4JI3M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule keywords 16S rRNA
molecule tags Ribosome
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ji3M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4ji3M02
3JR5A 4DV5M 1L2CA 4DR7M 1MX0A 1N33M 3GPYA 4G4NA 3J80S 4LF8M 4DV1M 3T1HM 1MU5A 3GPPA 2UUAM 5LMUM 5LMNM 3U6PA 1PM5A 2UU9M 5ITTA 4DR2M 4DUZM 3J7AS 1K3WA 4JI7M 4X62M 3GP1A 1XC8A 2XZFA 4DV0M 3W0FA 4LF9M 1PJJA 3U6QA 3JR4A 4PD2A 1Q39A 4ITQA 4X65M 3A42A 3VK7A 2UXDM 4NXNM 3U6SA 4PCZA 3GPXA 4JI5M 1L1ZA 1TDHA 5ITQA 4LFBM 4JI3M 3TWKA 3U6LA 3OTOM 4OX9M 4X66M 4JI0M 1Q3BA 3GPUA 4DR1M 1K82A 2UUCM 2VQFM 4DR6M 1FJGM 4JV5M 4LF7M 4B3RM 2F5PA 5FLXS 4DR3M 2XZUA 1L2BA 5ITXE 5BR8M 4G4RA 1K3XA 4LF5M 2UXCM 3VK8A 5ITYA 4JI2M 1I94M 4KHPM 3SAWA 1TDZA 5IWAM 1IBLM 4GKJM 1Z5AA 2HHHM 2F5OA 3SAUA 1L2DA 1Z5BA 4YHHM 5ITUA 2VQEM 2E5LM 4K0KM 3GQ4A 4DR4M 5IT9S 4JI1M 1R2YA 2EA0A 4DV7M 4NXMM 1XNRM 1IBKM 1HR0M 1HNWM 3U6EA 3U6DA 4G4OA 1J5EM 2OPFA 1PJIA 2Q2EB 2ZBKB 4JI6M 2UXBM 2UUBM 3T1YM 1XMQM 4GKKM 4DV3M 4LFAM 1N34M 1HNXM 4G4QA 4X64M 3J81S 4CISA 5A2QS 1Z5CA 4YY3M 5ITXA 4B3TM 3GO8A 4LF4M 3A45A 4JI4M 2OQ4A 4DV6M 3SAVA 1NNJA 1N32M 4DV2M 3U6OA 1EE8A 4NRVA 1Q3CA 4NRWA 3A46A 4MB7A 2F4VM 4B3SM 3TWLA 3C58A 1R2ZA 3GQ3A 1Z59A 4JYAM 3U6MA 4PDGA 3DOAA 1HNZM 5ITRA 3GQ5A 4DV4M 1N36M 3TWMA 4LF6M 1L1TA 3JAMS 2ZM6M 3SBJA 1IBMM 2HKJA 2F5SA 4DUYM 4PDIA 4DR5M 2F5NA 3SATA 4B3MM 3SASA 1KFVA 1XNQM 4LFCM 3U6CA 4AQYM 2F5QA 1XMOM 3SARA 4JI8M
chains in the Genus database with same CATH superfamily
4DV5M 1GJTA 3HU1A 3SHGB 2DI0A 2CP8A 4NSOB 1SXJC 1L2CA 2J7OA 4DR7M 3FUWA 4II7A 3U61B 1IXRC 4LF8M 2HAKA 3C3DA 3KXEC 1LV7A 5LMUM 1PM5A 2XFSA 2JY5A 4DR2M 4I81A 2YFQA 1E94E 4FVMA 2R45A 4GEWA 1VEGA 2L09A 4X62M 2R0IA 3SMPA 2XZFA 2I7PA 3UGJA 2QBYB 2HWJA 1DGHA 2V1CA 3LMMA 3M0EA 4BBAA 1QAOA 2C99A 4X65M 5F3WA 4MGIE 4NXNM 1GLNA 2WZJA 2M5ZA 3QWLA 4JI5M 2X4AA 4WURA 5ITQA 3PNVA 4FCVA 2JWSA 2QSFX 2KA6B 4OVZA 4IBDA 1J09A 1SXJA 5EP4A 3HHYA 4X66M 4B08A 4Z6YA 2YR0A 2Z4RA 1OAIA 1PRBA 1FJGM 3HKPA 3AJIB 4GRIA 4LF7M 3B7NA 3NWLA 3Q8GA 3H4JA 5FLXS 1IQPA 1A5TA 3TL4X 5GKNA 2CV0A 2JY7A 3NBIA 4M0WA 5ITXE 2EKFA 3KFUG 2UXCM 3LQRA 1VG5A 1N78A 3MMPA 2ERCA 3AOEC 2Z7JA 4LJAA 1I94M 2R4JA 3FTFA 1D0MA 1ORYB 2HHHM 1WXQA 3SAUA 3SHFA 2DKLA 3B7ZA 2FOIC 1IXSB 3FUUA 4KLNA 2DZOB 3C3EA 3FRHA 2EKKA 4FWDA 4GC9A 4ZPXA 4DR4M 2M60A 5IT9S 1R2YA 3THGA 2KRKA 3KP1E 3VKHA 2R62A 1IY0A 1XNRM 4F1IA 1QANA 1G3IA 4L4UA 1C1KA 3FUTA 3FE3A 1N75A 1S3SA 3U6DA 2QQ8A 1SXJD 3L27A 1PJIA 2O01F 2DAEA 3WHLA 3U61A 2LVOC 1Q02A 5FTNA 2JXNA 4GKKM 3AOEA 1HNXM 1VQ1A 1N77A 4G4QA 3VDPA 4I4LA 3WHKA 1Z5CA 5EP3A 5ITXA 4B3TM 3A45A 3LCUA 3HX3A 2QBYA 5H37D 4UN2B 2CRUA 4B7GA 4DV2M 3KP0E 5KO3A 4LY6A 1GL6A 1QAQA 2MH8A 1G59A 4LCBA 2L7HA 2F4VM 1MN3A 2L2DA 1DGHB 5EJCA 1NJGA 1DO2A 1W5TA 3U6MA 1WGLA 2LWXA 4FW9A 4PDGA 2XF3A 2DZLA 1TH3A 3KOWE 1X37A 4DV4M 2DWMA 4LF6M 2HL7A 2G8LA 2K0BX 2CHQA 3RGSA 1RU3A 3VFDA 3JAMS 4B7FA 1T6OA 2Y0TA 3GRRA 5C18A 2F5SA 2F5NA 4IBIA 2DWZB 2JA2A 3B89A 4OVZB 1KFVA 5IZ7D 3Q8XA 1NV9A 2JY6B 3SARA 3H4MA 4PT5A 3SMSA 2CUZA 3M7GA 3VDUA 3GLIB 3JR5A 4AW4A 1UM8A 3HJ8A 3KW6A 1ZQ9A 1L8QA 4GC5A 3GPYA 1HT2E 3PVSA 1TR8A 1QDRA 4G4NA 3J80S 3AFHA 3T1HM 2X8AA 3GPPA 2UUAM 1IXSA 2VF7A 3U6PA 3L25A 3TPZA 5ITTA 1R7RA 2N35A 3J7AS 1IN5A 1K3WA 3RFWA 2LNHC 5DNYA 3GP1A 1XB2B 3W0FA 1PJJA 4KO8A 3JR4A 1R6BX 3ZH9B 1SXJE 3VK7A 2CWBA 2DVWB 2H1RA 2QZ4A 4F2LA 2UXDM 3GPXA 4LFBM 4IBBA 4JI3M 2A5YB 2Y20A 3SC3A 5E26A 3IHPA 3B9PA 2UUCM 3F92A 4M9ZA 3RGPA 1PJQA 4KT0F 2XSZA 4QHSA 2Z8YM 4L16A 4JXJA 5EQTA 4DR3M 2FH0A 2XZUA 2BJWA 3FTDA 2B3TA 2KRUA 5BR8M 4G4RA 1K3XA 4OU7A 3VK8A 1JR3E 4G6ZA 4RF1A 1GKIA 4JI2M 5KPTA 3W0LB 1CUKA 2BJVA 3U60B 4XGIA 4RF0A 4KHPM 3VKGA 2DZNB 1NO1A 2L4FA 2LVQD 2C9CA 4LJ4A 2KHHA 3UMMA 7CATA 1L2DA 1Z5BA 5ITUA 2VIIA 4K0KM 1BVSA 4QOSA 2C98A 2MROB 1G4AE 1LTMA 1NSFA 2BWEA 2P5TA 2K9DA 2ZAMA 3HY5A 1XWIA 3I01M 4FCWA 2LVNC 3EIHA 2EA0A 4QNRA 1D0KA 3GLIA 3GLGB 2C9OA 1HQYE 1QVRA 2OOAA 1HR0M 4GHLA 4AKIA 1E9RA 5KQDA 4NOOB 2R65A 4JI6M 1TGUA 1OIPA 3LVVA 2UUBM 5DYIA 2XSZD 1YSYA 1VEKA 1XMQM 1N34M 4WP2A 4X64M 3J81S 3C9PA 4CISA 2O25A 1T3TA 3GRVA 1D2NA 2JUJA 1NVMA 2NQ8C 1R5LA 1ZAEA 1ZMWA 2LBCA 3K92A 3CF0A 1ZMVA 4R3DA 2ZAOA 4CHTB 4JI4M 1JR3A 3KDSE 4OW0A 3GLHB 1N32M 3T6PA 2YNMD 4FCTA 2DXIA 3DZDA 2XLJA 5EP2A 4NRVA 4QHTA 2MGWA 4B3SM 1NJFA 3GLGE 3HWSA 4JYAM 1IN7A 1W5SA 2EO2A 2KDLA 3FRIA 3J27B 2R6FA 4CIZA 2V6ZM 1JB0F 3FYDA 2ZM6M 1IBMM 4CGYB 5DYGA 3VLFB 8CATA 2ZANA 3I4YA 3MK6A 4B3MM 1PJTA 4LFCM 1V33A 4P16A 4AQYM 1WGNA 2Y21A 1FNNA 4ANRA 3GLHE 4G3OA 1DO0A 4JI8M 3SYLA 3W68A 3U60A 1ZV1A 2LH0A 1MX0A 3KVWA 3UK6A 1UFZA 2K47A 2FS1A 1WIVA 1NV8A 3FUVA 1MU5A 3FD9A 4HLQA 1JR3D 1XXHB 4XK8F 3ZQJA 4GMQA 2UU9M 2QHOB 2XGNA 3LQQA 4L8RC 4DUZM 1IN4A 2CV2A 4HL4A 4NL4H 1DV0A 1XC8A 4KODA 4IBKA 4RNAA 4Y28F 1KYIA 3B74A 5EXTA 2OOBA 4DV0M 3GLGA 2WSEF 4PD2A 4FWHA 1QZEA 4ITQA 4IBCA 4L78A 1PGYA 4FD2A 1V34A 3U6SA 3B7QA 3LCVB 4QNMA 3L26A 3AL0C 3BOSA 5C1BA 1E9SA 1DGGA 4MH0E 3OTOM 2DWNA 1QQWA 3KOYE 4OX9M 1K82A 1I4WA 3BXWA 4P17A 3PXGA 2VQFM 4DR6M 4JV5M 3HU3A 1V92A 2X49A 4B3RM 3K2LA 2KW0A 3GLHA 2F5PA 1GABA 2WSCF 3EIEA 1EIJA 3GRUA 3KOZE 2CV1A 1YE9A 4DBGB 2DHYA 4M9XA 3DA1A 4Q7JA 3AKZA 2J7NA 5DFLA 1L1TA 2Y0QA 3CF6E 2L7IA 4D82A 3FTCA 2JZ1A 1OKSA 1TDZA 3HZJA 3HJQA 1GO5A 4GH9A 1HJPA 2VQEM 1IY2A 2E5LM 2ZTDA 2GQFA 4NC6A 3GQ4A 3GLIE 3GRYA 4S12A 2W82A 3U5ZB 1QUSA 4JI1M 2QP9X 1NNUC 3SYKA 1GJSA 4DV7M 3RE8A 1WR1B 5KPRA 4TUWA 2JP7A 1EFUB 3K8ZA 3QYEA 1IBKM 1IN8A 1YLAA 3U6EA 1WHCA 4G4OA 3HJSA 3R9XB 2OPFA 1OFHA 2LVPC 2RRUA 2ZBKB 3LVWA 4MGHA 5L8RF 4AKHA 1H6UA 2KXEA 3T1YM 2RGHA 2R44A 1QDTA 3MJ5A 4LFAM 3UJNA 1XXHA 2VF8A 3UZUA 4DV3M 2RKOA 5A2QS 3HHZA 1G71A 1AIPC 2J5YA 1QZMA 1Y8GA 3CF2A 2R46A 2MJ5B 4YY3M 3KOXE 2QPAA 4D80A 2DHRA 2I7NA 2OQ4A 3SAVA 5BPVA 2KEBA 1DGFA 3HGIA 2RGOA 2AHMA 3MHVC 1ZMUA 2CHVA 4I5SA 4IJFA 4LJ7A 2VDBB 3AV0A 3FYCA 1IN6A 4NRWA 2KZUA 2DNAA 4IJEA 2Z4SA 4IIWA 4LJ8A 3TWLA 4W5WA 3C58A 1R2ZA 3GQ3A 1Z59A 2D7HA 2KNVA 1SG9A 4M0DA 4XBOA 4A3VB 1HNZM 5ITRA 3L2AA 3TWMA 3L29A 3ILKA 4EIWA 3SBJA 2D7GA 1AUAA 4DR5M 2V1UA 5JI3E 1HT1E 2G3QA 2DAGA 2R4EA 1J7KA 1QAMA 2Z3XA 3U6CA 2F5QA 3A98B 1KSFX 1OTRA 1D0LA 3SFZA 2CE7A 2QENA 3E46A 3NBXX 2JNHA 1IY1A 3K1JA 5EXXA 5FTKA 1XMOM 5EXPA 1N33M 4LZJA 3L28A 3V76A 1PJSA 4DV1M 3GLFB 5LMNM 4AI6A 5JI2E 4IBGA 4REZA 4L6V6 3U5ZA 5FTJA 2APLA 4NSRA 4JI7M 5EXSA 4JN6A 1E32A 4I8OA 2BWBA 3E9SA 2DAKA 3QAUA 4LF9M 3U6QA 2D7EA 4IBEA 1Q39A 1QUTA 1YUBA 1JQJC 3A42A 3DFZA 3PFIA 4PCZA 5FSWA 3R8FA 1XHBA 2L4EA 1L1ZA 1TDHA 3J2PB 4WW0A 1OQYA 5IREB 1DGBA 1G41A 1OIZA 3CTWB 2KZSA 4Z8XA 5E6JA 3TWKA 5KQ8A 2G5GX 1VDLA 3U6LA 1TH2A 2ZTCA 3E21A 4JI0M 1Q3BA 2CFOA 2WSFF 3K9PA 3W67A 3GPUA 4DR1M 2KNAA 3GLFE 4LG2A 1OAOC 4LRSA 2XFTA 2BNKA 4D81A 1F4IA 1L2BA 1NHWC 2JZ0A 4LF5M 5ITYA 4AKGA 1IFYA 2C96A 1GVNA 3IG5A 4IBJA 3M6AA 4B7HA 4LGYA 1P3QQ 2CHGA 1QYRA 3PNYA 4HEOA 2EUCA 3TE6A 3SAWA 5IWAM 1GL7A 1NHGC 3CGWA 3J7BA 4GITA 1IBLM 1Z5AA 3I51A 2F5OA 4GKJM 3FTEA 2JY8A 4MGZE 4YHHM 2MR9A 3KS8A 1HQCA 3HU2A 3D8LA 2DAIA 2LHCA 2LXEA 2L6OA 2R18A 1OJLA 4M9SA 4BB9A 3IG8A 4LJ5A 3I04M 4IBFA 4NXMM 2LTUA 3TQSA 3LW5F 4LJ9A 4MM3B 1T43A 1XXHE 1HNWM 5FTMA 1J5EM 1VDDA 2FE8A 2OO9A 4LZZA 1IM2A 2HCBA 2Q2EB 3I4VA 3FKEA 1TF0B 2FFJA 2UXBM 2DAMA 4RKUF 1MJGM 4L15A 3GLFA 1TTEA 3BBZA 5EP1A 3K9OA 1OFIA 1SXJB 4GHAA 3HHWA 1G8PA 1VEJA 1IXZA 3T15A 3IECA 4R71A 3GO8A 4LF4M 3E4RA 4LRTA 4GIPA 1C7YA 2QNJA 4QOZC 4LGMA 4DV6M 2DENA 1NNJA 3QYBA 3U6OA 4FWGA 1EE8A 2FNAA 4AG6A 1Q3CA 2XH9A 4MB7A 3A46A 2CEAA 3FUXA 1R4GA 3KSXA 2KNZA 1TH4A 4MGKE 4AG5A 2GNOA 2H5XA 3ZCBB 3KSJA 3DOAA 4R7GA 3GQ5A 2XEPA 2LHGA 5KPZA 1N36M 2DWLA 2EJSA 1NY6A 3ZC7B 3T38A 2C5RA 4AZFA 2HKJA 2LVAA 3D8BA 2YQZA 4DUYM 4CJ6A 4PDIA 3SATA 3SASA 1XNQM 3HHXA 2QCUA 3KS4A 4MGYE 1NY5A 2O5RA 4BLCA 5FTLA 3AOGA 1Z6TA 2K6BA 1WJ7A 4LJ6A
chains in the Genus database with same CATH topology
4DV5M 3HU1A 3SHGB 4NSOB 1SXJC 1L2CA 2J7OA 4DR7M 3FUWA 4II7A 3U61B 1IXRC 4LF8M 3KXEC 1LV7A 5LMUM 1PM5A 2XFSA 4DR2M 4I81A 2YFQA 1E94E 4FVMA 2R45A 2L09A 4X62M 3SMPA 2XZFA 2I7PA 3UGJA 2QBYB 3LMMA 1DGHA 2V1CA 3M0EA 4BBAA 1QAOA 2C99A 4X65M 5F3WA 4MGIE 4NXNM 1GLNA 3QWLA 2M5ZA 4JI5M 2X4AA 4WURA 5ITQA 3PNVA 4FCVA 2KA6B 4OVZA 4IBDA 1J09A 1SXJA 5EP4A 3HHYA 4X66M 4B08A 4Z6YA 2YR0A 2Z4RA 1FJGM 3HKPA 3AJIB 4GRIA 4LF7M 3NWLA 5FLXS 1IQPA 3TL4X 5GKNA 2CV0A 5ITXE 3NBIA 4M0WA 3KFUG 2UXCM 3LQRA 1N78A 2ERCA 3AOEC 2Z7JA 4LJAA 1I94M 2R4JA 3FTFA 1ORYB 2HHHM 1WXQA 3SAUA 3SHFA 3FUUA 2FOIC 1IXSB 4KLNA 2DZOB 4ZPXA 4DR4M 4FWDA 4GC9A 2M60A 5IT9S 1R2YA 3THGA 2KRKA 3KP1E 3VKHA 2R62A 1IY0A 1XNRM 1QANA 1G3IA 4L4UA 1C1KA 3FUTA 3U6DA 1N75A 1S3SA 1SXJD 3L27A 1PJIA 3WHLA 3U61A 5FTNA 4GKKM 3AOEA 1HNXM 1N77A 4G4QA 3VDPA 4I4LA 3WHKA 1Z5CA 5EP3A 5ITXA 4B3TM 3A45A 2QBYA 5H37D 4B7GA 4DV2M 3KP0E 5KO3A 4LY6A 1GL6A 1QAQA 1G59A 4LCBA 2L7HA 2F4VM 1DGHB 5EJCA 1NJGA 1DO2A 1W5TA 3U6MA 2LWXA 4FW9A 4PDGA 2XF3A 1TH3A 3KOWE 1X37A 4DV4M 2DWMA 4LF6M 2HL7A 2G8LA 3RGSA 2CHQA 3VFDA 3JAMS 5C18A 1L1TA 4B7FA 2Y0TA 3GRRA 2F5SA 2F5NA 4IBIA 2DWZB 2JA2A 4OVZB 1KFVA 5IZ7D 3Q8XA 3SARA 3H4MA 4PT5A 3SMSA 2CUZA 3M7GA 3VDUA 3GLIB 3JR5A 4AW4A 1UM8A 3HJ8A 3KW6A 1ZQ9A 1L8QA 4GC5A 3GPYA 1HT2E 3PVSA 4G4NA 3J80S 3AFHA 3T1HM 2X8AA 3GPPA 2UUAM 3U6PA 3L25A 3TPZA 5ITTA 1R7RA 3J7AS 1IN5A 1K3WA 3RFWA 2LNHC 5DNYA 3GP1A 3W0FA 1PJJA 4KO8A 3JR4A 1R6BX 3ZH9B 1SXJE 3VK7A 2H1RA 2DVWB 2QZ4A 2UXDM 3GPXA 4LFBM 4IBBA 4JI3M 2A5YB 2Y20A 3SC3A 5E26A 3B9PA 2UUCM 4M9ZA 3RGPA 2XSZA 4QHSA 4L16A 5EQTA 4JXJA 4DR3M 2XZUA 2BJWA 3FTDA 2KRUA 5BR8M 4G4RA 1K3XA 4OU7A 3VK8A 4G6ZA 4RF1A 1GKIA 4JI2M 5KPTA 3W0LB 2BJVA 3U60B 4XGIA 4RF0A 4KHPM 3VKGA 2DZNB 2C9CA 4LJ4A 3UMMA 7CATA 1L2DA 1Z5BA 5ITUA 2VIIA 4K0KM 4QOSA 2C98A 1G4AE 1NSFA 2P5TA 2ZAMA 1XWIA 4FCWA 3EIHA 2EA0A 4QNRA 3GLIA 3GLGB 2C9OA 1HQYE 1QVRA 1HR0M 4GHLA 4AKIA 1E9RA 5KQDA 4NOOB 2R65A 4JI6M 1TGUA 3LVVA 2UUBM 5DYIA 2XSZD 1YSYA 1XMQM 1N34M 4X64M 3J81S 4CISA 3GRVA 1T3TA 1D2NA 1NVMA 2NQ8C 4R3DA 1ZAEA 3K92A 3CF0A 2ZAOA 4CHTB 4JI4M 1JR3A 3KDSE 4OW0A 3GLHB 1N32M 2YNMD 4FCTA 2DXIA 3DZDA 2XLJA 5EP2A 4NRVA 4QHTA 4B3SM 1NJFA 3HWSA 4JYAM 1IN7A 1W5SA 2EO2A 3J27B 2V6ZM 3FYDA 2ZM6M 1IBMM 4CGYB 5DYGA 3VLFB 8CATA 2ZANA 3I4YA 3MK6A 4B3MM 4LFCM 4P16A 4AQYM 2Y21A 1FNNA 4JI8M 1DO0A 3SYLA 3U60A 2LH0A 1MX0A 3KVWA 3UK6A 2K47A 3FUVA 1MU5A 3FD9A 4HLQA 1JR3D 1XXHB 4GMQA 2UU9M 2XGNA 3LQQA 4L8RC 4DUZM 1IN4A 2CV2A 4HL4A 4NL4H 1XC8A 4KODA 4IBKA 4RNAA 4DV0M 1KYIA 5EXTA 3GLGA 4PD2A 4FWHA 4ITQA 4IBCA 4L78A 4FD2A 3U6SA 4QNMA 3L26A 3AL0C 3BOSA 5C1BA 1E9SA 1DGGA 4MH0E 3OTOM 2DWNA 1QQWA 3KOYE 4OX9M 1K82A 1I4WA 3PXGA 2VQFM 4DR6M 4JV5M 3HU3A 2X49A 4B3RM 3K2LA 2KW0A 3GLHA 2F5PA 3EIEA 3GRUA 3KOZE 2CV1A 1YE9A 4M9XA 3DA1A 3AKZA 2J7NA 2Y0QA 3CF6E 2L7IA 4D82A 3FTCA 1TDZA 3HJQA 4GH9A 2VQEM 1IY2A 2E5LM 3GQ4A 3GRYA 4S12A 2W82A 3U5ZB 4JI1M 2QP9X 1NNUC 3SYKA 4DV7M 3RE8A 5KPRA 4TUWA 3K8ZA 1IBKM 1IN8A 3U6EA 4G4OA 3HJSA 3R9XB 2OPFA 1OFHA 2ZBKB 3LVWA 4MGHA 4AKHA 1H6UA 2KXEA 3T1YM 2RGHA 3MJ5A 4DV3M 4LFAM 3UJNA 1XXHA 3UZUA 2RKOA 5A2QS 3HHZA 1QZMA 3CF2A 2R46A 4YY3M 3KOXE 2QPAA 4D80A 2DHRA 2I7NA 2OQ4A 3SAVA 5BPVA 2KEBA 1DGFA 3HGIA 2RGOA 2AHMA 3MHVC 4I5SA 2CHVA 4IJFA 4LJ7A 3FYCA 3AV0A 1IN6A 4NRWA 2KZUA 4IJEA 2Z4SA 4IIWA 4LJ8A 3TWLA 4W5WA 3C58A 1R2ZA 3GQ3A 1Z59A 2D7HA 4M0DA 4XBOA 4A3VB 1HNZM 5ITRA 3L2AA 3TWMA 3L29A 3ILKA 4EIWA 3SBJA 2D7GA 4DR5M 2V1UA 5JI3E 1HT1E 2R4EA 3U6CA 1J7KA 1QAMA 2Z3XA 2F5QA 3A98B 1KSFX 3SFZA 2CE7A 2QENA 5EXXA 1IY1A 3K1JA 5FTKA 1XMOM 1N33M 5EXPA 4LZJA 3L28A 4DV1M 3GLFB 5LMNM 4AI6A 5JI2E 4IBGA 4REZA 3U5ZA 5FTJA 4NSRA 4JI7M 5EXSA 4JN6A 1E32A 4I8OA 3E9SA 3QAUA 4LF9M 3U6QA 2D7EA 4IBEA 1Q39A 1YUBA 1JQJC 3A42A 3DFZA 3PFIA 4PCZA 5FSWA 3R8FA 1XHBA 1L1ZA 1TDHA 3J2PB 4WW0A 5IREB 1DGBA 1G41A 3CTWB 4Z8XA 2KZSA 5E6JA 3TWKA 5KQ8A 3U6LA 2G5GX 1TH2A 4JI0M 1Q3BA 2CFOA 3GPUA 4DR1M 4LG2A 4LRSA 2XFTA 2BNKA 4D81A 1L2BA 1NHWC 4LF5M 5ITYA 4AKGA 2C96A 1GVNA 3IG5A 4IBJA 3M6AA 4B7HA 4LGYA 2CHGA 1QYRA 3PNYA 3SAWA 2EUCA 3TE6A 5IWAM 1GL7A 1NHGC 3J7BA 4GITA 1IBLM 1Z5AA 3I51A 2F5OA 4GKJM 3FTEA 4MGZE 4YHHM 3KS8A 1HQCA 3HU2A 3D8LA 2LXEA 2L6OA 2R18A 1OJLA 4M9SA 4BB9A 3IG8A 4LJ5A 4IBFA 4NXMM 3TQSA 4LJ9A 4MM3B 1HNWM 5FTMA 1J5EM 1VDDA 2FE8A 4LZZA 1IM2A 2HCBA 2Q2EB 3I4VA 3FKEA 2FFJA 2UXBM 4L15A 3GLFA 5EP1A 1OFIA 1SXJB 4GHAA 3HHWA 1G8PA 1IXZA 3T15A 4LF4M 3GO8A 3E4RA 4LRTA 4GIPA 4QOZC 4LGMA 4DV6M 1NNJA 3U6OA 4FWGA 1EE8A 2FNAA 4AG6A 1Q3CA 2XH9A 4MB7A 3A46A 2CEAA 3FUXA 3KSXA 4MGKE 1TH4A 4AG5A 3ZCBB 3KSJA 3DOAA 4R7GA 3GQ5A 2XEPA 1N36M 5KPZA 2DWLA 1NY6A 3ZC7B 3T38A 2C5RA 4AZFA 2HKJA 3D8BA 2YQZA 4DUYM 4PDIA 3SATA 3SASA 1XNQM 3HHXA 2QCUA 3KS4A 4MGYE 1NY5A 2O5RA 4BLCA 5FTLA 3AOGA 1Z6TA 4LJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JR5 A;  4DV5 M;  1L2C A;  4DR7 M;  1MX0 A;  1N33 M;  3GPY A;  4G4N A;  3J80 S;  4LF8 M;  4DV1 M;  3T1H M;  1MU5 A;  3GPP A;  2UUA M;  5LMU M;  5LMN M;  3U6P A;  1PM5 A;  2UU9 M;  5ITT A;  4DR2 M;  4DUZ M;  3J7A S;  1K3W A;  4JI7 M;  4X62 M;  3GP1 A;  1XC8 A;  2XZF A;  4DV0 M;  3W0F A;  4LF9 M;  1PJJ A;  3U6Q A;  3JR4 A;  4PD2 A;  1Q39 A;  4ITQ A;  4X65 M;  3A42 A;  3VK7 A;  2UXD M;  4NXN M;  3U6S A;  4PCZ A;  3GPX A;  4JI5 M;  1L1Z A;  1TDH A;  5ITQ A;  4LFB M;  4JI3 M;  3TWK A;  3U6L A;  3OTO M;  4OX9 M;  4X66 M;  4JI0 M;  1Q3B A;  3GPU A;  4DR1 M;  1K82 A;  2UUC M;  2VQF M;  4DR6 M;  1FJG M;  4JV5 M;  4LF7 M;  4B3R M;  2F5P A;  5FLX S;  4DR3 M;  2XZU A;  1L2B A;  5ITX E;  5BR8 M;  4G4R A;  1K3X A;  4LF5 M;  2UXC M;  3VK8 A;  5ITY A;  4JI2 M;  1I94 M;  4KHP M;  3SAW A;  1TDZ A;  5IWA M;  1IBL M;  4GKJ M;  1Z5A A;  2HHH M;  2F5O A;  3SAU A;  1L2D A;  1Z5B A;  4YHH M;  5ITU A;  2VQE M;  2E5L M;  4K0K M;  3GQ4 A;  4DR4 M;  5IT9 S;  4JI1 M;  1R2Y A;  2EA0 A;  4DV7 M;  4NXM M;  1XNR M;  1IBK M;  1HR0 M;  1HNW M;  3U6E A;  3U6D A;  4G4O A;  1J5E M;  2OPF A;  1PJI A;  2Q2E B;  2ZBK B;  4JI6 M;  2UXB M;  2UUB M;  3T1Y M;  1XMQ M;  4GKK M;  4DV3 M;  4LFA M;  1N34 M;  1HNX M;  4G4Q A;  4X64 M;  3J81 S;  4CIS A;  5A2Q S;  1Z5C A;  4YY3 M;  5ITX A;  4B3T M;  3GO8 A;  4LF4 M;  3A45 A;  4JI4 M;  2OQ4 A;  4DV6 M;  3SAV A;  1NNJ A;  1N32 M;  4DV2 M;  3U6O A;  1EE8 A;  4NRV A;  1Q3C A;  4NRW A;  3A46 A;  4MB7 A;  2F4V M;  4B3S M;  3TWL A;  3C58 A;  1R2Z A;  3GQ3 A;  1Z59 A;  4JYA M;  3U6M A;  4PDG A;  3DOA A;  1HNZ M;  5ITR A;  3GQ5 A;  4DV4 M;  1N36 M;  3TWM A;  4LF6 M;  1L1T A;  3JAM S;  2ZM6 M;  3SBJ A;  1IBM M;  2HKJ A;  2F5S A;  4DUY M;  4PDI A;  4DR5 M;  2F5N A;  3SAT A;  4B3M M;  3SAS A;  1KFV A;  1XNQ M;  4LFC M;  3U6C A;  4AQY M;  2F5Q A;  1XMO M;  3SAR A;  4JI8 M; 
#chains in the Genus database with same CATH topology
 4DV5 M;  1GJT A;  3HU1 A;  3SHG B;  2DI0 A;  2CP8 A;  4NSO B;  1SXJ C;  1L2C A;  2J7O A;  4DR7 M;  3FUW A;  4II7 A;  3U61 B;  1IXR C;  4LF8 M;  2HAK A;  3C3D A;  3KXE C;  1LV7 A;  5LMU M;  1PM5 A;  2XFS A;  2JY5 A;  4DR2 M;  4I81 A;  2YFQ A;  1E94 E;  4FVM A;  2R45 A;  4GEW A;  1VEG A;  2L09 A;  4X62 M;  2R0I A;  3SMP A;  2XZF A;  2I7P A;  3UGJ A;  2QBY B;  2HWJ A;  1DGH A;  2V1C A;  3LMM A;  3M0E A;  4BBA A;  1QAO A;  2C99 A;  4X65 M;  5F3W A;  4MGI E;  4NXN M;  1GLN A;  2WZJ A;  2M5Z A;  3QWL A;  4JI5 M;  2X4A A;  4WUR A;  5ITQ A;  3PNV A;  4FCV A;  2JWS A;  2QSF X;  2KA6 B;  4OVZ A;  4IBD A;  1J09 A;  1SXJ A;  5EP4 A;  3HHY A;  4X66 M;  4B08 A;  4Z6Y A;  2YR0 A;  2Z4R A;  1OAI A;  1PRB A;  1FJG M;  3HKP A;  3AJI B;  4GRI A;  4LF7 M;  3B7N A;  3NWL A;  3Q8G A;  3H4J A;  5FLX S;  1IQP A;  1A5T A;  3TL4 X;  5GKN A;  2CV0 A;  2JY7 A;  3NBI A;  4M0W A;  5ITX E;  2EKF A;  3KFU G;  2UXC M;  3LQR A;  1VG5 A;  1N78 A;  3MMP A;  2ERC A;  3AOE C;  2Z7J A;  4LJA A;  1I94 M;  2R4J A;  3FTF A;  1D0M A;  1ORY B;  2HHH M;  1WXQ A;  3SAU A;  3SHF A;  2DKL A;  3B7Z A;  2FOI C;  1IXS B;  3FUU A;  4KLN A;  2DZO B;  3C3E A;  3FRH A;  2EKK A;  4FWD A;  4GC9 A;  4ZPX A;  4DR4 M;  2M60 A;  5IT9 S;  1R2Y A;  3THG A;  2KRK A;  3KP1 E;  3VKH A;  2R62 A;  1IY0 A;  1XNR M;  4F1I A;  1QAN A;  1G3I A;  4L4U A;  1C1K A;  3FUT A;  3FE3 A;  1N75 A;  1S3S A;  3U6D A;  2QQ8 A;  1SXJ D;  3L27 A;  1PJI A;  2O01 F;  2DAE A;  3WHL A;  3U61 A;  2LVO C;  1Q02 A;  5FTN A;  2JXN A;  4GKK M;  3AOE A;  1HNX M;  1VQ1 A;  1N77 A;  4G4Q A;  3VDP A;  4I4L A;  3WHK A;  1Z5C A;  5EP3 A;  5ITX A;  4B3T M;  3A45 A;  3LCU A;  3HX3 A;  2QBY A;  5H37 D;  4UN2 B;  2CRU A;  4B7G A;  4DV2 M;  3KP0 E;  5KO3 A;  4LY6 A;  1GL6 A;  1QAQ A;  2MH8 A;  1G59 A;  4LCB A;  2L7H A;  2F4V M;  1MN3 A;  2L2D A;  1DGH B;  5EJC A;  1NJG A;  1DO2 A;  1W5T A;  3U6M A;  1WGL A;  2LWX A;  4FW9 A;  4PDG A;  2XF3 A;  2DZL A;  1TH3 A;  3KOW E;  1X37 A;  4DV4 M;  2DWM A;  4LF6 M;  2HL7 A;  2G8L A;  2K0B X;  2CHQ A;  3RGS A;  1RU3 A;  3VFD A;  3JAM S;  4B7F A;  1T6O A;  2Y0T A;  3GRR A;  5C18 A;  2F5S A;  2F5N A;  4IBI A;  2DWZ B;  2JA2 A;  3B89 A;  4OVZ B;  1KFV A;  5IZ7 D;  3Q8X A;  1NV9 A;  2JY6 B;  3SAR A;  3H4M A;  4PT5 A;  3SMS A;  2CUZ A;  3M7G A;  3VDU A;  3GLI B;  3JR5 A;  4AW4 A;  1UM8 A;  3HJ8 A;  3KW6 A;  1ZQ9 A;  1L8Q A;  4GC5 A;  3GPY A;  1HT2 E;  3PVS A;  1TR8 A;  1QDR A;  4G4N A;  3J80 S;  3AFH A;  3T1H M;  2X8A A;  3GPP A;  2UUA M;  1IXS A;  2VF7 A;  3U6P A;  3L25 A;  3TPZ A;  5ITT A;  1R7R A;  2N35 A;  3J7A S;  1IN5 A;  1K3W A;  3RFW A;  2LNH C;  5DNY A;  3GP1 A;  1XB2 B;  3W0F A;  1PJJ A;  4KO8 A;  3JR4 A;  1R6B X;  3ZH9 B;  1SXJ E;  3VK7 A;  2CWB A;  2DVW B;  2H1R A;  2QZ4 A;  4F2L A;  2UXD M;  3GPX A;  4LFB M;  4IBB A;  4JI3 M;  2A5Y B;  2Y20 A;  3SC3 A;  5E26 A;  3IHP A;  3B9P A;  2UUC M;  3F92 A;  4M9Z A;  3RGP A;  1PJQ A;  4KT0 F;  2XSZ A;  4QHS A;  2Z8Y M;  4L16 A;  4JXJ A;  5EQT A;  4DR3 M;  2FH0 A;  2XZU A;  2BJW A;  3FTD A;  2B3T A;  2KRU A;  5BR8 M;  4G4R A;  1K3X A;  4OU7 A;  3VK8 A;  1JR3 E;  4G6Z A;  4RF1 A;  1GKI A;  4JI2 M;  5KPT A;  3W0L B;  1CUK A;  2BJV A;  3U60 B;  4XGI A;  4RF0 A;  4KHP M;  3VKG A;  2DZN B;  1NO1 A;  2L4F A;  2LVQ D;  2C9C A;  4LJ4 A;  2KHH A;  3UMM A;  7CAT A;  1L2D A;  1Z5B A;  5ITU A;  2VII A;  4K0K M;  1BVS A;  4QOS A;  2C98 A;  2MRO B;  1G4A E;  1LTM A;  1NSF A;  2BWE A;  2P5T A;  2K9D A;  2ZAM A;  3HY5 A;  1XWI A;  3I01 M;  4FCW A;  2LVN C;  3EIH A;  2EA0 A;  4QNR A;  1D0K A;  3GLI A;  3GLG B;  2C9O A;  1HQY E;  1QVR A;  2OOA A;  1HR0 M;  4GHL A;  4AKI A;  1E9R A;  5KQD A;  4NOO B;  2R65 A;  4JI6 M;  1TGU A;  1OIP A;  3LVV A;  2UUB M;  5DYI A;  2XSZ D;  1YSY A;  1VEK A;  1XMQ M;  1N34 M;  4WP2 A;  4X64 M;  3J81 S;  3C9P A;  4CIS A;  2O25 A;  1T3T A;  3GRV A;  1D2N A;  2JUJ A;  1NVM A;  2NQ8 C;  1R5L A;  1ZAE A;  1ZMW A;  2LBC A;  3K92 A;  3CF0 A;  1ZMV A;  4R3D A;  2ZAO A;  4CHT B;  4JI4 M;  1JR3 A;  3KDS E;  4OW0 A;  3GLH B;  1N32 M;  3T6P A;  2YNM D;  4FCT A;  2DXI A;  3DZD A;  2XLJ A;  5EP2 A;  4NRV A;  4QHT A;  2MGW A;  4B3S M;  1NJF A;  3GLG E;  3HWS A;  4JYA M;  1IN7 A;  1W5S A;  2EO2 A;  2KDL A;  3FRI A;  3J27 B;  2R6F A;  4CIZ A;  2V6Z M;  1JB0 F;  3FYD A;  2ZM6 M;  1IBM M;  4CGY B;  5DYG A;  3VLF B;  8CAT A;  2ZAN A;  3I4Y A;  3MK6 A;  4B3M M;  1PJT A;  4LFC M;  1V33 A;  4P16 A;  4AQY M;  1WGN A;  2Y21 A;  1FNN A;  4ANR A;  3GLH E;  4G3O A;  1DO0 A;  4JI8 M;  3SYL A;  3W68 A;  3U60 A;  1ZV1 A;  2LH0 A;  1MX0 A;  3KVW A;  3UK6 A;  1UFZ A;  2K47 A;  2FS1 A;  1WIV A;  1NV8 A;  3FUV A;  1MU5 A;  3FD9 A;  4HLQ A;  1JR3 D;  1XXH B;  4XK8 F;  3ZQJ A;  4GMQ A;  2UU9 M;  2QHO B;  2XGN A;  3LQQ A;  4L8R C;  4DUZ M;  1IN4 A;  2CV2 A;  4HL4 A;  4NL4 H;  1DV0 A;  1XC8 A;  4KOD A;  4IBK A;  4RNA A;  4Y28 F;  1KYI A;  3B74 A;  5EXT A;  2OOB A;  4DV0 M;  3GLG A;  2WSE F;  4PD2 A;  4FWH A;  1QZE A;  4ITQ A;  4IBC A;  4L78 A;  1PGY A;  4FD2 A;  1V34 A;  3U6S A;  3B7Q A;  3LCV B;  4QNM A;  3L26 A;  3AL0 C;  3BOS A;  5C1B A;  1E9S A;  1DGG A;  4MH0 E;  3OTO M;  2DWN A;  1QQW A;  3KOY E;  4OX9 M;  1K82 A;  1I4W A;  3BXW A;  4P17 A;  3PXG A;  2VQF M;  4DR6 M;  4JV5 M;  3HU3 A;  1V92 A;  2X49 A;  4B3R M;  3K2L A;  2KW0 A;  3GLH A;  2F5P A;  1GAB A;  2WSC F;  3EIE A;  1EIJ A;  3GRU A;  3KOZ E;  2CV1 A;  1YE9 A;  4DBG B;  2DHY A;  4M9X A;  3DA1 A;  4Q7J A;  3AKZ A;  2J7N A;  5DFL A;  1L1T A;  2Y0Q A;  3CF6 E;  2L7I A;  4D82 A;  3FTC A;  2JZ1 A;  1OKS A;  1TDZ A;  3HZJ A;  3HJQ A;  1GO5 A;  4GH9 A;  1HJP A;  2VQE M;  1IY2 A;  2E5L M;  2ZTD A;  2GQF A;  4NC6 A;  3GQ4 A;  3GLI E;  3GRY A;  4S12 A;  2W82 A;  3U5Z B;  1QUS A;  4JI1 M;  2QP9 X;  1NNU C;  3SYK A;  1GJS A;  4DV7 M;  3RE8 A;  1WR1 B;  5KPR A;  4TUW A;  2JP7 A;  1EFU B;  3K8Z A;  3QYE A;  1IBK M;  1IN8 A;  1YLA A;  3U6E A;  1WHC A;  4G4O A;  3HJS A;  3R9X B;  2OPF A;  1OFH A;  2LVP C;  2RRU A;  2ZBK B;  3LVW A;  4MGH A;  5L8R F;  4AKH A;  1H6U A;  2KXE A;  3T1Y M;  2RGH A;  2R44 A;  1QDT A;  3MJ5 A;  4LFA M;  3UJN A;  1XXH A;  2VF8 A;  3UZU A;  4DV3 M;  2RKO A;  5A2Q S;  3HHZ A;  1G71 A;  1AIP C;  2J5Y A;  1QZM A;  1Y8G A;  3CF2 A;  2R46 A;  2MJ5 B;  4YY3 M;  3KOX E;  2QPA A;  4D80 A;  2DHR A;  2I7N A;  2OQ4 A;  3SAV A;  5BPV A;  2KEB A;  1DGF A;  3HGI A;  2RGO A;  2AHM A;  3MHV C;  1ZMU A;  2CHV A;  4I5S A;  4IJF A;  4LJ7 A;  2VDB B;  3AV0 A;  3FYC A;  1IN6 A;  4NRW A;  2KZU A;  2DNA A;  4IJE A;  2Z4S A;  4IIW A;  4LJ8 A;  3TWL A;  4W5W A;  3C58 A;  1R2Z A;  3GQ3 A;  1Z59 A;  2D7H A;  2KNV A;  1SG9 A;  4M0D A;  4XBO A;  4A3V B;  1HNZ M;  5ITR A;  3L2A A;  3TWM A;  3L29 A;  3ILK A;  4EIW A;  3SBJ A;  2D7G A;  1AUA A;  4DR5 M;  2V1U A;  5JI3 E;  1HT1 E;  2G3Q A;  2DAG A;  2R4E A;  1J7K A;  1QAM A;  2Z3X A;  3U6C A;  2F5Q A;  3A98 B;  1KSF X;  1OTR A;  1D0L A;  3SFZ A;  2CE7 A;  2QEN A;  3E46 A;  3NBX X;  2JNH A;  1IY1 A;  3K1J A;  5EXX A;  5FTK A;  1XMO M;  5EXP A;  1N33 M;  4LZJ A;  3L28 A;  3V76 A;  1PJS A;  4DV1 M;  3GLF B;  5LMN M;  4AI6 A;  5JI2 E;  4IBG A;  4REZ A;  4L6V 6;  3U5Z A;  5FTJ A;  2APL A;  4NSR A;  4JI7 M;  5EXS A;  4JN6 A;  1E32 A;  4I8O A;  2BWB A;  3E9S A;  2DAK A;  3QAU A;  4LF9 M;  3U6Q A;  2D7E A;  4IBE A;  1Q39 A;  1QUT A;  1YUB A;  1JQJ C;  3A42 A;  3DFZ A;  3PFI A;  4PCZ A;  5FSW A;  3R8F A;  1XHB A;  2L4E A;  1L1Z A;  1TDH A;  3J2P B;  4WW0 A;  1OQY A;  5IRE B;  1DGB A;  1G41 A;  1OIZ A;  3CTW B;  2KZS A;  4Z8X A;  5E6J A;  3TWK A;  5KQ8 A;  2G5G X;  1VDL A;  3U6L A;  1TH2 A;  2ZTC A;  3E21 A;  4JI0 M;  1Q3B A;  2CFO A;  2WSF F;  3K9P A;  3W67 A;  3GPU A;  4DR1 M;  2KNA A;  3GLF E;  4LG2 A;  1OAO C;  4LRS A;  2XFT A;  2BNK A;  4D81 A;  1F4I A;  1L2B A;  1NHW C;  2JZ0 A;  4LF5 M;  5ITY A;  4AKG A;  1IFY A;  2C96 A;  1GVN A;  3IG5 A;  4IBJ A;  3M6A A;  4B7H A;  4LGY A;  1P3Q Q;  2CHG A;  1QYR A;  3PNY A;  4HEO A;  2EUC A;  3TE6 A;  3SAW A;  5IWA M;  1GL7 A;  1NHG C;  3CGW A;  3J7B A;  4GIT A;  1IBL M;  1Z5A A;  3I51 A;  2F5O A;  4GKJ M;  3FTE A;  2JY8 A;  4MGZ E;  4YHH M;  2MR9 A;  3KS8 A;  1HQC A;  3HU2 A;  3D8L A;  2DAI A;  2LHC A;  2LXE A;  2L6O A;  2R18 A;  1OJL A;  4M9S A;  4BB9 A;  3IG8 A;  4LJ5 A;  3I04 M;  4IBF A;  4NXM M;  2LTU A;  3TQS A;  3LW5 F;  4LJ9 A;  4MM3 B;  1T43 A;  1XXH E;  1HNW M;  5FTM A;  1J5E M;  1VDD A;  2FE8 A;  2OO9 A;  4LZZ A;  1IM2 A;  2HCB A;  2Q2E B;  3I4V A;  3FKE A;  1TF0 B;  2FFJ A;  2UXB M;  2DAM A;  4RKU F;  1MJG M;  4L15 A;  3GLF A;  1TTE A;  3BBZ A;  5EP1 A;  3K9O A;  1OFI A;  1SXJ B;  4GHA A;  3HHW A;  1G8P A;  1VEJ A;  1IXZ A;  3T15 A;  3IEC A;  4R71 A;  3GO8 A;  4LF4 M;  3E4R A;  4LRT A;  4GIP A;  1C7Y A;  2QNJ A;  4QOZ C;  4LGM A;  4DV6 M;  2DEN A;  1NNJ A;  3QYB A;  3U6O A;  4FWG A;  1EE8 A;  2FNA A;  4AG6 A;  1Q3C A;  2XH9 A;  4MB7 A;  3A46 A;  2CEA A;  3FUX A;  1R4G A;  3KSX A;  2KNZ A;  1TH4 A;  4MGK E;  4AG5 A;  2GNO A;  2H5X A;  3ZCB B;  3KSJ A;  3DOA A;  4R7G A;  3GQ5 A;  2XEP A;  2LHG A;  5KPZ A;  1N36 M;  2DWL A;  2EJS A;  1NY6 A;  3ZC7 B;  3T38 A;  2C5R A;  4AZF A;  2HKJ A;  2LVA A;  3D8B A;  2YQZ A;  4DUY M;  4CJ6 A;  4PDI A;  3SAT A;  3SAS A;  1XNQ M;  3HHX A;  2QCU A;  3KS4 A;  4MGY E;  1NY5 A;  2O5R A;  4BLC A;  5FTL A;  3AOG A;  1Z6T A;  2K6B A;  1WJ7 A;  4LJ6 A; 
#chains in the Genus database with same CATH homology
 4DV5 M;  3HU1 A;  3SHG B;  4NSO B;  1SXJ C;  1L2C A;  2J7O A;  4DR7 M;  3FUW A;  4II7 A;  3U61 B;  1IXR C;  4LF8 M;  3KXE C;  1LV7 A;  5LMU M;  1PM5 A;  2XFS A;  4DR2 M;  4I81 A;  2YFQ A;  1E94 E;  4FVM A;  2R45 A;  2L09 A;  4X62 M;  3SMP A;  2XZF A;  2I7P A;  3UGJ A;  2QBY B;  3LMM A;  1DGH A;  2V1C A;  3M0E A;  4BBA A;  1QAO A;  2C99 A;  4X65 M;  5F3W A;  4MGI E;  4NXN M;  1GLN A;  3QWL A;  2M5Z A;  4JI5 M;  2X4A A;  4WUR A;  5ITQ A;  3PNV A;  4FCV A;  2KA6 B;  4OVZ A;  4IBD A;  1J09 A;  1SXJ A;  5EP4 A;  3HHY A;  4X66 M;  4B08 A;  4Z6Y A;  2YR0 A;  2Z4R A;  1FJG M;  3HKP A;  3AJI B;  4GRI A;  4LF7 M;  3NWL A;  5FLX S;  1IQP A;  3TL4 X;  5GKN A;  2CV0 A;  5ITX E;  3NBI A;  4M0W A;  3KFU G;  2UXC M;  3LQR A;  1N78 A;  2ERC A;  3AOE C;  2Z7J A;  4LJA A;  1I94 M;  2R4J A;  3FTF A;  1ORY B;  2HHH M;  1WXQ A;  3SAU A;  3SHF A;  3FUU A;  2FOI C;  1IXS B;  4KLN A;  2DZO B;  4ZPX A;  4DR4 M;  4FWD A;  4GC9 A;  2M60 A;  5IT9 S;  1R2Y A;  3THG A;  2KRK A;  3KP1 E;  3VKH A;  2R62 A;  1IY0 A;  1XNR M;  1QAN A;  1G3I A;  4L4U A;  1C1K A;  3FUT A;  3U6D A;  1N75 A;  1S3S A;  1SXJ D;  3L27 A;  1PJI A;  3WHL A;  3U61 A;  5FTN A;  4GKK M;  3AOE A;  1HNX M;  1N77 A;  4G4Q A;  3VDP A;  4I4L A;  3WHK A;  1Z5C A;  5EP3 A;  5ITX A;  4B3T M;  3A45 A;  2QBY A;  5H37 D;  4B7G A;  4DV2 M;  3KP0 E;  5KO3 A;  4LY6 A;  1GL6 A;  1QAQ A;  1G59 A;  4LCB A;  2L7H A;  2F4V M;  1DGH B;  5EJC A;  1NJG A;  1DO2 A;  1W5T A;  3U6M A;  2LWX A;  4FW9 A;  4PDG A;  2XF3 A;  1TH3 A;  3KOW E;  1X37 A;  4DV4 M;  2DWM A;  4LF6 M;  2HL7 A;  2G8L A;  3RGS A;  2CHQ A;  3VFD A;  3JAM S;  5C18 A;  1L1T A;  4B7F A;  2Y0T A;  3GRR A;  2F5S A;  2F5N A;  4IBI A;  2DWZ B;  2JA2 A;  4OVZ B;  1KFV A;  5IZ7 D;  3Q8X A;  3SAR A;  3H4M A;  4PT5 A;  3SMS A;  2CUZ A;  3M7G A;  3VDU A;  3GLI B;  3JR5 A;  4AW4 A;  1UM8 A;  3HJ8 A;  3KW6 A;  1ZQ9 A;  1L8Q A;  4GC5 A;  3GPY A;  1HT2 E;  3PVS A;  4G4N A;  3J80 S;  3AFH A;  3T1H M;  2X8A A;  3GPP A;  2UUA M;  3U6P A;  3L25 A;  3TPZ A;  5ITT A;  1R7R A;  3J7A S;  1IN5 A;  1K3W A;  3RFW A;  2LNH C;  5DNY A;  3GP1 A;  3W0F A;  1PJJ A;  4KO8 A;  3JR4 A;  1R6B X;  3ZH9 B;  1SXJ E;  3VK7 A;  2H1R A;  2DVW B;  2QZ4 A;  2UXD M;  3GPX A;  4LFB M;  4IBB A;  4JI3 M;  2A5Y B;  2Y20 A;  3SC3 A;  5E26 A;  3B9P A;  2UUC M;  4M9Z A;  3RGP A;  2XSZ A;  4QHS A;  4L16 A;  5EQT A;  4JXJ A;  4DR3 M;  2XZU A;  2BJW A;  3FTD A;  2KRU A;  5BR8 M;  4G4R A;  1K3X A;  4OU7 A;  3VK8 A;  4G6Z A;  4RF1 A;  1GKI A;  4JI2 M;  5KPT A;  3W0L B;  2BJV A;  3U60 B;  4XGI A;  4RF0 A;  4KHP M;  3VKG A;  2DZN B;  2C9C A;  4LJ4 A;  3UMM A;  7CAT A;  1L2D A;  1Z5B A;  5ITU A;  2VII A;  4K0K M;  4QOS A;  2C98 A;  1G4A E;  1NSF A;  2P5T A;  2ZAM A;  1XWI A;  4FCW A;  3EIH A;  2EA0 A;  4QNR A;  3GLI A;  3GLG B;  2C9O A;  1HQY E;  1QVR A;  1HR0 M;  4GHL A;  4AKI A;  1E9R A;  5KQD A;  4NOO B;  2R65 A;  4JI6 M;  1TGU A;  3LVV A;  2UUB M;  5DYI A;  2XSZ D;  1YSY A;  1XMQ M;  1N34 M;  4X64 M;  3J81 S;  4CIS A;  3GRV A;  1T3T A;  1D2N A;  1NVM A;  2NQ8 C;  4R3D A;  1ZAE A;  3K92 A;  3CF0 A;  2ZAO A;  4CHT B;  4JI4 M;  1JR3 A;  3KDS E;  4OW0 A;  3GLH B;  1N32 M;  2YNM D;  4FCT A;  2DXI A;  3DZD A;  2XLJ A;  5EP2 A;  4NRV A;  4QHT A;  4B3S M;  1NJF A;  3HWS A;  4JYA M;  1IN7 A;  1W5S A;  2EO2 A;  3J27 B;  2V6Z M;  3FYD A;  2ZM6 M;  1IBM M;  4CGY B;  5DYG A;  3VLF B;  8CAT A;  2ZAN A;  3I4Y A;  3MK6 A;  4B3M M;  4LFC M;  4P16 A;  4AQY M;  2Y21 A;  1FNN A;  4JI8 M;  1DO0 A;  3SYL A;  3U60 A;  2LH0 A;  1MX0 A;  3KVW A;  3UK6 A;  2K47 A;  3FUV A;  1MU5 A;  3FD9 A;  4HLQ A;  1JR3 D;  1XXH B;  4GMQ A;  2UU9 M;  2XGN A;  3LQQ A;  4L8R C;  4DUZ M;  1IN4 A;  2CV2 A;  4HL4 A;  4NL4 H;  1XC8 A;  4KOD A;  4IBK A;  4RNA A;  4DV0 M;  1KYI A;  5EXT A;  3GLG A;  4PD2 A;  4FWH A;  4ITQ A;  4IBC A;  4L78 A;  4FD2 A;  3U6S A;  4QNM A;  3L26 A;  3AL0 C;  3BOS A;  5C1B A;  1E9S A;  1DGG A;  4MH0 E;  3OTO M;  2DWN A;  1QQW A;  3KOY E;  4OX9 M;  1K82 A;  1I4W A;  3PXG A;  2VQF M;  4DR6 M;  4JV5 M;  3HU3 A;  2X49 A;  4B3R M;  3K2L A;  2KW0 A;  3GLH A;  2F5P A;  3EIE A;  3GRU A;  3KOZ E;  2CV1 A;  1YE9 A;  4M9X A;  3DA1 A;  3AKZ A;  2J7N A;  2Y0Q A;  3CF6 E;  2L7I A;  4D82 A;  3FTC A;  1TDZ A;  3HJQ A;  4GH9 A;  2VQE M;  1IY2 A;  2E5L M;  3GQ4 A;  3GRY A;  4S12 A;  2W82 A;  3U5Z B;  4JI1 M;  2QP9 X;  1NNU C;  3SYK A;  4DV7 M;  3RE8 A;  5KPR A;  4TUW A;  3K8Z A;  1IBK M;  1IN8 A;  3U6E A;  4G4O A;  3HJS A;  3R9X B;  2OPF A;  1OFH A;  2ZBK B;  3LVW A;  4MGH A;  4AKH A;  1H6U A;  2KXE A;  3T1Y M;  2RGH A;  3MJ5 A;  4DV3 M;  4LFA M;  3UJN A;  1XXH A;  3UZU A;  2RKO A;  5A2Q S;  3HHZ A;  1QZM A;  3CF2 A;  2R46 A;  4YY3 M;  3KOX E;  2QPA A;  4D80 A;  2DHR A;  2I7N A;  2OQ4 A;  3SAV A;  5BPV A;  2KEB A;  1DGF A;  3HGI A;  2RGO A;  2AHM A;  3MHV C;  4I5S A;  2CHV A;  4IJF A;  4LJ7 A;  3FYC A;  3AV0 A;  1IN6 A;  4NRW A;  2KZU A;  4IJE A;  2Z4S A;  4IIW A;  4LJ8 A;  3TWL A;  4W5W A;  3C58 A;  1R2Z A;  3GQ3 A;  1Z59 A;  2D7H A;  4M0D A;  4XBO A;  4A3V B;  1HNZ M;  5ITR A;  3L2A A;  3TWM A;  3L29 A;  3ILK A;  4EIW A;  3SBJ A;  2D7G A;  4DR5 M;  2V1U A;  5JI3 E;  1HT1 E;  2R4E A;  3U6C A;  1J7K A;  1QAM A;  2Z3X A;  2F5Q A;  3A98 B;  1KSF X;  3SFZ A;  2CE7 A;  2QEN A;  5EXX A;  1IY1 A;  3K1J A;  5FTK A;  1XMO M;  1N33 M;  5EXP A;  4LZJ A;  3L28 A;  4DV1 M;  3GLF B;  5LMN M;  4AI6 A;  5JI2 E;  4IBG A;  4REZ A;  3U5Z A;  5FTJ A;  4NSR A;  4JI7 M;  5EXS A;  4JN6 A;  1E32 A;  4I8O A;  3E9S A;  3QAU A;  4LF9 M;  3U6Q A;  2D7E A;  4IBE A;  1Q39 A;  1YUB A;  1JQJ C;  3A42 A;  3DFZ A;  3PFI A;  4PCZ A;  5FSW A;  3R8F A;  1XHB A;  1L1Z A;  1TDH A;  3J2P B;  4WW0 A;  5IRE B;  1DGB A;  1G41 A;  3CTW B;  4Z8X A;  2KZS A;  5E6J A;  3TWK A;  5KQ8 A;  3U6L A;  2G5G X;  1TH2 A;  4JI0 M;  1Q3B A;  2CFO A;  3GPU A;  4DR1 M;  4LG2 A;  4LRS A;  2XFT A;  2BNK A;  4D81 A;  1L2B A;  1NHW C;  4LF5 M;  5ITY A;  4AKG A;  2C96 A;  1GVN A;  3IG5 A;  4IBJ A;  3M6A A;  4B7H A;  4LGY A;  2CHG A;  1QYR A;  3PNY A;  3SAW A;  2EUC A;  3TE6 A;  5IWA M;  1GL7 A;  1NHG C;  3J7B A;  4GIT A;  1IBL M;  1Z5A A;  3I51 A;  2F5O A;  4GKJ M;  3FTE A;  4MGZ E;  4YHH M;  3KS8 A;  1HQC A;  3HU2 A;  3D8L A;  2LXE A;  2L6O A;  2R18 A;  1OJL A;  4M9S A;  4BB9 A;  3IG8 A;  4LJ5 A;  4IBF A;  4NXM M;  3TQS A;  4LJ9 A;  4MM3 B;  1HNW M;  5FTM A;  1J5E M;  1VDD A;  2FE8 A;  4LZZ A;  1IM2 A;  2HCB A;  2Q2E B;  3I4V A;  3FKE A;  2FFJ A;  2UXB M;  4L15 A;  3GLF A;  5EP1 A;  1OFI A;  1SXJ B;  4GHA A;  3HHW A;  1G8P A;  1IXZ A;  3T15 A;  4LF4 M;  3GO8 A;  3E4R A;  4LRT A;  4GIP A;  4QOZ C;  4LGM A;  4DV6 M;  1NNJ A;  3U6O A;  4FWG A;  1EE8 A;  2FNA A;  4AG6 A;  1Q3C A;  2XH9 A;  4MB7 A;  3A46 A;  2CEA A;  3FUX A;  3KSX A;  4MGK E;  1TH4 A;  4AG5 A;  3ZCB B;  3KSJ A;  3DOA A;  4R7G A;  3GQ5 A;  2XEP A;  1N36 M;  5KPZ A;  2DWL A;  1NY6 A;  3ZC7 B;  3T38 A;  2C5R A;  4AZF A;  2HKJ A;  3D8B A;  2YQZ A;  4DUY M;  4PDI A;  3SAT A;  3SAS A;  1XNQ M;  3HHX A;  2QCU A;  3KS4 A;  4MGY E;  1NY5 A;  2O5R A;  4BLC A;  5FTL A;  3AOG A;  1Z6T A;  4LJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...