4JI3M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ji3M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4ji3M02
5FLXS 3TWKA 5IWAM 4PDGA 4DR4M 4YY3M 4JI0M 3VK8A 4AQYM 4DV6M 2XZFA 4DR6M 5ITQA 4LF8M 1XC8A 2E5LM 4G4QA 1N34M 2HHHM 3DOAA 4NXNM 2UXDM 4K0KM 4JI3M 4B3RM 1XMOM 3GO8A 3U6SA 3VK7A 1EE8A 1N33M 3JR5A 1L2DA 4X65M 1K82A 2UXCM 1N32M 4B3SM 4G4RA 1L1TA 4DV0M 1Z5AA 5LMNM 1NNJA 1MU5A 1Z59A 4DV7M 1Z5CA 3U6DA 2ZBKB 5ITTA 3GPPA 1KFVA 3TWLA 1N36M 4DV3M 1Q3CA 1L1ZA 3A46A 4DUYM 3SBJA 3T1YM 1TDHA 3SAVA 4DV2M 4LF5M 4DR7M 1IBMM 1Q39A 4LF7M 4JI5M 3GPYA 2UU9M 4JI8M 4X64M 4LFCM 3J80S 4JI1M 4GKKM 1R2ZA 3U6CA 4GKJM 2ZM6M 4LF6M 3J7AS 5ITXA 2F5PA 3SARA 4JI7M 3JAMS 1MX0A 3SASA 2UUAM 2OQ4A 4PDIA 4DR3M 4LFAM 3GP1A 4LF4M 3J81S 3C58A 2VQFM 3U6PA 1HNZM 4LFBM 2VQEM 4JYAM 3GQ5A 1R2YA 1IBKM 3U6LA 1J5EM 1Z5BA 4DV4M 2UXBM 5IT9S 4NRVA 4JV5M 1PJIA 3GQ3A 2F4VM 1Q3BA 5LMUM 3U6OA 2F5NA 3OTOM 4DR5M 4JI4M 3W0FA 2F5SA 4G4NA 2HKJA 4DV5M 1I94M 4ITQA 5A2QS 3U6EA 1PJJA 4LF9M 3T1HM 3A42A 1HNWM 4PD2A 4X66M 4MB7A 4NRWA 4CISA 1K3XA 3GPUA 1L2BA 4B3MM 5BR8M 2EA0A 5ITYA 1HNXM 4DR1M 5ITRA 3GQ4A 1K3WA 1IBLM 3TWMA 2UUBM 2UUCM 5ITUA 4G4OA 2OPFA 1XMQM 2XZUA 3A45A 1PM5A 3SATA 4DR2M 1XNRM 1TDZA 4JI2M 4JI6M 1XNQM 4DV1M 1L2CA 3JR4A 3U6QA 2Q2EB 4NXMM 1FJGM 4KHPM 4PCZA 3SAWA 2F5OA 2F5QA 3GPXA 5ITXE 4B3TM 4X62M 4YHHM 4DUZM 3U6MA 1HR0M 3SAUA 4OX9M
chains in the Genus database with same CATH superfamily
2OOAA 1RU3A 1HJPA 1NJFA 2EKFA 1YSYA 5IWAM 3J7BA 2ZTCA 4YY3M 1NV8A 1WGLA 2EJSA 2RRUA 4AQYM 3VK8A 2L7HA 1G4AE 3UMMA 5ITQA 3SYLA 4IJFA 2L6OA 4LF8M 2Z4RA 2FNAA 3E9SA 4QOZC 1V92A 1VQ1A 3FKEA 4CJ6A 1N34M 2HHHM 1P3QQ 2H1RA 3AFHA 3FRHA 5E6JA 2UXDM 3AL0C 3L2AA 1XMOM 2DHRA 4D80A 1QZEA 3U6SA 4M9SA 1DO2A 1ORYB 2DI0A 2ZANA 3C3DA 1EE8A 4DBGB 3FTFA 1N33M 2CP8A 3FTDA 4NSRA 4MGKE 3U60A 1OKSA 4FD2A 1L2DA 2UXCM 4QHTA 2ZTDA 1N75A 1Z5AA 5F3WA 3K2LA 5KQDA 1QDTA 1A5TA 2L7IA 3U6DA 3EIEA 1QAQA 2R18A 1KFVA 2LH0A 3HJSA 4WW0A 3MMPA 1Q3CA 2DZNB 4RF0A 2LXEA 2XLJA 4GHAA 1IM2A 3K9OA 4XK8F 1PJTA 2X49A 3I01M 1TDHA 3TQSA 4BBAA 1LV7A 2H5XA 4BLCA 2KEBA 2R65A 3I4YA 3KW6A 1Q39A 3GLFE 2UU9M 2WSCF 3GRYA 5FTKA 1E9SA 3KFUG 3SMPA 2VF7A 4B08A 4GKJM 3CTWB 4S12A 3K92A 2F5PA 1MX0A 1IY0A 2UUAM 4DR3M 2C99A 2YNMD 4L78A 5C18A 2XSZD 4PT5A 3BXWA 1JQJC 2FH0A 4OW0A 4LJ5A 3VLFB 1OJLA 1TTEA 3AJIB 3ZQJA 1C7YA 3CGWA 3HZJA 3F92A 5FSWA 1R2YA 3B74A 1Z5BA 3CF2A 2RGOA 1G3IA 3D8LA 3ZC7B 2BWBA 2O25A 4HEOA 2D7EA 1QUTA 2R0IA 3KSXA 1QVRA 5LMUM 2F5NA 4DR5M 1OQYA 1NSFA 3SYKA 3U5ZA 3KOZE 2LVAA 2QCUA 2XEPA 1ZQ9A 3DFZA 1H6UA 2B3TA 3KXEC 2KRKA 3PNVA 2QPAA 3HY5A 2DZLA 4G4NA 1QDRA 2HKJA 2HWJA 3I04M 2CHGA 1I94M 4LF9M 1MN3A 1YUBA 2KZUA 2CV1A 3FYDA 3Q8XA 4OVZA 4UN2B 4QOSA 3T38A 1Z6TA 1SXJB 3L29A 2BJWA 1IN7A 3VKGA 3LVVA 4AKIA 4B3MM 2DWLA 5BR8M 2EA0A 1ZMWA 1HNXM 1IY2A 3GQ4A 1K3WA 3LCVB 1QAMA 2JWSA 2OPFA 1E9RA 4F1IA 2MR9A 1PJQA 3H4JA 2XZUA 3AOEC 5FTJA 3U5ZB 3GLFA 4JI2M 2K6BA 3GRVA 3TE6A 1L2CA 5DFLA 2DNAA 4NXMM 2JZ0A 1QANA 1W5TA 2JY5A 2K0BX 2DAEA 1XXHE 2Y0QA 1R5LA 2F5QA 2LVPC 1G41A 2DENA 4ZPXA 3U6MA 2OOBA 2ZAOA 1G8PA 4KODA 5DNYA 4LCBA 3TWKA 4CGYB 4PDGA 4JI0M 2HCBA 2W82A 3GRRA 4DV6M 1WHCA 4L6V6 1R7RA 4QNRA 1TH2A 3E46A 3LCUA 1IXSA 3GLFB 3BOSA 2J7NA 1DGHB 3R9XB 2KZSA 4K0KM 1CUKA 4JI3M 4B3RM 2QBYA 1ZAEA 1EFUB 5EP3A 3RGSA 1NV9A 4RKUF 3IHPA 3NWLA 3B9PA 1E32A 2C9CA 3HKPA 1WIVA 1J09A 3HU2A 4LJ7A 3GLGA 1Z5CA 4DV7M 3UJNA 4KO8A 2KNAA 1E94E 1WR1B 4LJAA 3GPPA 3WHLA 2YFQA 4MGYE 2LVNC 4DV3M 1N36M 2R4EA 1VDLA 3H4MA 8CATA 3A46A 2LHGA 4DUYM 2DVWB 3SBJA 4BB9A 3MJ5A 2AHMA 2Z4SA 3HU1A 3SAVA 1GJTA 2HAKA 2XH9A 3VDPA 1IBMM 4I5SA 4IIWA 1IFYA 1GL7A 2M5ZA 2HL7A 3GPYA 1VG5A 2Z3XA 4LFCM 4JI1M 1IN8A 1XXHA 4GKKM 4LF6M 2O5RA 4LRSA 4GMQA 2OO9A 2QSFX 3GLGB 4W5WA 1ZMUA 3U61A 3JAMS 4JI7M 5JI2E 2OQ4A 4PDIA 4JN6A 3FTEA 2DAKA 2YQZA 3J27B 2DAIA 3LQRA 3T6PA 2VQFM 3V76A 3FUVA 1HNZM 4LFBM 5EXXA 3GQ5A 2CEAA 2MH8A 2WSFF 4IBGA 4LJ9A 1J5EM 4DV4M 2Y20A 4NRVA 3CF0A 4FWGA 4R3DA 2R45A 3K8ZA 2O01F 2VDBB 2F4VM 3QWLA 4JV5M 1Q3BA 1ZV1A 4LRTA 3ZH9B 4MH0E 5EXTA 4FWHA 2FOIC 3QAUA 4M9ZA 3U6OA 2P5TA 3VFDA 3AOEA 3R8FA 1HQYE 3U60B 3U61B 1V33A 4AZFA 1G71A 1TR8A 2BWEA 3HHWA 4REZA 1N78A 4IBIA 2KNZA 2R46A 3SFZA 1PJJA 3T1HM 3I51A 1BVSA 4LGMA 3UZUA 4X66M 4NRWA 4GITA 1XHBA 4GH9A 1R4GA 1DO0A 4NC6A 2JY6B 1GKIA 2J5YA 3I4VA 3L26A 2D7GA 4DR1M 3TWMA 5E26A 2UUBM 2QP9X 4A3VB 3FUTA 5EP2A 4ANRA 4LJ4A 1XB2B 2MROB 2N35A 1JR3D 3A45A 4LZZA 2KHHA 4WURA 3SATA 1XNRM 4AW4A 4GC9A 1FNNA 4DV1M 3JR4A 3GLHE 1QUSA 2Q2EB 3HX3A 4PCZA 3PNYA 1VEKA 4Z8XA 4D82A 5ITXE 4B7GA 2JA2A 5DYIA 2Y0TA 3KOWE 1HR0M 4L8RC 3SAUA 4LG2A 4OX9M 2CV0A 4G3OA 2V1CA 1IN4A 1HT2E 2LHCA 4DR4M 3UGJA 1NHGC 2DKLA 4OU7A 2XF3A 1DGFA 1YLAA 5FTLA 4G4QA 3GLIE 2JXNA 1KSFX 3DOAA 4FCTA 3UK6A 3AKZA 1D0LA 4LJ8A 4JXJA 3GO8A 3B7QA 1NJGA 5EQTA 2WSEF 1YE9A 2ERCA 1VEJA 2G3QA 1OIPA 3AV0A 4X65M 3B89A 3D8BA 4IJEA 4NOOB 4B3SM 1L1TA 3B7NA 1NNJA 3HHXA 1MU5A 1NHWC 1Z59A 2R44A 2LVQD 4OVZB 5FTMA 4AG5A 3TL4X 2ZBKB 5KPZA 1QYRA 5GKNA 3PFIA 2QNJA 3KS8A 2CUZA 2J7OA 3QYEA 4CIZA 3T1YM 3DA1A 1WGNA 3KOXE 4GRIA 1W5SA 4LF5M 4DR7M 1VDDA 4IBJA 1G59A 2VIIA 2KW0A 3GLHA 2DAGA 3J7AS 1IN5A 1T6OA 3IECA 4P17A 4QHSA 4JI5M 4JI8M 1D2NA 1Y8GA 4IBCA 3J80S 4R7GA 4CHTB 1IXZA 4HLQA 3U6CA 5KPRA 1T43A 2ZAMA 5ITXA 3THGA 1IN6A 3LQQA 2FFJA 3SARA 1MJGM 3SASA 5KPTA 2DZOB 4LGYA 4WP2A 7CATA 2XSZA 4LFAM 2BJVA 3KSJA 4MM3B 3KOYE 2FE8A 4D81A 3J81S 3C58A 2V1UA 4LF4M 3U6PA 2JY8A 2VQEM 1DGBA 2MGWA 1TF0B 1IBKM 3U6LA 2I7NA 1IXSB 2K9DA 3VDUA 1SXJD 5KO3A 3NBIA 3Q8GA 5EP1A 3GQ3A 3GLIA 1PJIA 2KRUA 3GLHB 1R6BX 4I81A 1WXQA 3LW5F 4M0WA 2QBYB 3TPZA 2X4AA 3T15A 1OAOC 1LTMA 1HQCA 4JI4M 1GABA 2G5GX 2EO2A 3L27A 3FUUA 3RFWA 3WHKA 4NL4H 4MGZE 5C1BA 4GEWA 2F5SA 4F2LA 4EIWA 5EJCA 2CFOA 4KT0F 4ITQA 1GVNA 5A2QS 3U6EA 2KXEA 3A42A 4PD2A 1SG9A 1I4WA 1T3TA 2QHOB 3LVWA 2LTUA 2XGNA 1K3XA 3FUXA 3GPUA 1L2BA 2RKOA 1SXJE 2QQ8A 3K1JA 5EP4A 3GLIB 3HWSA 3VKHA 2R62A 4B7HA 1IBLM 2MJ5B 2EUCA 4G4OA 3HGIA 4GC5A 4RNAA 4L16A 3HJQA 1HT1E 4DR2M 2DWNA 5IZ7D 4IBDA 4G6ZA 1GLNA 1UM8A 4XBOA 5FTNA 4RF1A 1XXHB 5BPVA 3U6QA 1DGGA 4KHPM 3SAWA 1DV0A 2LNHC 1IY1A 2L4EA 3SMSA 3ZCBB 2RGHA 3C9PA 3E21A 1GJSA 4AKHA 3MHVC 4AI6A 4MGIE 2JUJA 2NQ8C 4X62M 1N77A 2KNVA 4YHHM 4DUZM 4GHLA 3M6AA 1L1ZA 1UFZA 5FLXS 2M60A 1EIJA 1QAOA 2I7PA 1L8QA 2JZ1A 2XZFA 1PRBA 4B7FA 2CE7A 3B7ZA 4GIPA 1XC8A 2E5LM 4NXNM 3W67A 3W0LB 2YR0A 3SC3A 2C9OA 2DXIA 1C1KA 2KDLA 4LY6A 3K9PA 3KS4A 3JR5A 3VK7A 1K82A 5KQ8A 5EXSA 1N32M 3AOGA 1Q02A 4XGIA 1OIZA 1PJSA 2DHYA 4G4RA 4DV0M 2CHVA 2LBCA 5LMNM 1NVMA 1D0MA 1QQWA 1V34A 3L28A 2G8LA 2DAMA 2LVOC 3ILKA 4Y28F 5ITTA 3TWLA 3LMMA 2DWZB 4LZJA 1SXJA 2APLA 3GRUA 4I8OA 3W68A 4L4UA 4FCWA 2C96A 3IG5A 1AIPC 1NO1A 2CHQA 3C3EA 4IBBA 2C98A 1JR3E 4QNMA 4DV2M 4KLNA 3J2PB 2JY7A 2L4FA 2FS1A 4LF7M 4AKGA 3FE3A 1WJ7A 4X64M 3HHZA 1TH4A 2GNOA 3NBXX 1R2ZA 4M9XA 2L2DA 2ZM6M 4FCVA 4Q7JA 4IBFA 3RGPA 1GL6A 5EXPA 1OFHA 4LJ6A 2BNKA 3RE8A 2R6FA 3BBZA 5H37D 3GLGE 3GP1A 5L8RF 3A98B 3HU3A 3SHGB 2K47A 2EKKA 1OFIA 4I4LA 3KDSE 1TGUA 2XFSA 5JI3E 4JYAM 2XFTA 2CWBA 2UXBM 5IT9S 1XWIA 1J7KA 4HL4A 1PGYA 1X37A 1NNUC 2V6ZM 3MK6A 4FVMA 4FW9A 3HHYA 2Z7JA 1DGHA 1IXRC 3OTOM 1S3SA 3PVSA 1NY6A 2Z8YM 4P16A 3M7GA 2L09A 3W0FA 1AUAA 2LWXA 4AG6A 2D7HA 3KVWA 3FRIA 1IQPA 1ZMVA 4DV5M 2JNHA 3FYCA 3PXGA 1HNWM 2JP7A 2VF8A 3M0EA 3FTCA 3FUWA 4IBEA 3EIHA 1OTRA 4Z6YA 4MB7A 1JB0F 1KYIA 2A5YB 2WZJA 4MGHA 4CISA 4NSOB 1GO5A 3HJ8A 2DWMA 1SXJC 1TH3A 1D0KA 2R4JA 4R71A 1VEGA 4II7A 5ITYA 4L15A 4M0DA 5ITRA 4FWDA 2QENA 1OAIA 3QYBA 5ITUA 2UUCM 4IBKA 2CV2A 1JR3A 3DZDA 1XMQM 3KP1E 1QZMA 1PM5A 3IG8A 1TDZA 2Y21A 3KP0E 4JI6M 1XNQM 2CRUA 2KA6B 2X8AA 1FJGM 5IREB 3E4RA 2GQFA 2F5OA 5DYGA 4TUWA 3CF6E 3SHFA 3GPXA 2QZ4A 4B3TM 2C5RA 3L25A 3FD9A 4DR6M 1NY5A 1F4IA
chains in the Genus database with same CATH topology
1NJFA 1YSYA 5IWAM 3J7BA 4YY3M 3VK8A 4AQYM 2L7HA 1G4AE 3UMMA 5ITQA 3SYLA 4IJFA 2L6OA 4LF8M 2Z4RA 2FNAA 3E9SA 4QOZC 3FKEA 1N34M 2HHHM 2H1RA 3AFHA 5E6JA 2UXDM 3AL0C 3L2AA 1XMOM 2DHRA 4D80A 3U6SA 4M9SA 1DO2A 1ORYB 2ZANA 1EE8A 3FTFA 1N33M 3FTDA 4NSRA 3U60A 4MGKE 1L2DA 4FD2A 2UXCM 4QHTA 1N75A 1Z5AA 5F3WA 3K2LA 5KQDA 2L7IA 3U6DA 3EIEA 1QAQA 2R18A 1KFVA 2LH0A 3HJSA 4WW0A 1Q3CA 2DZNB 4RF0A 2LXEA 2XLJA 4GHAA 1IM2A 2X49A 3TQSA 1TDHA 4BBAA 1LV7A 4BLCA 2KEBA 2R65A 3I4YA 3KW6A 1Q39A 2UU9M 3GRYA 5FTKA 1E9SA 3KFUG 3SMPA 4B08A 4GKJM 3CTWB 4S12A 3K92A 2F5PA 1MX0A 1IY0A 2UUAM 4DR3M 2C99A 2YNMD 4L78A 5C18A 2XSZD 4PT5A 3VLFB 1JQJC 4OW0A 4LJ5A 1OJLA 3AJIB 5FSWA 1R2YA 1Z5BA 3CF2A 2RGOA 1G3IA 3D8LA 3ZC7B 2D7EA 3KSXA 1QVRA 5LMUM 2F5NA 4DR5M 1NSFA 3SYKA 3U5ZA 3KOZE 3KXEC 3DFZA 2QCUA 1ZQ9A 2XEPA 1H6UA 3PNVA 2KRKA 2QPAA 4G4NA 2HKJA 1I94M 2CHGA 4LF9M 1YUBA 2KZUA 2CV1A 3FYDA 3Q8XA 4OVZA 4QOSA 3T38A 1Z6TA 1SXJB 3L29A 2BJWA 1IN7A 3VKGA 3LVVA 4AKIA 4B3MM 2DWLA 5BR8M 2EA0A 1HNXM 1IY2A 3GQ4A 1K3WA 1QAMA 2OPFA 1E9RA 2XZUA 3AOEC 5FTJA 3U5ZB 3GLFA 4JI2M 3GRVA 3TE6A 1L2CA 4NXMM 1QANA 1W5TA 2Y0QA 2F5QA 1G41A 4ZPXA 3U6MA 2ZAOA 1G8PA 4KODA 5DNYA 4LCBA 3TWKA 4CGYB 4PDGA 4JI0M 2HCBA 2W82A 3GRRA 4DV6M 1R7RA 4QNRA 1TH2A 3GLFB 3BOSA 2J7NA 1DGHB 3R9XB 2KZSA 4K0KM 4JI3M 4B3RM 2QBYA 1ZAEA 5EP3A 3RGSA 3NWLA 3B9PA 1E32A 2C9CA 3HKPA 1J09A 3HU2A 4LJ7A 3GLGA 1Z5CA 4DV7M 3UJNA 4KO8A 1E94E 4LJAA 3GPPA 3WHLA 2YFQA 4MGYE 1N36M 4DV3M 2R4EA 3H4MA 8CATA 3A46A 4DUYM 2DVWB 3SBJA 4BB9A 3MJ5A 2AHMA 2Z4SA 3HU1A 3SAVA 2XH9A 3VDPA 1IBMM 4I5SA 4IIWA 1GL7A 2M5ZA 2HL7A 3GPYA 2Z3XA 4LFCM 4JI1M 1IN8A 1XXHA 4GKKM 4LF6M 2O5RA 4LRSA 4GMQA 3GLGB 3U61A 3J7AS 4W5WA 4JI7M 3JAMS 5JI2E 2OQ4A 4PDIA 4JN6A 3FTEA 2YQZA 3J27B 3LQRA 2VQFM 3FUVA 1HNZM 4LFBM 5EXXA 3GQ5A 2CEAA 4IBGA 4LJ9A 1J5EM 4DV4M 2Y20A 4NRVA 3CF0A 4FWGA 4R3DA 2R45A 3K8ZA 2F4VM 4JV5M 3QWLA 1Q3BA 3U6OA 4LRTA 3ZH9B 4MH0E 5EXTA 4FWHA 2FOIC 3QAUA 4M9ZA 2P5TA 3VFDA 3AOEA 3R8FA 1HQYE 3U60B 3U61B 4AZFA 3HHWA 4REZA 1N78A 4IBIA 2R46A 3SFZA 1PJJA 3T1HM 3I51A 3UZUA 4LGMA 4X66M 4NRWA 4GITA 1XHBA 4GH9A 1DO0A 1GKIA 3I4VA 3L26A 2D7GA 4DR1M 3TWMA 5E26A 2UUBM 2QP9X 4A3VB 3FUTA 5EP2A 4LJ4A 4WURA 1JR3D 3A45A 4LZZA 3SATA 1XNRM 4AW4A 4GC9A 1FNNA 4DV1M 3JR4A 2Q2EB 4PCZA 3PNYA 4Z8XA 4D82A 5ITXE 4B7GA 2JA2A 5DYIA 2Y0TA 3KOWE 1HR0M 4L8RC 3SAUA 4LG2A 4OX9M 2CV0A 2V1CA 1IN4A 1HT2E 4DR4M 3UGJA 1NHGC 4OU7A 2XF3A 1DGFA 5FTLA 4G4QA 1KSFX 3DOAA 4FCTA 3UK6A 3AKZA 4LJ8A 4JXJA 3GO8A 1NJGA 5EQTA 1YE9A 2ERCA 3AV0A 4X65M 3D8BA 4IJEA 4NOOB 4B3SM 1L1TA 1NNJA 3HHXA 1MU5A 1NHWC 1Z59A 4OVZB 5FTMA 4AG5A 3TL4X 2ZBKB 5KPZA 1QYRA 5GKNA 3PFIA 3KS8A 2CUZA 2J7OA 3T1YM 3DA1A 3KOXE 4GRIA 1W5SA 4LF5M 4DR7M 1VDDA 4IBJA 1G59A 2VIIA 2KW0A 3GLHA 1IN5A 4QHSA 4JI5M 4JI8M 1D2NA 4IBCA 3J80S 4R7GA 4CHTB 1IXZA 4HLQA 3U6CA 5KPRA 2ZAMA 5ITXA 3THGA 1IN6A 3LQQA 2FFJA 3SARA 3SASA 5KPTA 2DZOB 4LGYA 7CATA 2XSZA 4LFAM 2BJVA 3KSJA 4MM3B 3KOYE 2FE8A 4D81A 3J81S 3C58A 2V1UA 4LF4M 3U6PA 2VQEM 1DGBA 1IBKM 3U6LA 2I7NA 1IXSB 3VDUA 1SXJD 5KO3A 3NBIA 5EP1A 3GQ3A 3GLIA 1PJIA 2KRUA 3GLHB 1R6BX 4I81A 1WXQA 4M0WA 2QBYB 3TPZA 2X4AA 3T15A 1HQCA 4JI4M 2G5GX 2EO2A 3L27A 3FUUA 3RFWA 3WHKA 4NL4H 4MGZE 5C1BA 2F5SA 4EIWA 5EJCA 2CFOA 4ITQA 1GVNA 5A2QS 3U6EA 2KXEA 3A42A 4PD2A 1I4WA 1T3TA 3LVWA 2XGNA 1K3XA 3FUXA 3GPUA 1L2BA 2RKOA 1SXJE 5EP4A 3K1JA 3GLIB 3VKHA 3HWSA 2R62A 4B7HA 1IBLM 2EUCA 4G4OA 3HGIA 4GC5A 4RNAA 4L16A 3HJQA 1HT1E 4DR2M 2DWNA 5IZ7D 4IBDA 4G6ZA 1GLNA 1UM8A 4XBOA 5FTNA 4RF1A 1XXHB 5BPVA 3U6QA 1DGGA 4KHPM 3SAWA 2LNHC 1IY1A 3SMSA 3ZCBB 2RGHA 4AKHA 4AI6A 3MHVC 4MGIE 2NQ8C 4X62M 1N77A 4YHHM 4DUZM 4GHLA 3M6AA 1L1ZA 5FLXS 2M60A 1QAOA 2I7PA 1L8QA 2XZFA 4B7FA 2CE7A 1XC8A 4GIPA 2E5LM 4NXNM 3W0LB 2YR0A 3SC3A 2C9OA 2DXIA 1C1KA 4LY6A 3VK7A 3KS4A 3JR5A 1K82A 5KQ8A 5EXSA 1N32M 3AOGA 4XGIA 4G4RA 4DV0M 2CHVA 5LMNM 1NVMA 1QQWA 3L28A 2G8LA 3ILKA 5ITTA 3TWLA 3LMMA 2DWZB 4LZJA 1SXJA 3GRUA 4I8OA 4L4UA 4FCWA 2C96A 3IG5A 2CHQA 4IBBA 2C98A 4QNMA 4DV2M 4KLNA 3J2PB 4LF7M 4AKGA 4X64M 3HHZA 1TH4A 1R2ZA 4M9XA 2ZM6M 4FCVA 4IBFA 3RGPA 1GL6A 5EXPA 1OFHA 4LJ6A 2BNKA 3RE8A 5H37D 3GP1A 3A98B 3HU3A 3SHGB 2K47A 1OFIA 4I4LA 3KDSE 1TGUA 2XFSA 5JI3E 4JYAM 2XFTA 2UXBM 5IT9S 1XWIA 1J7KA 4HL4A 1X37A 1NNUC 2V6ZM 3MK6A 4FVMA 4FW9A 3HHYA 2Z7JA 1DGHA 1IXRC 3OTOM 1S3SA 3PVSA 1NY6A 4P16A 3M7GA 2L09A 3W0FA 4AG6A 2LWXA 2D7HA 3KVWA 1IQPA 4DV5M 3FYCA 3PXGA 1HNWM 3M0EA 3FTCA 3FUWA 4IBEA 3EIHA 4Z6YA 4MB7A 1KYIA 2A5YB 4MGHA 4CISA 4NSOB 3HJ8A 2DWMA 1SXJC 1TH3A 2R4JA 4II7A 5ITYA 4L15A 4M0DA 5ITRA 4FWDA 2QENA 2UUCM 5ITUA 4IBKA 2CV2A 1JR3A 3DZDA 1XMQM 3KP1E 1QZMA 1PM5A 3IG8A 1TDZA 2Y21A 3KP0E 4JI6M 1XNQM 2KA6B 2X8AA 1FJGM 5IREB 3E4RA 2F5OA 5DYGA 4TUWA 3CF6E 3SHFA 3GPXA 2QZ4A 4B3TM 2C5RA 3L25A 3FD9A 4DR6M 1NY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLX S;  3TWK A;  5IWA M;  4PDG A;  4DR4 M;  4YY3 M;  4JI0 M;  3VK8 A;  4AQY M;  4DV6 M;  2XZF A;  4DR6 M;  5ITQ A;  4LF8 M;  1XC8 A;  2E5L M;  4G4Q A;  1N34 M;  2HHH M;  3DOA A;  4NXN M;  2UXD M;  4K0K M;  4JI3 M;  4B3R M;  1XMO M;  3GO8 A;  3U6S A;  3VK7 A;  1EE8 A;  1N33 M;  3JR5 A;  1L2D A;  4X65 M;  1K82 A;  2UXC M;  1N32 M;  4B3S M;  4G4R A;  1L1T A;  4DV0 M;  1Z5A A;  5LMN M;  1NNJ A;  1MU5 A;  1Z59 A;  4DV7 M;  1Z5C A;  3U6D A;  2ZBK B;  5ITT A;  3GPP A;  1KFV A;  3TWL A;  1N36 M;  4DV3 M;  1Q3C A;  1L1Z A;  3A46 A;  4DUY M;  3SBJ A;  3T1Y M;  1TDH A;  3SAV A;  4DV2 M;  4LF5 M;  4DR7 M;  1IBM M;  1Q39 A;  4LF7 M;  4JI5 M;  3GPY A;  2UU9 M;  4JI8 M;  4X64 M;  4LFC M;  3J80 S;  4JI1 M;  4GKK M;  1R2Z A;  3U6C A;  4GKJ M;  2ZM6 M;  4LF6 M;  3J7A S;  5ITX A;  2F5P A;  3SAR A;  4JI7 M;  3JAM S;  1MX0 A;  3SAS A;  2UUA M;  2OQ4 A;  4PDI A;  4DR3 M;  4LFA M;  3GP1 A;  4LF4 M;  3J81 S;  3C58 A;  2VQF M;  3U6P A;  1HNZ M;  4LFB M;  2VQE M;  4JYA M;  3GQ5 A;  1R2Y A;  1IBK M;  3U6L A;  1J5E M;  1Z5B A;  4DV4 M;  2UXB M;  5IT9 S;  4NRV A;  4JV5 M;  1PJI A;  3GQ3 A;  2F4V M;  1Q3B A;  5LMU M;  3U6O A;  2F5N A;  3OTO M;  4DR5 M;  4JI4 M;  3W0F A;  2F5S A;  4G4N A;  2HKJ A;  4DV5 M;  1I94 M;  4ITQ A;  5A2Q S;  3U6E A;  1PJJ A;  4LF9 M;  3T1H M;  3A42 A;  1HNW M;  4PD2 A;  4X66 M;  4MB7 A;  4NRW A;  4CIS A;  1K3X A;  3GPU A;  1L2B A;  4B3M M;  5BR8 M;  2EA0 A;  5ITY A;  1HNX M;  4DR1 M;  5ITR A;  3GQ4 A;  1K3W A;  1IBL M;  3TWM A;  2UUB M;  2UUC M;  5ITU A;  4G4O A;  2OPF A;  1XMQ M;  2XZU A;  3A45 A;  1PM5 A;  3SAT A;  4DR2 M;  1XNR M;  1TDZ A;  4JI2 M;  4JI6 M;  1XNQ M;  4DV1 M;  1L2C A;  3JR4 A;  3U6Q A;  2Q2E B;  4NXM M;  1FJG M;  4KHP M;  4PCZ A;  3SAW A;  2F5O A;  2F5Q A;  3GPX A;  5ITX E;  4B3T M;  4X62 M;  4YHH M;  4DUZ M;  3U6M A;  1HR0 M;  3SAU A;  4OX9 M; 
#chains in the Genus database with same CATH topology
 2OOA A;  1RU3 A;  1HJP A;  1NJF A;  2EKF A;  1YSY A;  5IWA M;  3J7B A;  2ZTC A;  4YY3 M;  1NV8 A;  1WGL A;  2EJS A;  2RRU A;  4AQY M;  3VK8 A;  2L7H A;  1G4A E;  3UMM A;  5ITQ A;  3SYL A;  4IJF A;  2L6O A;  4LF8 M;  2Z4R A;  2FNA A;  3E9S A;  4QOZ C;  1V92 A;  1VQ1 A;  3FKE A;  4CJ6 A;  1N34 M;  2HHH M;  1P3Q Q;  2H1R A;  3AFH A;  3FRH A;  5E6J A;  2UXD M;  3AL0 C;  3L2A A;  1XMO M;  2DHR A;  4D80 A;  1QZE A;  3U6S A;  4M9S A;  1DO2 A;  1ORY B;  2DI0 A;  2ZAN A;  3C3D A;  1EE8 A;  4DBG B;  3FTF A;  1N33 M;  2CP8 A;  3FTD A;  4NSR A;  4MGK E;  3U60 A;  1OKS A;  4FD2 A;  1L2D A;  2UXC M;  4QHT A;  2ZTD A;  1N75 A;  1Z5A A;  5F3W A;  3K2L A;  5KQD A;  1QDT A;  1A5T A;  2L7I A;  3U6D A;  3EIE A;  1QAQ A;  2R18 A;  1KFV A;  2LH0 A;  3HJS A;  4WW0 A;  3MMP A;  1Q3C A;  2DZN B;  4RF0 A;  2LXE A;  2XLJ A;  4GHA A;  1IM2 A;  3K9O A;  4XK8 F;  1PJT A;  2X49 A;  3I01 M;  1TDH A;  3TQS A;  4BBA A;  1LV7 A;  2H5X A;  4BLC A;  2KEB A;  2R65 A;  3I4Y A;  3KW6 A;  1Q39 A;  3GLF E;  2UU9 M;  2WSC F;  3GRY A;  5FTK A;  1E9S A;  3KFU G;  3SMP A;  2VF7 A;  4B08 A;  4GKJ M;  3CTW B;  4S12 A;  3K92 A;  2F5P A;  1MX0 A;  1IY0 A;  2UUA M;  4DR3 M;  2C99 A;  2YNM D;  4L78 A;  5C18 A;  2XSZ D;  4PT5 A;  3BXW A;  1JQJ C;  2FH0 A;  4OW0 A;  4LJ5 A;  3VLF B;  1OJL A;  1TTE A;  3AJI B;  3ZQJ A;  1C7Y A;  3CGW A;  3HZJ A;  3F92 A;  5FSW A;  1R2Y A;  3B74 A;  1Z5B A;  3CF2 A;  2RGO A;  1G3I A;  3D8L A;  3ZC7 B;  2BWB A;  2O25 A;  4HEO A;  2D7E A;  1QUT A;  2R0I A;  3KSX A;  1QVR A;  5LMU M;  2F5N A;  4DR5 M;  1OQY A;  1NSF A;  3SYK A;  3U5Z A;  3KOZ E;  2LVA A;  2QCU A;  2XEP A;  1ZQ9 A;  3DFZ A;  1H6U A;  2B3T A;  3KXE C;  2KRK A;  3PNV A;  2QPA A;  3HY5 A;  2DZL A;  4G4N A;  1QDR A;  2HKJ A;  2HWJ A;  3I04 M;  2CHG A;  1I94 M;  4LF9 M;  1MN3 A;  1YUB A;  2KZU A;  2CV1 A;  3FYD A;  3Q8X A;  4OVZ A;  4UN2 B;  4QOS A;  3T38 A;  1Z6T A;  1SXJ B;  3L29 A;  2BJW A;  1IN7 A;  3VKG A;  3LVV A;  4AKI A;  4B3M M;  2DWL A;  5BR8 M;  2EA0 A;  1ZMW A;  1HNX M;  1IY2 A;  3GQ4 A;  1K3W A;  3LCV B;  1QAM A;  2JWS A;  2OPF A;  1E9R A;  4F1I A;  2MR9 A;  1PJQ A;  3H4J A;  2XZU A;  3AOE C;  5FTJ A;  3U5Z B;  3GLF A;  4JI2 M;  2K6B A;  3GRV A;  3TE6 A;  1L2C A;  5DFL A;  2DNA A;  4NXM M;  2JZ0 A;  1QAN A;  1W5T A;  2JY5 A;  2K0B X;  2DAE A;  1XXH E;  2Y0Q A;  1R5L A;  2F5Q A;  2LVP C;  1G41 A;  2DEN A;  4ZPX A;  3U6M A;  2OOB A;  2ZAO A;  1G8P A;  4KOD A;  5DNY A;  4LCB A;  3TWK A;  4CGY B;  4PDG A;  4JI0 M;  2HCB A;  2W82 A;  3GRR A;  4DV6 M;  1WHC A;  4L6V 6;  1R7R A;  4QNR A;  1TH2 A;  3E46 A;  3LCU A;  1IXS A;  3GLF B;  3BOS A;  2J7N A;  1DGH B;  3R9X B;  2KZS A;  4K0K M;  1CUK A;  4JI3 M;  4B3R M;  2QBY A;  1ZAE A;  1EFU B;  5EP3 A;  3RGS A;  1NV9 A;  4RKU F;  3IHP A;  3NWL A;  3B9P A;  1E32 A;  2C9C A;  3HKP A;  1WIV A;  1J09 A;  3HU2 A;  4LJ7 A;  3GLG A;  1Z5C A;  4DV7 M;  3UJN A;  4KO8 A;  2KNA A;  1E94 E;  1WR1 B;  4LJA A;  3GPP A;  3WHL A;  2YFQ A;  4MGY E;  2LVN C;  4DV3 M;  1N36 M;  2R4E A;  1VDL A;  3H4M A;  8CAT A;  3A46 A;  2LHG A;  4DUY M;  2DVW B;  3SBJ A;  4BB9 A;  3MJ5 A;  2AHM A;  2Z4S A;  3HU1 A;  3SAV A;  1GJT A;  2HAK A;  2XH9 A;  3VDP A;  1IBM M;  4I5S A;  4IIW A;  1IFY A;  1GL7 A;  2M5Z A;  2HL7 A;  3GPY A;  1VG5 A;  2Z3X A;  4LFC M;  4JI1 M;  1IN8 A;  1XXH A;  4GKK M;  4LF6 M;  2O5R A;  4LRS A;  4GMQ A;  2OO9 A;  2QSF X;  3GLG B;  4W5W A;  1ZMU A;  3U61 A;  3JAM S;  4JI7 M;  5JI2 E;  2OQ4 A;  4PDI A;  4JN6 A;  3FTE A;  2DAK A;  2YQZ A;  3J27 B;  2DAI A;  3LQR A;  3T6P A;  2VQF M;  3V76 A;  3FUV A;  1HNZ M;  4LFB M;  5EXX A;  3GQ5 A;  2CEA A;  2MH8 A;  2WSF F;  4IBG A;  4LJ9 A;  1J5E M;  4DV4 M;  2Y20 A;  4NRV A;  3CF0 A;  4FWG A;  4R3D A;  2R45 A;  3K8Z A;  2O01 F;  2VDB B;  2F4V M;  3QWL A;  4JV5 M;  1Q3B A;  1ZV1 A;  4LRT A;  3ZH9 B;  4MH0 E;  5EXT A;  4FWH A;  2FOI C;  3QAU A;  4M9Z A;  3U6O A;  2P5T A;  3VFD A;  3AOE A;  3R8F A;  1HQY E;  3U60 B;  3U61 B;  1V33 A;  4AZF A;  1G71 A;  1TR8 A;  2BWE A;  3HHW A;  4REZ A;  1N78 A;  4IBI A;  2KNZ A;  2R46 A;  3SFZ A;  1PJJ A;  3T1H M;  3I51 A;  1BVS A;  4LGM A;  3UZU A;  4X66 M;  4NRW A;  4GIT A;  1XHB A;  4GH9 A;  1R4G A;  1DO0 A;  4NC6 A;  2JY6 B;  1GKI A;  2J5Y A;  3I4V A;  3L26 A;  2D7G A;  4DR1 M;  3TWM A;  5E26 A;  2UUB M;  2QP9 X;  4A3V B;  3FUT A;  5EP2 A;  4ANR A;  4LJ4 A;  1XB2 B;  2MRO B;  2N35 A;  1JR3 D;  3A45 A;  4LZZ A;  2KHH A;  4WUR A;  3SAT A;  1XNR M;  4AW4 A;  4GC9 A;  1FNN A;  4DV1 M;  3JR4 A;  3GLH E;  1QUS A;  2Q2E B;  3HX3 A;  4PCZ A;  3PNY A;  1VEK A;  4Z8X A;  4D82 A;  5ITX E;  4B7G A;  2JA2 A;  5DYI A;  2Y0T A;  3KOW E;  1HR0 M;  4L8R C;  3SAU A;  4LG2 A;  4OX9 M;  2CV0 A;  4G3O A;  2V1C A;  1IN4 A;  1HT2 E;  2LHC A;  4DR4 M;  3UGJ A;  1NHG C;  2DKL A;  4OU7 A;  2XF3 A;  1DGF A;  1YLA A;  5FTL A;  4G4Q A;  3GLI E;  2JXN A;  1KSF X;  3DOA A;  4FCT A;  3UK6 A;  3AKZ A;  1D0L A;  4LJ8 A;  4JXJ A;  3GO8 A;  3B7Q A;  1NJG A;  5EQT A;  2WSE F;  1YE9 A;  2ERC A;  1VEJ A;  2G3Q A;  1OIP A;  3AV0 A;  4X65 M;  3B89 A;  3D8B A;  4IJE A;  4NOO B;  4B3S M;  1L1T A;  3B7N A;  1NNJ A;  3HHX A;  1MU5 A;  1NHW C;  1Z59 A;  2R44 A;  2LVQ D;  4OVZ B;  5FTM A;  4AG5 A;  3TL4 X;  2ZBK B;  5KPZ A;  1QYR A;  5GKN A;  3PFI A;  2QNJ A;  3KS8 A;  2CUZ A;  2J7O A;  3QYE A;  4CIZ A;  3T1Y M;  3DA1 A;  1WGN A;  3KOX E;  4GRI A;  1W5S A;  4LF5 M;  4DR7 M;  1VDD A;  4IBJ A;  1G59 A;  2VII A;  2KW0 A;  3GLH A;  2DAG A;  3J7A S;  1IN5 A;  1T6O A;  3IEC A;  4P17 A;  4QHS A;  4JI5 M;  4JI8 M;  1D2N A;  1Y8G A;  4IBC A;  3J80 S;  4R7G A;  4CHT B;  1IXZ A;  4HLQ A;  3U6C A;  5KPR A;  1T43 A;  2ZAM A;  5ITX A;  3THG A;  1IN6 A;  3LQQ A;  2FFJ A;  3SAR A;  1MJG M;  3SAS A;  5KPT A;  2DZO B;  4LGY A;  4WP2 A;  7CAT A;  2XSZ A;  4LFA M;  2BJV A;  3KSJ A;  4MM3 B;  3KOY E;  2FE8 A;  4D81 A;  3J81 S;  3C58 A;  2V1U A;  4LF4 M;  3U6P A;  2JY8 A;  2VQE M;  1DGB A;  2MGW A;  1TF0 B;  1IBK M;  3U6L A;  2I7N A;  1IXS B;  2K9D A;  3VDU A;  1SXJ D;  5KO3 A;  3NBI A;  3Q8G A;  5EP1 A;  3GQ3 A;  3GLI A;  1PJI A;  2KRU A;  3GLH B;  1R6B X;  4I81 A;  1WXQ A;  3LW5 F;  4M0W A;  2QBY B;  3TPZ A;  2X4A A;  3T15 A;  1OAO C;  1LTM A;  1HQC A;  4JI4 M;  1GAB A;  2G5G X;  2EO2 A;  3L27 A;  3FUU A;  3RFW A;  3WHK A;  4NL4 H;  4MGZ E;  5C1B A;  4GEW A;  2F5S A;  4F2L A;  4EIW A;  5EJC A;  2CFO A;  4KT0 F;  4ITQ A;  1GVN A;  5A2Q S;  3U6E A;  2KXE A;  3A42 A;  4PD2 A;  1SG9 A;  1I4W A;  1T3T A;  2QHO B;  3LVW A;  2LTU A;  2XGN A;  1K3X A;  3FUX A;  3GPU A;  1L2B A;  2RKO A;  1SXJ E;  2QQ8 A;  3K1J A;  5EP4 A;  3GLI B;  3HWS A;  3VKH A;  2R62 A;  4B7H A;  1IBL M;  2MJ5 B;  2EUC A;  4G4O A;  3HGI A;  4GC5 A;  4RNA A;  4L16 A;  3HJQ A;  1HT1 E;  4DR2 M;  2DWN A;  5IZ7 D;  4IBD A;  4G6Z A;  1GLN A;  1UM8 A;  4XBO A;  5FTN A;  4RF1 A;  1XXH B;  5BPV A;  3U6Q A;  1DGG A;  4KHP M;  3SAW A;  1DV0 A;  2LNH C;  1IY1 A;  2L4E A;  3SMS A;  3ZCB B;  2RGH A;  3C9P A;  3E21 A;  1GJS A;  4AKH A;  3MHV C;  4AI6 A;  4MGI E;  2JUJ A;  2NQ8 C;  4X62 M;  1N77 A;  2KNV A;  4YHH M;  4DUZ M;  4GHL A;  3M6A A;  1L1Z A;  1UFZ A;  5FLX S;  2M60 A;  1EIJ A;  1QAO A;  2I7P A;  1L8Q A;  2JZ1 A;  2XZF A;  1PRB A;  4B7F A;  2CE7 A;  3B7Z A;  4GIP A;  1XC8 A;  2E5L M;  4NXN M;  3W67 A;  3W0L B;  2YR0 A;  3SC3 A;  2C9O A;  2DXI A;  1C1K A;  2KDL A;  4LY6 A;  3K9P A;  3KS4 A;  3JR5 A;  3VK7 A;  1K82 A;  5KQ8 A;  5EXS A;  1N32 M;  3AOG A;  1Q02 A;  4XGI A;  1OIZ A;  1PJS A;  2DHY A;  4G4R A;  4DV0 M;  2CHV A;  2LBC A;  5LMN M;  1NVM A;  1D0M A;  1QQW A;  1V34 A;  3L28 A;  2G8L A;  2DAM A;  2LVO C;  3ILK A;  4Y28 F;  5ITT A;  3TWL A;  3LMM A;  2DWZ B;  4LZJ A;  1SXJ A;  2APL A;  3GRU A;  4I8O A;  3W68 A;  4L4U A;  4FCW A;  2C96 A;  3IG5 A;  1AIP C;  1NO1 A;  2CHQ A;  3C3E A;  4IBB A;  2C98 A;  1JR3 E;  4QNM A;  4DV2 M;  4KLN A;  3J2P B;  2JY7 A;  2L4F A;  2FS1 A;  4LF7 M;  4AKG A;  3FE3 A;  1WJ7 A;  4X64 M;  3HHZ A;  1TH4 A;  2GNO A;  3NBX X;  1R2Z A;  4M9X A;  2L2D A;  2ZM6 M;  4FCV A;  4Q7J A;  4IBF A;  3RGP A;  1GL6 A;  5EXP A;  1OFH A;  4LJ6 A;  2BNK A;  3RE8 A;  2R6F A;  3BBZ A;  5H37 D;  3GLG E;  3GP1 A;  5L8R F;  3A98 B;  3HU3 A;  3SHG B;  2K47 A;  2EKK A;  1OFI A;  4I4L A;  3KDS E;  1TGU A;  2XFS A;  5JI3 E;  4JYA M;  2XFT A;  2CWB A;  2UXB M;  5IT9 S;  1XWI A;  1J7K A;  4HL4 A;  1PGY A;  1X37 A;  1NNU C;  2V6Z M;  3MK6 A;  4FVM A;  4FW9 A;  3HHY A;  2Z7J A;  1DGH A;  1IXR C;  3OTO M;  1S3S A;  3PVS A;  1NY6 A;  2Z8Y M;  4P16 A;  3M7G A;  2L09 A;  3W0F A;  1AUA A;  2LWX A;  4AG6 A;  2D7H A;  3KVW A;  3FRI A;  1IQP A;  1ZMV A;  4DV5 M;  2JNH A;  3FYC A;  3PXG A;  1HNW M;  2JP7 A;  2VF8 A;  3M0E A;  3FTC A;  3FUW A;  4IBE A;  3EIH A;  1OTR A;  4Z6Y A;  4MB7 A;  1JB0 F;  1KYI A;  2A5Y B;  2WZJ A;  4MGH A;  4CIS A;  4NSO B;  1GO5 A;  3HJ8 A;  2DWM A;  1SXJ C;  1TH3 A;  1D0K A;  2R4J A;  4R71 A;  1VEG A;  4II7 A;  5ITY A;  4L15 A;  4M0D A;  5ITR A;  4FWD A;  2QEN A;  1OAI A;  3QYB A;  5ITU A;  2UUC M;  4IBK A;  2CV2 A;  1JR3 A;  3DZD A;  1XMQ M;  3KP1 E;  1QZM A;  1PM5 A;  3IG8 A;  1TDZ A;  2Y21 A;  3KP0 E;  4JI6 M;  1XNQ M;  2CRU A;  2KA6 B;  2X8A A;  1FJG M;  5IRE B;  3E4R A;  2GQF A;  2F5O A;  5DYG A;  4TUW A;  3CF6 E;  3SHF A;  3GPX A;  2QZ4 A;  4B3T M;  2C5R A;  3L25 A;  3FD9 A;  4DR6 M;  1NY5 A;  1F4I A; 
#chains in the Genus database with same CATH homology
 1NJF A;  1YSY A;  5IWA M;  3J7B A;  4YY3 M;  3VK8 A;  4AQY M;  2L7H A;  1G4A E;  3UMM A;  5ITQ A;  3SYL A;  4IJF A;  2L6O A;  4LF8 M;  2Z4R A;  2FNA A;  3E9S A;  4QOZ C;  3FKE A;  1N34 M;  2HHH M;  2H1R A;  3AFH A;  5E6J A;  2UXD M;  3AL0 C;  3L2A A;  1XMO M;  2DHR A;  4D80 A;  3U6S A;  4M9S A;  1DO2 A;  1ORY B;  2ZAN A;  1EE8 A;  3FTF A;  1N33 M;  3FTD A;  4NSR A;  3U60 A;  4MGK E;  1L2D A;  4FD2 A;  2UXC M;  4QHT A;  1N75 A;  1Z5A A;  5F3W A;  3K2L A;  5KQD A;  2L7I A;  3U6D A;  3EIE A;  1QAQ A;  2R18 A;  1KFV A;  2LH0 A;  3HJS A;  4WW0 A;  1Q3C A;  2DZN B;  4RF0 A;  2LXE A;  2XLJ A;  4GHA A;  1IM2 A;  2X49 A;  3TQS A;  1TDH A;  4BBA A;  1LV7 A;  4BLC A;  2KEB A;  2R65 A;  3I4Y A;  3KW6 A;  1Q39 A;  2UU9 M;  3GRY A;  5FTK A;  1E9S A;  3KFU G;  3SMP A;  4B08 A;  4GKJ M;  3CTW B;  4S12 A;  3K92 A;  2F5P A;  1MX0 A;  1IY0 A;  2UUA M;  4DR3 M;  2C99 A;  2YNM D;  4L78 A;  5C18 A;  2XSZ D;  4PT5 A;  3VLF B;  1JQJ C;  4OW0 A;  4LJ5 A;  1OJL A;  3AJI B;  5FSW A;  1R2Y A;  1Z5B A;  3CF2 A;  2RGO A;  1G3I A;  3D8L A;  3ZC7 B;  2D7E A;  3KSX A;  1QVR A;  5LMU M;  2F5N A;  4DR5 M;  1NSF A;  3SYK A;  3U5Z A;  3KOZ E;  3KXE C;  3DFZ A;  2QCU A;  1ZQ9 A;  2XEP A;  1H6U A;  3PNV A;  2KRK A;  2QPA A;  4G4N A;  2HKJ A;  1I94 M;  2CHG A;  4LF9 M;  1YUB A;  2KZU A;  2CV1 A;  3FYD A;  3Q8X A;  4OVZ A;  4QOS A;  3T38 A;  1Z6T A;  1SXJ B;  3L29 A;  2BJW A;  1IN7 A;  3VKG A;  3LVV A;  4AKI A;  4B3M M;  2DWL A;  5BR8 M;  2EA0 A;  1HNX M;  1IY2 A;  3GQ4 A;  1K3W A;  1QAM A;  2OPF A;  1E9R A;  2XZU A;  3AOE C;  5FTJ A;  3U5Z B;  3GLF A;  4JI2 M;  3GRV A;  3TE6 A;  1L2C A;  4NXM M;  1QAN A;  1W5T A;  2Y0Q A;  2F5Q A;  1G41 A;  4ZPX A;  3U6M A;  2ZAO A;  1G8P A;  4KOD A;  5DNY A;  4LCB A;  3TWK A;  4CGY B;  4PDG A;  4JI0 M;  2HCB A;  2W82 A;  3GRR A;  4DV6 M;  1R7R A;  4QNR A;  1TH2 A;  3GLF B;  3BOS A;  2J7N A;  1DGH B;  3R9X B;  2KZS A;  4K0K M;  4JI3 M;  4B3R M;  2QBY A;  1ZAE A;  5EP3 A;  3RGS A;  3NWL A;  3B9P A;  1E32 A;  2C9C A;  3HKP A;  1J09 A;  3HU2 A;  4LJ7 A;  3GLG A;  1Z5C A;  4DV7 M;  3UJN A;  4KO8 A;  1E94 E;  4LJA A;  3GPP A;  3WHL A;  2YFQ A;  4MGY E;  1N36 M;  4DV3 M;  2R4E A;  3H4M A;  8CAT A;  3A46 A;  4DUY M;  2DVW B;  3SBJ A;  4BB9 A;  3MJ5 A;  2AHM A;  2Z4S A;  3HU1 A;  3SAV A;  2XH9 A;  3VDP A;  1IBM M;  4I5S A;  4IIW A;  1GL7 A;  2M5Z A;  2HL7 A;  3GPY A;  2Z3X A;  4LFC M;  4JI1 M;  1IN8 A;  1XXH A;  4GKK M;  4LF6 M;  2O5R A;  4LRS A;  4GMQ A;  3GLG B;  3U61 A;  3J7A S;  4W5W A;  4JI7 M;  3JAM S;  5JI2 E;  2OQ4 A;  4PDI A;  4JN6 A;  3FTE A;  2YQZ A;  3J27 B;  3LQR A;  2VQF M;  3FUV A;  1HNZ M;  4LFB M;  5EXX A;  3GQ5 A;  2CEA A;  4IBG A;  4LJ9 A;  1J5E M;  4DV4 M;  2Y20 A;  4NRV A;  3CF0 A;  4FWG A;  4R3D A;  2R45 A;  3K8Z A;  2F4V M;  4JV5 M;  3QWL A;  1Q3B A;  3U6O A;  4LRT A;  3ZH9 B;  4MH0 E;  5EXT A;  4FWH A;  2FOI C;  3QAU A;  4M9Z A;  2P5T A;  3VFD A;  3AOE A;  3R8F A;  1HQY E;  3U60 B;  3U61 B;  4AZF A;  3HHW A;  4REZ A;  1N78 A;  4IBI A;  2R46 A;  3SFZ A;  1PJJ A;  3T1H M;  3I51 A;  3UZU A;  4LGM A;  4X66 M;  4NRW A;  4GIT A;  1XHB A;  4GH9 A;  1DO0 A;  1GKI A;  3I4V A;  3L26 A;  2D7G A;  4DR1 M;  3TWM A;  5E26 A;  2UUB M;  2QP9 X;  4A3V B;  3FUT A;  5EP2 A;  4LJ4 A;  4WUR A;  1JR3 D;  3A45 A;  4LZZ A;  3SAT A;  1XNR M;  4AW4 A;  4GC9 A;  1FNN A;  4DV1 M;  3JR4 A;  2Q2E B;  4PCZ A;  3PNY A;  4Z8X A;  4D82 A;  5ITX E;  4B7G A;  2JA2 A;  5DYI A;  2Y0T A;  3KOW E;  1HR0 M;  4L8R C;  3SAU A;  4LG2 A;  4OX9 M;  2CV0 A;  2V1C A;  1IN4 A;  1HT2 E;  4DR4 M;  3UGJ A;  1NHG C;  4OU7 A;  2XF3 A;  1DGF A;  5FTL A;  4G4Q A;  1KSF X;  3DOA A;  4FCT A;  3UK6 A;  3AKZ A;  4LJ8 A;  4JXJ A;  3GO8 A;  1NJG A;  5EQT A;  1YE9 A;  2ERC A;  3AV0 A;  4X65 M;  3D8B A;  4IJE A;  4NOO B;  4B3S M;  1L1T A;  1NNJ A;  3HHX A;  1MU5 A;  1NHW C;  1Z59 A;  4OVZ B;  5FTM A;  4AG5 A;  3TL4 X;  2ZBK B;  5KPZ A;  1QYR A;  5GKN A;  3PFI A;  3KS8 A;  2CUZ A;  2J7O A;  3T1Y M;  3DA1 A;  3KOX E;  4GRI A;  1W5S A;  4LF5 M;  4DR7 M;  1VDD A;  4IBJ A;  1G59 A;  2VII A;  2KW0 A;  3GLH A;  1IN5 A;  4QHS A;  4JI5 M;  4JI8 M;  1D2N A;  4IBC A;  3J80 S;  4R7G A;  4CHT B;  1IXZ A;  4HLQ A;  3U6C A;  5KPR A;  2ZAM A;  5ITX A;  3THG A;  1IN6 A;  3LQQ A;  2FFJ A;  3SAR A;  3SAS A;  5KPT A;  2DZO B;  4LGY A;  7CAT A;  2XSZ A;  4LFA M;  2BJV A;  3KSJ A;  4MM3 B;  3KOY E;  2FE8 A;  4D81 A;  3J81 S;  3C58 A;  2V1U A;  4LF4 M;  3U6P A;  2VQE M;  1DGB A;  1IBK M;  3U6L A;  2I7N A;  1IXS B;  3VDU A;  1SXJ D;  5KO3 A;  3NBI A;  5EP1 A;  3GQ3 A;  3GLI A;  1PJI A;  2KRU A;  3GLH B;  1R6B X;  4I81 A;  1WXQ A;  4M0W A;  2QBY B;  3TPZ A;  2X4A A;  3T15 A;  1HQC A;  4JI4 M;  2G5G X;  2EO2 A;  3L27 A;  3FUU A;  3RFW A;  3WHK A;  4NL4 H;  4MGZ E;  5C1B A;  2F5S A;  4EIW A;  5EJC A;  2CFO A;  4ITQ A;  1GVN A;  5A2Q S;  3U6E A;  2KXE A;  3A42 A;  4PD2 A;  1I4W A;  1T3T A;  3LVW A;  2XGN A;  1K3X A;  3FUX A;  3GPU A;  1L2B A;  2RKO A;  1SXJ E;  5EP4 A;  3K1J A;  3GLI B;  3VKH A;  3HWS A;  2R62 A;  4B7H A;  1IBL M;  2EUC A;  4G4O A;  3HGI A;  4GC5 A;  4RNA A;  4L16 A;  3HJQ A;  1HT1 E;  4DR2 M;  2DWN A;  5IZ7 D;  4IBD A;  4G6Z A;  1GLN A;  1UM8 A;  4XBO A;  5FTN A;  4RF1 A;  1XXH B;  5BPV A;  3U6Q A;  1DGG A;  4KHP M;  3SAW A;  2LNH C;  1IY1 A;  3SMS A;  3ZCB B;  2RGH A;  4AKH A;  4AI6 A;  3MHV C;  4MGI E;  2NQ8 C;  4X62 M;  1N77 A;  4YHH M;  4DUZ M;  4GHL A;  3M6A A;  1L1Z A;  5FLX S;  2M60 A;  1QAO A;  2I7P A;  1L8Q A;  2XZF A;  4B7F A;  2CE7 A;  1XC8 A;  4GIP A;  2E5L M;  4NXN M;  3W0L B;  2YR0 A;  3SC3 A;  2C9O A;  2DXI A;  1C1K A;  4LY6 A;  3VK7 A;  3KS4 A;  3JR5 A;  1K82 A;  5KQ8 A;  5EXS A;  1N32 M;  3AOG A;  4XGI A;  4G4R A;  4DV0 M;  2CHV A;  5LMN M;  1NVM A;  1QQW A;  3L28 A;  2G8L A;  3ILK A;  5ITT A;  3TWL A;  3LMM A;  2DWZ B;  4LZJ A;  1SXJ A;  3GRU A;  4I8O A;  4L4U A;  4FCW A;  2C96 A;  3IG5 A;  2CHQ A;  4IBB A;  2C98 A;  4QNM A;  4DV2 M;  4KLN A;  3J2P B;  4LF7 M;  4AKG A;  4X64 M;  3HHZ A;  1TH4 A;  1R2Z A;  4M9X A;  2ZM6 M;  4FCV A;  4IBF A;  3RGP A;  1GL6 A;  5EXP A;  1OFH A;  4LJ6 A;  2BNK A;  3RE8 A;  5H37 D;  3GP1 A;  3A98 B;  3HU3 A;  3SHG B;  2K47 A;  1OFI A;  4I4L A;  3KDS E;  1TGU A;  2XFS A;  5JI3 E;  4JYA M;  2XFT A;  2UXB M;  5IT9 S;  1XWI A;  1J7K A;  4HL4 A;  1X37 A;  1NNU C;  2V6Z M;  3MK6 A;  4FVM A;  4FW9 A;  3HHY A;  2Z7J A;  1DGH A;  1IXR C;  3OTO M;  1S3S A;  3PVS A;  1NY6 A;  4P16 A;  3M7G A;  2L09 A;  3W0F A;  4AG6 A;  2LWX A;  2D7H A;  3KVW A;  1IQP A;  4DV5 M;  3FYC A;  3PXG A;  1HNW M;  3M0E A;  3FTC A;  3FUW A;  4IBE A;  3EIH A;  4Z6Y A;  4MB7 A;  1KYI A;  2A5Y B;  4MGH A;  4CIS A;  4NSO B;  3HJ8 A;  2DWM A;  1SXJ C;  1TH3 A;  2R4J A;  4II7 A;  5ITY A;  4L15 A;  4M0D A;  5ITR A;  4FWD A;  2QEN A;  2UUC M;  5ITU A;  4IBK A;  2CV2 A;  1JR3 A;  3DZD A;  1XMQ M;  3KP1 E;  1QZM A;  1PM5 A;  3IG8 A;  1TDZ A;  2Y21 A;  3KP0 E;  4JI6 M;  1XNQ M;  2KA6 B;  2X8A A;  1FJG M;  5IRE B;  3E4R A;  2F5O A;  5DYG A;  4TUW A;  3CF6 E;  3SHF A;  3GPX A;  2QZ4 A;  4B3T M;  2C5R A;  3L25 A;  3FD9 A;  4DR6 M;  1NY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...