3PX4A 2BXJA 2BJ1A 1X0PA 2FJBB 1YGYA 1XTZA 2MKSA 3MTJA 5BR8J 4DV2J 5KT6A 2HS3A 3FSYA 5T41A 4ZHRA 1S12A 2FY8A 2YKPA 2CUYA 4BBYA 1KEKA 3W5XA 5GAEI 2KG1A 3UDLA 1OJ4A 1Y9OA 1N5QA 2B6AA 1YVFA 2BRKA 4G6VB 4J9UE 4EYHB 2AIRB 1FKOB 3NRBA 3TARA 4KY3A 4P7TA 2C22A 1Y5NB 2CDRB 3FEXB 1IM6A 4C0BA 4TLQA 5A76A 1XNRF 1GXTA 1RT1B 1FDAA 2QLFB 3FK4A 4YB5A 5LM7E 4Z2XA 1Y5IB 4KE5A 3EX7B 2AW0A 1XNQJ 1EJ7L 1R6YA 3BGRB 3NAIA 4OYZA 2CQHA 3W9IA 1QY7A 2ACMA 2ADCA 3HKZD 1MW7A 1U6ZA 3JTPA 4JI1J 2QYCA 2J76E 2RUSA 2Z0GA 4OX8A 3F41A 4DQPA 4TY8A 3M2UB 3KK2B 2G0IA 1SJQA 5DJBA 3QSIA 3HJFA 5KFKA 4DR1F 5GMEA 4X4QA 4DSIA 1R8CA 4ZJOA 5IQQA 3FQLA 5I3QA 5KFDA 1F60B 4ZVSB 2UVUA 3EE3A 1Z1ZA 1QVFR 2FVQA 3BDEA 4F3OA 3TUZC 2NPFA 1FERA 1KC8T 2G2OA 1N6QB 4E2FB 3CIMA 2VJVA 1WKLA 1HR0F 2B5JA 5D4LA 5KFWA 1T8EA 4DR5F 4NLGA 2JZ5A 1RT5A 1RBAA 1R8AA 3RBZA 3BO4A 1D8YA 1NKEA 1S76D 3QZ8A 1JLGB 1WF2A 5I4MA 1B7YB 3ET6A 3DCAA 4BLGA 4ED1A 1FD8A 4WCEQ 4CIOA 4CLZA 2WCXA 4U7UD 5ETPA 3BSAA 3IN5A 5M2RA 1CJUB 3VAGA 3ZZOA 5A8KB 4J9PA 4USJC 3UWTA 3TA2A 1NJYA 1WWHA 1RBLA 2VPWB 3TX0A 1X4CA 4P2XA 4RW7A 3M4XA 1G4CA 5DLGA 4U96A 5A6WA 1APSA 3BBCA 2ZC4A 1QJHA 1LWCB 3DRXA 3BH7B 3ILIA 2Z2YB 2BM1A 2N82B 2E9TA 2JEIA 3BKFA 1TFYA 3GYNA 3ET6B 1VQ9S 4YY3F 4BC9A 5I3UA 2HIQA 3W9HA 3PCOB 1WEYA 2E1MC 1YJUA 2G0JA 4YB6A 2V63A 5GMDA 3T9ZA 3HVAA 2X3GA 4F26A 3KFWX 2OFGX 2YBVA 4FYWB 4J37A 4MK8A 4PYDA 3TZYA 4CO5A 2OI2A 2JC1A 4L73A 3T19A 1NEEA 3ZC4A 3TAPA 1DZ5A 4TU8A 1P1LA 1VHFA 2DNMA 5KFTA 4FBUA 2LMIA 1RADB 2VG5B 2YY3A 3CCLS 2UU9F 2NUHA 4DPYA 4RNFA 2PDAA 3W61A 1BXNA 2OEJA 1KWMA 2AX1A 2MLYA 4DPWA 1S6OA 3MCSA 3VALA 4A8QA 1H7XA 4BDPA 2IA0A 4WFBQ 1OO0B 4H4KC 1CQNA 1FKPB 4KB7A 2XCPA 3MMBA 3LP1A 1YTYA 4P75A 1V9OA 4MKVA 4F25A 1NJZA 1LFPA 5K9FA 1MSWD 1TELA 4JBCA 2HFSA 3T5JA 2AEJA 4NXNJ 4DX8H 4EI2A 3NOCA 1X9SA 2FC8A 5IM0A 1BY9A 3VGVA 4ILRA 2ROGA 4OZJA 2R7WA 2WW4A 3KDOA 2MKIA 1Q82T 3K57A 1TUGB 4ELVA 1RACB 2F8HA 1V3SA 1R31A 4N47A 5BR8F 2POKA 3PKMA 1T7PA 1FCAA 2XYHB 2W25A 4A8OA 3P8BB 3D9BA 1TL7B 5EX3A 3P45B 3OSPA 4DV4F 1U1QA 3DHXA 2HFOA 3ETMA 3DLHA 4I67A 4ZP9A 2A1BA 2WTFA 2P9EA 1C0TA 1E6YA 1SQEA 3C66A 3QYYA 5C42B 5KFJA 4B9UA 1FK9B 5A6PA 4DFPA 2J9CA 2OAUA 2QE5A 2H54B 3DOLA 3H2LA 2UXBJ 4YOEA 1S1VB 4Q7AA 1Q8KA 1UWBB 1AXQA 3JAMY 2MKJA 1HQUB 3KLFB 4E98A 2PI5A 1K1SA 1IKYA 3QT7A 4U8YA 2ZZNA 5L1JA 2H48B 3I87A 1SC6A 1WELA 4Z7CA 6AT1B 4J9RA 5J1PA 4WXWA 1OY8A 3OFEA 2RILA 4GMKA 4ECRA 3N01A 2EBGA 2PGCA 4ZPDA 4QWBA 1N36F 1AB8A 3DYAB 2RDDA 4LF7J 3FZ2A 2CJ9A 1ZOTA 2OEMA 5KFAA 4KKOA 1RT3B 3DRPA 1A0OB 2VL1A 2WOMB 4I1TA 5C42A 2EFPA 5DDPC 4HI2A 3AHPA 3WQPA 4DU8A 1H98A 3UVJB 3OTDA 2MEWA 2QN6B 3AA9A 3TVKA 5C25A 2ZH9A 4ZLJA 3CXCR 3E01B 1EX8A 3E51A 2BOAA 2JH3A 3CJ5A 1TU0B 2C42A 2WVCA 2BOPA 2H3EB 1PSDA 1T3OA 2F8EX 4K2JA 4LQ9A 1LEOA 1FFGB 3Q86A 3SCJE 4E8UA 1HYSB 3TANA 2CQ2A 3A8KA 2V94A 3OUYB 3GFHA 2I2YA 4ZVHA 2ZBCA 1J5EJ 1F2GA 1S1TA 1BQNA 1VRTA 2XZTB 2A3JA 2DHGA 2Z4PA 4I2PA 3OLAA 1DAXA 4C8LA 1SKRA 2VDIA 4OZLA 3LH2S 4QYZK 3KNAA 4XTTA 2VPYB 1Q0NA 2GJFA 4A8MP 1TQLA 5GADU 2W7PA 3QIDA 1RT7B 4PG6A 1TUVA 4NRUA 1SPBP 2VBXA 3R3TA 4QJVA 5ETTA 4TKTA 1RTDB 5KTQA 4IOBA 4UUXA 3GJQB 1S0NA 4JI8F 2MHEA 2LU2A 1S1TB 3I32A 5CCLA 1I5OB 3G86A 3MM9B 4WIQA 2OHDA 3HHLA 2FJWA 3DLGB 1XERA 3LALA 1KQFB 1S77D 4ED5A 4FKYA 3LUYA 1RGVA 1J27A 2DNRA 1PKUA 2MZQA 3BKTA 1N8RT 1B64A 5K14A 3OR2A 2E1CA 1NZ8A 3TVZA 1KRPA 3MMCB 4B9LA 1SQGA 4OYAA 3V4MA 1NPRA 3PX6A 2KO1A 1F5BA 2YVSA 3MAHA 1LW2A 1N5TA 4KHPF 4UT4A 2BJEA 2J9DA 2R8IA 3QRRA 4QBUA 3B4MA 1HWUA 3ISNC 4Q0BA 4GRSA 1SC1B 1IR0A 5EDWA 2NZ4A 1PC5A 3AB2B 1IVZA 4X66J 1V5IB 1PILA 2LKZA 3IS9B 4TQSA 1C1BA 4ID8A 1S1XB 5HMZA 1OQ6A 3UDVA 3IGVA 2NXJA 2J9DE 2H65B 3OR2B 4KGMA 1Z2ZA 3CCTA 4LUBA 1EKSA 3D6TB 2XULA 4CI0B 4ZN3A 4O44A 3T6BA 4C98A 4O23A 4ZPAA 1EP4A 2RJZA 1LW2B 4M5MA 4YY3J 1BHNA 4X4PA 1KLNA 2AKWB 2Y0BB 1S0VA 1ZM4A 3PV8A 2KZZA 3MDFA 1RBOB 3FGVA 2YNIB 3DGPB 3HSJA 4H4OB 1JLFA 1NAQA 3L3CA 2XS7A 3OVAA 4NYOA 3KMSA 1P9YA 3M9NB 2V4QA 2LFVA 3RRKA 4UW2A 1C1BB 5B0FA 2LDYA 4X4OA 1YQHA 3ZNJ1 2Q79A 2ZH7A 3R1LA 3C16B 5E7OB 2XI3A 5B0DA 2PT0A 4LF9J 1KHVA 3FUYA 3T1AA 2MQLA 2QV6A 4I7FB 2RSQA 3FBFA 1JJ4A 2XMMA 1SQFA 5BYRA 5KAKA 4OI0A 4DV5F 4KGKA 2HHHJ 1XR7A 3DOMB 2C3PA 4MYUA 2ROEA 2UUCF 3MM6B 4Q2MA 2M7SA 3A8EA 5IV3A 1W7WA 3PW7A 4W90B 3NOGA 4DL2A 4LSZB 2C2EA 2J6TA 2GJ2A 1K1QA 2QMWA 5IT9Y 1B7FA 2YNGA 5KG5A 1BGXT 3T3FA 6FDRA 3CB4A 2MGZA 1X9WA 1G7CB 4J90A 1GMVA 3SCIE 4UOGA 2OH2A 1C4AA 3DRSA 2CQ4A 1UAWA 2JWNA 1S1WA 2DHXA 3NCQA 3BYPA 1FA0A 3CD0A 4R5PB 5IOLA 2MB0B 2CDQA 3CIZA 4JI0F 1HNIA 4MAKA 3DU5A 4PABA 4LVNP 4GKKF 2V4JB 2VG6A 3M8PB 3PEJA 4WBFA 1U24A 3BREA 3I9V9 2AWZA 3FBCA 4TVAB 3TA0A 2FVPA 3HK2A 3D66A 3D5MA 1IJEB 2VFTA 4KFBB 4EBDA 1PGZA 4NI2A 4OYIA 4GKJJ 2QLBB 4K7QA 1S1WB 2XTJP 3NWRA 3NCRA 5HQMA 3Q8RB 1UP1A 2G0CA 3MM8A 2CVEA 1GAOA 4ZCLA 4DMZA 5L8RC 4LRFA 5E3QA 3KLIA 3KG4A 4CNZA 1PJ7A 1IN0A 4RW8A 3BKUA 4NLUA 3AT1B 2ZBIA 2IVFB 1F6TA 2ZVIA 3TVYA 1FK9A 1SJ3P 2BKNA 5G4DA 4C11B 1X4AA 3M2RB 3SMZA 2LA6A 3CPWR 2E7XA 3C15B 4B02A 1HQUA 1VLOA 4KFBA 1VQYA 3KNGA 5D0RA 1DFDA 2CVIA 4MKAA 4DWIA 4RUBA 5KG6A 2OEKA 1JLCB 1WHYA 2QLWA 3DYAA 3L7UA 3P4UB 4AQYF 1L3SA 2OO4A 4G1QB 4RW8B 2KH9A 1EETB 1C0UA 2CNLB 2W4PA 3GZ7A 5DS7A 4U67Q 3TA1A 1HWLA 4IFYA 2I6WA 4WTYA 4ZOSA 4AUKA 2I5JB 3R7NB 3C15A 3RBDA 3ITHB 1VBYA 4DPXA 4Y0FA 3GCWP 2HQGA 2VG5A 3BV8A 4FYXB 1KR4A 3CJ3A 3R27A 2AHOB 3K5NA 4F0HA 3AY0A 2H5IB 4NA2A 3UE2A 1A7GE 1GX5A 3Q24A 4KR0B 3TJ8A 5MLCV 2LLZA 2XWYA 3UDEA 1RWOB 2LCWA 3MAAB 2K8GA 2QT7A 1DTQB 4F02A 5EX0A 2RDJA 1D9AA 3U1LA 3W2VB 5RUBA 1CJVA 3HXMA 2ZNZA 3LGNA 4K4WA 5IWAJ 1NKCA 4P73A 2NLWA 4O3SA 2FDNA 4OHVA 4BWMA 3W8GA 4DL7A 4OZ3A 3T41A 5HMYA 1J5EF 2E9ZA 1WC0A 1VHIA 1WKKA 5LMUF 1GXUA 2GVZB 3FBBA 1S79A 1S1UB 4RW9A 5ETLA 5J2PB 1REVB 4PWUA 3KLVA 4UOCA 3G6ES 1U1KA 4ED0A 4JI6F 4Y2AA 4CO0A 1KFSA 1U6BA 4KGZB 5I3PA 3KLEA 2ALZA 2KVQE 4MTPA 3W2VA 2QTWA 3W9JA 3CD5A 3M9MB 2V2QA 1KQSR 2Y1JA 3MMCA 2DEJA 2HGMA 5L1LA 2DR7A 4TY9A 2UUCJ 4R0EA 3PTWA 1HA1A 5CYMB 3BGUA 4DR2J 1UA1A 5F41A 1NRKA 3R9LA 1VC0A 2XNRA 4ZLNA 3V6JA 3KLHB 3GPAA 1NBEB 1S1UA 2ZBRA 2W4DA 4RW9B 5J2PA 4PUOA 1X31C 2OPSB 4YHHF 1QAXA 2HWIA 4AXIA 4OLOA 1ITPA 3GYGA 4FF2A 2HYIB 3I0RB 2X1FA 3PYDA 2Z2MA 5IS2A 1ZM3A 3HZGA 4J9SA 3NMAA 2F5GA 5CZVA 1MU2B 3DDIA 5KFFA 2UVRA 1TL1A 4C2MA 1T02A 5GAGU 2BR0A 2YWWA 3DRRA 2DYAA 1BD6A 4HDGA 2E5LF 2UZAA 4R8UB 1VJQA 2ERRA 2YNIA 3N9UC 4K0KJ 3TAMA 5H9EK 2AYMA 3W60A 2DO4A 2OD6A 3DGVA 3R1HA 3UQSA 2LA4A 2PN6A 1WC3A 2C2KB 4OI6A 2DBBA 2E1AA 2FYXA 3SDEB 4Q5VA 2ZKTA 2I0XA 4RU9A 1YIJS 5L1IA 1VK8A 5KFPA 4K2XA 3EXYA 4DX5A 4B9VA 4X4RA 2V6AA 3QO9A 1HW9A 2ZJQQ 4NCBA 4OJ3A 4ETXA 2BMBA 4I7FA 1PBAA 4ZVUB 4EO6A 5LT5A 1VQ7S 3RB6A 2K1RB 5ETVA 1RLDA 4IKAA 4Y6IA 3L7PA 8RUCA 3QGPA 4URGA 3S8SA 4DR4F 4DQIA 2DCLA 3OW2R 2C3UA 4ZK7M 2CADA 1NDLA 3CDWA 3MFHA 4LBHA 2IDLA 3KG1A 1S57A 2HEKA 1VBKA 2BM0A 1IUJA 2QYGA 3FZBA 3OFFA 4ZVEA 1U0HB 4F67A 4X65J 3SEOA 3P5TL 3MUMP 3NGRA 5KFZA 4P10A 3M8SA 5IT4A 2XMJA 5JVGQ 4LQ3A 1CEZA 2QJ3A 4O3OA 3ZXWA 3H40A 2HHSA 4DR1J 1L3VA 4IDKB 4C3KA 1ZTTA 4N7TA 2MY8A 3IAS9 3CW2C 4QIFA 1XN9A 3HT3A 1T03B 4HKQA 1ZAVA 3HHKA 3S6EA 1FEEA 1NMEB 3GFYA 4HACB 1UMJA 2F1FA 4TLRA 4O0IA 2CPXA 2ZC3A 2CQPA 2QC3A 1U0HA 2HRYA 2ZHBA 3WIVA 4PPZA 5DDQC 3CCSS 3D28A 5KFOA 3M9OB 4GC7A 1XJWB 1SL1A 3N0VA 4WP9A 3J7YU 2HNDA 4M95A 1S59A 4CLYA 4L72B 4A8WA 3GSDA 1WI8A 2B4UA 3CC4S 2DGVA 1XMOF 1FT8A 4J91A 1HI8A 3BH6B 1BMQB 2AJ2A 3G96A 3G2XA 5KFGA 1CC8A 2A10A 2BJ8A 1WSVA 3IWXA 4JV5F 2LVWA 1RT2B 2AJFE 3TZZA 1RZMA 2KT3A 3DXSX 1X4BA 2HKEA 2ZBPA 2RQKA 2XQCA 4NE9C 3WBZA 3D1OA 3MI7X 2RU9A 4Y2MA 3RW6A 5A8RA 5IT9U 1RHKB 1QAIA 2HHUA 5JMNA 3MEEA 1HHTP 1FXDA 1HNZF 1FKPA 3US5A 2J0XA 2JFKA 4ECUA 2O01C 1F2HA 1MWQA 5DRKA 4CLKA 3W65A 4LF8J 2UUBF 2APOA 2R2UA 5K5MA 3HVTB 1XBWA 1EHWA 1NSKL 2XGPA 1IBCB 1XR5A 4DPUA 4O3NA 3U27A 2CJYB 3G6VA 3OBIA 2BJ7A 1U2CA 1S9EA 3TNVA 2XS5A 2HW3A 3KDNA 1Q16B 1RTHB 1WC4A 1FVSA 3GONA 4KQZA 1U48A 1RTIB 4RBVA 2VFUA 4CTAA 2ZH8A 2OPRB 3GWCA 1B4SA 3QNWB 4ALZA 3CT9A 3M30B 2QSWA 4DJBA 2HBYB 4DZDA 3ZTRA 2QO3A 1O6XA 1O5JA 2AGQA 1F9FA 3LWMA 5JVHQ 2VQEJ 2FLOA 1NH7A 1CJVB 2W9BB 4FS2A 4ERDA 5KFRA 5EGYA 3AODA 1TKXA 2DNZA 1JK9B 5HJXA 1N34J 1D8ZA 1MROB 2FHMA 2YX4A 3BBBA 3K7RA 4CRJA 4EFAC 2MSSA 4I0WA 2XMTA 3EWGA 1KONA 2HVDA 2WVDA 3MM5B 2R4FA 3M1VB 1U02A 4P71A 3AAWB 4RX6A 1RISA 3MPUB 1D1UA 3CJTA 1JLQA 5DGBA 1U8SA 2XNQA 4OX9J 4NA3A 3S7RA 3KLEB 2IY5B 1YJTA 1TKZA 3DLBA 1M5HA 3B8HA 2C2OB 2RD5C 3UR0A 1VRUA 5SZTA 1K73T 1ROFA 3GU0A 3HX9A 3OTEA 3HHLC 3JQJA 4WTOB 1RU1A 5DG9A 2CQGA 5D0EA 1SI9A 2BZ2A 2LP4A 2WBRA 3VF0B 2E44A 1U1NA 4KSEB 1NDKA 3Q2SC 1EARA 2ZE2B 3U02A 1H2VZ 2OPSA 1Q5VA 4USHA 2V9WA 4F4KA 4X64F 4RW6B 2CZ9A 2R7OA 3CJKA 1JLAA 1TKTB 3G9CA 1GMWA 3GIRA 1CPZA 2DEIA 1X60A 3BM7A 2HHQA 2AJ0A 1WDTA 2Z30B 3VGUA 4A8XA 3OL7A 2DGUA 1N34F 2B4OA 2EPIA 2UV8A 4TQRA 1MMLA 1WACA 1HNZJ 1NU4A 3E2EA 1EB0A 5B0CA 3AJ2A 1P1TA 2EG2A 5HVGA 1HQEB 2H51B 2Q6CA 2PFDA 5KFMA 2MZ1A 2CJAA 5CAAA 4FNIA 1R3NA 4I64A 5KFHA 4GO7X 2EI5A 2AZ1A 4QPXA 1M1KT 4A8SA 2V4RA 1HBMB 4FF3A 3GTYX 4OX7A 2RRNA 2A2DA 4DUZF 2IVMA 1FD2A 3DMJB 1TV6B 1AFIA 2R7UA 2RRBA 1S10A 3MR3A 1SKUB 1Z4UA 3FFIA 3DLGA 4P74A 5JXSA 4C7QA 1M5SA 4ELUA 4UY8T 4UY85 1M1HA 1T9UA 1CBKA 2JEFA 2OSQA 4CH7A 2UP1A 3HD2A 3LP0A 2K1RA 2W4CA 4H54A 1XMQF 1Z2LA 4DOZA 2YWFA 4HTJA 2N7YA 4F50A 2BABA 2BYCA 1FKOA 2O66A 1S6PA 5HO4A 1X5OA 2AD9A 1JNZB 3QLHA 5D15A 2C3YA 1GQEA 2C2MB 5SUHA 1M5VC 4CZCA 2GX8A 3GFXA 2DJWA 3FFIB 4KBIA 3SSQA 5K8OA 4X4NA 1NH8A 3ZO7A 1S1XA 2ZKUA 1M90T 4EZ6A 3E3XA 4HEA9 4ZCIA 3B4DA 4QQBA 3C2PA 1H72C 1LOUA 3H42A 4LSLA 2YQ0A 2HNYB 4RUAA 3OLBA 2W9AA 4GVLA 2CPIA 5I42A 4RU2A 1R7IA 5AXKA 1V6HA 2W9CA 1Y5LB 3HSZA 3KJQB 2EFOA 4WYWA 5KT2A 1W26A 2EG1A 4K50A 2L48A 3OQ2A 5C24B 1RB0A 4X4TA 5CCMA 4P9SA 3QZ7A 4J9NA 1HNXF 4HACA 5DGAA 1YBTA 5DDRC 1JLFB 2BE7D 3H20A 3IGNA 2ASDA 4EBEA 1RCXB 4IH5A 5GVQA 4IOCQ 1FDBA 4QWDA 4OIXA 3U1MA 3PRDA 3HHLD 3EXCX 1RT5B 4O3QA 4I2QB 3PXGa 3MPVA 5D8HB 3JSBA 4GC6A 5HP1B 3PKYA 1X7VA 2AYEA 4MKBA 4F04B 1MU2A 4CCHA 2RAQA 1SH2A 1KHWA 1J5OB 4IO1A 2RQCA 3CO9A 2DXEA 2QIFA 4F4WA 2ZOFA 1LWFB 3JS9A 1QSYA 1OQ3A 1YZ7A 4JI4F 3C46A 3PEHA 1EQMA 1DLOA 1RP5A 3DOMA 1RT2A 2C1EB 4DF8A 1FJGF 4DV6F 4DU7A 4OV1A 3MM6A 1WC5A 1LK5A 4EMDA 1KNZA 4F0KA 1U47A 2RRAA 1CJKA 1NLKL 3LQVA 2NYIA 1SL2A 4OL8A 4MYTA 1KSPA 2FLNA 3QWUA 3FEYB 3IP0A 4KIAA 4KTQA 5D3GB 1HBOB 5LSOA 2XC9A 3LAKA 2LECA 1C1CA 1WD6A 1JLBA 3JSRA 3M2VB 4P6QA 2EKNA 3CVKA 4WU3A 4Y2KA 1EAYC 1HWIA 2W2NP 4C3MA 5A2QY 4R5PA 3T1YF 3CO0P 1KD1T 2C2RA 1NUEA 5J1NA 1V3ZA 5HQLA 1LK7A 2EK6A 2HGNA 2QFIA 1E6VA 1N0VC 1LFWA 2YPYA 1FEHA 4YDDB 1XMQJ 4DSKA 4JI7J 4DR6F 1AZSA 2YNHA 1X5PA 2NXNA 4MIWA 2VPZB 3V6HA 3PDNA 5DDOC 3F73A 1OPIA 3ZZTA 5FLXU 2Q3PA 4ELTA 1Q53A 1S9GA 2DPIA 2G2YA 2YWKA 4L74A 2MKKA 2DH7A 1L5UA 4L3NA 4Y34A 2I8EA 4XIUA 1MG7A 2FPHX 3BQ0A 3R5GA 4DV2F 1SIZA 1WHXA 2JEGA 1FESA 1H38A 2PD1A 1UEKA 3ENVA 4OHWA 1PG5B 2Z2LA 4UQTA 4DR5J 2XG8A 4B9SA 4TU9A 2HZCA 3I9ZA 2XY5A 2ZM6F 3RUBL 1XNRJ 1Y00A 2XHWA 4IG3B 3MF5A 3QAUA 1TKXB 4CO2A 5ETSA 3IG1B 2A6MA 1X5TA 3OPKA 3JAMU 2MDAA 1HLWA 2VV5A 3LOUA 4MJKA 4ZLPA 4ZMMA 5B08A 3DRYA 1JKHA 5ETMA 1JLEA 1S9GB 3JSYA 3I56S 1UVIA 2XLIA 4UOFA 3PRBA 1QTNB 4QIGA 2RU3A 3T1HJ 3BPSP 4JI3F 1YJRA 4NEYA 2W2MP 3F0NA 2QA4G 1QLNA 1PYTA 3HT0A 1HNXJ 4C8YA 2PIIA 1DQ8A 3NBPA 4ECQA 1QSLA 1U1RA 2DR5A 5K8MA 4A8FA 1TUWA 4GO5X 3UN2A 2OIHA 2KJVA 2M2BA 2XGQA 3L4BC 2D9OA 1RHQB 1KOOA 2ZJRQ 3MEGA 3NS5A 3W8PA 2Y8WA 2NXCA 5E5NA 3BO2A 1HI0P 2LQ9A 5J2MA 5AJ3F 4ZLLA 2YWGA 4CQ1A 2B43A 2KKHA 3ITHA 3Q8YA 2UUWA 2VC1A 4EU0A 2HQDA 2LU1A 2B0GA 1WEZA 3WX8A 1RE1B 4X62F 3Q83A 3OV7A 2ZITA 3A8IA 3LP2A 2J0WA 3I4HX 4LIRA 3G82A 3GG1A 3RGIA 2XO7A 4LFBJ 2MQ8A 5CD4A 5HLFA 2P6TA 2MXYA 4DSLA 1UFKA 1ZA1B 2UUTA 4NYZA 3PY8A 2YTCA 2KN4A 2CJQA 5FDLB 2LDIA 1ZZNA 4B08A 3CCJS 4C4WA 3FBEA 3IWNC 3OJUA 3HVTA 1X4HA 1SH0A 5DZ7A 1CULB 3THTA 1URNA 2EFGA 4F3QA 3A13A 3HSDA 3G8QA 2PFFB 1LWEB 2PMZD 4YQWA 3LP2B 2ADBA 3W66A 4QR0A 1NHUA 1Q8LA 3IO1A 4JP8A 4YR0A 1RCOB 2OPRA 3AOAA 3CCQS 3IMQJ 4R0JA 4DSFA 2DVIA 4IRCA 3N5FA 1KN6A 3EVMA 5FDLA 1FTCA 4OYOA 2GAGC 2DNHA 3RG6A 1SXLA 3AA8A 3HDSA 2DRBA 1H2UX 2HIYA 3DLKB 1S5ZA 3ISZA 4M5HA 5F8MA 3EDQB 4BC7A 2ZH3A 1MROA 1U8WA 2E7WA 1S49A 4N76A 3HVWA 4Q8EA 5IT0A 2X1AA 1NK8A 3J7ZT 4RNHA 1MMDA 3M1VA 4LR7A 4NMXA 3K5MA 4JI1F 3GV8B 3G8SA 3M05A 1JLQB 5J2NA 1RUSA 1RJJA 3AH6A 1RHRB 3IFEA 2K7KA 1IR2A 3ZZ0A 1WHVA 4WKYA 5AXLA 2UXDJ 2V69A 5L39A 1OWXA 2M52A 3JXOA 5D4NA 5CQGA 4IFVB 3CE8A 3CTRA 2RDIA 2KDOA 2VG7B 2BQUA 1X9MA 2R7QA 2J0SD 1QE1B 2IA6A 2V8PA 1IXKA 2FZCB 2KXHA 4M5IA 3I5AA 2LXIA 2Y1IA 2BW7A 3SQGA 4WFXA 2ZE2A 1T0TV 1ZAXA 2BJ3A 3MM7B 4FF4A 1CC7A 2XY6A 2DK2A 2XB2D 1G1XA 5F8HA 2AEFA 4MFBB 3V81A 3C6UA 4OHZA 2YX7A 3SZ2A 4LFBF 1SUQA 1LWCA 3KK1A 1Y10A 2OTJS 3NGDA 4CYUB 2YKNA 4NXMF 2HBQB 5BYSA 3T6JA 3GCXP 1FI4A 3PJXA 5ETOA 1ZETA 2DB1A 1UPMB 5HQ8A 1TMJA 2DGTA 2FIUA 4WFZA 2X1BA 4NZ7A 3I5CA 2DY1A 2GW8A 3VR1A 3HHEA 2XEXA 3NGTA 4H4OA 2CQCA 4M5KA 5E3PA 2P6SA 3SXLA 2HBZB 1R43A 3SSSA 4C8KA 1ZYQA 1QDUB 2NXEA 3FJ2A 2HVHA 2R2SA 1N36J 1VLYA 1YZ6A 4G65A 3MEDA 1EZZB 2YH1A 4UF4A 1RAGB 1UZDA 2B51A 1T95A 3DMJA 4DFJA 3HCXA 1WOPA 2RVJA 3VV2B 4Q8FA 2WAQD 2HLUA 3D54A 4MIAA 5T14A 1U2FA 3J81j 4JI5F 5D3GA 3MR7A 4NRTA 1P9QC 4ICLB 1JLBB 1SBRA 2IRYA 2U1AA 2CKWA 2H5JB 2Q6BA 4FXVA 4MMOA 1Q8IA 2V8VA 2VFRA 1SV5B 3FKBA 1IKVA 5B0AA 2CQIA 3I6PA 5AJ3J 2WHOA 1D09B 2PO4A 4Z37A 2F63A 2HHWA 1RAFB 2GFFA 4LF2A 1N5YB 5A0YA 4IQXA 1HMVB 3OFHA 4QR1A 3AJ1A 3DI6A 2JRSA 1UZHA 4RWWA 1HIYA 4M94A 5KOXA 1IKWB 1YJ7A 2GIQA 3THPA 2W24A 1RABB 2M9KA 3MD1A 1YRXA 2HQIA 2ZOGA 1ZTWA 1AUDA 1SIWB 2N4CA 1U7LA 4YDXA 3LTOA 3W1YC 2KG0A 4ZVGA 2K2PA 2RF2A 3M6UA 3AXMA 2M8HA 2HURA 2P5VA 5I42B 4F4YA 3RAQA 3QGIA 2DNNA 1VC5A 4ZVTB 1AW0A 1Y11A 1YKWA 4CH0S 2HPUA 1NDPA 3R7SB 2GVDA 2MQMA 3CJRA 3NG8A 4OYXA 3VZIA 1VC6A 2XY7A 2HSEB 1CS4B 1RT4B 4NLPA 4OZ1A 2VBWA 3AQPA 4WYLA 3D6MB 4ED2A 1TK8A 1FXRA 2BJ9A 2H1YA 1W2BR 2ZD1A 5E3CA 2HLTA 4HI1A 1XIQA 1S9FA 1BLUA 2GC8A 3PW4A 1NHKL 3H2VE 4NLDA 1JJ2R 1V5VA 3I5BA 3JB9k 1J5OA 3EZOA 1H7WA 1Y3JA 2FZKB 3JQMA 1N0UA 3SFGA 2B7CB 2PEBA 1VQ8S 2E7VA 4OLPA 3GILA 2PA3A 2GVDB 1XR6A 2ZBQA 1DLOB 2HAIA 3B82A 3BZQA 3MPWA 4RJVA 3UCGA 4ZCMA 5K8PA 2AJ1A 3Q23A 3QJPA 4OJGA 3HP6A 3OL9A 1G2EA 3BGOP 2HWTA 3SCLE 3DFEA 4ES1A 4HHJA 3C14A 1KLMB 4ZA1A 4DG1A 4YB1P 1NKBA 2FLPA 1N32F 1JXLA 5E0OA 4RZRA 3TYTA 1DTTB 4ECZA 4KAIA 1M5KC 2UXDF 1FJ7A 2GS8A 1UEVA 1FE4A 1KTVA 2BE9B 3CJ4A 3M30A 1C1CB 2XYPB 5F8IA 3UR3C 3QJJA 2ZOMA 2CZ4A 3BB5A 1SKWA 5KT4A 2MKYA 2FHJD 3KJVB 1IKXB 1S48A 5DQHA 3OTOJ 2XLJA 3R7BB 3A3NB 4IFYB 3VVUA 3KHGA 3GIJA 3KUHA 4DV4J 1AROP 2Q1LA 2BANA 1WF1A 4PXEA 3IR5B 4U6PA 3T5LA 2R7XA 5G0RB 3RR7A 1KLMA 2CNNB 4DG1B 2J7WA 2DY9A 3PJ9A 2XYGB 1KDNA 1A6LA 4U9RA 4AL7A 3W62A 3TQ1A 4A8YA 2KZMA 4LF6J 4WZMA 1UFLA 5D78A 1GEHA 5B09A 2F40A 1X0FA 3A8JA 2HK2A 4AYBD 2ZZTA 4ECWA 4EO8A 3D1HA 4U7UK 4IO9Q 1BUXA 2XMUA 3PYEA 1DTQA 2BA9A 4NYPA 4C48A 5LSRA 3MR2A 4DV5J 1HFEL 1R0CB 1UVMA 4F3MA 5CYQB 1YSJA 3B54A 3KWMA 5KFXA 2D3ZA 4I69A 4J9VA 4NLYA 1I51B 1D9DA 2MSTA 3MMJA 1X4DA 3FNNA 1VMBA 3DOLB 3RRHA 3H8YA 1JLEB 1UWBA 5DLFA 4YFUA 2ZUGA 5E3AA 4FNHA 5J2QA 3KTQA 3H4BA 4USWA 1AYEA 4MT1A 2HG4A 3ZTSA 2N3OA 2CG8A 4KV8B 3CMQA 4C6AA 1S7HA 4FYDA 1FX2A 2GZOA 1N52B 2F9DA 2DKOB 4M5DB 1WC1A 1WJ9A 4PXCA 4ANDA 1LWXA 4KHPJ 2AMCB 2MMYA 2VG7A 1DBDA 3MEGB 3PFOA 4MK9A 4O44B 4YB7A 1KS2A 3WHIA 3ZZPA 4ZHRB 3BEGB 1IQZA 1LXNA 1QE1A 2H4WB 4LVOP 1XWLA 3NMRA 3E01A 2OMLA 3PYFA 1PBUA 3ISND 2HFZA 2YPZA 4NLQA 3MCNA 3G87A 3SQGB 5KG4A 4FP9A 2KM8C 1HW8A 3G4SS 4PUOB 2EC2A 2B4PA 3DKDA 3M32A 3VAKA 2M5YA 3HSGA 1N4LA 1QUPA 2BE2B 2PE8A 3LA0A 2RKIB 2FQQB 2XZDB 3EMTA 4XPEA 4PAAA 3I55S 2R2RA 2VUGA 4ZN1A 5EWEA 4JI8J 4DN0A 4USVA 3OHBA 3BF4A 4QWAA 3CUNA 2WSEC 4X4UA 3CCZA 2YKNB 2A18A 1HPZB 2NPIA 4J7CA 4NOHA 2ROPA 4P52A 2DNQA 3RW7A 1RAHB 3DRRB 4NCGA 3M2UA 5C7PA 4GVBA 3D6HB 3CJQA 3KK2A 3O3LA 4PG8A 4M1KA 1RT7A 2ZH4A 2BACA 4YHHJ 1KP6A 3OTCA 2QFJA 1B0TA 3CULA 1NPKA 3QIPA 5FJ4A 2HQ3A 2DISA 4J5OA 4KC5A 3QLHB 1VQSA 1R8HA 4RWXA 1SVDA 5HVFA 3RAMA 3JYTB 1F0XA 2IYGA 2RKIA 3R5BA 1K8AT 1KQKA 1B3TA 4G1PA 1ZM2A 4LT6A 4K4ZA 4N41A 1R27B 2CNKB 2PMHA 2UXCF 2AV5A 3UO0A 5LMNF 5K14B 4USTA 2HNZA 2GGPB 3P96A 2HMIB 3V6KA 4ZP8A 3RU0A 4DV7J 2RS8A 1N32J 4OMFG 1VIOA 2UUAF 4LFCF 2NQPA 5A0YB 3KKFA 5AT1B 4ECTA 5C24A 4CP5A 4B9TA 3UI3A 2M0GB 5A8KA 3EYZA 1RWVB 3DDNA 1BE4A 4ZVQB 1UVKA 3H0PA 1VDHA 1WHWA 4RW7B 4ES2A 5KFEA 3CCMS 3NNCA 3M6XA 1YJVA 3HHNB 1UJ6A 1IBKJ 2IVYA 5DO2A 1FRMA 1BQXA 5AE2A 2CJKA 4JYAJ 3PHTA 2QL7B 2GGPA 8AT1B 3M8QA 2VONA 4DV1J 2KTQA 4C8MA 2EW9A 3GJRB 1FWLA 4HT7A 4Q44A 1EP4B 2RHSB 5KFBA 1Q8BA 1X8DA 4O0NA 3I4PA 1NJIT 4C11A 1N6QA 2WSFC 3DGPA 5KT3A 2CAJA 3AB4B 1H73A 2JVRA 4RO0A 4W98A 1WF0A 2Y0SD 3FCWA 4CLPA 1T05B 4GKJF 4FXDA 1VJWA 5DG7A 4JI6J 2IJFA 3MHYA 2QX0A 1TTHB 5L38A 4DLGA 3C6UB 2RS2A 2W2OP 5F8NA 3DM2A 3C16A 3SSRA 3VHQA 1R0BG 1QM9A 3EZ5A 2I38A 3VCDA 4B3SF 1M5OC 2ZHOA 1QAYA 1RWNB 3F56A 4V1Ak 2Q66A 3MMBB 4ZVFA 4OI3A 2IFXA 4W92B 7FDRA 3LO3A 5KOWA 2VASA 3F44A 5HATA 4DV3F 2B7BB 2MZTA 1VYAA 3LAMA 2ATCB 1JXVA 2IM0A 2O3DA 2R7TA 2PMWA 5LJ3Y 2FVRA 4GKKJ 1FNOA 2XSJB 3FCHA 3ZZRA 3N6MA 5A8RB 2YNGB 4AQYJ 4ETZA 4ZPVR 1HHSA 3DN9A 5D77A 1BWVA 2CG4A 2IPOB 2MZJA 2D1CA 3DOKB 4NLSA 1YHQS 2G1DA 1FNXH 3R8YA 3QGGA 2V2VA 1U1OA 1RWMB 1M1GA 1QSSA 4JYAF 5KFNA 4QW8A 4C97A 4NWBA 3UNGC 3GLJA 2HFNA 1PJ6A 2PI4A 4FBTA 1NNDA 1JQGA 1VISA 4NLVA 1W2IA 2QA1A 3NGSA 5K8NA 1UJ4A 2C2DA 2W1BA 3H98A 3OXFA 4RBUA 2KM8B 1RAOA 2D41A 2EEYA 1VIXA 3DI6B 2XS2A 2XSJA 3M8PA 2B9WA 5ADZA 2VQFF 2WONA 1RHMB 1JKHB 3VQSA 4B9MA 4CTAB 3MWBA 2YQ3A 2IAJB 2O5DA 5IXUA 4RNOA 2R2TA 3CCES 5HBMA 2ASLA 5EUHA 1REVA 3QQCD 4NI2B 3J80U 3LP1B 4HH0A 1SC4B 1QUVA 3ZNUA 2RF2B 3M8ZA 2JSXA 2ZM6J 1IBKF 1WG1A 4X4SA 1NM2A 4HDHA 3IM8A 1TVRB 4DUYF 1Q81T 1U0SA 3GR0A 1LQ9A 2ILZA 2CZVC 2DH9A 3VGSA 1ZZFA 2CA9A 5CYMA 1GTHA 2L3MA 4PXBA 3DLEB 1R0AB 1LXJA 1SCJB 4F4AA 5DQGA 2F4FA 1F5AA 4JI3J 3NY0A 4DR7F 4L75A 3MCMA 1Y0HA 2DHSA 4AT1B 2F7VA 4C0OC 1U1PA 2ZH1A 1FE0A 1KBRA 3GSIA 2DNOA 1U45A 4K4SA 3MFIA 3IRWP 3T9NA 1TL7A 3I31A 5HLFB 4USKA 3EPIA 3KG0A 1UKUA 3CSKA 1OY9A 7AT1B 1VRUB 3H5UA 1EETA 2EXUA 5D0GA 2FGCA 4Q2LA 2VBZA 3PVXA 2UUAJ 4UTGA 3AJDA 4I6WA 4PPDA 1UCNA 1D9FA 1YWXA 2YQ1A 4M5GA 2CPJA 1CJTA 2HBRB 2BQRA 3KLFA 4IR1A 1KQGB 4Y2IA 3J7Z5 2HFUA 5ITHA 2D3O1 5H9FJ 1N5SA 3O8WA 3NS6A 1Q95G 1DTTA 3POTA 1NK7A 1BQMA 2LQBA 2DNLA 1RWKB 2V5HG 3CNQP 2CQBA 3DDKA 4NLWA 3HVRA 1H74A 4TXSA 4ED7A 1NB2A 2ZDPA 2DXFA 4LJMA 3ZZYA 3D7SB 5LL6d 3M7VA 3D3BJ 2XMKA 4DV0J 3MM9A 2HZAA 8ATCB 3J80Y 4EGLA 3BR8A 2K7JA 2RH3A 2KT2A 1B0VA 2DIVA 4PWWA 4ED3A 4O3RA 2DRAA 2IM2A 2K3KA 3HD1A 2UXCJ 5DM6Q 1JX4A 3OXGA 4PXDA 1HNVB 2ILYA 4RBTA 3K8WA 2B6AB 3QJLA 5FIIA 1NB7A 1C2PA 3QIPB 2B56A 3MURP 1RHUB 1TMMA 4IYQA 3VAMA 1MNEA 4DR2F 3TJ9A 4LRDA 3TI0A 2M88A 4CLUA 2CPFA 4Q0BB 1X4GA 1VRTB 1G6BA 4W4MA 4LF8F 1TV6A 2FGOA 1DQAA 1MMNA 1U25A 4I2PB 3TX8A 2R8HA 3NKYA 2JFDA 3IS9A 1J2VA 2KHDA 2YKMA 1RYRA 4F8RA 3QSYB 1C4CA 4YEAA 1NXIA 4ZITA 2KXNB 1JIHA 3H59A 2XMAA 1IBLF 2G13A 3HLUA 2FD2A 3QT6A 4OX9F 4P7VA 2W01A 3UW1A 2VKRA 5HI7A 2L9DA 1RTDA 2GJIA 3J81Y 4DCPB 3BN4A 3GJSB 4ZPCA 2W8LA 5KFQA 3SYZA 5J2QB 2L41A 4DSJA 2F65A 3IR7B 4XDCA 3ZTQA 2DPJA 1RLCL 1RA7A 1ZAWA 3GB0A 4RNNA 2B5JB 4K4YA 3HHLB 3ILLA 2VFSA 3G8TA 1R89A 4NLOA 2VQEF 3OJSA 4XO0A 2XCAA 2HHHF 1U2RA 2J6SA 3CD6S 4AL5A 3ILOA 3WC0A 1T9TA 4ZS6A 4JOUA 4CYUA 5KFCA 1YITS 2OELA 1N5VA 4CO4A 2Z8QA 4HVZA 3RZAA 1WOOA 4HL9A 4DX6A 3BPDA 4LR9A 4RUHA 1FO1A 2MLZA 2RMLA 1G3OA 1Q79A 4R8UA 4ZVOB 3Q8QB 2FJXA 4QYZJ 2KFZA 2HS0A 3JSMA 4A8KA 3SI8A 2D9PA 2Z2ZA 2CQDA 1RWXB 2N7CA 2OJ3A 1EKRA 3MPDA 4M8LA 3R5CA 4ED6A 2GIFA 1YRUA 1DARA 3DM2B 4HT5A 3Q2TC 4DUYJ 5LXYA 3HKWA 5HP1A 4CDIA 3QO9B 1I1GA 4H4KA 9RUBA 3LPYA 4DUZJ 3SV4A 1ZBTA 3AXKA 3T5KA 3KLGB 5F8JA 4X66F 1RAAB 1UEUA 4FVMA 1VR6A 3D1QA 1QAJA 2AJQA 3TZXA 2CPYA 3K89A 1P27B 3WZ0A 3THVA 2MKHA 1VRQC 4X64J 2BBEA 4X4VA 3B78A 5IQ6A 3A1YG 2RQ4A 3D3CJ 1HMVA 4LF4J 5L9XA 3IC1A 1SH3A 4M5LA 1NJXA 1K44A 2DRDA 2V4JA 2VG6B 5D4PA 3W5YA 2HZVA 1O8BA 5M2PA 3J7YI 3MR6A 2YKAA 1SKSA 1WOSA 3MCOA 4QIVA 3EGNA 2RIJA 4TY8B 3SQOP 2DHHA 4X62J 1S97A 2OPQA 2V8HA 4Y2CA 1F5CA 2JL9A 4KO0A 4KHRA 3R97A 3CDUA 3HFZB 2E9RX 2JLEA 4BWJA 2B8QA 5CZXA 1XMOJ 1RU2A 2HHXA 4PQAA 3C6TA 3KUGA 4MIBA 4S0MA 4U7CA 2FJVA 1CLFA 4HTIA 3M2RA 5IM0B 3OXLA 2LEPA 3IXQA 1VS3A 4CT8A 4RW4A 1M5PC 1IWAA 2AP6A 2AX0A 2MQNA 3MM5A 1X5SA 2ZVSA 2MGZB 3MOJB 2JHEA 3EGVA 3UCUP 2RT3A 3EPGA 1U4BA 1RA6A 3PHEA 4LF5F 3DHWC 1JLGA 1Q1KA 2QLXA 1NSQA 3VTIA 2R42A 4ZIVA 4KH1B 4CNYA 4RR5A 5ETNA 1PYOB 1TVRA 1RTJB 2DGXA 3BBFA 3CDEA 3MGJA 4RNMA 2M4MA 2BRLA 1C0TB 2ZJPQ 3IG1A 4IR9A 3QT5A 4NASA 4L6V3 4CWBA 2UUBJ 1OY6A 4N56A 5L9NA 1Y3KA 4KT0C 2I5JA 3NL0A 3TQEA 2HQCA 2A0FB 1TL3A 3ZFVA 5BJRA 3Q22A 4LMZA 4FVCA 3MAQA 1IKYB 2XZWA 3CJSA 2ALYB 4N5SA 4PWDA 4DR3J 1RT6A 3AQOA 3SCKE 2ABYA 3OVBA 2AZ3A 1JLAB 1QD1A 2ASYA 1VQMS 4N77A 3FSIA 3X3UA 1PO6A 1RTJA 2KB2A 3K5OA 2C2ZB 4QOTA 4DBQA 4KKOB 3VVTA 5KG0A 4J9LA 1OYEA 2V2KA 3V6DA 3U7JA 2EC0A 2QA4S 4Y00A 3J7AN 4WZQA 2D69A 2HGLA 4PEOA 2CPHA 5ETRA 3MR5A 4WE1A 3UVJA 4JV1A 2CWKA 2IIHA 2IJRA 2MY7A 1HQ2A 2DO0A 5U47A 3GG0A 4DFMA 3M8WA 3H5YA 1ELOA 1HD1A 4PG7A 1OYDA 3NS7B 4OI2A 4FS1A 1HBUA 4JI7F 4EZ9A 5HVHA 2GVZA 4DUTA 5DETA 3I0SB 4C9DA 1DHMA 2GMLA 4QW9A 4G1QA 4DL5A 2OMOA 1VQLS 1HL6A 1LV5A 1ULRA 5T7LA 2HVZA 1H6KX 3V6DB 1HR0J 2WVEA 4IQMA 2IC3A 5FD1A 3KK3A 1F1BB 3VAIA 3RAXA 2M8DB 2KYXA 4B3RF 4DV6J 4ILMA 1HNVA 5HAOA 5KG7A 1FTRA 3QFHA 3WIUA 3R2CJ 2AT1B 1L3KA 4KYZA 1S6PB 4LRBA 3JTOA 5AXNA 1HWKA 3TEGA 3CCVS 1LKZA 5GAEU
chains in the Genus database with same CATH topology
4LFBJ 1I94J 5IT9U 2MQ8A 3J80U 4JI8J 4DUYJ 1N33J 2E5LJ 3W1YC 2KVQE 4LF9J 4DUZJ 4HHUA 2ZM6J 5BR8J 4DV2J 4LF8J 2UUCJ 2HHHJ 3R2DJ 4DR2J 4YHHJ 4X64J 2UXBJ 4KY3A 4JI3J 3D3CJ 4LF4J 4NEZA 5LM7E 2F4VJ 1XNQJ 3IMQJ 3T1YJ 2MTLA 4B3SJ 2KL8A 4JI1J 4LF7J 4X62J 2UUAJ 2VQEJ 4DV7J 2MEWA 3J81U 4RJVA 1XMOJ 1N32J 1N34J 4K0KJ 4LFAJ 4JI2J 4LF5J 4B3TJ 4DV3J 4DR6J 4JI5J 2UU9J 1J5EJ 4GKJJ 1IBKJ 3D3BJ 4OX9J 4DV0J 2UXDJ 4PWWA 4DV1J 3OTOJ 4LFCJ 1FJGJ 2UXCJ 4B3MJ 4DV4J 4NXMJ 5LMUJ 2UUBJ 1HNWJ 1XMQJ 4JI7J 5LMNJ 1IBMJ 5FLXU 4LF6J 4JI6J 4DR3J 1HNXJ 4X65J 4JYAJ 4DV5J 4JV5J 5A2QU 4DR5J 4DR1J 4V1Ak 1HNZJ 3J7AN 1XNRJ 3JAMU 4JI4J 1N36J 4JI0J 3T1HJ 4GKKJ 4DR7J 4X66J 4AQYJ 4NEYA 4B3RJ 4DR4J 1HR0J 4KHPJ 5AJ3J 4DV6J 4YY3J 2VQFJ 1IBLJ 5IWAJ 3R2CJ 4KYZA 4NXNJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFB J;  1I94 J;  5IT9 U;  2MQ8 A;  3J80 U;  4JI8 J;  4DUY J;  1N33 J;  2E5L J;  3W1Y C;  2KVQ E;  4LF9 J;  4DUZ J;  4HHU A;  2ZM6 J;  5BR8 J;  4DV2 J;  4LF8 J;  2UUC J;  2HHH J;  3R2D J;  4DR2 J;  4YHH J;  4X64 J;  2UXB J;  4KY3 A;  4JI3 J;  3D3C J;  4LF4 J;  4NEZ A;  5LM7 E;  2F4V J;  1XNQ J;  3IMQ J;  3T1Y J;  2MTL A;  4B3S J;  2KL8 A;  4JI1 J;  4LF7 J;  4X62 J;  2UUA J;  2VQE J;  4DV7 J;  2MEW A;  3J81 U;  4RJV A;  1XMO J;  1N32 J;  1N34 J;  4K0K J;  4LFA J;  4JI2 J;  4LF5 J;  4B3T J;  4DV3 J;  4DR6 J;  4JI5 J;  2UU9 J;  1J5E J;  4GKJ J;  1IBK J;  3D3B J;  4OX9 J;  4DV0 J;  2UXD J;  4PWW A;  4DV1 J;  3OTO J;  4LFC J;  1FJG J;  2UXC J;  4B3M J;  4DV4 J;  4NXM J;  5LMU J;  2UUB J;  1HNW J;  1XMQ J;  4JI7 J;  5LMN J;  1IBM J;  5FLX U;  4LF6 J;  4JI6 J;  4DR3 J;  1HNX J;  4X65 J;  4JYA J;  4DV5 J;  4JV5 J;  5A2Q U;  4DR5 J;  4DR1 J;  4V1A k;  1HNZ J;  3J7A N;  1XNR J;  3JAM U;  4JI4 J;  1N36 J;  4JI0 J;  3T1H J;  4GKK J;  4DR7 J;  4X66 J;  4AQY J;  4NEY A;  4B3R J;  4DR4 J;  1HR0 J;  4KHP J;  5AJ3 J;  4DV6 J;  4YY3 J;  2VQF J;  1IBL J;  5IWA J;  3R2C J;  4KYZ A;  4NXN J; 
#chains in the Genus database with same CATH topology
 1ZPV A;  3MAA A;  1XEZ A;  5T7L B;  4A48 A;  1UFW A;  1X4E A;  2YWH A;  4HLB A;  1F3F A;  1MN9 A;  1UVL A;  2EK1 A;  7FD1 A;  3QPI A;  3G71 S;  2IMW P;  1R8B A;  5B0G A;  2AYB A;  4LR8 A;  5H9E J;  2H5E A;  2FY1 A;  1X4F A;  4KH0 B;  3W64 A;  2CXE A;  2MQQ A;  2FTR A;  1UWA A;  2A2C A;  3LW5 C;  4C0H A;  2DR6 A;  3KJN B;  1YRT A;  4A47 A;  2CFX A;  1S1V A;  4ANC A;  4O4G A;  2L9N A;  3BYR A;  1VQ5 S;  2RQM A;  1OS5 A;  3MEC A;  4KPC A;  4QWC A;  2A6O A;  1PYS B;  1QTM A;  1UJ5 A;  3AFG A;  4EUV A;  3T5H A;  3S1T A;  2JLF A;  3SBM A;  5IWA F;  3GP9 A;  3OT9 A;  2JX2 A;  4FN5 A;  2VIH A;  4ECX A;  5F3Z A;  2IYI A;  1YK9 A;  2PC6 A;  3DC2 A;  2QRR A;  1FFW B;  4NZ0 A;  4OV6 A;  4DI6 A;  4J9Q A;  4DL4 A;  1XNQ F;  1FRH A;  3P3D A;  1RT3 A;  1FXL A;  3BSO A;  5A8W A;  4IFV A;  4TU7 A;  3ENQ A;  1AFJ A;  2CJX B;  1HNW F;  5IC6 B;  1UW4 A;  3P49 B;  2AJ4 A;  4GVB B;  5KFY A;  4ECY A;  3QBC A;  2DH8 A;  2ZH2 A;  3MEC B;  2VU5 A;  2HRT A;  2ASJ A;  2IBK A;  2VH7 A;  3HMJ G;  4LFA J;  4OX6 A;  4DHV A;  4AL6 A;  2ZZM A;  3GR1 A;  4MKY A;  1P8G A;  2XBP A;  3KHR A;  1BQM B;  4YME A;  2L9W A;  5D4O A;  4B3T J;  2QG9 B;  3I0R A;  1VBZ A;  2FC9 A;  2VA2 A;  3BGR A;  3FC9 A;  2FHJ A;  1FWP A;  4WK1 A;  5GAG I;  1SUQ B;  4WJB A;  4ZP6 A;  2LEA A;  3KK1 B;  4ZIW A;  4URS A;  4ZPB A;  1S6Q A;  3BJY A;  1ICE B;  1T11 A;  1VQ6 S;  1HBO A;  1SC3 B;  1TL1 B;  4QYR A;  3BR9 A;  2EVZ A;  3K59 A;  3KLG A;  3NNH A;  2XMW A;  2M3D A;  4UUW A;  1FRX A;  2WRM A;  2D3U A;  5MAO A;  2VOD A;  4KHM A;  3UFC X;  4OQJ A;  5J2N B;  3BQ1 A;  4B3M J;  4TYB A;  1OPZ A;  4CO1 A;  3X1L B;  3SIP B;  3EJM A;  1Y4Z B;  1E6V B;  2BKO A;  2OLW A;  4L76 A;  3AD7 C;  1AZS B;  2YNH B;  2OGU A;  1GT8 A;  2ZHA A;  4IUF A;  2VBY A;  2Y1R I;  2VDH A;  4UQG A;  4WK3 A;  3HHD A;  4RKU C;  5F0U A;  5J1E B;  2FJD B;  2V9K A;  3CED A;  4DCJ B;  1N48 A;  2PA8 D;  4Z7Y A;  1VI7 A;  4H4M A;  2NYH A;  2V67 A;  5DZ6 A;  1VOM A;  1HKA A;  4DN9 A;  3PZP A;  2XI2 A;  4JV5 J;  3DRS B;  3H2U B;  4USI A;  4CLS A;  4DX7 A;  2CPD A;  3Q8S B;  1HHQ A;  1N33 F;  1T94 A;  3PYG A;  2J7U A;  2I1R A;  2LYV A;  2E5J A;  1IKV B;  3M8Q B;  4LSL B;  4RLE A;  3TRG A;  5GMK a;  3RRG A;  4LF4 F;  1VQO S;  1PCA A;  3D68 A;  3EUN A;  5CXT A;  1RTZ A;  1N5Y A;  3EGZ A;  3TW0 A;  2KXF A;  1CJU A;  2V34 A;  2BKP A;  2QL5 B;  3CD7 A;  3N4W A;  2X7I A;  5BYQ A;  2UV8 G;  3TUJ C;  4ATN A;  4B17 A;  3HFV A;  4QPT A;  3DNC A;  5HK4 A;  3BDP A;  2Y1L B;  1VQN S;  4H4M B;  2NRE A;  3TUI C;  3E8O A;  3ZTO A;  2VKZ G;  1KVK A;  3LGM A;  4M5N A;  2K3I A;  2LEB A;  1GMW D;  2C28 A;  3M6W A;  1NJW A;  4CT9 A;  4Q43 A;  4DR4 J;  1ZA2 B;  1UTA A;  4I2Q A;  1AUS L;  2KFN A;  1HBN A;  3ADA C;  1F9E B;  3MEE B;  4DL0 C;  3UN3 A;  2R7R A;  2LQ5 A;  4JB8 B;  3ETO A;  3CCR S;  2DD8 S;  1GFW B;  1SB6 A;  3FRZ A;  3TOQ A;  1HWJ A;  6FD1 A;  4EBC A;  2UVV A;  1VQP S;  3PG9 A;  2DCU B;  4NPO A;  3L9Z A;  3LPE A;  4NCA A;  2DGQ A;  3BS9 A;  4FPR A;  5HL7 Q;  1VCT A;  4F36 A;  4WU2 A;  1TL3 B;  3HUL A;  3BSN A;  2Q43 A;  3CC7 S;  1S4F A;  4LBP A;  2ZUA A;  2QLJ B;  1RTH A;  3EVW A;  4LF7 F;  4DDF A;  2JJ4 D;  3IAM 9;  2UVW A;  1FDN A;  3G82 B;  4DPO A;  1WG5 A;  2ZNY A;  2L08 A;  3EIC A;  4DQR A;  1FJE B;  1FVQ A;  5THW A;  2R8G A;  2R9L A;  4QU6 A;  1NPP A;  3M2V A;  4C8Z A;  3A12 A;  2BV3 A;  3NAH A;  4IRD A;  3KHH A;  1NDC A;  3JQK A;  3QGH A;  1WTB A;  3W2W A;  4FYY B;  3JTN A;  2F9J A;  2COL A;  4WE1 B;  2GA7 A;  2YH0 A;  3OR1 A;  5C2G A;  2W9B A;  5IC4 B;  2HVE A;  4JI2 F;  4EYI B;  3QRQ A;  1RWU A;  4DV1 F;  3FRY A;  1EQ0 A;  5KT5 A;  3C14 B;  4DS5 A;  4NL5 A;  1GTE A;  2D7S A;  3ENW A;  3DLJ A;  2WON B;  2NR0 A;  1H0H B;  4D3G A;  3R6L B;  4NX9 A;  3MD3 A;  5GAD I;  3MXH P;  1S99 A;  2MTL A;  3K8V A;  2KL8 A;  2KRR A;  2YX1 A;  4DQS A;  2OUG A;  1HAR A;  1KOH A;  2KJW A;  3C8Y A;  4IH6 A;  3SFU A;  3AD9 C;  3GV7 B;  9ATC B;  2Z57 B;  1RKI A;  2R3V A;  1IKX A;  3H5S A;  2BUN A;  2IDE A;  4P72 A;  3HF5 A;  4TN2 A;  4ZVP B;  5HAN A;  5M2U A;  1Q4R A;  1TKZ B;  2HFV A;  2MYF A;  2N4D A;  3BGF A;  4FDF A;  1FJC A;  1EIY B;  1FDD A;  1UL3 A;  1R6V A;  3C6T B;  3NGU A;  4PG4 A;  5HMW A;  3AOC A;  4BS2 A;  3RBX A;  5CYJ A;  1S4E A;  1T9X A;  3P5B P;  4OZ0 A;  4WII A;  3H90 A;  1YBA A;  1RXO B;  2VOO A;  2YXL A;  2Y9H A;  2GO9 A;  3A3O B;  4DV3 J;  2HRU A;  1WSR A;  4JI5 J;  2R7S A;  3OTB A;  2B9X A;  4DL3 A;  2CYY A;  2WVF A;  2PSZ A;  5EHH A;  2ATL A;  4RW6 A;  4YS2 A;  2YWE A;  3ZZU A;  4D3H A;  3CDA A;  3UD4 P;  1ACM B;  3PW0 A;  3QWP A;  5D0H A;  2JLG A;  3RB0 A;  3KLI B;  4DPT A;  2J8S A;  2ZWP A;  4FKX A;  5KFI A;  3W3S A;  3PW2 A;  3DRP B;  1KFD A;  2WOM A;  4OHX A;  1XC9 A;  4NXN F;  1CVJ A;  3MTK A;  2W2Q P;  3O44 A;  5LMU J;  4NXM J;  2FLL A;  4F2S A;  1HNW J;  4PQU A;  4WKR A;  3PJW A;  1U1L A;  1D0E A;  5LMN J;  2V8D A;  2W7O A;  5EN1 A;  2P2C B;  1U6F A;  2OKQ A;  1KVJ A;  1RT6 B;  4QZV B;  1U26 A;  2MQP A;  3POT B;  2MZR A;  5E41 A;  1NK0 A;  1UVN A;  2AYG A;  4RL1 A;  1YG0 A;  1BQN B;  4K4T A;  4IH7 A;  2BX6 A;  3PO4 A;  2GHP A;  4M5D A;  3HFK A;  1DQ9 A;  2JDJ A;  4XDD A;  1WNE A;  2NSB A;  4FPI A;  5E33 A;  5HJY A;  1N56 A;  1K0T A;  3LF0 A;  3FMB A;  4OYP A;  1GK8 A;  2NZC A;  2IMO A;  4O4R A;  3OTO F;  1Q86 T;  2GQC A;  2GHV C;  2E5G A;  2N3L A;  4CM2 A;  3G6X A;  4B3M F;  5CHC B;  1TR0 A;  2JOQ A;  1LWE A;  4YN3 B;  1T9V A;  3TAQ A;  3M32 B;  2XM3 A;  4JI0 J;  2W2P P;  2YKQ A;  4HH1 A;  3CJK B;  3NLC A;  1JJC B;  1W25 A;  1PC4 A;  4QU7 A;  2SXL A;  2ZDO A;  3D4J A;  4OYM A;  1RKJ A;  2CQ1 A;  1TZ0 A;  2GHW A;  2U2F A;  3GJT B;  4DQQ A;  1S6Q B;  3IBC B;  4DSE A;  2W7A A;  2EFQ A;  2VF3 A;  2XWX A;  3PFE A;  4OYB A;  2DNY A;  5ETK A;  1I6J A;  4IRK A;  4QIW D;  1TFW A;  3RYL A;  4AE5 A;  3MOZ A;  2WZ1 A;  4MK7 A;  2ZH5 A;  1SV5 A;  3TJA A;  1UA0 A;  4A46 A;  2KYZ A;  4K4X A;  2AQ4 A;  3HJV A;  2HQF A;  1JNR B;  4Y28 C;  1TL5 A;  2DNP A;  3N79 A;  3JYT A;  4A4J A;  5HN0 A;  4PYA A;  2VFV A;  4FXW A;  3GE9 A;  1FKA F;  2JVO A;  4B3O A;  2DGO A;  4KGV B;  3VQT A;  3PR5 B;  2HHT A;  5HMX A;  2JC0 A;  4HHU A;  1RQ0 A;  4WF9 Q;  4N8N A;  4F4Z A;  3TEH B;  3S01 A;  1XK8 A;  5KFS A;  2G9O A;  2HMI A;  3O2I A;  3D0H E;  2DGW A;  1P6T A;  2IM3 A;  4ITS A;  4YR2 A;  2DIT A;  1L3T A;  4PCQ A;  4LF6 F;  3R2D J;  1B0P A;  2BEF A;  1YX2 A;  3TO8 A;  4KPY A;  1LW0 A;  2NS1 B;  3MUV P;  4CLT A;  2HHV A;  4ED8 A;  3FEZ A;  2GV1 A;  3OD2 A;  5L46 A;  4ECV A;  4LSN A;  3OL6 A;  2LQJ A;  3JSM B;  3GII A;  2H9Z A;  2EBE A;  5KFV A;  4NLT A;  4FZV A;  3T1Y J;  4E0D A;  2ZD1 B;  3AD8 C;  4N8O A;  4ZVR B;  1NK6 A;  4JV2 A;  2XLK A;  3C3L A;  5KG1 A;  2B9Y A;  3V4I A;  4I56 A;  4DV7 F;  5A8W B;  5IZH A;  2VOP A;  3UCZ P;  4K4U A;  2FHO B;  4DZ6 A;  3GIM A;  5KFL A;  2W9C B;  4LBI A;  2RE1 A;  1S0O A;  2BW2 A;  2C3M A;  2LQ8 A;  4BHQ A;  1RK8 A;  4DR7 J;  1LW0 B;  4PR6 A;  4FF1 A;  2V50 A;  1VQ4 S;  2J5A A;  4PG5 A;  3KXD A;  1RSC A;  5DG8 A;  4U8V A;  5DQI A;  4LSN B;  5AE1 A;  1T05 A;  5B0B A;  5HSP A;  2CWX A;  2X3D A;  2CPE A;  3SDE A;  3GIK A;  4JI2 J;  3MED B;  2VJU A;  2XMV A;  1RDR A;  2Z58 B;  2IRX A;  4ID5 B;  5F8G A;  1RAE B;  1MN7 A;  3HI9 A;  5ETQ A;  1FRL A;  1UET A;  3AOB A;  3D67 A;  4C3L A;  4YUD A;  3VAH A;  2UU9 J;  4G3I A;  1YJW S;  5HRO B;  5KFU A;  2FVC A;  2V0N A;  1OMS A;  5I3U B;  5LJ5 Y;  2P9C A;  4X65 F;  2UXB F;  5LXR A;  1LWF A;  2CIM A;  3IWL A;  4KO0 B;  4CM0 A;  2WK4 A;  2X1G A;  2JEJ A;  3TZW A;  5IFM A;  2BAN B;  2GQQ A;  3L09 A;  2O67 A;  3RTV A;  4V19 J;  1I3O B;  1WDD A;  2F4V F;  1Y7P A;  2J8A A;  4KJI A;  2NCK L;  1SL0 A;  1KVI A;  1PJ5 A;  4V19 X;  2IM1 A;  1DUR A;  1GXL A;  3DOK A;  3EM1 A;  2GQ2 A;  4RW4 B;  2WSC C;  4I6Y A;  1ZH5 A;  1K0V A;  2KVI A;  3TWZ A;  1KKH A;  2RUG A;  1M0S A;  2B3T B;  2WW8 A;  3CGI A;  4QR2 A;  3GV5 B;  3NBP B;  4DF4 A;  3MM8 B;  3CWJ A;  3R6G B;  1UPP A;  2AEM A;  3FSX A;  4P2F A;  2VA3 A;  3L95 X;  2VD3 A;  3PAC A;  3CCU S;  1CQM A;  4M5J A;  3D0G E;  3KMQ A;  5H1S V;  1RHJ B;  2OP5 A;  3BSC A;  4OZN A;  5B7W A;  1Q7L B;  2E5H A;  1IJF B;  1PAU B;  3I82 A;  1CS4 A;  1RT4 A;  3O5T B;  2EKY A;  2VC0 A;  3BN7 A;  2LXF A;  4XPC A;  4LF9 F;  2G4B A;  3PM9 A;  3W5Z A;  2IAJ A;  2G2Z A;  4KRW A;  1R8P A;  5IV4 A;  2GMH A;  2VB6 A;  4ZKA A;  5EWG A;  2ZWO A;  1U09 A;  2OSR A;  3EVO A;  4PWD B;  2FUG 9;  2CQ3 A;  2MZS A;  1GH8 A;  2HND B;  2VIC A;  2B4V A;  4JI4 J;  1FWK A;  1RAI B;  3CC2 S;  3K17 A;  1YBU A;  2WB4 A;  3EGW B;  3FDS A;  1F9H A;  1B99 A;  4J9M A;  3KYL A;  2J6U A;  2MPU A;  1C0U B;  2AF6 A;  4XK8 C;  4IOA Q;  4RPF A;  4NLR A;  2VQF J;  2P9G A;  2VPX B;  3HO1 A;  3WX4 A;  2NXU A;  4ANE A;  1YJN S;  5KG2 A;  1TAQ A;  3H4D A;  1NHV A;  4CLL A;  1HBU B;  2LXU A;  3K0J A;  2RNE A;  2HS4 A;  3CJ8 A;  4TNO A;  4NLX A;  4ZJL A;  4ES3 A;  2BE2 A;  4CLF A;  3ELH A;  4K4V A;  3IR6 B;  3QRP A;  2K06 A;  4IG0 B;  3A4T A;  2GIR A;  4DFK A;  2ZFH A;  1FRI A;  3QT8 A;  3K2Y A;  1JMT A;  3A3P B;  3PIO Q;  2GO8 A;  2DR9 A;  1H2T Z;  1HPZ A;  2O1P A;  5C25 B;  2V68 A;  3PX0 A;  4NCG B;  5J2M B;  3CJ0 A;  3Q89 A;  1CJT B;  1OSD A;  4WWS A;  2R8J A;  3K5L A;  4ILL A;  2OPP A;  1HQE A;  3MMA B;  1S9E B;  4I6A A;  3IBF B;  4KGX B;  4YR3 A;  2QGF B;  3OVS A;  2FVS A;  1HD0 A;  2D74 B;  4CLW A;  4NEZ A;  1RTI A;  4DS4 A;  4ER8 A;  2J0Q D;  2F4V J;  1HYS A;  1RT1 A;  1FRJ A;  2KHC A;  4LF1 A;  4CH1 A;  3D2W A;  3NWG A;  2AGP A;  3CME S;  4B3S J;  4Y65 A;  2Y3Y A;  3OSN A;  4X2B A;  4J9O A;  1TAU A;  3DLL Q;  2ZH6 A;  3GFZ A;  4P2M A;  3BQ2 A;  2JNJ A;  1OSC A;  4LRE A;  1CSJ A;  2AGO A;  3O1L A;  2FJA B;  4WXO A;  3UD3 P;  2HNZ B;  1PIE A;  1IM4 A;  1ZM9 A;  2WB1 D;  3FQK A;  3LP0 B;  4ECS A;  2B8P A;  4NA1 A;  4OHY A;  3IBW A;  1TP7 A;  3J81 U;  5L1K A;  3H25 A;  4QWE A;  4DCO B;  2W8K A;  5KG3 A;  1Q5Y A;  2MLX A;  4DXL A;  1VFJ A;  3GQC A;  1WTF A;  3UPF A;  3KLH A;  2GMJ A;  2KU7 A;  1I94 F;  2HAF A;  1JWW A;  4OJ1 A;  4PZV A;  5JUM A;  5CA5 A;  2MJU A;  3HZE A;  4P2S A;  5GAH I;  4OZ5 A;  2EFN A;  3CF5 Q;  1KTQ A;  1WOR A;  2YKM B;  3R5A A;  3TR5 A;  3M6V A;  2DXD A;  3V81 B;  4UZC A;  3VWS A;  4HYK A;  3P6Y C;  4LFC J;  2OD4 A;  4L3K A;  2F8M A;  2J7K A;  2I9S A;  3FCV A;  4ZJQ A;  4F0M A;  1S72 S;  1N54 B;  3UNY A;  1NSA A;  3EZU A;  4ZCK A;  1FNM A;  2WVB A;  1RYS A;  1ZS6 A;  5B0E A;  3MUT P;  3TAM B;  4YP3 A;  1NK4 A;  1IBM J;  5F8L A;  1LNQ A;  3LWL A;  4LF5 J;  2EWH A;  3WDO A;  1O0P A;  2G1H A;  1FRK A;  4K5R A;  3VAF A;  3ULH A;  5D6G A;  2XO6 A;  3ENA A;  3OL8 A;  1DRZ A;  3R5J B;  1O51 A;  5A2Q U;  3KOA A;  3V4I B;  1IQT A;  2QMU B;  1CG2 A;  1JJH A;  4AFF A;  4ICL A;  4AD6 A;  2QZ8 A;  3H5X A;  1MWZ A;  2RHQ B;  3NEK A;  1Q7Y T;  1Q78 A;  2E1R A;  3M8R A;  1YJ9 S;  1T3N A;  3M8Y A;  4DLE A;  3QAT A;  3IA0 A;  3IRX B;  3QMQ A;  5AXM A;  2QSF A;  4Y3C A;  4WFN Q;  3GYX B;  5FLX Y;  3G6Y A;  2DR8 A;  3RB3 A;  3RR8 A;  4WPA A;  4ID5 A;  4EEY A;  1H3D A;  3TUP A;  4ED4 A;  2IBO A;  3OHA A;  5J1E A;  5GAH U;  2FJE B;  3DXB A;  4LIW A;  3VAJ A;  3C19 A;  2OTL S;  1N88 A;  5HRO A;  3N28 A;  2QA2 A;  2QL9 B;  1NSP A;  2AU0 A;  3NNA A;  4URQ U;  2DT9 A;  3W63 A;  3MEK A;  2GAH C;  4F2R A;  2E29 A;  3IM9 A;  4QIE A;  4IDK A;  2MKC A;  2DNK A;  3DU6 A;  1SJ4 P;  1IBL J;  3PR4 A;  4PKD B;  3IRX A;  3HM9 A;  1XMB A;  4G1I A;  4R25 A;  4USU A;  2RB7 A;  3UD5 A;  1RI7 A;  1TL4 A;  2C2N A;  2VHG A;  1T03 A;  3V2U C;  3J7A 1;  2XHC A;  3KJF B;  1XQI A;  3O6Q A;  4TYA A;  2KI2 A;  2WBM A;  4ZP7 A;  2BDP A;  2EFV A;  3NGK A;  2HWH A;  1I94 J;  4DV0 F;  1WG4 A;  4B3O B;  2DHA A;  2FHK A;  3I96 A;  2KFY A;  5HBM B;  2HK3 A;  1N33 J;  1JB0 C;  1SJ1 A;  2ACY A;  4F4X A;  2E5L J;  1TKD A;  1A9N B;  2OPQ B;  1FX4 A;  1HBN B;  5F3T A;  3UN5 A;  4B3T F;  3LGH A;  1T9W A;  2HNY A;  1U49 A;  3PO5 A;  3R5D A;  3D0I E;  4BCA A;  4K5S A;  1HNI B;  1S0M A;  4ENO A;  3UDC A;  2XSF A;  5E3R A;  3CCW A;  5JJB A;  1DY3 A;  1F3V A;  3EDR B;  3ONQ A;  3MZI A;  5KT7 A;  3BO3 A;  3DLE A;  2HHP A;  4F7V A;  1B70 B;  4J9K A;  1VQK S;  2DIU A;  1IKW A;  3CDB A;  5F0W A;  1VBX A;  2B9E A;  2V2Z A;  1K9M T;  5EWF A;  1DJ0 A;  3WC2 A;  1IR1 A;  3MPY A;  4PRF A;  2VZ9 A;  1S6U A;  1WEX A;  4QCL A;  3RJM B;  5LOQ A;  2M70 A;  1L3U A;  4ZPW R;  5H9F K;  2J9E A;  4MH8 A;  2E66 A;  3W2W B;  2PEH A;  3VZH A;  4RUC A;  1RWW B;  5E2Q A;  5BXI A;  3OR1 B;  2ZEJ A;  3T1H F;  1T9Y A;  2DNG A;  2FB0 A;  5G0R A;  4FYV B;  4NML A;  3Q8P B;  1CJK B;  3D6F B;  4XAK A;  4OI4 A;  2D3O R;  1NK9 A;  1URR A;  1VGY A;  2BJD A;  3FMW A;  5K20 B;  2DGS A;  1NZA A;  4DR6 J;  3PRV A;  2OFH X;  3TP2 A;  3HPO A;  2X51 A;  1JLC A;  3QFW A;  3B6B A;  2F3J A;  4HR2 A;  4IG0 A;  4NZ6 A;  2R7V A;  5C2C A;  4HHH A;  2BQ3 A;  1AA1 B;  1MWY A;  4JUZ A;  5F9L A;  1S7I A;  2IHR 1;  2MJN A;  3NXZ A;  4EWT A;  3RBE A;  2E5I A;  5DM7 Q;  1FJG J;  1BC6 A;  1CUL A;  1VK3 A;  4OYW A;  1IBM F;  1TK0 A;  5AE3 A;  3K58 A;  2R8K A;  2OPP B;  2NSC A;  3MMA A;  4I68 A;  2QEX S;  4X84 A;  2CNO B;  2C3O A;  1WUU A;  3BGL A;  3FVY A;  1TK5 A;  2P8I A;  1FF2 A;  1YI2 S;  2KT5 A;  4OJH A;  1GNK A;  4M63 A;  3ZTP A;  3V5R A;  1SJF A;  2MHN A;  2V8G A;  3I0S A;  5C5J A;  1UW9 A;  1U1M A;  2YNF A;  4WFA Q;  3PW5 A;  1HI1 A;  4C8O A;  3NCP A;  1YLX A;  4LFA F;  3KJV A;  3SV3 A;  4B9N A;  2QMX A;  2IC3 B;  3CJ2 A;  4KV8 A;  3KK3 B;  2Y8Y A;  1K47 A;  4ZDN A;  5CD4 H;  3N6N A;  2GNK A;  2KRB A;  2NUU G;  2E1P A;  2FZG B;  1NK5 A;  3KUE A;  1OIA A;  4IG3 A;  3DLK A;  1NO8 A;  3Q8U A;  3U1N A;  1E6Y B;  4LRC A;  4AXJ A;  1D3W A;  4I4B A;  3CMA S;  4CO3 A;  5F9N A;  1R0A A;  2CJB A;  3PNI A;  2YKO A;  4PQU B;  1AT1 B;  4LRA A;  2Z56 B;  4OI1 A;  2H4Y B;  3VGT A;  2YNF B;  2GCF A;  4C8N A;  4Q45 A;  1ZPW X;  1FHT A;  1BWE A;  1WC6 A;  2MQO A;  1MLA A;  3N5B A;  4WP8 A;  3ZZZ A;  3RB4 A;  1TKT A;  1UVJ A;  4B3R J;  4WFY A;  1V3R A;  4K59 A;  4ZPT R;  4DR3 F;  5CYQ A;  1RWP B;  2CQ0 A;  3LAN A;  4DEZ A;  1GX6 A;  4K8R A;  2HVI A;  3ILJ A;  5CAB A;  4DL6 A;  4WP3 A;  3NP5 A;  1REG X;  1PAE X;  5CH7 B;  4UOH A;  1NCL A;  2CRL A;  4O4G B;  4OFZ A;  1IWG A;  4JV0 A;  1YDL A;  4USM A;  4UZB A;  3Q0A A;  3KHL A;  3W7B A;  4O3P A;  3L7O A;  5LSL A;  1WKJ A;  3H7H B;  3N6L A;  3MM7 A;  4OZ2 A;  2IRU A;  3GMG A;  3Q8V A;  4K0K F;  3ICL A;  3K5P A;  2DTJ A;  3OFG A;  2IJN A;  1HBM A;  1JXE A;  1SJR A;  1FFS B;  1WI6 A;  4EK2 A;  3OUY A;  1QVG R;  1GMU A;  4U95 A;  3QAE A;  2BVZ A;  4MFB A;  1RAJ A;  2CPZ A;  3PIP Q;  3PX4 A;  2BXJ A;  2BJ1 A;  1X0P A;  2FJB B;  1YGY A;  1XTZ A;  2MKS A;  3MTJ A;  5BR8 J;  4DV2 J;  5KT6 A;  2HS3 A;  3FSY A;  5T41 A;  4ZHR A;  1S12 A;  2FY8 A;  2YKP A;  2CUY A;  4BBY A;  1KEK A;  3W5X A;  5GAE I;  2KG1 A;  3UDL A;  1OJ4 A;  1Y9O A;  1N5Q A;  2B6A A;  1YVF A;  2BRK A;  4G6V B;  4J9U E;  4EYH B;  2AIR B;  1FKO B;  3NRB A;  3TAR A;  4KY3 A;  4P7T A;  2C22 A;  1Y5N B;  2CDR B;  3FEX B;  1IM6 A;  4C0B A;  4TLQ A;  5A76 A;  1XNR F;  1GXT A;  1RT1 B;  1FDA A;  2QLF B;  3FK4 A;  4YB5 A;  5LM7 E;  4Z2X A;  1Y5I B;  4KE5 A;  3EX7 B;  2AW0 A;  1XNQ J;  1EJ7 L;  1R6Y A;  3BGR B;  3NAI A;  4OYZ A;  2CQH A;  3W9I A;  1QY7 A;  2ACM A;  2ADC A;  3HKZ D;  1MW7 A;  1U6Z A;  3JTP A;  4JI1 J;  2QYC A;  2J76 E;  2RUS A;  2Z0G A;  4OX8 A;  3F41 A;  4DQP A;  4TY8 A;  3M2U B;  3KK2 B;  2G0I A;  1SJQ A;  5DJB A;  3QSI A;  3HJF A;  5KFK A;  4DR1 F;  5GME A;  4X4Q A;  4DSI A;  1R8C A;  4ZJO A;  5IQQ A;  3FQL A;  5I3Q A;  5KFD A;  1F60 B;  4ZVS B;  2UVU A;  3EE3 A;  1Z1Z A;  1QVF R;  2FVQ A;  3BDE A;  4F3O A;  3TUZ C;  2NPF A;  1FER A;  1KC8 T;  2G2O A;  1N6Q B;  4E2F B;  3CIM A;  2VJV A;  1WKL A;  1HR0 F;  2B5J A;  5D4L A;  5KFW A;  1T8E A;  4DR5 F;  4NLG A;  2JZ5 A;  1RT5 A;  1RBA A;  1R8A A;  3RBZ A;  3BO4 A;  1D8Y A;  1NKE A;  1S76 D;  3QZ8 A;  1JLG B;  1WF2 A;  5I4M A;  1B7Y B;  3ET6 A;  3DCA A;  4BLG A;  4ED1 A;  1FD8 A;  4WCE Q;  4CIO A;  4CLZ A;  2WCX A;  4U7U D;  5ETP A;  3BSA A;  3IN5 A;  5M2R A;  1CJU B;  3VAG A;  3ZZO A;  5A8K B;  4J9P A;  4USJ C;  3UWT A;  3TA2 A;  1NJY A;  1WWH A;  1RBL A;  2VPW B;  3TX0 A;  1X4C A;  4P2X A;  4RW7 A;  3M4X A;  1G4C A;  5DLG A;  4U96 A;  5A6W A;  1APS A;  3BBC A;  2ZC4 A;  1QJH A;  1LWC B;  3DRX A;  3BH7 B;  3ILI A;  2Z2Y B;  2BM1 A;  2N82 B;  2E9T A;  2JEI A;  3BKF A;  1TFY A;  3GYN A;  3ET6 B;  1VQ9 S;  4YY3 F;  4BC9 A;  5I3U A;  2HIQ A;  3W9H A;  3PCO B;  1WEY A;  2E1M C;  1YJU A;  2G0J A;  4YB6 A;  2V63 A;  5GMD A;  3T9Z A;  3HVA A;  2X3G A;  4F26 A;  3KFW X;  2OFG X;  2YBV A;  4FYW B;  4J37 A;  4MK8 A;  4PYD A;  3TZY A;  4CO5 A;  2OI2 A;  2JC1 A;  4L73 A;  3T19 A;  1NEE A;  3ZC4 A;  3TAP A;  1DZ5 A;  4TU8 A;  1P1L A;  1VHF A;  2DNM A;  5KFT A;  4FBU A;  2LMI A;  1RAD B;  2VG5 B;  2YY3 A;  3CCL S;  2UU9 F;  2NUH A;  4DPY A;  4RNF A;  2PDA A;  3W61 A;  1BXN A;  2OEJ A;  1KWM A;  2AX1 A;  2MLY A;  4DPW A;  1S6O A;  3MCS A;  3VAL A;  4A8Q A;  1H7X A;  4BDP A;  2IA0 A;  4WFB Q;  1OO0 B;  4H4K C;  1CQN A;  1FKP B;  4KB7 A;  2XCP A;  3MMB A;  3LP1 A;  1YTY A;  4P75 A;  1V9O A;  4MKV A;  4F25 A;  1NJZ A;  1LFP A;  5K9F A;  1MSW D;  1TEL A;  4JBC A;  2HFS A;  3T5J A;  2AEJ A;  4NXN J;  4DX8 H;  4EI2 A;  3NOC A;  1X9S A;  2FC8 A;  5IM0 A;  1BY9 A;  3VGV A;  4ILR A;  2ROG A;  4OZJ A;  2R7W A;  2WW4 A;  3KDO A;  2MKI A;  1Q82 T;  3K57 A;  1TUG B;  4ELV A;  1RAC B;  2F8H A;  1V3S A;  1R31 A;  4N47 A;  5BR8 F;  2POK A;  3PKM A;  1T7P A;  1FCA A;  2XYH B;  2W25 A;  4A8O A;  3P8B B;  3D9B A;  1TL7 B;  5EX3 A;  3P45 B;  3OSP A;  4DV4 F;  1U1Q A;  3DHX A;  2HFO A;  3ETM A;  3DLH A;  4I67 A;  4ZP9 A;  2A1B A;  2WTF A;  2P9E A;  1C0T A;  1E6Y A;  1SQE A;  3C66 A;  3QYY A;  5C42 B;  5KFJ A;  4B9U A;  1FK9 B;  5A6P A;  4DFP A;  2J9C A;  2OAU A;  2QE5 A;  2H54 B;  3DOL A;  3H2L A;  2UXB J;  4YOE A;  1S1V B;  4Q7A A;  1Q8K A;  1UWB B;  1AXQ A;  3JAM Y;  2MKJ A;  1HQU B;  3KLF B;  4E98 A;  2PI5 A;  1K1S A;  1IKY A;  3QT7 A;  4U8Y A;  2ZZN A;  5L1J A;  2H48 B;  3I87 A;  1SC6 A;  1WEL A;  4Z7C A;  6AT1 B;  4J9R A;  5J1P A;  4WXW A;  1OY8 A;  3OFE A;  2RIL A;  4GMK A;  4ECR A;  3N01 A;  2EBG A;  2PGC A;  4ZPD A;  4QWB A;  1N36 F;  1AB8 A;  3DYA B;  2RDD A;  4LF7 J;  3FZ2 A;  2CJ9 A;  1ZOT A;  2OEM A;  5KFA A;  4KKO A;  1RT3 B;  3DRP A;  1A0O B;  2VL1 A;  2WOM B;  4I1T A;  5C42 A;  2EFP A;  5DDP C;  4HI2 A;  3AHP A;  3WQP A;  4DU8 A;  1H98 A;  3UVJ B;  3OTD A;  2MEW A;  2QN6 B;  3AA9 A;  3TVK A;  5C25 A;  2ZH9 A;  4ZLJ A;  3CXC R;  3E01 B;  1EX8 A;  3E51 A;  2BOA A;  2JH3 A;  3CJ5 A;  1TU0 B;  2C42 A;  2WVC A;  2BOP A;  2H3E B;  1PSD A;  1T3O A;  2F8E X;  4K2J A;  4LQ9 A;  1LEO A;  1FFG B;  3Q86 A;  3SCJ E;  4E8U A;  1HYS B;  3TAN A;  2CQ2 A;  3A8K A;  2V94 A;  3OUY B;  3GFH A;  2I2Y A;  4ZVH A;  2ZBC A;  1J5E J;  1F2G A;  1S1T A;  1BQN A;  1VRT A;  2XZT B;  2A3J A;  2DHG A;  2Z4P A;  4I2P A;  3OLA A;  1DAX A;  4C8L A;  1SKR A;  2VDI A;  4OZL A;  3LH2 S;  4QYZ K;  3KNA A;  4XTT A;  2VPY B;  1Q0N A;  2GJF A;  4A8M P;  1TQL A;  5GAD U;  2W7P A;  3QID A;  1RT7 B;  4PG6 A;  1TUV A;  4NRU A;  1SPB P;  2VBX A;  3R3T A;  4QJV A;  5ETT A;  4TKT A;  1RTD B;  5KTQ A;  4IOB A;  4UUX A;  3GJQ B;  1S0N A;  4JI8 F;  2MHE A;  2LU2 A;  1S1T B;  3I32 A;  5CCL A;  1I5O B;  3G86 A;  3MM9 B;  4WIQ A;  2OHD A;  3HHL A;  2FJW A;  3DLG B;  1XER A;  3LAL A;  1KQF B;  1S77 D;  4ED5 A;  4FKY A;  3LUY A;  1RGV A;  1J27 A;  2DNR A;  1PKU A;  2MZQ A;  3BKT A;  1N8R T;  1B64 A;  5K14 A;  3OR2 A;  2E1C A;  1NZ8 A;  3TVZ A;  1KRP A;  3MMC B;  4B9L A;  1SQG A;  4OYA A;  3V4M A;  1NPR A;  3PX6 A;  2KO1 A;  1F5B A;  2YVS A;  3MAH A;  1LW2 A;  1N5T A;  4KHP F;  4UT4 A;  2BJE A;  2J9D A;  2R8I A;  3QRR A;  4QBU A;  3B4M A;  1HWU A;  3ISN C;  4Q0B A;  4GRS A;  1SC1 B;  1IR0 A;  5EDW A;  2NZ4 A;  1PC5 A;  3AB2 B;  1IVZ A;  4X66 J;  1V5I B;  1PIL A;  2LKZ A;  3IS9 B;  4TQS A;  1C1B A;  4ID8 A;  1S1X B;  5HMZ A;  1OQ6 A;  3UDV A;  3IGV A;  2NXJ A;  2J9D E;  2H65 B;  3OR2 B;  4KGM A;  1Z2Z A;  3CCT A;  4LUB A;  1EKS A;  3D6T B;  2XUL A;  4CI0 B;  4ZN3 A;  4O44 A;  3T6B A;  4C98 A;  4O23 A;  4ZPA A;  1EP4 A;  2RJZ A;  1LW2 B;  4M5M A;  4YY3 J;  1BHN A;  4X4P A;  1KLN A;  2AKW B;  2Y0B B;  1S0V A;  1ZM4 A;  3PV8 A;  2KZZ A;  3MDF A;  1RBO B;  3FGV A;  2YNI B;  3DGP B;  3HSJ A;  4H4O B;  1JLF A;  1NAQ A;  3L3C A;  2XS7 A;  3OVA A;  4NYO A;  3KMS A;  1P9Y A;  3M9N B;  2V4Q A;  2LFV A;  3RRK A;  4UW2 A;  1C1B B;  5B0F A;  2LDY A;  4X4O A;  1YQH A;  3ZNJ 1;  2Q79 A;  2ZH7 A;  3R1L A;  3C16 B;  5E7O B;  2XI3 A;  5B0D A;  2PT0 A;  4LF9 J;  1KHV A;  3FUY A;  3T1A A;  2MQL A;  2QV6 A;  4I7F B;  2RSQ A;  3FBF A;  1JJ4 A;  2XMM A;  1SQF A;  5BYR A;  5KAK A;  4OI0 A;  4DV5 F;  4KGK A;  2HHH J;  1XR7 A;  3DOM B;  2C3P A;  4MYU A;  2ROE A;  2UUC F;  3MM6 B;  4Q2M A;  2M7S A;  3A8E A;  5IV3 A;  1W7W A;  3PW7 A;  4W90 B;  3NOG A;  4DL2 A;  4LSZ B;  2C2E A;  2J6T A;  2GJ2 A;  1K1Q A;  2QMW A;  5IT9 Y;  1B7F A;  2YNG A;  5KG5 A;  1BGX T;  3T3F A;  6FDR A;  3CB4 A;  2MGZ A;  1X9W A;  1G7C B;  4J90 A;  1GMV A;  3SCI E;  4UOG A;  2OH2 A;  1C4A A;  3DRS A;  2CQ4 A;  1UAW A;  2JWN A;  1S1W A;  2DHX A;  3NCQ A;  3BYP A;  1FA0 A;  3CD0 A;  4R5P B;  5IOL A;  2MB0 B;  2CDQ A;  3CIZ A;  4JI0 F;  1HNI A;  4MAK A;  3DU5 A;  4PAB A;  4LVN P;  4GKK F;  2V4J B;  2VG6 A;  3M8P B;  3PEJ A;  4WBF A;  1U24 A;  3BRE A;  3I9V 9;  2AWZ A;  3FBC A;  4TVA B;  3TA0 A;  2FVP A;  3HK2 A;  3D66 A;  3D5M A;  1IJE B;  2VFT A;  4KFB B;  4EBD A;  1PGZ A;  4NI2 A;  4OYI A;  4GKJ J;  2QLB B;  4K7Q A;  1S1W B;  2XTJ P;  3NWR A;  3NCR A;  5HQM A;  3Q8R B;  1UP1 A;  2G0C A;  3MM8 A;  2CVE A;  1GAO A;  4ZCL A;  4DMZ A;  5L8R C;  4LRF A;  5E3Q A;  3KLI A;  3KG4 A;  4CNZ A;  1PJ7 A;  1IN0 A;  4RW8 A;  3BKU A;  4NLU A;  3AT1 B;  2ZBI A;  2IVF B;  1F6T A;  2ZVI A;  3TVY A;  1FK9 A;  1SJ3 P;  2BKN A;  5G4D A;  4C11 B;  1X4A A;  3M2R B;  3SMZ A;  2LA6 A;  3CPW R;  2E7X A;  3C15 B;  4B02 A;  1HQU A;  1VLO A;  4KFB A;  1VQY A;  3KNG A;  5D0R A;  1DFD A;  2CVI A;  4MKA A;  4DWI A;  4RUB A;  5KG6 A;  2OEK A;  1JLC B;  1WHY A;  2QLW A;  3DYA A;  3L7U A;  3P4U B;  4AQY F;  1L3S A;  2OO4 A;  4G1Q B;  4RW8 B;  2KH9 A;  1EET B;  1C0U A;  2CNL B;  2W4P A;  3GZ7 A;  5DS7 A;  4U67 Q;  3TA1 A;  1HWL A;  4IFY A;  2I6W A;  4WTY A;  4ZOS A;  4AUK A;  2I5J B;  3R7N B;  3C15 A;  3RBD A;  3ITH B;  1VBY A;  4DPX A;  4Y0F A;  3GCW P;  2HQG A;  2VG5 A;  3BV8 A;  4FYX B;  1KR4 A;  3CJ3 A;  3R27 A;  2AHO B;  3K5N A;  4F0H A;  3AY0 A;  2H5I B;  4NA2 A;  3UE2 A;  1A7G E;  1GX5 A;  3Q24 A;  4KR0 B;  3TJ8 A;  5MLC V;  2LLZ A;  2XWY A;  3UDE A;  1RWO B;  2LCW A;  3MAA B;  2K8G A;  2QT7 A;  1DTQ B;  4F02 A;  5EX0 A;  2RDJ A;  1D9A A;  3U1L A;  3W2V B;  5RUB A;  1CJV A;  3HXM A;  2ZNZ A;  3LGN A;  4K4W A;  5IWA J;  1NKC A;  4P73 A;  2NLW A;  4O3S A;  2FDN A;  4OHV A;  4BWM A;  3W8G A;  4DL7 A;  4OZ3 A;  3T41 A;  5HMY A;  1J5E F;  2E9Z A;  1WC0 A;  1VHI A;  1WKK A;  5LMU F;  1GXU A;  2GVZ B;  3FBB A;  1S79 A;  1S1U B;  4RW9 A;  5ETL A;  5J2P B;  1REV B;  4PWU A;  3KLV A;  4UOC A;  3G6E S;  1U1K A;  4ED0 A;  4JI6 F;  4Y2A A;  4CO0 A;  1KFS A;  1U6B A;  4KGZ B;  5I3P A;  3KLE A;  2ALZ A;  2KVQ E;  4MTP A;  3W2V A;  2QTW A;  3W9J A;  3CD5 A;  3M9M B;  2V2Q A;  1KQS R;  2Y1J A;  3MMC A;  2DEJ A;  2HGM A;  5L1L A;  2DR7 A;  4TY9 A;  2UUC J;  4R0E A;  3PTW A;  1HA1 A;  5CYM B;  3BGU A;  4DR2 J;  1UA1 A;  5F41 A;  1NRK A;  3R9L A;  1VC0 A;  2XNR A;  4ZLN A;  3V6J A;  3KLH B;  3GPA A;  1NBE B;  1S1U A;  2ZBR A;  2W4D A;  4RW9 B;  5J2P A;  4PUO A;  1X31 C;  2OPS B;  4YHH F;  1QAX A;  2HWI A;  4AXI A;  4OLO A;  1ITP A;  3GYG A;  4FF2 A;  2HYI B;  3I0R B;  2X1F A;  3PYD A;  2Z2M A;  5IS2 A;  1ZM3 A;  3HZG A;  4J9S A;  3NMA A;  2F5G A;  5CZV A;  1MU2 B;  3DDI A;  5KFF A;  2UVR A;  1TL1 A;  4C2M A;  1T02 A;  5GAG U;  2BR0 A;  2YWW A;  3DRR A;  2DYA A;  1BD6 A;  4HDG A;  2E5L F;  2UZA A;  4R8U B;  1VJQ A;  2ERR A;  2YNI A;  3N9U C;  4K0K J;  3TAM A;  5H9E K;  2AYM A;  3W60 A;  2DO4 A;  2OD6 A;  3DGV A;  3R1H A;  3UQS A;  2LA4 A;  2PN6 A;  1WC3 A;  2C2K B;  4OI6 A;  2DBB A;  2E1A A;  2FYX A;  3SDE B;  4Q5V A;  2ZKT A;  2I0X A;  4RU9 A;  1YIJ S;  5L1I A;  1VK8 A;  5KFP A;  4K2X A;  3EXY A;  4DX5 A;  4B9V A;  4X4R A;  2V6A A;  3QO9 A;  1HW9 A;  2ZJQ Q;  4NCB A;  4OJ3 A;  4ETX A;  2BMB A;  4I7F A;  1PBA A;  4ZVU B;  4EO6 A;  5LT5 A;  1VQ7 S;  3RB6 A;  2K1R B;  5ETV A;  1RLD A;  4IKA A;  4Y6I A;  3L7P A;  8RUC A;  3QGP A;  4URG A;  3S8S A;  4DR4 F;  4DQI A;  2DCL A;  3OW2 R;  2C3U A;  4ZK7 M;  2CAD A;  1NDL A;  3CDW A;  3MFH A;  4LBH A;  2IDL A;  3KG1 A;  1S57 A;  2HEK A;  1VBK A;  2BM0 A;  1IUJ A;  2QYG A;  3FZB A;  3OFF A;  4ZVE A;  1U0H B;  4F67 A;  4X65 J;  3SEO A;  3P5T L;  3MUM P;  3NGR A;  5KFZ A;  4P10 A;  3M8S A;  5IT4 A;  2XMJ A;  5JVG Q;  4LQ3 A;  1CEZ A;  2QJ3 A;  4O3O A;  3ZXW A;  3H40 A;  2HHS A;  4DR1 J;  1L3V A;  4IDK B;  4C3K A;  1ZTT A;  4N7T A;  2MY8 A;  3IAS 9;  3CW2 C;  4QIF A;  1XN9 A;  3HT3 A;  1T03 B;  4HKQ A;  1ZAV A;  3HHK A;  3S6E A;  1FEE A;  1NME B;  3GFY A;  4HAC B;  1UMJ A;  2F1F A;  4TLR A;  4O0I A;  2CPX A;  2ZC3 A;  2CQP A;  2QC3 A;  1U0H A;  2HRY A;  2ZHB A;  3WIV A;  4PPZ A;  5DDQ C;  3CCS S;  3D28 A;  5KFO A;  3M9O B;  4GC7 A;  1XJW B;  1SL1 A;  3N0V A;  4WP9 A;  3J7Y U;  2HND A;  4M95 A;  1S59 A;  4CLY A;  4L72 B;  4A8W A;  3GSD A;  1WI8 A;  2B4U A;  3CC4 S;  2DGV A;  1XMO F;  1FT8 A;  4J91 A;  1HI8 A;  3BH6 B;  1BMQ B;  2AJ2 A;  3G96 A;  3G2X A;  5KFG A;  1CC8 A;  2A10 A;  2BJ8 A;  1WSV A;  3IWX A;  4JV5 F;  2LVW A;  1RT2 B;  2AJF E;  3TZZ A;  1RZM A;  2KT3 A;  3DXS X;  1X4B A;  2HKE A;  2ZBP A;  2RQK A;  2XQC A;  4NE9 C;  3WBZ A;  3D1O A;  3MI7 X;  2RU9 A;  4Y2M A;  3RW6 A;  5A8R A;  5IT9 U;  1RHK B;  1QAI A;  2HHU A;  5JMN A;  3MEE A;  1HHT P;  1FXD A;  1HNZ F;  1FKP A;  3US5 A;  2J0X A;  2JFK A;  4ECU A;  2O01 C;  1F2H A;  1MWQ A;  5DRK A;  4CLK A;  3W65 A;  4LF8 J;  2UUB F;  2APO A;  2R2U A;  5K5M A;  3HVT B;  1XBW A;  1EHW A;  1NSK L;  2XGP A;  1IBC B;  1XR5 A;  4DPU A;  4O3N A;  3U27 A;  2CJY B;  3G6V A;  3OBI A;  2BJ7 A;  1U2C A;  1S9E A;  3TNV A;  2XS5 A;  2HW3 A;  3KDN A;  1Q16 B;  1RTH B;  1WC4 A;  1FVS A;  3GON A;  4KQZ A;  1U48 A;  1RTI B;  4RBV A;  2VFU A;  4CTA A;  2ZH8 A;  2OPR B;  3GWC A;  1B4S A;  3QNW B;  4ALZ A;  3CT9 A;  3M30 B;  2QSW A;  4DJB A;  2HBY B;  4DZD A;  3ZTR A;  2QO3 A;  1O6X A;  1O5J A;  2AGQ A;  1F9F A;  3LWM A;  5JVH Q;  2VQE J;  2FLO A;  1NH7 A;  1CJV B;  2W9B B;  4FS2 A;  4ERD A;  5KFR A;  5EGY A;  3AOD A;  1TKX A;  2DNZ A;  1JK9 B;  5HJX A;  1N34 J;  1D8Z A;  1MRO B;  2FHM A;  2YX4 A;  3BBB A;  3K7R A;  4CRJ A;  4EFA C;  2MSS A;  4I0W A;  2XMT A;  3EWG A;  1KON A;  2HVD A;  2WVD A;  3MM5 B;  2R4F A;  3M1V B;  1U02 A;  4P71 A;  3AAW B;  4RX6 A;  1RIS A;  3MPU B;  1D1U A;  3CJT A;  1JLQ A;  5DGB A;  1U8S A;  2XNQ A;  4OX9 J;  4NA3 A;  3S7R A;  3KLE B;  2IY5 B;  1YJT A;  1TKZ A;  3DLB A;  1M5H A;  3B8H A;  2C2O B;  2RD5 C;  3UR0 A;  1VRU A;  5SZT A;  1K73 T;  1ROF A;  3GU0 A;  3HX9 A;  3OTE A;  3HHL C;  3JQJ A;  4WTO B;  1RU1 A;  5DG9 A;  2CQG A;  5D0E A;  1SI9 A;  2BZ2 A;  2LP4 A;  2WBR A;  3VF0 B;  2E44 A;  1U1N A;  4KSE B;  1NDK A;  3Q2S C;  1EAR A;  2ZE2 B;  3U02 A;  1H2V Z;  2OPS A;  1Q5V A;  4USH A;  2V9W A;  4F4K A;  4X64 F;  4RW6 B;  2CZ9 A;  2R7O A;  3CJK A;  1JLA A;  1TKT B;  3G9C A;  1GMW A;  3GIR A;  1CPZ A;  2DEI A;  1X60 A;  3BM7 A;  2HHQ A;  2AJ0 A;  1WDT A;  2Z30 B;  3VGU A;  4A8X A;  3OL7 A;  2DGU A;  1N34 F;  2B4O A;  2EPI A;  2UV8 A;  4TQR A;  1MML A;  1WAC A;  1HNZ J;  1NU4 A;  3E2E A;  1EB0 A;  5B0C A;  3AJ2 A;  1P1T A;  2EG2 A;  5HVG A;  1HQE B;  2H51 B;  2Q6C A;  2PFD A;  5KFM A;  2MZ1 A;  2CJA A;  5CAA A;  4FNI A;  1R3N A;  4I64 A;  5KFH A;  4GO7 X;  2EI5 A;  2AZ1 A;  4QPX A;  1M1K T;  4A8S A;  2V4R A;  1HBM B;  4FF3 A;  3GTY X;  4OX7 A;  2RRN A;  2A2D A;  4DUZ F;  2IVM A;  1FD2 A;  3DMJ B;  1TV6 B;  1AFI A;  2R7U A;  2RRB A;  1S10 A;  3MR3 A;  1SKU B;  1Z4U A;  3FFI A;  3DLG A;  4P74 A;  5JXS A;  4C7Q A;  1M5S A;  4ELU A;  4UY8 T;  4UY8 5;  1M1H A;  1T9U A;  1CBK A;  2JEF A;  2OSQ A;  4CH7 A;  2UP1 A;  3HD2 A;  3LP0 A;  2K1R A;  2W4C A;  4H54 A;  1XMQ F;  1Z2L A;  4DOZ A;  2YWF A;  4HTJ A;  2N7Y A;  4F50 A;  2BAB A;  2BYC A;  1FKO A;  2O66 A;  1S6P A;  5HO4 A;  1X5O A;  2AD9 A;  1JNZ B;  3QLH A;  5D15 A;  2C3Y A;  1GQE A;  2C2M B;  5SUH A;  1M5V C;  4CZC A;  2GX8 A;  3GFX A;  2DJW A;  3FFI B;  4KBI A;  3SSQ A;  5K8O A;  4X4N A;  1NH8 A;  3ZO7 A;  1S1X A;  2ZKU A;  1M90 T;  4EZ6 A;  3E3X A;  4HEA 9;  4ZCI A;  3B4D A;  4QQB A;  3C2P A;  1H72 C;  1LOU A;  3H42 A;  4LSL A;  2YQ0 A;  2HNY B;  4RUA A;  3OLB A;  2W9A A;  4GVL A;  2CPI A;  5I42 A;  4RU2 A;  1R7I A;  5AXK A;  1V6H A;  2W9C A;  1Y5L B;  3HSZ A;  3KJQ B;  2EFO A;  4WYW A;  5KT2 A;  1W26 A;  2EG1 A;  4K50 A;  2L48 A;  3OQ2 A;  5C24 B;  1RB0 A;  4X4T A;  5CCM A;  4P9S A;  3QZ7 A;  4J9N A;  1HNX F;  4HAC A;  5DGA A;  1YBT A;  5DDR C;  1JLF B;  2BE7 D;  3H20 A;  3IGN A;  2ASD A;  4EBE A;  1RCX B;  4IH5 A;  5GVQ A;  4IOC Q;  1FDB A;  4QWD A;  4OIX A;  3U1M A;  3PRD A;  3HHL D;  3EXC X;  1RT5 B;  4O3Q A;  4I2Q B;  3PXG a;  3MPV A;  5D8H B;  3JSB A;  4GC6 A;  5HP1 B;  3PKY A;  1X7V A;  2AYE A;  4MKB A;  4F04 B;  1MU2 A;  4CCH A;  2RAQ A;  1SH2 A;  1KHW A;  1J5O B;  4IO1 A;  2RQC A;  3CO9 A;  2DXE A;  2QIF A;  4F4W A;  2ZOF A;  1LWF B;  3JS9 A;  1QSY A;  1OQ3 A;  1YZ7 A;  4JI4 F;  3C46 A;  3PEH A;  1EQM A;  1DLO A;  1RP5 A;  3DOM A;  1RT2 A;  2C1E B;  4DF8 A;  1FJG F;  4DV6 F;  4DU7 A;  4OV1 A;  3MM6 A;  1WC5 A;  1LK5 A;  4EMD A;  1KNZ A;  4F0K A;  1U47 A;  2RRA A;  1CJK A;  1NLK L;  3LQV A;  2NYI A;  1SL2 A;  4OL8 A;  4MYT A;  1KSP A;  2FLN A;  3QWU A;  3FEY B;  3IP0 A;  4KIA A;  4KTQ A;  5D3G B;  1HBO B;  5LSO A;  2XC9 A;  3LAK A;  2LEC A;  1C1C A;  1WD6 A;  1JLB A;  3JSR A;  3M2V B;  4P6Q A;  2EKN A;  3CVK A;  4WU3 A;  4Y2K A;  1EAY C;  1HWI A;  2W2N P;  4C3M A;  5A2Q Y;  4R5P A;  3T1Y F;  3CO0 P;  1KD1 T;  2C2R A;  1NUE A;  5J1N A;  1V3Z A;  5HQL A;  1LK7 A;  2EK6 A;  2HGN A;  2QFI A;  1E6V A;  1N0V C;  1LFW A;  2YPY A;  1FEH A;  4YDD B;  1XMQ J;  4DSK A;  4JI7 J;  4DR6 F;  1AZS A;  2YNH A;  1X5P A;  2NXN A;  4MIW A;  2VPZ B;  3V6H A;  3PDN A;  5DDO C;  3F73 A;  1OPI A;  3ZZT A;  5FLX U;  2Q3P A;  4ELT A;  1Q53 A;  1S9G A;  2DPI A;  2G2Y A;  2YWK A;  4L74 A;  2MKK A;  2DH7 A;  1L5U A;  4L3N A;  4Y34 A;  2I8E A;  4XIU A;  1MG7 A;  2FPH X;  3BQ0 A;  3R5G A;  4DV2 F;  1SIZ A;  1WHX A;  2JEG A;  1FES A;  1H38 A;  2PD1 A;  1UEK A;  3ENV A;  4OHW A;  1PG5 B;  2Z2L A;  4UQT A;  4DR5 J;  2XG8 A;  4B9S A;  4TU9 A;  2HZC A;  3I9Z A;  2XY5 A;  2ZM6 F;  3RUB L;  1XNR J;  1Y00 A;  2XHW A;  4IG3 B;  3MF5 A;  3QAU A;  1TKX B;  4CO2 A;  5ETS A;  3IG1 B;  2A6M A;  1X5T A;  3OPK A;  3JAM U;  2MDA A;  1HLW A;  2VV5 A;  3LOU A;  4MJK A;  4ZLP A;  4ZMM A;  5B08 A;  3DRY A;  1JKH A;  5ETM A;  1JLE A;  1S9G B;  3JSY A;  3I56 S;  1UVI A;  2XLI A;  4UOF A;  3PRB A;  1QTN B;  4QIG A;  2RU3 A;  3T1H J;  3BPS P;  4JI3 F;  1YJR A;  4NEY A;  2W2M P;  3F0N A;  2QA4 G;  1QLN A;  1PYT A;  3HT0 A;  1HNX J;  4C8Y A;  2PII A;  1DQ8 A;  3NBP A;  4ECQ A;  1QSL A;  1U1R A;  2DR5 A;  5K8M A;  4A8F A;  1TUW A;  4GO5 X;  3UN2 A;  2OIH A;  2KJV A;  2M2B A;  2XGQ A;  3L4B C;  2D9O A;  1RHQ B;  1KOO A;  2ZJR Q;  3MEG A;  3NS5 A;  3W8P A;  2Y8W A;  2NXC A;  5E5N A;  3BO2 A;  1HI0 P;  2LQ9 A;  5J2M A;  5AJ3 F;  4ZLL A;  2YWG A;  4CQ1 A;  2B43 A;  2KKH A;  3ITH A;  3Q8Y A;  2UUW A;  2VC1 A;  4EU0 A;  2HQD A;  2LU1 A;  2B0G A;  1WEZ A;  3WX8 A;  1RE1 B;  4X62 F;  3Q83 A;  3OV7 A;  2ZIT A;  3A8I A;  3LP2 A;  2J0W A;  3I4H X;  4LIR A;  3G82 A;  3GG1 A;  3RGI A;  2XO7 A;  4LFB J;  2MQ8 A;  5CD4 A;  5HLF A;  2P6T A;  2MXY A;  4DSL A;  1UFK A;  1ZA1 B;  2UUT A;  4NYZ A;  3PY8 A;  2YTC A;  2KN4 A;  2CJQ A;  5FDL B;  2LDI A;  1ZZN A;  4B08 A;  3CCJ S;  4C4W A;  3FBE A;  3IWN C;  3OJU A;  3HVT A;  1X4H A;  1SH0 A;  5DZ7 A;  1CUL B;  3THT A;  1URN A;  2EFG A;  4F3Q A;  3A13 A;  3HSD A;  3G8Q A;  2PFF B;  1LWE B;  2PMZ D;  4YQW A;  3LP2 B;  2ADB A;  3W66 A;  4QR0 A;  1NHU A;  1Q8L A;  3IO1 A;  4JP8 A;  4YR0 A;  1RCO B;  2OPR A;  3AOA A;  3CCQ S;  3IMQ J;  4R0J A;  4DSF A;  2DVI A;  4IRC A;  3N5F A;  1KN6 A;  3EVM A;  5FDL A;  1FTC A;  4OYO A;  2GAG C;  2DNH A;  3RG6 A;  1SXL A;  3AA8 A;  3HDS A;  2DRB A;  1H2U X;  2HIY A;  3DLK B;  1S5Z A;  3ISZ A;  4M5H A;  5F8M A;  3EDQ B;  4BC7 A;  2ZH3 A;  1MRO A;  1U8W A;  2E7W A;  1S49 A;  4N76 A;  3HVW A;  4Q8E A;  5IT0 A;  2X1A A;  1NK8 A;  3J7Z T;  4RNH A;  1MMD A;  3M1V A;  4LR7 A;  4NMX A;  3K5M A;  4JI1 F;  3GV8 B;  3G8S A;  3M05 A;  1JLQ B;  5J2N A;  1RUS A;  1RJJ A;  3AH6 A;  1RHR B;  3IFE A;  2K7K A;  1IR2 A;  3ZZ0 A;  1WHV A;  4WKY A;  5AXL A;  2UXD J;  2V69 A;  5L39 A;  1OWX A;  2M52 A;  3JXO A;  5D4N A;  5CQG A;  4IFV B;  3CE8 A;  3CTR A;  2RDI A;  2KDO A;  2VG7 B;  2BQU A;  1X9M A;  2R7Q A;  2J0S D;  1QE1 B;  2IA6 A;  2V8P A;  1IXK A;  2FZC B;  2KXH A;  4M5I A;  3I5A A;  2LXI A;  2Y1I A;  2BW7 A;  3SQG A;  4WFX A;  2ZE2 A;  1T0T V;  1ZAX A;  2BJ3 A;  3MM7 B;  4FF4 A;  1CC7 A;  2XY6 A;  2DK2 A;  2XB2 D;  1G1X A;  5F8H A;  2AEF A;  4MFB B;  3V81 A;  3C6U A;  4OHZ A;  2YX7 A;  3SZ2 A;  4LFB F;  1SUQ A;  1LWC A;  3KK1 A;  1Y10 A;  2OTJ S;  3NGD A;  4CYU B;  2YKN A;  4NXM F;  2HBQ B;  5BYS A;  3T6J A;  3GCX P;  1FI4 A;  3PJX A;  5ETO A;  1ZET A;  2DB1 A;  1UPM B;  5HQ8 A;  1TMJ A;  2DGT A;  2FIU A;  4WFZ A;  2X1B A;  4NZ7 A;  3I5C A;  2DY1 A;  2GW8 A;  3VR1 A;  3HHE A;  2XEX A;  3NGT A;  4H4O A;  2CQC A;  4M5K A;  5E3P A;  2P6S A;  3SXL A;  2HBZ B;  1R43 A;  3SSS A;  4C8K A;  1ZYQ A;  1QDU B;  2NXE A;  3FJ2 A;  2HVH A;  2R2S A;  1N36 J;  1VLY A;  1YZ6 A;  4G65 A;  3MED A;  1EZZ B;  2YH1 A;  4UF4 A;  1RAG B;  1UZD A;  2B51 A;  1T95 A;  3DMJ A;  4DFJ A;  3HCX A;  1WOP A;  2RVJ A;  3VV2 B;  4Q8F A;  2WAQ D;  2HLU A;  3D54 A;  4MIA A;  5T14 A;  1U2F A;  3J81 j;  4JI5 F;  5D3G A;  3MR7 A;  4NRT A;  1P9Q C;  4ICL B;  1JLB B;  1SBR A;  2IRY A;  2U1A A;  2CKW A;  2H5J B;  2Q6B A;  4FXV A;  4MMO A;  1Q8I A;  2V8V A;  2VFR A;  1SV5 B;  3FKB A;  1IKV A;  5B0A A;  2CQI A;  3I6P A;  5AJ3 J;  2WHO A;  1D09 B;  2PO4 A;  4Z37 A;  2F63 A;  2HHW A;  1RAF B;  2GFF A;  4LF2 A;  1N5Y B;  5A0Y A;  4IQX A;  1HMV B;  3OFH A;  4QR1 A;  3AJ1 A;  3DI6 A;  2JRS A;  1UZH A;  4RWW A;  1HIY A;  4M94 A;  5KOX A;  1IKW B;  1YJ7 A;  2GIQ A;  3THP A;  2W24 A;  1RAB B;  2M9K A;  3MD1 A;  1YRX A;  2HQI A;  2ZOG A;  1ZTW A;  1AUD A;  1SIW B;  2N4C A;  1U7L A;  4YDX A;  3LTO A;  3W1Y C;  2KG0 A;  4ZVG A;  2K2P A;  2RF2 A;  3M6U A;  3AXM A;  2M8H A;  2HUR A;  2P5V A;  5I42 B;  4F4Y A;  3RAQ A;  3QGI A;  2DNN A;  1VC5 A;  4ZVT B;  1AW0 A;  1Y11 A;  1YKW A;  4CH0 S;  2HPU A;  1NDP A;  3R7S B;  2GVD A;  2MQM A;  3CJR A;  3NG8 A;  4OYX A;  3VZI A;  1VC6 A;  2XY7 A;  2HSE B;  1CS4 B;  1RT4 B;  4NLP A;  4OZ1 A;  2VBW A;  3AQP A;  4WYL A;  3D6M B;  4ED2 A;  1TK8 A;  1FXR A;  2BJ9 A;  2H1Y A;  1W2B R;  2ZD1 A;  5E3C A;  2HLT A;  4HI1 A;  1XIQ A;  1S9F A;  1BLU A;  2GC8 A;  3PW4 A;  1NHK L;  3H2V E;  4NLD A;  1JJ2 R;  1V5V A;  3I5B A;  3JB9 k;  1J5O A;  3EZO A;  1H7W A;  1Y3J A;  2FZK B;  3JQM A;  1N0U A;  3SFG A;  2B7C B;  2PEB A;  1VQ8 S;  2E7V A;  4OLP A;  3GIL A;  2PA3 A;  2GVD B;  1XR6 A;  2ZBQ A;  1DLO B;  2HAI A;  3B82 A;  3BZQ A;  3MPW A;  4RJV A;  3UCG A;  4ZCM A;  5K8P A;  2AJ1 A;  3Q23 A;  3QJP A;  4OJG A;  3HP6 A;  3OL9 A;  1G2E A;  3BGO P;  2HWT A;  3SCL E;  3DFE A;  4ES1 A;  4HHJ A;  3C14 A;  1KLM B;  4ZA1 A;  4DG1 A;  4YB1 P;  1NKB A;  2FLP A;  1N32 F;  1JXL A;  5E0O A;  4RZR A;  3TYT A;  1DTT B;  4ECZ A;  4KAI A;  1M5K C;  2UXD F;  1FJ7 A;  2GS8 A;  1UEV A;  1FE4 A;  1KTV A;  2BE9 B;  3CJ4 A;  3M30 A;  1C1C B;  2XYP B;  5F8I A;  3UR3 C;  3QJJ A;  2ZOM A;  2CZ4 A;  3BB5 A;  1SKW A;  5KT4 A;  2MKY A;  2FHJ D;  3KJV B;  1IKX B;  1S48 A;  5DQH A;  3OTO J;  2XLJ A;  3R7B B;  3A3N B;  4IFY B;  3VVU A;  3KHG A;  3GIJ A;  3KUH A;  4DV4 J;  1ARO P;  2Q1L A;  2BAN A;  1WF1 A;  4PXE A;  3IR5 B;  4U6P A;  3T5L A;  2R7X A;  5G0R B;  3RR7 A;  1KLM A;  2CNN B;  4DG1 B;  2J7W A;  2DY9 A;  3PJ9 A;  2XYG B;  1KDN A;  1A6L A;  4U9R A;  4AL7 A;  3W62 A;  3TQ1 A;  4A8Y A;  2KZM A;  4LF6 J;  4WZM A;  1UFL A;  5D78 A;  1GEH A;  5B09 A;  2F40 A;  1X0F A;  3A8J A;  2HK2 A;  4AYB D;  2ZZT A;  4ECW A;  4EO8 A;  3D1H A;  4U7U K;  4IO9 Q;  1BUX A;  2XMU A;  3PYE A;  1DTQ A;  2BA9 A;  4NYP A;  4C48 A;  5LSR A;  3MR2 A;  4DV5 J;  1HFE L;  1R0C B;  1UVM A;  4F3M A;  5CYQ B;  1YSJ A;  3B54 A;  3KWM A;  5KFX A;  2D3Z A;  4I69 A;  4J9V A;  4NLY A;  1I51 B;  1D9D A;  2MST A;  3MMJ A;  1X4D A;  3FNN A;  1VMB A;  3DOL B;  3RRH A;  3H8Y A;  1JLE B;  1UWB A;  5DLF A;  4YFU A;  2ZUG A;  5E3A A;  4FNH A;  5J2Q A;  3KTQ A;  3H4B A;  4USW A;  1AYE A;  4MT1 A;  2HG4 A;  3ZTS A;  2N3O A;  2CG8 A;  4KV8 B;  3CMQ A;  4C6A A;  1S7H A;  4FYD A;  1FX2 A;  2GZO A;  1N52 B;  2F9D A;  2DKO B;  4M5D B;  1WC1 A;  1WJ9 A;  4PXC A;  4AND A;  1LWX A;  4KHP J;  2AMC B;  2MMY A;  2VG7 A;  1DBD A;  3MEG B;  3PFO A;  4MK9 A;  4O44 B;  4YB7 A;  1KS2 A;  3WHI A;  3ZZP A;  4ZHR B;  3BEG B;  1IQZ A;  1LXN A;  1QE1 A;  2H4W B;  4LVO P;  1XWL A;  3NMR A;  3E01 A;  2OML A;  3PYF A;  1PBU A;  3ISN D;  2HFZ A;  2YPZ A;  4NLQ A;  3MCN A;  3G87 A;  3SQG B;  5KG4 A;  4FP9 A;  2KM8 C;  1HW8 A;  3G4S S;  4PUO B;  2EC2 A;  2B4P A;  3DKD A;  3M32 A;  3VAK A;  2M5Y A;  3HSG A;  1N4L A;  1QUP A;  2BE2 B;  2PE8 A;  3LA0 A;  2RKI B;  2FQQ B;  2XZD B;  3EMT A;  4XPE A;  4PAA A;  3I55 S;  2R2R A;  2VUG A;  4ZN1 A;  5EWE A;  4JI8 J;  4DN0 A;  4USV A;  3OHB A;  3BF4 A;  4QWA A;  3CUN A;  2WSE C;  4X4U A;  3CCZ A;  2YKN B;  2A18 A;  1HPZ B;  2NPI A;  4J7C A;  4NOH A;  2ROP A;  4P52 A;  2DNQ A;  3RW7 A;  1RAH B;  3DRR B;  4NCG A;  3M2U A;  5C7P A;  4GVB A;  3D6H B;  3CJQ A;  3KK2 A;  3O3L A;  4PG8 A;  4M1K A;  1RT7 A;  2ZH4 A;  2BAC A;  4YHH J;  1KP6 A;  3OTC A;  2QFJ A;  1B0T A;  3CUL A;  1NPK A;  3QIP A;  5FJ4 A;  2HQ3 A;  2DIS A;  4J5O A;  4KC5 A;  3QLH B;  1VQS A;  1R8H A;  4RWX A;  1SVD A;  5HVF A;  3RAM A;  3JYT B;  1F0X A;  2IYG A;  2RKI A;  3R5B A;  1K8A T;  1KQK A;  1B3T A;  4G1P A;  1ZM2 A;  4LT6 A;  4K4Z A;  4N41 A;  1R27 B;  2CNK B;  2PMH A;  2UXC F;  2AV5 A;  3UO0 A;  5LMN F;  5K14 B;  4UST A;  2HNZ A;  2GGP B;  3P96 A;  2HMI B;  3V6K A;  4ZP8 A;  3RU0 A;  4DV7 J;  2RS8 A;  1N32 J;  4OMF G;  1VIO A;  2UUA F;  4LFC F;  2NQP A;  5A0Y B;  3KKF A;  5AT1 B;  4ECT A;  5C24 A;  4CP5 A;  4B9T A;  3UI3 A;  2M0G B;  5A8K A;  3EYZ A;  1RWV B;  3DDN A;  1BE4 A;  4ZVQ B;  1UVK A;  3H0P A;  1VDH A;  1WHW A;  4RW7 B;  4ES2 A;  5KFE A;  3CCM S;  3NNC A;  3M6X A;  1YJV A;  3HHN B;  1UJ6 A;  1IBK J;  2IVY A;  5DO2 A;  1FRM A;  1BQX A;  5AE2 A;  2CJK A;  4JYA J;  3PHT A;  2QL7 B;  2GGP A;  8AT1 B;  3M8Q A;  2VON A;  4DV1 J;  2KTQ A;  4C8M A;  2EW9 A;  3GJR B;  1FWL A;  4HT7 A;  4Q44 A;  1EP4 B;  2RHS B;  5KFB A;  1Q8B A;  1X8D A;  4O0N A;  3I4P A;  1NJI T;  4C11 A;  1N6Q A;  2WSF C;  3DGP A;  5KT3 A;  2CAJ A;  3AB4 B;  1H73 A;  2JVR A;  4RO0 A;  4W98 A;  1WF0 A;  2Y0S D;  3FCW A;  4CLP A;  1T05 B;  4GKJ F;  4FXD A;  1VJW A;  5DG7 A;  4JI6 J;  2IJF A;  3MHY A;  2QX0 A;  1TTH B;  5L38 A;  4DLG A;  3C6U B;  2RS2 A;  2W2O P;  5F8N A;  3DM2 A;  3C16 A;  3SSR A;  3VHQ A;  1R0B G;  1QM9 A;  3EZ5 A;  2I38 A;  3VCD A;  4B3S F;  1M5O C;  2ZHO A;  1QAY A;  1RWN B;  3F56 A;  4V1A k;  2Q66 A;  3MMB B;  4ZVF A;  4OI3 A;  2IFX A;  4W92 B;  7FDR A;  3LO3 A;  5KOW A;  2VAS A;  3F44 A;  5HAT A;  4DV3 F;  2B7B B;  2MZT A;  1VYA A;  3LAM A;  2ATC B;  1JXV A;  2IM0 A;  2O3D A;  2R7T A;  2PMW A;  5LJ3 Y;  2FVR A;  4GKK J;  1FNO A;  2XSJ B;  3FCH A;  3ZZR A;  3N6M A;  5A8R B;  2YNG B;  4AQY J;  4ETZ A;  4ZPV R;  1HHS A;  3DN9 A;  5D77 A;  1BWV A;  2CG4 A;  2IPO B;  2MZJ A;  2D1C A;  3DOK B;  4NLS A;  1YHQ S;  2G1D A;  1FNX H;  3R8Y A;  3QGG A;  2V2V A;  1U1O A;  1RWM B;  1M1G A;  1QSS A;  4JYA F;  5KFN A;  4QW8 A;  4C97 A;  4NWB A;  3UNG C;  3GLJ A;  2HFN A;  1PJ6 A;  2PI4 A;  4FBT A;  1NND A;  1JQG A;  1VIS A;  4NLV A;  1W2I A;  2QA1 A;  3NGS A;  5K8N A;  1UJ4 A;  2C2D A;  2W1B A;  3H98 A;  3OXF A;  4RBU A;  2KM8 B;  1RAO A;  2D41 A;  2EEY A;  1VIX A;  3DI6 B;  2XS2 A;  2XSJ A;  3M8P A;  2B9W A;  5ADZ A;  2VQF F;  2WON A;  1RHM B;  1JKH B;  3VQS A;  4B9M A;  4CTA B;  3MWB A;  2YQ3 A;  2IAJ B;  2O5D A;  5IXU A;  4RNO A;  2R2T A;  3CCE S;  5HBM A;  2ASL A;  5EUH A;  1REV A;  3QQC D;  4NI2 B;  3J80 U;  3LP1 B;  4HH0 A;  1SC4 B;  1QUV A;  3ZNU A;  2RF2 B;  3M8Z A;  2JSX A;  2ZM6 J;  1IBK F;  1WG1 A;  4X4S A;  1NM2 A;  4HDH A;  3IM8 A;  1TVR B;  4DUY F;  1Q81 T;  1U0S A;  3GR0 A;  1LQ9 A;  2ILZ A;  2CZV C;  2DH9 A;  3VGS A;  1ZZF A;  2CA9 A;  5CYM A;  1GTH A;  2L3M A;  4PXB A;  3DLE B;  1R0A B;  1LXJ A;  1SCJ B;  4F4A A;  5DQG A;  2F4F A;  1F5A A;  4JI3 J;  3NY0 A;  4DR7 F;  4L75 A;  3MCM A;  1Y0H A;  2DHS A;  4AT1 B;  2F7V A;  4C0O C;  1U1P A;  2ZH1 A;  1FE0 A;  1KBR A;  3GSI A;  2DNO A;  1U45 A;  4K4S A;  3MFI A;  3IRW P;  3T9N A;  1TL7 A;  3I31 A;  5HLF B;  4USK A;  3EPI A;  3KG0 A;  1UKU A;  3CSK A;  1OY9 A;  7AT1 B;  1VRU B;  3H5U A;  1EET A;  2EXU A;  5D0G A;  2FGC A;  4Q2L A;  2VBZ A;  3PVX A;  2UUA J;  4UTG A;  3AJD A;  4I6W A;  4PPD A;  1UCN A;  1D9F A;  1YWX A;  2YQ1 A;  4M5G A;  2CPJ A;  1CJT A;  2HBR B;  2BQR A;  3KLF A;  4IR1 A;  1KQG B;  4Y2I A;  3J7Z 5;  2HFU A;  5ITH A;  2D3O 1;  5H9F J;  1N5S A;  3O8W A;  3NS6 A;  1Q95 G;  1DTT A;  3POT A;  1NK7 A;  1BQM A;  2LQB A;  2DNL A;  1RWK B;  2V5H G;  3CNQ P;  2CQB A;  3DDK A;  4NLW A;  3HVR A;  1H74 A;  4TXS A;  4ED7 A;  1NB2 A;  2ZDP A;  2DXF A;  4LJM A;  3ZZY A;  3D7S B;  5LL6 d;  3M7V A;  3D3B J;  2XMK A;  4DV0 J;  3MM9 A;  2HZA A;  8ATC B;  3J80 Y;  4EGL A;  3BR8 A;  2K7J A;  2RH3 A;  2KT2 A;  1B0V A;  2DIV A;  4PWW A;  4ED3 A;  4O3R A;  2DRA A;  2IM2 A;  2K3K A;  3HD1 A;  2UXC J;  5DM6 Q;  1JX4 A;  3OXG A;  4PXD A;  1HNV B;  2ILY A;  4RBT A;  3K8W A;  2B6A B;  3QJL A;  5FII A;  1NB7 A;  1C2P A;  3QIP B;  2B56 A;  3MUR P;  1RHU B;  1TMM A;  4IYQ A;  3VAM A;  1MNE A;  4DR2 F;  3TJ9 A;  4LRD A;  3TI0 A;  2M88 A;  4CLU A;  2CPF A;  4Q0B B;  1X4G A;  1VRT B;  1G6B A;  4W4M A;  4LF8 F;  1TV6 A;  2FGO A;  1DQA A;  1MMN A;  1U25 A;  4I2P B;  3TX8 A;  2R8H A;  3NKY A;  2JFD A;  3IS9 A;  1J2V A;  2KHD A;  2YKM A;  1RYR A;  4F8R A;  3QSY B;  1C4C A;  4YEA A;  1NXI A;  4ZIT A;  2KXN B;  1JIH A;  3H59 A;  2XMA A;  1IBL F;  2G13 A;  3HLU A;  2FD2 A;  3QT6 A;  4OX9 F;  4P7V A;  2W01 A;  3UW1 A;  2VKR A;  5HI7 A;  2L9D A;  1RTD A;  2GJI A;  3J81 Y;  4DCP B;  3BN4 A;  3GJS B;  4ZPC A;  2W8L A;  5KFQ A;  3SYZ A;  5J2Q B;  2L41 A;  4DSJ A;  2F65 A;  3IR7 B;  4XDC A;  3ZTQ A;  2DPJ A;  1RLC L;  1RA7 A;  1ZAW A;  3GB0 A;  4RNN A;  2B5J B;  4K4Y A;  3HHL B;  3ILL A;  2VFS A;  3G8T A;  1R89 A;  4NLO A;  2VQE F;  3OJS A;  4XO0 A;  2XCA A;  2HHH F;  1U2R A;  2J6S A;  3CD6 S;  4AL5 A;  3ILO A;  3WC0 A;  1T9T A;  4ZS6 A;  4JOU A;  4CYU A;  5KFC A;  1YIT S;  2OEL A;  1N5V A;  4CO4 A;  2Z8Q A;  4HVZ A;  3RZA A;  1WOO A;  4HL9 A;  4DX6 A;  3BPD A;  4LR9 A;  4RUH A;  1FO1 A;  2MLZ A;  2RML A;  1G3O A;  1Q79 A;  4R8U A;  4ZVO B;  3Q8Q B;  2FJX A;  4QYZ J;  2KFZ A;  2HS0 A;  3JSM A;  4A8K A;  3SI8 A;  2D9P A;  2Z2Z A;  2CQD A;  1RWX B;  2N7C A;  2OJ3 A;  1EKR A;  3MPD A;  4M8L A;  3R5C A;  4ED6 A;  2GIF A;  1YRU A;  1DAR A;  3DM2 B;  4HT5 A;  3Q2T C;  4DUY J;  5LXY A;  3HKW A;  5HP1 A;  4CDI A;  3QO9 B;  1I1G A;  4H4K A;  9RUB A;  3LPY A;  4DUZ J;  3SV4 A;  1ZBT A;  3AXK A;  3T5K A;  3KLG B;  5F8J A;  4X66 F;  1RAA B;  1UEU A;  4FVM A;  1VR6 A;  3D1Q A;  1QAJ A;  2AJQ A;  3TZX A;  2CPY A;  3K89 A;  1P27 B;  3WZ0 A;  3THV A;  2MKH A;  1VRQ C;  4X64 J;  2BBE A;  4X4V A;  3B78 A;  5IQ6 A;  3A1Y G;  2RQ4 A;  3D3C J;  1HMV A;  4LF4 J;  5L9X A;  3IC1 A;  1SH3 A;  4M5L A;  1NJX A;  1K44 A;  2DRD A;  2V4J A;  2VG6 B;  5D4P A;  3W5Y A;  2HZV A;  1O8B A;  5M2P A;  3J7Y I;  3MR6 A;  2YKA A;  1SKS A;  1WOS A;  3MCO A;  4QIV A;  3EGN A;  2RIJ A;  4TY8 B;  3SQO P;  2DHH A;  4X62 J;  1S97 A;  2OPQ A;  2V8H A;  4Y2C A;  1F5C A;  2JL9 A;  4KO0 A;  4KHR A;  3R97 A;  3CDU A;  3HFZ B;  2E9R X;  2JLE A;  4BWJ A;  2B8Q A;  5CZX A;  1XMO J;  1RU2 A;  2HHX A;  4PQA A;  3C6T A;  3KUG A;  4MIB A;  4S0M A;  4U7C A;  2FJV A;  1CLF A;  4HTI A;  3M2R A;  5IM0 B;  3OXL A;  2LEP A;  3IXQ A;  1VS3 A;  4CT8 A;  4RW4 A;  1M5P C;  1IWA A;  2AP6 A;  2AX0 A;  2MQN A;  3MM5 A;  1X5S A;  2ZVS A;  2MGZ B;  3MOJ B;  2JHE A;  3EGV A;  3UCU P;  2RT3 A;  3EPG A;  1U4B A;  1RA6 A;  3PHE A;  4LF5 F;  3DHW C;  1JLG A;  1Q1K A;  2QLX A;  1NSQ A;  3VTI A;  2R42 A;  4ZIV A;  4KH1 B;  4CNY A;  4RR5 A;  5ETN A;  1PYO B;  1TVR A;  1RTJ B;  2DGX A;  3BBF A;  3CDE A;  3MGJ A;  4RNM A;  2M4M A;  2BRL A;  1C0T B;  2ZJP Q;  3IG1 A;  4IR9 A;  3QT5 A;  4NAS A;  4L6V 3;  4CWB A;  2UUB J;  1OY6 A;  4N56 A;  5L9N A;  1Y3K A;  4KT0 C;  2I5J A;  3NL0 A;  3TQE A;  2HQC A;  2A0F B;  1TL3 A;  3ZFV A;  5BJR A;  3Q22 A;  4LMZ A;  4FVC A;  3MAQ A;  1IKY B;  2XZW A;  3CJS A;  2ALY B;  4N5S A;  4PWD A;  4DR3 J;  1RT6 A;  3AQO A;  3SCK E;  2ABY A;  3OVB A;  2AZ3 A;  1JLA B;  1QD1 A;  2ASY A;  1VQM S;  4N77 A;  3FSI A;  3X3U A;  1PO6 A;  1RTJ A;  2KB2 A;  3K5O A;  2C2Z B;  4QOT A;  4DBQ A;  4KKO B;  3VVT A;  5KG0 A;  4J9L A;  1OYE A;  2V2K A;  3V6D A;  3U7J A;  2EC0 A;  2QA4 S;  4Y00 A;  3J7A N;  4WZQ A;  2D69 A;  2HGL A;  4PEO A;  2CPH A;  5ETR A;  3MR5 A;  4WE1 A;  3UVJ A;  4JV1 A;  2CWK A;  2IIH A;  2IJR A;  2MY7 A;  1HQ2 A;  2DO0 A;  5U47 A;  3GG0 A;  4DFM A;  3M8W A;  3H5Y A;  1ELO A;  1HD1 A;  4PG7 A;  1OYD A;  3NS7 B;  4OI2 A;  4FS1 A;  1HBU A;  4JI7 F;  4EZ9 A;  5HVH A;  2GVZ A;  4DUT A;  5DET A;  3I0S B;  4C9D A;  1DHM A;  2GML A;  4QW9 A;  4G1Q A;  4DL5 A;  2OMO A;  1VQL S;  1HL6 A;  1LV5 A;  1ULR A;  5T7L A;  2HVZ A;  1H6K X;  3V6D B;  1HR0 J;  2WVE A;  4IQM A;  2IC3 A;  5FD1 A;  3KK3 A;  1F1B B;  3VAI A;  3RAX A;  2M8D B;  2KYX A;  4B3R F;  4DV6 J;  4ILM A;  1HNV A;  5HAO A;  5KG7 A;  1FTR A;  3QFH A;  3WIU A;  3R2C J;  2AT1 B;  1L3K A;  4KYZ A;  1S6P B;  4LRB A;  3JTO A;  5AXN A;  1HWK A;  3TEG A;  3CCV S;  1LKZ A;  5GAE U; 
#chains in the Genus database with same CATH homology
 4LFB J;  1I94 J;  5IT9 U;  2MQ8 A;  3J80 U;  4JI8 J;  4DUY J;  1N33 J;  2E5L J;  3W1Y C;  2KVQ E;  4LF9 J;  4DUZ J;  4HHU A;  2ZM6 J;  5BR8 J;  4DV2 J;  4LF8 J;  2UUC J;  2HHH J;  3R2D J;  4DR2 J;  4YHH J;  4X64 J;  2UXB J;  4KY3 A;  4JI3 J;  3D3C J;  4LF4 J;  4NEZ A;  5LM7 E;  2F4V J;  1XNQ J;  3IMQ J;  3T1Y J;  2MTL A;  4B3S J;  2KL8 A;  4JI1 J;  4LF7 J;  4X62 J;  2UUA J;  2VQE J;  4DV7 J;  2MEW A;  3J81 U;  4RJV A;  1XMO J;  1N32 J;  1N34 J;  4K0K J;  4LFA J;  4JI2 J;  4LF5 J;  4B3T J;  4DV3 J;  4DR6 J;  4JI5 J;  2UU9 J;  1J5E J;  4GKJ J;  1IBK J;  3D3B J;  4OX9 J;  4DV0 J;  2UXD J;  4PWW A;  4DV1 J;  3OTO J;  4LFC J;  1FJG J;  2UXC J;  4B3M J;  4DV4 J;  4NXM J;  5LMU J;  2UUB J;  1HNW J;  1XMQ J;  4JI7 J;  5LMN J;  1IBM J;  5FLX U;  4LF6 J;  4JI6 J;  4DR3 J;  1HNX J;  4X65 J;  4JYA J;  4DV5 J;  4JV5 J;  5A2Q U;  4DR5 J;  4DR1 J;  4V1A k;  1HNZ J;  3J7A N;  1XNR J;  3JAM U;  4JI4 J;  1N36 J;  4JI0 J;  3T1H J;  4GKK J;  4DR7 J;  4X66 J;  4AQY J;  4NEY A;  4B3R J;  4DR4 J;  1HR0 J;  4KHP J;  5AJ3 J;  4DV6 J;  4YY3 J;  2VQF J;  1IBL J;  5IWA J;  3R2C J;  4KYZ A;  4NXN J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...