4JI4D

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
208
structure length
208
Chain Sequence
GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRPSDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRLDNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQLVIEFYSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 56
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00163 Ribosomal_S4 Ribosomal protein S4/S9 N-terminal domain
D PF01479 S4 S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1050.10 Mainly Alpha Orthogonal Bundle Ribosomal Protein S4 Delta 41; Chain A, domain 1 Ribosomal Protein S4 Delta 41; Chain A, domain 1 4ji4D01
3.10.290.10 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A RNA-binding S4 domain 4ji4D02
4DV2D 1JH3A 2F4VD 2JANA 4B3SD 4B3TD 4DR5D 1C05A 4GKKD 2UXDD 4X66D 1H3EA 3T1HD 1HR0D 4DUZD 2E5LD 3KBGA 2UU9D 4DV0D 4LGTA 4DV1D 4LF7D 1J5ED 2UUCD 4JI6D 4LF6D 1N33D 4X65D 4DV3D 1XMOD 2ZM6D 4JV5D 4GKJD 3OTOD 1HNXD 4JI5D 1KSLA 4NXND 4DV7D 4B3RD 1DM9A 2UXCD 4LFAD 1H3FA 4X64D 4JI4D 1IBLD 4LFBD 4OX9D 2KTLA 4DUYD 1P9KA 3T1YD 4KHPD 4DV5D 4DR1D 5LMND 1N36D 1XNQD 1HNWD 3DH3A 1C06A 1FJGD 4DV4D 4JI0D 4JI2D 4LF8D 1KSVA 4LF4D 4JI1D 1XMQD 2VQFD 4DR4D 1IBMD 4YHHD 1N34D 2UUBD 4NXMD 2VQED 2UXBD 4YY3D 5LMUD 3HP7A 1N32D 5IWAD 5BR8D 4DR6D 4DR7D 1VIOA 2UUAD 4OUDA 4DR2D 4JYAD 1FKAD 4JI7D 4LFCD 1I94D 1IBKD 4K0KD 2HHHD 4B3MD 4JI3D 1KSKA 4X62D 1XNRD 4LF9D 4AQYD 2ISTA 4JI8D 4LF5D 2K6PA 4DV6D 1HNZD 4DR3D
chains in the Genus database with same CATH superfamily
4DV2D 1JH3A 2F4VD 2JANA 4B3SD 4B3TD 4DR5D 5FLXE 1Y8RB 1C05A 3J81E 4GKKD 2UXDD 4X66D 1H3EA 3T1HD 5A2QE 1HR0D 1Y8XB 4DUZD 2E5LD 3KBGA 2UU9D 4II2A 3KYDB 4DV0D 4LGTA 4DV1D 4LF7D 1Y8QB 1J5ED 2UUCD 4JI6D 4LF6D 3KYCB 1N33D 4X65D 4DV3D 1XMOD 2ZM6D 4JV5D 4GKJD 3JAME 3OTOD 1HNXD 4JI5D 1KSLA 4NXND 4DV7D 4B3RD 1DM9A 2UXCD 4LFAD 1H3FA 4X64D 4JI4D 1IBLD 4LFBD 3FN1A 4OX9D 2KTLA 4DUYD 1P9KA 3T1YD 5LL6S 4KHPD 4DV5D 2LQ7A 5IT9E 4DR1D 5LMND 1N36D 1XNQD 1HNWD 3DH3A 1C06A 1FJGD 4DV4D 4JI0D 2ZTBA 4JI2D 4LF8D 1KSVA 3J7AF 4LF4D 4NNJA 4JI1D 1XMQD 2VQFD 4DR4D 2NVUB 1IBMD 4YHHD 5FQ2B 1N34D 2UUBD 4NXMD 2VQED 5KNLA 4II3A 2UXBD 4YY3D 5LMUD 3HP7A 1N32D 3ONHA 5IWAD 5BR8D 4DR6D 4DR7D 1VIOA 2UUAD 4OUDA 4DR2D 4JYAD 1FKAD 4JI7D 4LFCD 1I94D 1IBKD 2I1SA 4K0KD 2HHHD 4B3MD 4JI3D 1KSKA 4X62D 1XNRD 4LF9D 4AQYD 3J80E 3CMMA 2ISTA 4JI8D 3ONGA 4LF5D 2K6PA 2L3NA 4DV6D 4W5VB 1HNZD 4DR3D
chains in the Genus database with same CATH topology
4DV2D 1JH3A 2F4VD 2JANA 4B3SD 4B3TD 4DR5D 1C05A 4GKKD 2UXDD 4X66D 1H3EA 3T1HD 1HR0D 4DUZD 2E5LD 3KBGA 2UU9D 4DV0D 4LGTA 4DV1D 4LF7D 1J5ED 2UUCD 4JI6D 4LF6D 1N33D 4X65D 4DV3D 1XMOD 2ZM6D 4JV5D 4GKJD 3OTOD 1HNXD 4JI5D 1KSLA 4NXND 4DV7D 4B3RD 1DM9A 2UXCD 4LFAD 1H3FA 4X64D 4JI4D 1IBLD 4LFBD 4OX9D 2KTLA 4DUYD 1P9KA 3T1YD 4KHPD 4DV5D 4DR1D 5LMND 1N36D 1XNQD 1HNWD 3DH3A 1C06A 1FJGD 4DV4D 4JI0D 4JI2D 4LF8D 1KSVA 4LF4D 4JI1D 1XMQD 2VQFD 4DR4D 1IBMD 4YHHD 1N34D 2UUBD 4NXMD 2VQED 2UXBD 4YY3D 5LMUD 3HP7A 1N32D 5IWAD 5BR8D 4DR6D 4DR7D 1VIOA 2UUAD 4OUDA 4DR2D 4JYAD 1FKAD 4JI7D 4LFCD 1I94D 1IBKD 4K0KD 2HHHD 4B3MD 4JI3D 1KSKA 4X62D 1XNRD 4LF9D 4AQYD 2ISTA 4JI8D 4LF5D 2K6PA 2L3NA 4DV6D 1HNZD 4DR3D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV2 D;  1JH3 A;  2F4V D;  2JAN A;  4B3S D;  4B3T D;  4DR5 D;  1C05 A;  4GKK D;  2UXD D;  4X66 D;  1H3E A;  3T1H D;  1HR0 D;  4DUZ D;  2E5L D;  3KBG A;  2UU9 D;  4DV0 D;  4LGT A;  4DV1 D;  4LF7 D;  1J5E D;  2UUC D;  4JI6 D;  4LF6 D;  1N33 D;  4X65 D;  4DV3 D;  1XMO D;  2ZM6 D;  4JV5 D;  4GKJ D;  3OTO D;  1HNX D;  4JI5 D;  1KSL A;  4NXN D;  4DV7 D;  4B3R D;  1DM9 A;  2UXC D;  4LFA D;  1H3F A;  4X64 D;  4JI4 D;  1IBL D;  4LFB D;  4OX9 D;  2KTL A;  4DUY D;  1P9K A;  3T1Y D;  4KHP D;  4DV5 D;  4DR1 D;  5LMN D;  1N36 D;  1XNQ D;  1HNW D;  3DH3 A;  1C06 A;  1FJG D;  4DV4 D;  4JI0 D;  4JI2 D;  4LF8 D;  1KSV A;  4LF4 D;  4JI1 D;  1XMQ D;  2VQF D;  4DR4 D;  1IBM D;  4YHH D;  1N34 D;  2UUB D;  4NXM D;  2VQE D;  2UXB D;  4YY3 D;  5LMU D;  3HP7 A;  1N32 D;  5IWA D;  5BR8 D;  4DR6 D;  4DR7 D;  1VIO A;  2UUA D;  4OUD A;  4DR2 D;  4JYA D;  1FKA D;  4JI7 D;  4LFC D;  1I94 D;  1IBK D;  4K0K D;  2HHH D;  4B3M D;  4JI3 D;  1KSK A;  4X62 D;  1XNR D;  4LF9 D;  4AQY D;  2IST A;  4JI8 D;  4LF5 D;  2K6P A;  4DV6 D;  1HNZ D;  4DR3 D; 
#chains in the Genus database with same CATH topology
 4DV2 D;  1JH3 A;  2F4V D;  2JAN A;  4B3S D;  4B3T D;  4DR5 D;  5FLX E;  1Y8R B;  1C05 A;  3J81 E;  4GKK D;  2UXD D;  4X66 D;  1H3E A;  3T1H D;  5A2Q E;  1HR0 D;  1Y8X B;  4DUZ D;  2E5L D;  3KBG A;  2UU9 D;  4II2 A;  3KYD B;  4DV0 D;  4LGT A;  4DV1 D;  4LF7 D;  1Y8Q B;  1J5E D;  2UUC D;  4JI6 D;  4LF6 D;  3KYC B;  1N33 D;  4X65 D;  4DV3 D;  1XMO D;  2ZM6 D;  4JV5 D;  4GKJ D;  3JAM E;  3OTO D;  1HNX D;  4JI5 D;  1KSL A;  4NXN D;  4DV7 D;  4B3R D;  1DM9 A;  2UXC D;  4LFA D;  1H3F A;  4X64 D;  4JI4 D;  1IBL D;  4LFB D;  3FN1 A;  4OX9 D;  2KTL A;  4DUY D;  1P9K A;  3T1Y D;  5LL6 S;  4KHP D;  4DV5 D;  2LQ7 A;  5IT9 E;  4DR1 D;  5LMN D;  1N36 D;  1XNQ D;  1HNW D;  3DH3 A;  1C06 A;  1FJG D;  4DV4 D;  4JI0 D;  2ZTB A;  4JI2 D;  4LF8 D;  1KSV A;  3J7A F;  4LF4 D;  4NNJ A;  4JI1 D;  1XMQ D;  2VQF D;  4DR4 D;  2NVU B;  1IBM D;  4YHH D;  5FQ2 B;  1N34 D;  2UUB D;  4NXM D;  2VQE D;  5KNL A;  4II3 A;  2UXB D;  4YY3 D;  5LMU D;  3HP7 A;  1N32 D;  3ONH A;  5IWA D;  5BR8 D;  4DR6 D;  4DR7 D;  1VIO A;  2UUA D;  4OUD A;  4DR2 D;  4JYA D;  1FKA D;  4JI7 D;  4LFC D;  1I94 D;  1IBK D;  2I1S A;  4K0K D;  2HHH D;  4B3M D;  4JI3 D;  1KSK A;  4X62 D;  1XNR D;  4LF9 D;  4AQY D;  3J80 E;  3CMM A;  2IST A;  4JI8 D;  3ONG A;  4LF5 D;  2K6P A;  2L3N A;  4DV6 D;  4W5V B;  1HNZ D;  4DR3 D; 
#chains in the Genus database with same CATH homology
 4DV2 D;  1JH3 A;  2F4V D;  2JAN A;  4B3S D;  4B3T D;  4DR5 D;  1C05 A;  4GKK D;  2UXD D;  4X66 D;  1H3E A;  3T1H D;  1HR0 D;  4DUZ D;  2E5L D;  3KBG A;  2UU9 D;  4DV0 D;  4LGT A;  4DV1 D;  4LF7 D;  1J5E D;  2UUC D;  4JI6 D;  4LF6 D;  1N33 D;  4X65 D;  4DV3 D;  1XMO D;  2ZM6 D;  4JV5 D;  4GKJ D;  3OTO D;  1HNX D;  4JI5 D;  1KSL A;  4NXN D;  4DV7 D;  4B3R D;  1DM9 A;  2UXC D;  4LFA D;  1H3F A;  4X64 D;  4JI4 D;  1IBL D;  4LFB D;  4OX9 D;  2KTL A;  4DUY D;  1P9K A;  3T1Y D;  4KHP D;  4DV5 D;  4DR1 D;  5LMN D;  1N36 D;  1XNQ D;  1HNW D;  3DH3 A;  1C06 A;  1FJG D;  4DV4 D;  4JI0 D;  4JI2 D;  4LF8 D;  1KSV A;  4LF4 D;  4JI1 D;  1XMQ D;  2VQF D;  4DR4 D;  1IBM D;  4YHH D;  1N34 D;  2UUB D;  4NXM D;  2VQE D;  2UXB D;  4YY3 D;  5LMU D;  3HP7 A;  1N32 D;  5IWA D;  5BR8 D;  4DR6 D;  4DR7 D;  1VIO A;  2UUA D;  4OUD A;  4DR2 D;  4JYA D;  1FKA D;  4JI7 D;  4LFC D;  1I94 D;  1IBK D;  4K0K D;  2HHH D;  4B3M D;  4JI3 D;  1KSK A;  4X62 D;  1XNR D;  4LF9 D;  4AQY D;  2IST A;  4JI8 D;  4LF5 D;  2K6P A;  2L3N A;  4DV6 D;  1HNZ D;  4DR3 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...