4JI3M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ji3M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4ji3M02
5ITXA 4DV3M 1Q3CA 4CISA 2EA0A 1R2ZA 5ITYA 4DR7M 5A2QS 4JI5M 3SATA 4JI3M 1L1TA 1R2YA 1Z59A 1FJGM 3A46A 1HNZM 5ITUA 3SAWA 4DUYM 1HNWM 4DR5M 3JR4A 2UU9M 5ITQA 2Q2EB 2XZFA 1L2BA 4LFAM 3JAMS 1IBMM 5IWAM 2UXBM 4GKKM 1L2DA 3VK7A 1XMOM 4PCZA 1K3WA 1EE8A 4DV6M 4B3SM 2HKJA 4JI7M 1K82A 3T1HM 3U6PA 4JI1M 4G4NA 4NXMM 4DV7M 1XNQM 3GP1A 2UUBM 4G4QA 4B3RM 3SBJA 3C58A 4X64M 4X65M 1Z5CA 1Z5BA 3OTOM 2F4VM 4YY3M 4PD2A 3J80S 4X66M 1N32M 4NRVA 2F5NA 3SASA 2OQ4A 2XZUA 1Q39A 1HR0M 4OX9M 4LFBM 1J5EM 2UXCM 1XC8A 3U6OA 2HHHM 2UXDM 5ITTA 4LF5M 1Q3BA 2OPFA 4G4OA 5LMUM 1PM5A 1PJIA 3GPXA 1HNXM 2F5OA 4YHHM 3U6QA 3U6SA 5ITRA 4NRWA 3SAVA 3GPYA 3SAUA 3GO8A 2UUCM 1N34M 1KFVA 1IBLM 1N36M 4LFCM 4NXNM 2E5LM 4LF7M 4X62M 4PDGA 4PDIA 4LF8M 4MB7A 3GPPA 1PJJA 1N33M 3W0FA 4JI0M 4LF4M 1Z5AA 3GPUA 4JV5M 4DUZM 4DR6M 3U6LA 3VK8A 1TDZA 1L2CA 3GQ3A 4JI8M 3TWKA 2VQEM 4DR4M 4JYAM 4DV2M 4JI6M 3J7AS 3TWLA 4DR2M 4DV1M 3SARA 4DR1M 2UUAM 4DV5M 1TDHA 4ITQA 5LMNM 4GKJM 2F5QA 1I94M 3J81S 2F5PA 3A45A 5ITXE 4KHPM 1XNRM 4B3TM 1L1ZA 2F5SA 2ZM6M 1MX0A 1NNJA 1K3XA 1MU5A 3JR5A 1IBKM 3T1YM 3TWMA 3GQ4A 1XMQM 4JI4M 4DV0M 4JI2M 5IT9S 4DV4M 3A42A 4DR3M 4LF9M 3U6MA 3U6CA 3U6DA 2ZBKB 4AQYM 3U6EA 2VQFM 4K0KM 5BR8M 4LF6M 3DOAA 4B3MM 5FLXS 4G4RA 3GQ5A
chains in the Genus database with same CATH superfamily
2DZNB 3HX3A 3SFZA 4CISA 5DYGA 2EA0A 4DR7M 2JXNA 3HU1A 3D8BA 3THGA 4QOZC 1W5TA 1Y8GA 2QENA 4GMQA 1L1TA 1GLNA 1Z59A 3KVWA 4R3DA 2G3QA 2JZ0A 1HNZM 5ITUA 1WJ7A 3FTCA 2VDBB 3LCUA 3R8FA 2CEAA 2CWBA 1HNWM 1V92A 3RGPA 5F3WA 4IBBA 2KA6B 3JAMS 4IBCA 3VKGA 3SMSA 3H4JA 4L78A 2LHGA 4MGZE 3GLHE 2R65A 1QAOA 1OJLA 2V1UA 2C9CA 2HKJA 4W5WA 1NV8A 4OU7A 3PNYA 5FTLA 3UGJA 3U6PA 3Q8XA 4LGMA 3QYEA 4IBFA 4D81A 4G4QA 4B3RM 1CUKA 2XF3A 3SBJA 1C7YA 2J7NA 3V76A 5L8RF 2C98A 3E9SA 4PD2A 3J80S 5E6JA 3GLGB 3KSXA 2Y21A 2R6FA 1PGYA 1IXSB 2XZUA 2GNOA 3QYBA 2XLJA 5EP4A 3E4RA 1SXJD 3K1JA 3PVSA 2EKFA 1EFUB 1JQJC 1R7RA 2R4JA 1GVNA 2KNZA 2ZTDA 5FTJA 2Z4SA 4NC6A 3B7ZA 5LMUM 1PJIA 1PM5A 2QSFX 2CV1A 5DFLA 2JY7A 3KP1E 3NBXX 1QZMA 4MH0E 3U6QA 4NRWA 4FCWA 3W0LB 3SAUA 2WZJA 4IBEA 2A5YB 3ZCBB 2UUCM 3KOZE 4KODA 3FKEA 4LF7M 2KDLA 1XXHA 4X62M 2JUJA 4PDIA 4LF8M 3HKPA 1T43A 4MB7A 3GPPA 2QBYB 2L4FA 4JI0M 4RF0A 2Z8YM 3GLHA 3CGWA 3W0FA 2NQ8C 1SXJA 2ZAOA 2O01F 3K92A 3LVWA 3U6LA 3GLGA 1E9SA 3GQ3A 5EXSA 4HEOA 3TWKA 2CHVA 4NOOB 4B7GA 4DV2M 1G4AE 2KNAA 3HHYA 4LJ7A 1VEKA 2DWLA 5EQTA 4LG2A 4JN6A 3HWSA 3HGIA 2F5QA 3J81S 1J09A 2RGHA 4DBGB 5FTKA 2L7IA 4KHPM 2AHMA 4B3TM 2JWSA 3GLFA 5DYIA 2ZM6M 1YSYA 3F92A 1MX0A 4P16A 3I4YA 1G8PA 2VF8A 2JZ1A 1OIZA 2QNJA 4AKGA 1TH4A 3JR5A 5KQ8A 1XMQM 4JI4M 2WSCF 1IXRC 4OVZB 3AV0A 1GKIA 2ZAMA 4MGYE 1V33A 4DR3M 2J7OA 2QHOB 3E21A 2YR0A 4LJ4A 3U6EA 1D0MA 2I7PA 2QPAA 2L6OA 4K0KM 5BR8M 2DKLA 4B3MM 1IN4A 1DV0A 5FLXS 1NJGA 2Y20A 4G4RA 2Z3XA 4P17A 3FYCA 1LV7A 5ITXA 2OOAA 4G6ZA 3HHZA 1H6UA 3MK6A 4DV3M 5ITYA 1R2ZA 1WIVA 3ZQJA 3J27B 3KW6A 5A2QS 2QBYA 2JP7A 1NY5A 2BWBA 1IY1A 1VG5A 1HQCA 1FJGM 1C1KA 2Y0TA 1QZEA 1DO0A 4IBKA 4Q7JA 5GKNA 3FE3A 2CV2A 3CF0A 4GC5A 4Y28F 2R45A 3JR4A 4LY6A 2XZFA 1FNNA 2DAKA 1MJGM 3C3EA 2M5ZA 5EXXA 3M0EA 1VDDA 4BBAA 3U61A 2XSZD 4L6V6 1UM8A 1XMOM 4GHAA 1E32A 1LTMA 1K3WA 2LVQD 3AKZA 1D0KA 2C99A 4KLNA 4GEWA 4JI7M 2HAKA 1HQYE 3W68A 4NXMM 2BJWA 2N35A 3T15A 3CTWB 3KOYE 3HU3A 1D0LA 4MGIE 2RGOA 5EP2A 4AG5A 1QDTA 2ZTCA 1QUTA 2FNAA 3GRRA 3C58A 1E9RA 1GABA 3K9PA 2LWXA 2V1CA 1OIPA 1VEJA 4LJAA 5FTMA 1GJTA 3T38A 3FRHA 3VDPA 4BB9A 4LJ9A 2CFOA 4IIWA 1N32M 3QWLA 4OVZA 4QHSA 3IG8A 4GITA 1KSFX 2C96A 3FTFA 1UFZA 1SG9A 2QP9X 1HR0M 4OX9M 2UXCM 1XC8A 2XEPA 2VIIA 3KOWE 2HHHM 1RU3A 1G71A 4M9SA 1MN3A 3FUUA 4AKIA 2EUCA 1Q3BA 3EIHA 3FD9A 3J2PB 4L16A 2FOIC 3EIEA 4GC9A 3MMPA 1R4GA 5KPZA 3GPXA 1HNXM 1NVMA 3C9PA 3SHGB 2DWMA 2KRUA 3TPZA 1IN7A 2F5OA 3VKHA 1YE9A 4YHHM 3GLIA 1JR3A 3U6SA 4AZFA 5ITRA 2QCUA 4REZA 1JR3E 3GPYA 3GO8A 2C9OA 2JY6B 4GIPA 3IHPA 1XHBA 2QZ4A 1N34M 1IBLM 3L26A 1N36M 5EXPA 3BOSA 3WHKA 3ZC7B 1IY2A 2CRUA 2M60A 4XGIA 2LVAA 4DUZM 3GRYA 2R4EA 4L4UA 1QANA 4DR6M 1TDZA 2GQFA 1PRBA 1QAMA 1SXJB 3HJQA 1ZAEA 2ERCA 1DGFA 2YNMD 2EKKA 3FUXA 1WXQA 3GLIB 2Y0QA 4JI6M 3U5ZA 3J7AS 4M0DA 3TWLA 4CGYB 1TTEA 4D80A 4DR2M 1WHCA 4LGYA 2UUAM 1GL7A 1TDHA 4DV5M 4ITQA 2MH8A 1GJSA 2XFTA 2R62A 1NHWC 4LRSA 1GL6A 3H4MA 4UN2B 2DVWB 1XNRM 1DGGA 2O25A 3HZJA 4GRIA 1ZQ9A 1VDLA 4KT0F 5C18A 1IN6A 1NNJA 2MGWA 3SYKA 3I4VA 1HT1E 1MU5A 4B08A 2B3TA 3UMMA 1OTRA 2KHHA 1IM2A 4FCTA 3KDSE 2DWNA 4NSRA 3BBZA 2K9DA 2MR9A 4ZPXA 4CHTB 4DV4M 2JY8A 2FH0A 3RFWA 1IQPA 1DGHB 1PJSA 3AFHA 4GH9A 3U6DA 5EJCA 3U6MA 2OOBA 1XXHB 4PT5A 3LCVB 5IREB 3DOAA 2UXDM 3PNVA 1OAIA 1NHGC 1XB2B 3ZH9B 1IXZA 2CUZA 3TE6A 3K2LA 3SATA 4FW9A 2D7GA 2FFJA 3DZDA 2XH9A 1R2YA 3A46A 4ANRA 2KZUA 3CF2A 1BVSA 4CJ6A 2R44A 3LQQA 4FWDA 2G5GX 2W82A 1WGLA 5FTNA 1NO1A 2DWZB 4DR5M 2EJSA 2JNHA 3AJIB 4JXJA 3GRUA 3VDUA 1IBMM 1OFIA 1OFHA 1TF0B 1L2DA 3VK7A 1A5TA 2K6BA 1SXJC 5IZ7D 3R9XB 4PCZA 4AI6A 2APLA 3QAUA 3L2AA 1EE8A 1AUAA 4MM3B 4F2LA 1N77A 1K82A 3T1HM 2H1RA 3I01M 1IY0A 3BXWA 1XNQM 2KZSA 3HY5A 2V6ZM 5KO3A 2UUBM 2YFQA 4IBDA 5JI2E 4WURA 1X37A 3HHXA 2BJVA 3B7NA 3E46A 4HL4A 4LCBA 3KS8A 2DAIA 3OTOM 2DHRA 3W67A 4FD2A 3VFDA 2R18A 2F5NA 2KXEA 2FS1A 3K9OA 2OQ4A 4LFBM 2R0IA 1J7KA 2X49A 1TGUA 2P5TA 1NV9A 3DA1A 3MHVC 4B7FA 2LVOC 3U6OA 2CHQA 4LZJA 1XXHE 3FUVA 2DENA 3VLFB 5ITTA 3B74A 1P3QQ 1I4WA 2OPFA 1VQ1A 4LF5M 4G4OA 1JB0F 3FUTA 1YLAA 2XSZA 5EXTA 3GLFE 2YQZA 8CATA 4I5SA 1DGBA 2DNAA 4FVMA 4F1IA 2G8LA 1NSFA 3SAVA 3IG5A 4QNRA 1EIJA 1R6BX 4XK8F 2L7HA 4NXNM 4M0WA 2E5LM 2QQ8A 3GLHB 1TR8A 5EP1A 1GO5A 2KEBA 2XGNA 2LVPC 1PJJA 4AW4A 3KFUG 4LF4M 1Z5AA 2X4AA 3D8LA 1WGNA 4JV5M 3SMPA 1XWIA 1ORYB 1IN5A 3U61B 3VK8A 1L2CA 5KPTA 2Z4RA 4IBIA 3M6AA 4DR4M 2DHYA 1OAOC 1QVRA 4FCVA 2O5RA 4DV1M 3SARA 2HWJA 3UK6A 3HU2A 1IFYA 2EO2A 3HHWA 2J5YA 3LW5F 5LMNM 3B89A 1DGHA 1WR1B 3A45A 2FE8A 2CV0A 3AL0C 1NNUC 3CF6E 2CHGA 1N75A 3B7QA 4M9XA 3KSJA 3NWLA 4EIWA 3FTEA 2DAEA 2DXIA 1AIPC 7CATA 1N78A 1QDRA 3UZUA 2K47A 3J7BA 3FRIA 1ZMUA 3M7GA 1IBKM 1L8QA 2LBCA 3TWMA 1JR3D 2MJ5B 3AOGA 4AG6A 4DV0M 5IT9S 5E26A 3T6PA 3A42A 4LF9M 5H37D 4A3VB 2MROB 3NBIA 1YUBA 2VF7A 3MJ5A 4NL4H 2VQFM 4LF6M 2CE7A 1G41A 1SXJE 2XFSA 5KPRA 3GLGE 3U5ZB 4AKHA 5BPVA 2D7EA 3IECA 4BLCA 3GQ5A 1Q3CA 3RGSA 1VEGA 4JI5M 2RKOA 4JI3M 5EP3A 4NSOB 4WW0A 3PXGA 3SAWA 3HJSA 4DUYM 4OW0A 2LHCA 1PJQA 2BNKA 3SHFA 3I04M 2UU9M 3Q8GA 1W5SA 2Q2EB 4II7A 5ITQA 4LFAM 1L2BA 3UJNA 3RE8A 2Z7JA 1OQYA 5IWAM 2UXBM 2DI0A 4GKKM 4QHTA 4LRTA 5JI3E 4LZZA 2JY5A 4RKUF 4XBOA 3L25A 3LMMA 4DV6M 2DZOB 4B3SM 4IJFA 1HT2E 4JI1M 4G4NA 3HJ8A 4DV7M 2JA2A 4M9ZA 3FTDA 3GP1A 1QAQA 2D7HA 3WHLA 3C3DA 4QOSA 5KQDA 1OKSA 4X64M 3KXEC 2X8AA 1QQWA 1Z5CA 2ZANA 1Z5BA 4KO8A 4X65M 2F4VM 4YY3M 4X66M 2C5RA 1F4IA 2DAMA 3DFZA 3LVVA 4I8OA 4NRVA 3SC3A 3KOXE 5C1BA 3GLIE 3SASA 4LJ8A 1Q39A 1J5EM 1T3TA 1G3IA 1T6OA 3L27A 4IBGA 3U60B 2KRKA 4RNAA 1S3SA 2K0BX 4I81A 4L8RC 4S12A 1IXSA 4L15A 3SYLA 4Z6YA 4FWHA 1KYIA 4FWGA 2HL7A 4WP2A 4QNMA 1R5LA 2LVNC 2LTUA 1KFVA 4LFCM 1TH3A 3AOEC 1QUSA 3TL4X 4PDGA 1G59A 3AOEA 1N33M 3GPUA 2WSEF 1NY6A 2HCBA 4LJ5A 5DNYA 4MGHA 4JI8M 3LQRA 2VQEM 1ZMWA 1ZMVA 4R71A 1QYRA 4JYAM 4IBJA 4G3OA 2L2DA 2L4EA 3L28A 3L29A 1TH2A 4IJEA 3U60A 4DR1M 1ZV1A 3GRVA 4GKJM 1E94E 5FSWA 3FYDA 1I94M 1Z6TA 2F5PA 3B9PA 2KNVA 5ITXE 1D2NA 2H5XA 4TUWA 4Z8XA 2RRUA 3A98B 4D82A 1L1ZA 2F5SA 1V34A 2OO9A 2L09A 3I51A 4B7HA 1K3XA 2WSFF 2LH0A 2BWEA 2DZLA 2LNHC 1Q02A 2LXEA 3GLFB 1IN8A 3T1YM 3GQ4A 3KS4A 4LJ6A 3ILKA 4JI2M 3K8ZA 3PFIA 3U6CA 2ZBKB 2R46A 2CP8A 2DAGA 1NJFA 1DO2A 3FUWA 4CIZA 3TQSA 4AQYM 4GHLA 1PJTA 4MGKE 1HJPA 3KP0E 4I4LA 4RF1A 2I7NA 4HLQA 2KW0A 4R7GA
chains in the Genus database with same CATH topology
2DZNB 3SFZA 4CISA 5DYGA 2EA0A 4DR7M 3HU1A 3D8BA 3THGA 4QOZC 1W5TA 2QENA 4GMQA 1L1TA 1GLNA 1Z59A 3KVWA 4R3DA 1HNZM 5ITUA 3FTCA 3R8FA 2CEAA 1HNWM 3RGPA 5F3WA 4IBBA 2KA6B 3JAMS 4IBCA 3VKGA 3SMSA 4L78A 4MGZE 2R65A 1QAOA 1OJLA 2V1UA 2C9CA 2HKJA 4W5WA 4OU7A 3PNYA 5FTLA 3UGJA 3U6PA 3Q8XA 4LGMA 4IBFA 4D81A 4G4QA 4B3RM 2XF3A 3SBJA 2J7NA 2C98A 3E9SA 4PD2A 3J80S 5E6JA 3GLGB 3KSXA 2Y21A 1IXSB 2XZUA 2XLJA 5EP4A 3E4RA 1SXJD 3K1JA 3PVSA 1R7RA 1JQJC 2R4JA 1GVNA 5FTJA 5LMUM 1PJIA 2Z4SA 1PM5A 2CV1A 3KP1E 4MH0E 1QZMA 3U6QA 4NRWA 4FCWA 3W0LB 3SAUA 4IBEA 2A5YB 3ZCBB 2UUCM 3KOZE 4KODA 3FKEA 4LF7M 1XXHA 4X62M 4PDIA 4LF8M 3HKPA 4MB7A 3GPPA 2QBYB 3W0FA 4JI0M 4RF0A 3GLHA 2NQ8C 1SXJA 2ZAOA 3K92A 3LVWA 3U6LA 3GLGA 1E9SA 3GQ3A 5EXSA 3TWKA 2CHVA 4NOOB 4B7GA 4DV2M 1G4AE 3HHYA 4LJ7A 2DWLA 5EQTA 4LG2A 4JN6A 3HWSA 3HGIA 2F5QA 3J81S 1J09A 2RGHA 5FTKA 2L7IA 4KHPM 2AHMA 4B3TM 3GLFA 5DYIA 2ZM6M 1YSYA 1MX0A 4P16A 3I4YA 1G8PA 4AKGA 1TH4A 3JR5A 5KQ8A 1XMQM 4JI4M 1IXRC 4OVZB 3AV0A 1GKIA 2ZAMA 4MGYE 4DR3M 2J7OA 2YR0A 4LJ4A 3U6EA 2I7PA 2QPAA 2L6OA 4K0KM 5BR8M 4B3MM 1IN4A 5FLXS 1NJGA 2Y20A 4G4RA 2Z3XA 3FYCA 1LV7A 5ITXA 4DV3M 4G6ZA 3HHZA 1H6UA 3MK6A 1R2ZA 5ITYA 2QBYA 3J27B 3KW6A 5A2QS 1NY5A 1IY1A 1HQCA 1FJGM 1C1KA 2Y0TA 1DO0A 4IBKA 5GKNA 2CV2A 3CF0A 4GC5A 3JR4A 2R45A 4LY6A 2XZFA 1FNNA 2M5ZA 5EXXA 3M0EA 1VDDA 4BBAA 3U61A 2XSZD 1UM8A 1XMOM 4GHAA 1E32A 1K3WA 3AKZA 2C99A 4KLNA 4JI7M 1HQYE 4NXMM 2BJWA 3T15A 3CTWB 3KOYE 3HU3A 5EP2A 4MGIE 2RGOA 4AG5A 2FNAA 3GRRA 3C58A 1E9RA 2LWXA 2V1CA 3VDPA 4BB9A 4LJAA 5FTMA 3T38A 4LJ9A 2CFOA 4IIWA 1N32M 3QWLA 4OVZA 4QHSA 3IG8A 4GITA 1KSFX 2C96A 3FTFA 2QP9X 1HR0M 4OX9M 2UXCM 1XC8A 2XEPA 2VIIA 3KOWE 2HHHM 4M9SA 3FUUA 4AKIA 2EUCA 1Q3BA 3EIHA 3FD9A 3J2PB 4L16A 2FOIC 3EIEA 4GC9A 5KPZA 3GPXA 1HNXM 1NVMA 3SHGB 2DWMA 2KRUA 3TPZA 1IN7A 2F5OA 3VKHA 1YE9A 4YHHM 3GLIA 1JR3A 3U6SA 4AZFA 5ITRA 2QCUA 4REZA 3GPYA 3GO8A 2C9OA 4GIPA 1XHBA 2QZ4A 1N34M 1IBLM 3L26A 1N36M 5EXPA 3BOSA 3WHKA 3ZC7B 1IY2A 2M60A 4XGIA 4DUZM 3GRYA 2R4EA 4L4UA 1QANA 4DR6M 1TDZA 1QAMA 3HJQA 1SXJB 1ZAEA 2ERCA 1DGFA 2YNMD 3FUXA 3GLIB 1WXQA 2Y0QA 4JI6M 3U5ZA 3J7AS 4M0DA 3TWLA 4CGYB 4D80A 4DR2M 4LGYA 2UUAM 1GL7A 1TDHA 4DV5M 4ITQA 2XFTA 2R62A 1NHWC 4LRSA 1GL6A 3H4MA 1XNRM 2DVWB 1DGGA 4GRIA 1ZQ9A 5C18A 1IN6A 1NNJA 3SYKA 3I4VA 1HT1E 1MU5A 4B08A 3UMMA 1IM2A 4FCTA 3KDSE 2DWNA 4NSRA 4DV4M 4ZPXA 4CHTB 3RFWA 3U6MA 1IQPA 1DGHB 3AFHA 4GH9A 3U6DA 5EJCA 1XXHB 4PT5A 5IREB 3DOAA 2UXDM 3PNVA 1NHGC 3ZH9B 1IXZA 2CUZA 3TE6A 3K2LA 3SATA 4FW9A 2D7GA 2FFJA 3DZDA 2XH9A 1R2YA 3A46A 2KZUA 3CF2A 3LQQA 4FWDA 2G5GX 2W82A 5FTNA 2DWZB 4DR5M 3AJIB 4JXJA 3GRUA 3VDUA 1IBMM 1OFIA 1OFHA 1L2DA 3VK7A 3R9XB 5IZ7D 1SXJC 4AI6A 4PCZA 3QAUA 3L2AA 1EE8A 4MM3B 1N77A 1K82A 3T1HM 2H1RA 1IY0A 1XNQM 2KZSA 5KO3A 2V6ZM 2UUBM 2YFQA 4IBDA 5JI2E 4WURA 1X37A 3HHXA 2BJVA 4HL4A 4LCBA 3KS8A 3OTOM 2DHRA 4FD2A 3VFDA 2R18A 2F5NA 2KXEA 2OQ4A 4LFBM 1J7KA 2X49A 1TGUA 2P5TA 3DA1A 3MHVC 4B7FA 3U6OA 2CHQA 4LZJA 3FUVA 3VLFB 5ITTA 4LF5M 1I4WA 2OPFA 4G4OA 3FUTA 2XSZA 5EXTA 2YQZA 8CATA 4I5SA 1DGBA 4FVMA 2G8LA 1NSFA 3SAVA 3IG5A 4QNRA 1R6BX 2L7HA 4NXNM 4M0WA 2E5LM 3GLHB 5EP1A 2KEBA 2XGNA 1PJJA 4AW4A 3KFUG 4LF4M 1Z5AA 2X4AA 3D8LA 4JV5M 3SMPA 1XWIA 1ORYB 1IN5A 3U61B 3VK8A 1L2CA 5KPTA 2Z4RA 4IBIA 3M6AA 4DR4M 1QVRA 4FCVA 2O5RA 4DV1M 3SARA 3UK6A 3HU2A 2EO2A 3HHWA 5LMNM 1DGHA 3A45A 2FE8A 2CV0A 3AL0C 1NNUC 3CF6E 2CHGA 1N75A 4M9XA 3KSJA 3NWLA 4EIWA 3FTEA 2DXIA 1N78A 7CATA 3UZUA 2K47A 3J7BA 3M7GA 1IBKM 1L8QA 3TWMA 1JR3D 3AOGA 4AG6A 4DV0M 5IT9S 5E26A 3A42A 4LF9M 5H37D 4A3VB 3NBIA 1YUBA 3MJ5A 4NL4H 2VQFM 4LF6M 2CE7A 1G41A 1SXJE 2XFSA 5KPRA 3U5ZB 4AKHA 5BPVA 2D7EA 3GQ5A 4BLCA 1Q3CA 3RGSA 4JI5M 2RKOA 4JI3M 5EP3A 4NSOB 4WW0A 3PXGA 3SAWA 3HJSA 4DUYM 4OW0A 2BNKA 3SHFA 2UU9M 5ITQA 1W5SA 2Q2EB 4II7A 1L2BA 4LFAM 3UJNA 3RE8A 2Z7JA 5IWAM 2UXBM 4GKKM 4QHTA 4LRTA 5JI3E 4LZZA 4XBOA 3L25A 3LMMA 4DV6M 2DZOB 4B3SM 4IJFA 1HT2E 4JI1M 4G4NA 3HJ8A 4DV7M 2JA2A 4M9ZA 3FTDA 3GP1A 1QAQA 2D7HA 3WHLA 4QOSA 5KQDA 4X64M 3KXEC 2X8AA 1QQWA 1Z5CA 2ZANA 1Z5BA 4KO8A 4X65M 2F4VM 4YY3M 4X66M 2C5RA 3LVVA 3DFZA 4I8OA 4NRVA 3SC3A 5C1BA 3KOXE 3SASA 4LJ8A 1Q39A 1J5EM 1T3TA 1G3IA 3L27A 4IBGA 3U60B 2KRKA 4RNAA 1S3SA 4I81A 4L8RC 4S12A 4L15A 3SYLA 4Z6YA 4FWHA 1KYIA 4FWGA 2HL7A 4QNMA 1KFVA 4LFCM 1TH3A 3AOEC 3TL4X 4PDGA 1G59A 3AOEA 1N33M 3GPUA 1NY6A 2HCBA 4LJ5A 5DNYA 4MGHA 4JI8M 3LQRA 2VQEM 4JYAM 1QYRA 4IBJA 3L28A 3L29A 1TH2A 4IJEA 3U60A 4DR1M 3GRVA 4GKJM 1E94E 5FSWA 3FYDA 1I94M 1Z6TA 2F5PA 3B9PA 5ITXE 1D2NA 4TUWA 4Z8XA 3A98B 4D82A 1L1ZA 2F5SA 2L09A 3I51A 4B7HA 1K3XA 2LH0A 3GLFB 2LNHC 2LXEA 3T1YM 1IN8A 3GQ4A 3KS4A 4LJ6A 3ILKA 4JI2M 3K8ZA 3PFIA 3U6CA 2ZBKB 2R46A 4AQYM 1NJFA 3FUWA 1DO2A 3TQSA 4GHLA 4MGKE 4I4LA 3KP0E 4RF1A 2I7NA 4HLQA 2KW0A 4R7GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ITX A;  4DV3 M;  1Q3C A;  4CIS A;  2EA0 A;  1R2Z A;  5ITY A;  4DR7 M;  5A2Q S;  4JI5 M;  3SAT A;  4JI3 M;  1L1T A;  1R2Y A;  1Z59 A;  1FJG M;  3A46 A;  1HNZ M;  5ITU A;  3SAW A;  4DUY M;  1HNW M;  4DR5 M;  3JR4 A;  2UU9 M;  5ITQ A;  2Q2E B;  2XZF A;  1L2B A;  4LFA M;  3JAM S;  1IBM M;  5IWA M;  2UXB M;  4GKK M;  1L2D A;  3VK7 A;  1XMO M;  4PCZ A;  1K3W A;  1EE8 A;  4DV6 M;  4B3S M;  2HKJ A;  4JI7 M;  1K82 A;  3T1H M;  3U6P A;  4JI1 M;  4G4N A;  4NXM M;  4DV7 M;  1XNQ M;  3GP1 A;  2UUB M;  4G4Q A;  4B3R M;  3SBJ A;  3C58 A;  4X64 M;  4X65 M;  1Z5C A;  1Z5B A;  3OTO M;  2F4V M;  4YY3 M;  4PD2 A;  3J80 S;  4X66 M;  1N32 M;  4NRV A;  2F5N A;  3SAS A;  2OQ4 A;  2XZU A;  1Q39 A;  1HR0 M;  4OX9 M;  4LFB M;  1J5E M;  2UXC M;  1XC8 A;  3U6O A;  2HHH M;  2UXD M;  5ITT A;  4LF5 M;  1Q3B A;  2OPF A;  4G4O A;  5LMU M;  1PM5 A;  1PJI A;  3GPX A;  1HNX M;  2F5O A;  4YHH M;  3U6Q A;  3U6S A;  5ITR A;  4NRW A;  3SAV A;  3GPY A;  3SAU A;  3GO8 A;  2UUC M;  1N34 M;  1KFV A;  1IBL M;  1N36 M;  4LFC M;  4NXN M;  2E5L M;  4LF7 M;  4X62 M;  4PDG A;  4PDI A;  4LF8 M;  4MB7 A;  3GPP A;  1PJJ A;  1N33 M;  3W0F A;  4JI0 M;  4LF4 M;  1Z5A A;  3GPU A;  4JV5 M;  4DUZ M;  4DR6 M;  3U6L A;  3VK8 A;  1TDZ A;  1L2C A;  3GQ3 A;  4JI8 M;  3TWK A;  2VQE M;  4DR4 M;  4JYA M;  4DV2 M;  4JI6 M;  3J7A S;  3TWL A;  4DR2 M;  4DV1 M;  3SAR A;  4DR1 M;  2UUA M;  4DV5 M;  1TDH A;  4ITQ A;  5LMN M;  4GKJ M;  2F5Q A;  1I94 M;  3J81 S;  2F5P A;  3A45 A;  5ITX E;  4KHP M;  1XNR M;  4B3T M;  1L1Z A;  2F5S A;  2ZM6 M;  1MX0 A;  1NNJ A;  1K3X A;  1MU5 A;  3JR5 A;  1IBK M;  3T1Y M;  3TWM A;  3GQ4 A;  1XMQ M;  4JI4 M;  4DV0 M;  4JI2 M;  5IT9 S;  4DV4 M;  3A42 A;  4DR3 M;  4LF9 M;  3U6M A;  3U6C A;  3U6D A;  2ZBK B;  4AQY M;  3U6E A;  2VQF M;  4K0K M;  5BR8 M;  4LF6 M;  3DOA A;  4B3M M;  5FLX S;  4G4R A;  3GQ5 A; 
#chains in the Genus database with same CATH topology
 2DZN B;  3HX3 A;  3SFZ A;  4CIS A;  5DYG A;  2EA0 A;  4DR7 M;  2JXN A;  3HU1 A;  3D8B A;  3THG A;  4QOZ C;  1W5T A;  1Y8G A;  2QEN A;  4GMQ A;  1L1T A;  1GLN A;  1Z59 A;  3KVW A;  4R3D A;  2G3Q A;  2JZ0 A;  1HNZ M;  5ITU A;  1WJ7 A;  3FTC A;  2VDB B;  3LCU A;  3R8F A;  2CEA A;  2CWB A;  1HNW M;  1V92 A;  3RGP A;  5F3W A;  4IBB A;  2KA6 B;  3JAM S;  4IBC A;  3VKG A;  3SMS A;  3H4J A;  4L78 A;  2LHG A;  4MGZ E;  3GLH E;  2R65 A;  1QAO A;  1OJL A;  2V1U A;  2C9C A;  2HKJ A;  4W5W A;  1NV8 A;  4OU7 A;  3PNY A;  5FTL A;  3UGJ A;  3U6P A;  3Q8X A;  4LGM A;  3QYE A;  4IBF A;  4D81 A;  4G4Q A;  4B3R M;  1CUK A;  2XF3 A;  3SBJ A;  1C7Y A;  2J7N A;  3V76 A;  5L8R F;  2C98 A;  3E9S A;  4PD2 A;  3J80 S;  5E6J A;  3GLG B;  3KSX A;  2Y21 A;  2R6F A;  1PGY A;  1IXS B;  2XZU A;  2GNO A;  3QYB A;  2XLJ A;  5EP4 A;  3E4R A;  1SXJ D;  3K1J A;  3PVS A;  2EKF A;  1EFU B;  1JQJ C;  1R7R A;  2R4J A;  1GVN A;  2KNZ A;  2ZTD A;  5FTJ A;  2Z4S A;  4NC6 A;  3B7Z A;  5LMU M;  1PJI A;  1PM5 A;  2QSF X;  2CV1 A;  5DFL A;  2JY7 A;  3KP1 E;  3NBX X;  1QZM A;  4MH0 E;  3U6Q A;  4NRW A;  4FCW A;  3W0L B;  3SAU A;  2WZJ A;  4IBE A;  2A5Y B;  3ZCB B;  2UUC M;  3KOZ E;  4KOD A;  3FKE A;  4LF7 M;  2KDL A;  1XXH A;  4X62 M;  2JUJ A;  4PDI A;  4LF8 M;  3HKP A;  1T43 A;  4MB7 A;  3GPP A;  2QBY B;  2L4F A;  4JI0 M;  4RF0 A;  2Z8Y M;  3GLH A;  3CGW A;  3W0F A;  2NQ8 C;  1SXJ A;  2ZAO A;  2O01 F;  3K92 A;  3LVW A;  3U6L A;  3GLG A;  1E9S A;  3GQ3 A;  5EXS A;  4HEO A;  3TWK A;  2CHV A;  4NOO B;  4B7G A;  4DV2 M;  1G4A E;  2KNA A;  3HHY A;  4LJ7 A;  1VEK A;  2DWL A;  5EQT A;  4LG2 A;  4JN6 A;  3HWS A;  3HGI A;  2F5Q A;  3J81 S;  1J09 A;  2RGH A;  4DBG B;  5FTK A;  2L7I A;  4KHP M;  2AHM A;  4B3T M;  2JWS A;  3GLF A;  5DYI A;  2ZM6 M;  1YSY A;  3F92 A;  1MX0 A;  4P16 A;  3I4Y A;  1G8P A;  2VF8 A;  2JZ1 A;  1OIZ A;  2QNJ A;  4AKG A;  1TH4 A;  3JR5 A;  5KQ8 A;  1XMQ M;  4JI4 M;  2WSC F;  1IXR C;  4OVZ B;  3AV0 A;  1GKI A;  2ZAM A;  4MGY E;  1V33 A;  4DR3 M;  2J7O A;  2QHO B;  3E21 A;  2YR0 A;  4LJ4 A;  3U6E A;  1D0M A;  2I7P A;  2QPA A;  2L6O A;  4K0K M;  5BR8 M;  2DKL A;  4B3M M;  1IN4 A;  1DV0 A;  5FLX S;  1NJG A;  2Y20 A;  4G4R A;  2Z3X A;  4P17 A;  3FYC A;  1LV7 A;  5ITX A;  2OOA A;  4G6Z A;  3HHZ A;  1H6U A;  3MK6 A;  4DV3 M;  5ITY A;  1R2Z A;  1WIV A;  3ZQJ A;  3J27 B;  3KW6 A;  5A2Q S;  2QBY A;  2JP7 A;  1NY5 A;  2BWB A;  1IY1 A;  1VG5 A;  1HQC A;  1FJG M;  1C1K A;  2Y0T A;  1QZE A;  1DO0 A;  4IBK A;  4Q7J A;  5GKN A;  3FE3 A;  2CV2 A;  3CF0 A;  4GC5 A;  4Y28 F;  2R45 A;  3JR4 A;  4LY6 A;  2XZF A;  1FNN A;  2DAK A;  1MJG M;  3C3E A;  2M5Z A;  5EXX A;  3M0E A;  1VDD A;  4BBA A;  3U61 A;  2XSZ D;  4L6V 6;  1UM8 A;  1XMO M;  4GHA A;  1E32 A;  1LTM A;  1K3W A;  2LVQ D;  3AKZ A;  1D0K A;  2C99 A;  4KLN A;  4GEW A;  4JI7 M;  2HAK A;  1HQY E;  3W68 A;  4NXM M;  2BJW A;  2N35 A;  3T15 A;  3CTW B;  3KOY E;  3HU3 A;  1D0L A;  4MGI E;  2RGO A;  5EP2 A;  4AG5 A;  1QDT A;  2ZTC A;  1QUT A;  2FNA A;  3GRR A;  3C58 A;  1E9R A;  1GAB A;  3K9P A;  2LWX A;  2V1C A;  1OIP A;  1VEJ A;  4LJA A;  5FTM A;  1GJT A;  3T38 A;  3FRH A;  3VDP A;  4BB9 A;  4LJ9 A;  2CFO A;  4IIW A;  1N32 M;  3QWL A;  4OVZ A;  4QHS A;  3IG8 A;  4GIT A;  1KSF X;  2C96 A;  3FTF A;  1UFZ A;  1SG9 A;  2QP9 X;  1HR0 M;  4OX9 M;  2UXC M;  1XC8 A;  2XEP A;  2VII A;  3KOW E;  2HHH M;  1RU3 A;  1G71 A;  4M9S A;  1MN3 A;  3FUU A;  4AKI A;  2EUC A;  1Q3B A;  3EIH A;  3FD9 A;  3J2P B;  4L16 A;  2FOI C;  3EIE A;  4GC9 A;  3MMP A;  1R4G A;  5KPZ A;  3GPX A;  1HNX M;  1NVM A;  3C9P A;  3SHG B;  2DWM A;  2KRU A;  3TPZ A;  1IN7 A;  2F5O A;  3VKH A;  1YE9 A;  4YHH M;  3GLI A;  1JR3 A;  3U6S A;  4AZF A;  5ITR A;  2QCU A;  4REZ A;  1JR3 E;  3GPY A;  3GO8 A;  2C9O A;  2JY6 B;  4GIP A;  3IHP A;  1XHB A;  2QZ4 A;  1N34 M;  1IBL M;  3L26 A;  1N36 M;  5EXP A;  3BOS A;  3WHK A;  3ZC7 B;  1IY2 A;  2CRU A;  2M60 A;  4XGI A;  2LVA A;  4DUZ M;  3GRY A;  2R4E A;  4L4U A;  1QAN A;  4DR6 M;  1TDZ A;  2GQF A;  1PRB A;  1QAM A;  1SXJ B;  3HJQ A;  1ZAE A;  2ERC A;  1DGF A;  2YNM D;  2EKK A;  3FUX A;  1WXQ A;  3GLI B;  2Y0Q A;  4JI6 M;  3U5Z A;  3J7A S;  4M0D A;  3TWL A;  4CGY B;  1TTE A;  4D80 A;  4DR2 M;  1WHC A;  4LGY A;  2UUA M;  1GL7 A;  1TDH A;  4DV5 M;  4ITQ A;  2MH8 A;  1GJS A;  2XFT A;  2R62 A;  1NHW C;  4LRS A;  1GL6 A;  3H4M A;  4UN2 B;  2DVW B;  1XNR M;  1DGG A;  2O25 A;  3HZJ A;  4GRI A;  1ZQ9 A;  1VDL A;  4KT0 F;  5C18 A;  1IN6 A;  1NNJ A;  2MGW A;  3SYK A;  3I4V A;  1HT1 E;  1MU5 A;  4B08 A;  2B3T A;  3UMM A;  1OTR A;  2KHH A;  1IM2 A;  4FCT A;  3KDS E;  2DWN A;  4NSR A;  3BBZ A;  2K9D A;  2MR9 A;  4ZPX A;  4CHT B;  4DV4 M;  2JY8 A;  2FH0 A;  3RFW A;  1IQP A;  1DGH B;  1PJS A;  3AFH A;  4GH9 A;  3U6D A;  5EJC A;  3U6M A;  2OOB A;  1XXH B;  4PT5 A;  3LCV B;  5IRE B;  3DOA A;  2UXD M;  3PNV A;  1OAI A;  1NHG C;  1XB2 B;  3ZH9 B;  1IXZ A;  2CUZ A;  3TE6 A;  3K2L A;  3SAT A;  4FW9 A;  2D7G A;  2FFJ A;  3DZD A;  2XH9 A;  1R2Y A;  3A46 A;  4ANR A;  2KZU A;  3CF2 A;  1BVS A;  4CJ6 A;  2R44 A;  3LQQ A;  4FWD A;  2G5G X;  2W82 A;  1WGL A;  5FTN A;  1NO1 A;  2DWZ B;  4DR5 M;  2EJS A;  2JNH A;  3AJI B;  4JXJ A;  3GRU A;  3VDU A;  1IBM M;  1OFI A;  1OFH A;  1TF0 B;  1L2D A;  3VK7 A;  1A5T A;  2K6B A;  1SXJ C;  5IZ7 D;  3R9X B;  4PCZ A;  4AI6 A;  2APL A;  3QAU A;  3L2A A;  1EE8 A;  1AUA A;  4MM3 B;  4F2L A;  1N77 A;  1K82 A;  3T1H M;  2H1R A;  3I01 M;  1IY0 A;  3BXW A;  1XNQ M;  2KZS A;  3HY5 A;  2V6Z M;  5KO3 A;  2UUB M;  2YFQ A;  4IBD A;  5JI2 E;  4WUR A;  1X37 A;  3HHX A;  2BJV A;  3B7N A;  3E46 A;  4HL4 A;  4LCB A;  3KS8 A;  2DAI A;  3OTO M;  2DHR A;  3W67 A;  4FD2 A;  3VFD A;  2R18 A;  2F5N A;  2KXE A;  2FS1 A;  3K9O A;  2OQ4 A;  4LFB M;  2R0I A;  1J7K A;  2X49 A;  1TGU A;  2P5T A;  1NV9 A;  3DA1 A;  3MHV C;  4B7F A;  2LVO C;  3U6O A;  2CHQ A;  4LZJ A;  1XXH E;  3FUV A;  2DEN A;  3VLF B;  5ITT A;  3B74 A;  1P3Q Q;  1I4W A;  2OPF A;  1VQ1 A;  4LF5 M;  4G4O A;  1JB0 F;  3FUT A;  1YLA A;  2XSZ A;  5EXT A;  3GLF E;  2YQZ A;  8CAT A;  4I5S A;  1DGB A;  2DNA A;  4FVM A;  4F1I A;  2G8L A;  1NSF A;  3SAV A;  3IG5 A;  4QNR A;  1EIJ A;  1R6B X;  4XK8 F;  2L7H A;  4NXN M;  4M0W A;  2E5L M;  2QQ8 A;  3GLH B;  1TR8 A;  5EP1 A;  1GO5 A;  2KEB A;  2XGN A;  2LVP C;  1PJJ A;  4AW4 A;  3KFU G;  4LF4 M;  1Z5A A;  2X4A A;  3D8L A;  1WGN A;  4JV5 M;  3SMP A;  1XWI A;  1ORY B;  1IN5 A;  3U61 B;  3VK8 A;  1L2C A;  5KPT A;  2Z4R A;  4IBI A;  3M6A A;  4DR4 M;  2DHY A;  1OAO C;  1QVR A;  4FCV A;  2O5R A;  4DV1 M;  3SAR A;  2HWJ A;  3UK6 A;  3HU2 A;  1IFY A;  2EO2 A;  3HHW A;  2J5Y A;  3LW5 F;  5LMN M;  3B89 A;  1DGH A;  1WR1 B;  3A45 A;  2FE8 A;  2CV0 A;  3AL0 C;  1NNU C;  3CF6 E;  2CHG A;  1N75 A;  3B7Q A;  4M9X A;  3KSJ A;  3NWL A;  4EIW A;  3FTE A;  2DAE A;  2DXI A;  1AIP C;  7CAT A;  1N78 A;  1QDR A;  3UZU A;  2K47 A;  3J7B A;  3FRI A;  1ZMU A;  3M7G A;  1IBK M;  1L8Q A;  2LBC A;  3TWM A;  1JR3 D;  2MJ5 B;  3AOG A;  4AG6 A;  4DV0 M;  5IT9 S;  5E26 A;  3T6P A;  3A42 A;  4LF9 M;  5H37 D;  4A3V B;  2MRO B;  3NBI A;  1YUB A;  2VF7 A;  3MJ5 A;  4NL4 H;  2VQF M;  4LF6 M;  2CE7 A;  1G41 A;  1SXJ E;  2XFS A;  5KPR A;  3GLG E;  3U5Z B;  4AKH A;  5BPV A;  2D7E A;  3IEC A;  4BLC A;  3GQ5 A;  1Q3C A;  3RGS A;  1VEG A;  4JI5 M;  2RKO A;  4JI3 M;  5EP3 A;  4NSO B;  4WW0 A;  3PXG A;  3SAW A;  3HJS A;  4DUY M;  4OW0 A;  2LHC A;  1PJQ A;  2BNK A;  3SHF A;  3I04 M;  2UU9 M;  3Q8G A;  1W5S A;  2Q2E B;  4II7 A;  5ITQ A;  4LFA M;  1L2B A;  3UJN A;  3RE8 A;  2Z7J A;  1OQY A;  5IWA M;  2UXB M;  2DI0 A;  4GKK M;  4QHT A;  4LRT A;  5JI3 E;  4LZZ A;  2JY5 A;  4RKU F;  4XBO A;  3L25 A;  3LMM A;  4DV6 M;  2DZO B;  4B3S M;  4IJF A;  1HT2 E;  4JI1 M;  4G4N A;  3HJ8 A;  4DV7 M;  2JA2 A;  4M9Z A;  3FTD A;  3GP1 A;  1QAQ A;  2D7H A;  3WHL A;  3C3D A;  4QOS A;  5KQD A;  1OKS A;  4X64 M;  3KXE C;  2X8A A;  1QQW A;  1Z5C A;  2ZAN A;  1Z5B A;  4KO8 A;  4X65 M;  2F4V M;  4YY3 M;  4X66 M;  2C5R A;  1F4I A;  2DAM A;  3DFZ A;  3LVV A;  4I8O A;  4NRV A;  3SC3 A;  3KOX E;  5C1B A;  3GLI E;  3SAS A;  4LJ8 A;  1Q39 A;  1J5E M;  1T3T A;  1G3I A;  1T6O A;  3L27 A;  4IBG A;  3U60 B;  2KRK A;  4RNA A;  1S3S A;  2K0B X;  4I81 A;  4L8R C;  4S12 A;  1IXS A;  4L15 A;  3SYL A;  4Z6Y A;  4FWH A;  1KYI A;  4FWG A;  2HL7 A;  4WP2 A;  4QNM A;  1R5L A;  2LVN C;  2LTU A;  1KFV A;  4LFC M;  1TH3 A;  3AOE C;  1QUS A;  3TL4 X;  4PDG A;  1G59 A;  3AOE A;  1N33 M;  3GPU A;  2WSE F;  1NY6 A;  2HCB A;  4LJ5 A;  5DNY A;  4MGH A;  4JI8 M;  3LQR A;  2VQE M;  1ZMW A;  1ZMV A;  4R71 A;  1QYR A;  4JYA M;  4IBJ A;  4G3O A;  2L2D A;  2L4E A;  3L28 A;  3L29 A;  1TH2 A;  4IJE A;  3U60 A;  4DR1 M;  1ZV1 A;  3GRV A;  4GKJ M;  1E94 E;  5FSW A;  3FYD A;  1I94 M;  1Z6T A;  2F5P A;  3B9P A;  2KNV A;  5ITX E;  1D2N A;  2H5X A;  4TUW A;  4Z8X A;  2RRU A;  3A98 B;  4D82 A;  1L1Z A;  2F5S A;  1V34 A;  2OO9 A;  2L09 A;  3I51 A;  4B7H A;  1K3X A;  2WSF F;  2LH0 A;  2BWE A;  2DZL A;  2LNH C;  1Q02 A;  2LXE A;  3GLF B;  1IN8 A;  3T1Y M;  3GQ4 A;  3KS4 A;  4LJ6 A;  3ILK A;  4JI2 M;  3K8Z A;  3PFI A;  3U6C A;  2ZBK B;  2R46 A;  2CP8 A;  2DAG A;  1NJF A;  1DO2 A;  3FUW A;  4CIZ A;  3TQS A;  4AQY M;  4GHL A;  1PJT A;  4MGK E;  1HJP A;  3KP0 E;  4I4L A;  4RF1 A;  2I7N A;  4HLQ A;  2KW0 A;  4R7G A; 
#chains in the Genus database with same CATH homology
 2DZN B;  3SFZ A;  4CIS A;  5DYG A;  2EA0 A;  4DR7 M;  3HU1 A;  3D8B A;  3THG A;  4QOZ C;  1W5T A;  2QEN A;  4GMQ A;  1L1T A;  1GLN A;  1Z59 A;  3KVW A;  4R3D A;  1HNZ M;  5ITU A;  3FTC A;  3R8F A;  2CEA A;  1HNW M;  3RGP A;  5F3W A;  4IBB A;  2KA6 B;  3JAM S;  4IBC A;  3VKG A;  3SMS A;  4L78 A;  4MGZ E;  2R65 A;  1QAO A;  1OJL A;  2V1U A;  2C9C A;  2HKJ A;  4W5W A;  4OU7 A;  3PNY A;  5FTL A;  3UGJ A;  3U6P A;  3Q8X A;  4LGM A;  4IBF A;  4D81 A;  4G4Q A;  4B3R M;  2XF3 A;  3SBJ A;  2J7N A;  2C98 A;  3E9S A;  4PD2 A;  3J80 S;  5E6J A;  3GLG B;  3KSX A;  2Y21 A;  1IXS B;  2XZU A;  2XLJ A;  5EP4 A;  3E4R A;  1SXJ D;  3K1J A;  3PVS A;  1R7R A;  1JQJ C;  2R4J A;  1GVN A;  5FTJ A;  5LMU M;  1PJI A;  2Z4S A;  1PM5 A;  2CV1 A;  3KP1 E;  4MH0 E;  1QZM A;  3U6Q A;  4NRW A;  4FCW A;  3W0L B;  3SAU A;  4IBE A;  2A5Y B;  3ZCB B;  2UUC M;  3KOZ E;  4KOD A;  3FKE A;  4LF7 M;  1XXH A;  4X62 M;  4PDI A;  4LF8 M;  3HKP A;  4MB7 A;  3GPP A;  2QBY B;  3W0F A;  4JI0 M;  4RF0 A;  3GLH A;  2NQ8 C;  1SXJ A;  2ZAO A;  3K92 A;  3LVW A;  3U6L A;  3GLG A;  1E9S A;  3GQ3 A;  5EXS A;  3TWK A;  2CHV A;  4NOO B;  4B7G A;  4DV2 M;  1G4A E;  3HHY A;  4LJ7 A;  2DWL A;  5EQT A;  4LG2 A;  4JN6 A;  3HWS A;  3HGI A;  2F5Q A;  3J81 S;  1J09 A;  2RGH A;  5FTK A;  2L7I A;  4KHP M;  2AHM A;  4B3T M;  3GLF A;  5DYI A;  2ZM6 M;  1YSY A;  1MX0 A;  4P16 A;  3I4Y A;  1G8P A;  4AKG A;  1TH4 A;  3JR5 A;  5KQ8 A;  1XMQ M;  4JI4 M;  1IXR C;  4OVZ B;  3AV0 A;  1GKI A;  2ZAM A;  4MGY E;  4DR3 M;  2J7O A;  2YR0 A;  4LJ4 A;  3U6E A;  2I7P A;  2QPA A;  2L6O A;  4K0K M;  5BR8 M;  4B3M M;  1IN4 A;  5FLX S;  1NJG A;  2Y20 A;  4G4R A;  2Z3X A;  3FYC A;  1LV7 A;  5ITX A;  4DV3 M;  4G6Z A;  3HHZ A;  1H6U A;  3MK6 A;  1R2Z A;  5ITY A;  2QBY A;  3J27 B;  3KW6 A;  5A2Q S;  1NY5 A;  1IY1 A;  1HQC A;  1FJG M;  1C1K A;  2Y0T A;  1DO0 A;  4IBK A;  5GKN A;  2CV2 A;  3CF0 A;  4GC5 A;  3JR4 A;  2R45 A;  4LY6 A;  2XZF A;  1FNN A;  2M5Z A;  5EXX A;  3M0E A;  1VDD A;  4BBA A;  3U61 A;  2XSZ D;  1UM8 A;  1XMO M;  4GHA A;  1E32 A;  1K3W A;  3AKZ A;  2C99 A;  4KLN A;  4JI7 M;  1HQY E;  4NXM M;  2BJW A;  3T15 A;  3CTW B;  3KOY E;  3HU3 A;  5EP2 A;  4MGI E;  2RGO A;  4AG5 A;  2FNA A;  3GRR A;  3C58 A;  1E9R A;  2LWX A;  2V1C A;  3VDP A;  4BB9 A;  4LJA A;  5FTM A;  3T38 A;  4LJ9 A;  2CFO A;  4IIW A;  1N32 M;  3QWL A;  4OVZ A;  4QHS A;  3IG8 A;  4GIT A;  1KSF X;  2C96 A;  3FTF A;  2QP9 X;  1HR0 M;  4OX9 M;  2UXC M;  1XC8 A;  2XEP A;  2VII A;  3KOW E;  2HHH M;  4M9S A;  3FUU A;  4AKI A;  2EUC A;  1Q3B A;  3EIH A;  3FD9 A;  3J2P B;  4L16 A;  2FOI C;  3EIE A;  4GC9 A;  5KPZ A;  3GPX A;  1HNX M;  1NVM A;  3SHG B;  2DWM A;  2KRU A;  3TPZ A;  1IN7 A;  2F5O A;  3VKH A;  1YE9 A;  4YHH M;  3GLI A;  1JR3 A;  3U6S A;  4AZF A;  5ITR A;  2QCU A;  4REZ A;  3GPY A;  3GO8 A;  2C9O A;  4GIP A;  1XHB A;  2QZ4 A;  1N34 M;  1IBL M;  3L26 A;  1N36 M;  5EXP A;  3BOS A;  3WHK A;  3ZC7 B;  1IY2 A;  2M60 A;  4XGI A;  4DUZ M;  3GRY A;  2R4E A;  4L4U A;  1QAN A;  4DR6 M;  1TDZ A;  1QAM A;  3HJQ A;  1SXJ B;  1ZAE A;  2ERC A;  1DGF A;  2YNM D;  3FUX A;  3GLI B;  1WXQ A;  2Y0Q A;  4JI6 M;  3U5Z A;  3J7A S;  4M0D A;  3TWL A;  4CGY B;  4D80 A;  4DR2 M;  4LGY A;  2UUA M;  1GL7 A;  1TDH A;  4DV5 M;  4ITQ A;  2XFT A;  2R62 A;  1NHW C;  4LRS A;  1GL6 A;  3H4M A;  1XNR M;  2DVW B;  1DGG A;  4GRI A;  1ZQ9 A;  5C18 A;  1IN6 A;  1NNJ A;  3SYK A;  3I4V A;  1HT1 E;  1MU5 A;  4B08 A;  3UMM A;  1IM2 A;  4FCT A;  3KDS E;  2DWN A;  4NSR A;  4DV4 M;  4ZPX A;  4CHT B;  3RFW A;  3U6M A;  1IQP A;  1DGH B;  3AFH A;  4GH9 A;  3U6D A;  5EJC A;  1XXH B;  4PT5 A;  5IRE B;  3DOA A;  2UXD M;  3PNV A;  1NHG C;  3ZH9 B;  1IXZ A;  2CUZ A;  3TE6 A;  3K2L A;  3SAT A;  4FW9 A;  2D7G A;  2FFJ A;  3DZD A;  2XH9 A;  1R2Y A;  3A46 A;  2KZU A;  3CF2 A;  3LQQ A;  4FWD A;  2G5G X;  2W82 A;  5FTN A;  2DWZ B;  4DR5 M;  3AJI B;  4JXJ A;  3GRU A;  3VDU A;  1IBM M;  1OFI A;  1OFH A;  1L2D A;  3VK7 A;  3R9X B;  5IZ7 D;  1SXJ C;  4AI6 A;  4PCZ A;  3QAU A;  3L2A A;  1EE8 A;  4MM3 B;  1N77 A;  1K82 A;  3T1H M;  2H1R A;  1IY0 A;  1XNQ M;  2KZS A;  5KO3 A;  2V6Z M;  2UUB M;  2YFQ A;  4IBD A;  5JI2 E;  4WUR A;  1X37 A;  3HHX A;  2BJV A;  4HL4 A;  4LCB A;  3KS8 A;  3OTO M;  2DHR A;  4FD2 A;  3VFD A;  2R18 A;  2F5N A;  2KXE A;  2OQ4 A;  4LFB M;  1J7K A;  2X49 A;  1TGU A;  2P5T A;  3DA1 A;  3MHV C;  4B7F A;  3U6O A;  2CHQ A;  4LZJ A;  3FUV A;  3VLF B;  5ITT A;  4LF5 M;  1I4W A;  2OPF A;  4G4O A;  3FUT A;  2XSZ A;  5EXT A;  2YQZ A;  8CAT A;  4I5S A;  1DGB A;  4FVM A;  2G8L A;  1NSF A;  3SAV A;  3IG5 A;  4QNR A;  1R6B X;  2L7H A;  4NXN M;  4M0W A;  2E5L M;  3GLH B;  5EP1 A;  2KEB A;  2XGN A;  1PJJ A;  4AW4 A;  3KFU G;  4LF4 M;  1Z5A A;  2X4A A;  3D8L A;  4JV5 M;  3SMP A;  1XWI A;  1ORY B;  1IN5 A;  3U61 B;  3VK8 A;  1L2C A;  5KPT A;  2Z4R A;  4IBI A;  3M6A A;  4DR4 M;  1QVR A;  4FCV A;  2O5R A;  4DV1 M;  3SAR A;  3UK6 A;  3HU2 A;  2EO2 A;  3HHW A;  5LMN M;  1DGH A;  3A45 A;  2FE8 A;  2CV0 A;  3AL0 C;  1NNU C;  3CF6 E;  2CHG A;  1N75 A;  4M9X A;  3KSJ A;  3NWL A;  4EIW A;  3FTE A;  2DXI A;  1N78 A;  7CAT A;  3UZU A;  2K47 A;  3J7B A;  3M7G A;  1IBK M;  1L8Q A;  3TWM A;  1JR3 D;  3AOG A;  4AG6 A;  4DV0 M;  5IT9 S;  5E26 A;  3A42 A;  4LF9 M;  5H37 D;  4A3V B;  3NBI A;  1YUB A;  3MJ5 A;  4NL4 H;  2VQF M;  4LF6 M;  2CE7 A;  1G41 A;  1SXJ E;  2XFS A;  5KPR A;  3U5Z B;  4AKH A;  5BPV A;  2D7E A;  3GQ5 A;  4BLC A;  1Q3C A;  3RGS A;  4JI5 M;  2RKO A;  4JI3 M;  5EP3 A;  4NSO B;  4WW0 A;  3PXG A;  3SAW A;  3HJS A;  4DUY M;  4OW0 A;  2BNK A;  3SHF A;  2UU9 M;  5ITQ A;  1W5S A;  2Q2E B;  4II7 A;  1L2B A;  4LFA M;  3UJN A;  3RE8 A;  2Z7J A;  5IWA M;  2UXB M;  4GKK M;  4QHT A;  4LRT A;  5JI3 E;  4LZZ A;  4XBO A;  3L25 A;  3LMM A;  4DV6 M;  2DZO B;  4B3S M;  4IJF A;  1HT2 E;  4JI1 M;  4G4N A;  3HJ8 A;  4DV7 M;  2JA2 A;  4M9Z A;  3FTD A;  3GP1 A;  1QAQ A;  2D7H A;  3WHL A;  4QOS A;  5KQD A;  4X64 M;  3KXE C;  2X8A A;  1QQW A;  1Z5C A;  2ZAN A;  1Z5B A;  4KO8 A;  4X65 M;  2F4V M;  4YY3 M;  4X66 M;  2C5R A;  3LVV A;  3DFZ A;  4I8O A;  4NRV A;  3SC3 A;  5C1B A;  3KOX E;  3SAS A;  4LJ8 A;  1Q39 A;  1J5E M;  1T3T A;  1G3I A;  3L27 A;  4IBG A;  3U60 B;  2KRK A;  4RNA A;  1S3S A;  4I81 A;  4L8R C;  4S12 A;  4L15 A;  3SYL A;  4Z6Y A;  4FWH A;  1KYI A;  4FWG A;  2HL7 A;  4QNM A;  1KFV A;  4LFC M;  1TH3 A;  3AOE C;  3TL4 X;  4PDG A;  1G59 A;  3AOE A;  1N33 M;  3GPU A;  1NY6 A;  2HCB A;  4LJ5 A;  5DNY A;  4MGH A;  4JI8 M;  3LQR A;  2VQE M;  4JYA M;  1QYR A;  4IBJ A;  3L28 A;  3L29 A;  1TH2 A;  4IJE A;  3U60 A;  4DR1 M;  3GRV A;  4GKJ M;  1E94 E;  5FSW A;  3FYD A;  1I94 M;  1Z6T A;  2F5P A;  3B9P A;  5ITX E;  1D2N A;  4TUW A;  4Z8X A;  3A98 B;  4D82 A;  1L1Z A;  2F5S A;  2L09 A;  3I51 A;  4B7H A;  1K3X A;  2LH0 A;  3GLF B;  2LNH C;  2LXE A;  3T1Y M;  1IN8 A;  3GQ4 A;  3KS4 A;  4LJ6 A;  3ILK A;  4JI2 M;  3K8Z A;  3PFI A;  3U6C A;  2ZBK B;  2R46 A;  4AQY M;  1NJF A;  3FUW A;  1DO2 A;  3TQS A;  4GHL A;  4MGK E;  4I4L A;  3KP0 E;  4RF1 A;  2I7N A;  4HLQ A;  2KW0 A;  4R7G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...