4JI4F

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 22
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ji4F00
1HR0F 4DR6F 4LF9F 4JI5F 4LF8F 1RISA 4YY3F 2E5LF 1XMOF 1N34F 3T1HF 3R3TA 3OTOF 4LF5F 4YHHF 1G7CB 4DR1F 1CQMA 1IBLF 1IJFB 1FJGF 4DV1F 1GH8A 1HNZF 5AJ3F 4JYAF 4K0KF 4DV2F 4X65F 4LFAF 3ZZPA 4DV3F 3T1YF 1I94F 2ZM6F 1J5EF 2UXCF 2VQFF 4JI7F 1B64A 4DR5F 4JI2F 2UUCF 4JI8F 2YY3A 1F60B 2KJWA 4NXNF 4JI0F 2VQEF 4X64F 1XMQF 1N32F 1N33F 4DR4F 4GKKF 4LFCF 2BVZA 1IBMF 4LF7F 1VMBA 1HNXF 1XNRF 4DV6F 2J5AA 2F4VF 4JI6F 2KJVA 4X66F 4DV5F 4B3RF 1XNQF 4OX9F 1CQNA 4DV0F 4DUYF 4LF4F 1FKAF 1IJEB 4DUZF 4AQYF 2RJZA 1IBKF 4JI4F 4LFBF 2UUBF 4DR2F 4JI3F 4DR7F 4DR3F 2B7BB 1G1XA 5LMNF 4GKJF 4JI1F 4KHPF 4B3TF 4DV4F 4NXMF 5LMUF 2HHHF 1QJHA 5BR8F 2UXDF 1N36F 4DV7F 5IWAF 1HNWF 4B3MF 2BXJA 2UUAF 1LOUA 4LF6F 2UU9F 4B3SF 2UXBF 4JV5F 2B7CB 4X62F
chains in the Genus database with same CATH superfamily
3KG1A 2B9EA 2I5JB 4WFAQ 3MUTP 2YNGB 4LF5F 1RAOA 1GNKA 1U25A 5IT0A 3DLHA 1BHNA 4D3GA 4NLOA 4F0MA 2E9ZA 4IFVB 1FDBA 2OGUA 1VQ7S 3HK2A 3VCDA 2CPZA 3HHDA 4G1QB 3VGSA 1B3TA 1FRHA 2PSZA 5CYQA 1HNIB 4DV4J 2XGPA 1U6ZA 3ZTOA 1Q8IA 1TUVA 1P9YA 3FRYA 2NZCA 3G71S 4CO4A 3ILIA 2CQDA 3UQSA 2G2YA 2HWTA 4FPRA 4NMLA 1S59A 5AJ3J 7AT1B 1P1TA 1S99A 4NLUA 4OX9F 3EZUA 1RU2A 3R6LB 3HD2A 1VQ4S 3TQEA 1U49A 1RP5A 4MK8A 5KFSA 5JVGQ 1NKCA 4UY85 5D3GA 4DL2A 1X31C 1FHTA 3U7JA 2PI4A 3HP6A 2MY8A 2ZZMA 1URRA 2R2UA 1HMVB 3EVOA 5KFGA 1MSWD 4D3HA 3NNHA 2BJDA 2X1BA 1VISA 2UUTA 1SKWA 1M1GA 1FWPA 2YPZA 2FZCB 1JJHA 2JZ5A 3DN9A 5T7LA 1SH0A 1SVDA 5EUHA 4ECZA 2OPSB 5A8WA 3M30A 1HQUB 3H59A 1Y7PA 3AY0A 4NYZA 1JB0C 2ZM6F 4K4SA 3LANA 4KYZA 4OZ0A 2M3DA 2FDNA 2RD5C 2B6AA 1EJ7L 3OFFA 3BDEA 2W7PA 2RQKA 1J2VA 3EE3A 3LH2S 4QW8A 2D1CA 3TNVA 3QFHA 4HT7A 4NA1A 2RUGA 1U1QA 5AE1A 2XS7A 1H7XA 5J2MB 5IV3A 5A0YA 3HSZA 4IDKA 4JI4F 2VONA 2H5JB 3N6LA 5H9EJ 3PHTA 1JJ4A 4N8NA 4ZVOB 4X4RA 3NGDA 1FNOA 2ZDOA 2DXEA 1CBKA 3I0RA 3L95X 1KFSA 1V9OA 5KFLA 2X3GA 1J27A 3AAWB 4G65A 2XHCA 4CLZA 2B4PA 1RCOB 4PWUA 3H4DA 1TELA 4OX6A 4RNFA 3EGVA 5E2QA 4DX6A 2XULA 1B0PA 1KC8T 3S1TA 3PX6A 3N4WA 2JHEA 2VODA 1RHUB 1VK3A 2W01A 4LF6J 1AT1B 2MLYA 3CXCR 4C3LA 2YWGA 2BKNA 3EPIA 3D66A 2MZTA 3L9ZA 4LIRA 2IC3B 1FO1A 2C22A 5E3QA 2VDIA 2EI5A 4HH1A 4MYTA 4Z7YA 2VPWB 4J9PA 5L9NA 2NLWA 4HHJA 4MJKA 3IN5A 1T3OA 3FSYA 3M6VA 4OX7A 2BRKA 1TKTA 4DV4F 2CQ3A 4J9NA 1SKSA 4LF7J 1HNXJ 3EXYA 2HFSA 1R8AA 1AXQA 3RB4A 2XMUA 1AYEA 4RUBA 3K17A 2H54B 1B70B 3W2WB 1WF0A 4LF8F 2OSRA 2RF2B 4PXDA 1S10A 3I4PA 1LEOA 2HVEA 1RXOB 2IM0A 1NPRA 4FKYA 4LRCA 5E0OA 1X9SA 1U1KA 3HFZB 2ZH1A 1MW7A 4BHQA 1LXNA 1N36J 2ZJQQ 1WF1A 1Z2LA 3PO5A 4CZCA 4J9SA 3ENQA 3OL6A 1WORA 2B5JB 2B9YA 1WOSA 2NPFA 3K5MA 3FZ2A 2IA0A 2MKIA 2Q1LA 3K89A 2EPIA 3TAPA 1TL7B 1VBKA 4U95A 3P49B 1XIQA 1BD6A 1HBOA 2V69A 2PDAA 3DOMB 2E1PA 4TNOA 4FNHA 3IBFB 2YX1A 1RKIA 3MMCB 1JJCB 3IBWA 4ENOA 3DRRB 4KH0B 3IG1A 5K8OA 5ETMA 2CPIA 2A2CA 4TVAB 3CDEA 4DCOB 2XGQA 2ZZNA 2FVRA 4NRUA 3C2PA 4IOAQ 1QTNB 2HGMA 2HURA 2ZH6A 1RTIB 1REVB 3M8PB 3MGJA 4L76A 5AXNA 4J7CA 1PGZA 3M8SA 1IQTA 1Y0HA 2BZ2A 4I67A 4F3OA 4DPOA 2NQPA 4NL5A 4Y0FA 4NASA 1IBKJ 2F4FA 4I2PB 2E7VA 1LK7A 2G0IA 2NXUA 4NOHA 3PRVA 1Q79A 5BYSA 2YNFB 2E5GA 3BQ0A 3OTCA 2F4VF 1P1LA 3UW1A 4ZP6A 1DFDA 1CQNA 2DGVA 3CD7A 4KV8B 2N4DA 1ZBTA 3AOCA 5LMNF 4HR2A 2VU5A 5D0HA 1MMDA 5J1EB 2EFNA 1KVKA 1EAYC 5FD1A 2HGNA 1ITPA 1XK8A 2DGTA 3KUGA 2IM2A 2XMKA 4K2XA 4CO0A 2W8KA 3N9UC 1PJ6A 2DVIA 4M5NA 2OEJA 1E6VA 4DX8H 2WTFA 4Y2IA 4DCPB 3WX4A 2VASA 2ZUAA 2X1AA 5CD4H 3BYPA 5DZ7A 1ACMB 2IJFA 1ZM3A 4KR0B 4X4NA 3V2UC 2ATLA 2AKWB 2H4WB 4ALZA 3SSQA 1Q5VA 3CMQA 4LSNB 3QGPA 5A8RA 1YBAA 4FF4A 3TAQA 5A8WB 1D3WA 4DQSA 1VJQA 4TU9A 1U2RA 3OQ2A 4FBUA 3QJJA 1F2GA 1NHVA 2EG1A 2GJFA 3EGWB 5IQQA 4UOHA 2B9XA 3M6XA 2HVHA 1UVLA 5A6WA 2QMXA 2FD2A 2J9CA 5CXTA 2F8MA 4H4KC 4QW9A 3KLEA 1U45A 3AD9C 1X5PA 3KNGA 3G86A 3NOGA 3PR5B 1BQNA 3R1LA 3GG1A 3VAFA 1JNZB 3GIRA 4PG6A 2IVYA 3CJ3A 1N56A 4FNIA 2LQ9A 4AXIA 4MAKA 4FS1A 1U1RA 4ZPBA 1S1WB 2E44A 3PRBA 3ENAA 4DUTA 4IOCQ 3WBZA 4QCLA 4CLUA 5CZXA 1RT3B 5K20B 1LXJA 1S72S 1DTTA 2W2PP 4USIA 8AT1B 3AD8C 1IBKF 3ISNC 2UVVA 4V19X 1VC0A 4HI1A 1X5SA 1NB7A 5CCMA 2CRLA 2ACYA 2V2QA 3W8PA 3CCJS 1CJVA 2AJQA 2HNYA 3MM5B 5KFHA 1IKWA 5DLFA 1SJ3P 5JXSA 5KG3A 4NA2A 4ILLA 4ED8A 2RQMA 4DR7J 4F4YA 1ZZNA 2ZHBA 3B4MA 3HHNB 2Z56B 2GO8A 1HW8A 2W2QP 1WSVA 3CC2S 3ZZUA 2K8GA 1F1BB 3EICA 2KN4A 1X4EA 4X2BA 4HACA 3MWBA 2QA1A 6FDRA 1D8YA 3V6HA 4LMZA 4WXOA 1Q1KA 3OLAA 5A6PA 2V8VA 2GX8A 2VF3A 4IR1A 5K5MA 1FTCA 1NHKL 2X7IA 1FX4A 2GJ2A 1FK9A 3T6BA 2A2DA 5B0EA 1GK8A 3HSDA 2IPOB 5HLFA 3NAIA 1NAQA 3QIPB 4MTPA 1XNRJ 1NPPA 2D9OA 1DRZA 3PEHA 3LP0B 4JI6J 1IN0A 5KFBA 3MR5A 3WQPA 1KS2A 3S7RA 1A6LA 2HLUA 5F8IA 1X5OA 4CWBA 1HWLA 3JTOA 4Y65A 5LMUJ 2M8DB 3T1YF 1VR6A 2IYIA 2DNKA 3MAAA 1UTAA 2HKEA 4IH7A 3IS9A 1FESA 3SIPB 4RW8B 2COLA 1FNXH 1NXIA 3VZIA 5GADI 1BWVA 3OL8A 1X9MA 4NYPA 3HT0A 1T05A 2ZBQA 1HHSA 3CCMS 3B54A 1JK9B 4OYBA 3ZTSA 1R6VA 3HO1A 3CE8A 3Q23A 2BDPA 1GMVA 5KT2A 3GSIA 4F3QA 3ILJA 4P52A 3HHKA 3HLUA 2QLJB 5F3TA 1NJIT 1Q16B 1ZYQA 1U1NA 3PJ9A 1VBYA 4LF9F 2OHDA 3CF5Q 1XN9A 4NLDA 1S6OA 3CJKA 3TZWA 2OTLS 2FVCA 2J0XA 4U8VA 3CULA 1H7WA 4TXSA 1DLOB 1PCAA 4A8WA 4NLVA 1QE1A 4KIAA 5ETNA 3ZNUA 4KGKA 3CCES 3EXCX 1XMOJ 2L41A 1P9QC 2HHQA 3PACA 3ZTQA 4NLPA 5B08A 4C7QA 1WJ9A 3TJAA 1E6YB 1GXUA 3W5ZA 5AT1B 1V3SA 1H0HB 1IKYA 4ECTA 3EVMA 3FEYB 5DRKA 3R5AA 2HQFA 2RRBA 3DCAA 2MZRA 3VQTA 4B9SA 4NZ0A 2FUG9 2CPEA 3TANA 3W9JA 1SQEA 3QIDA 2RT3A 2HRYA 3CJ8A 2NREA 2ROPA 3DFEA 1OWXA 3SCJE 2XNRA 1YJWS 2WOMA 2HRTA 3MTKA 5A8RB 3N01A 1RAAB 1JLQA 4EBEA 1YVFA 3G2XA 4C8YA 5C5JA 1D0EA 1RB0A 5LJ5Y 4K59A 5DG9A 2HVZA 1K0VA 1TK8A 2XLJA 4OI0A 1NH8A 4S0MA 3SCLE 2GQ2A 3GJQB 4B9MA 2MKYA 3IAM9 1TFWA 4K4TA 2CJYB 3AQOA 3PYGA 3F56A 3BV8A 2NUUG 1WEZA 4H4MA 3CB4A 2KVQE 3R5CA 4UW2A 4X4UA 1ZM2A 2MB0B 3MUMP 3AOAA 4ZVPB 4ZCKA 3IWXA 4P73A 3NEKA 3EDRB 3DRYA 4YR3A 1BQNB 2HHXA 2VFRA 3MFHA 5C42A 1PAEX 2VHGA 4USVA 2YH1A 1BLUA 4URGA 4DR3F 5K8PA 3TAMB 1TK0A 1QY7A 2EC0A 1EX8A 2RB7A 1VDHA 4WJBA 3H5UA 2WW8A 2XI3A 4ZVRB 2NXNA 2ZH8A 2DGXA 1VK8A 3DHWC 4F04B 1OYEA 2OPPA 4OIXA 2Q6CA 5E5NA 1MU2B 2CG4A 2LP4A 5F8JA 1U48A 1JLAA 4KH1B 3MOJB 3GILA 3UCUP 1D9FA 2DR5A 1S9FA 1UZHA 2DRBA 1F9FA 2HNYB 2VOPA 3VQSA 2MJUA 4CLWA 4F3MA 1VQ8S 2HZCA 1FRXA 1IKWB 2N3OA 2C2RA 4TYBA 4RW9A 4M1KA 5B09A 3GJSB 3DLEA 3T9ZA 4G1IA 4L75A 2B7BB 3D2WA 2BKOA 1V6HA 2CVIA 5DQGA 2OD6A 1VRUA 2XY6A 4PG7A 1DHMA 1R0CB 3CD0A 3R7SB 3SEOA 1L3KA 3DU6A 1OJ4A 4MK9A 2OH2A 1TTHB 4UQTA 2W7AA 3I0SA 3ONQA 2ZHOA 4LBHA 4J9MA 2XS5A 1VHIA 2Y1JA 1FK9B 2AJFE 2ASJA 3JSBA 3W9HA 1KTQA 5GAEI 2FHJD 3OXLA 1OY9A 2B51A 5ETLA 2Z30B 3R2CJ 3BREA 2Y1LB 2IAJA 5D4PA 3U1MA 4UUWA 1CULA 2IM1A 2VG6A 2CIMA 2HIQA 5HVFA 4LFCF 2FPHX 2JL9A 3J7AN 1XC9A 2J6UA 4C4WA 2PEBA 4LT6A 2B56A 2HYIB 3DOLB 3GU0A 4NLXA 1CLFA 2BE2A 4C8NA 1HWIA 4ECVA 4RW6A 2W7OA 1PYTA 2HMIA 4KGVB 5KFUA 2RE1A 3AJDA 4EEYA 2EWHA 1RHJB 1ZAVA 3MOZA 1UJ6A 3CDWA 5HP1A 2BANA 1OMSA 3UO0A 2O01C 4ZKAA 2BJ8A 3IRXA 4ZA1A 1S9GA 2LKZA 3R5GA 1WELA 3ZC4A 4CNZA 1T05B 3LWMA 4NA3A 1NK9A 4KKOA 2WSCC 3W2VA 1BQMB 1LW2A 2CJBA 5KG2A 4CH0S 1H2VZ 4J9VA 3BGOP 2FGCA 2DR9A 1B7YB 1VQMS 4ED3A 1N88A 1Y3JA 1L3TA 3C6UB 2DO0A 1QAJA 1UJ4A 4RZRA 2N4CA 4ICLA 3AOBA 2D3O1 2OEMA 2ZZTA 3VGUA 4OZJA 2QYGA 2IYGA 5HJYA 4Q2LA 3LF0A 2BYCA 3O44A 3CJKB 3RW7A 4RUAA 4X66F 4DV5F 1OIAA 3CC4S 1XEZA 3R7NB 3G4SS 1FKOA 4OI4A 3PY8A 3MPYA 4I64A 3JTPA 5J2PA 1TK5A 4KC5A 1KSPA 1HQEB 4FYWB 2KM8C 2PEHA 1QE1B 2XZDB 2ZKUA 5GADU 1AFJA 4ZIWA 2WBMA 3FMBA 5J2NB 1YITS 4UT4A 1ZTTA 3QWPA 5F8NA 3ZZ0A 3B6BA 1JLGA 2BQ3A 4WP9A 1IKYB 5HMYA 5MLCV 2QA4G 3A8KA 3R3TA 4R0EA 1FDDA 3KLVA 4P75A 3AH6A 1RT7A 2NXJA 3DLBA 5EX0A 1TU0B 4HI2A 3Q24A 2HPUA 2WONA 3QBCA 3Q22A 3BR8A 3IR6B 3OHAA 3VHQA 1S1VB 1X9WA 2WOMB 3ISZA 2HS4A 2K1RB 1OS5A 4CLPA 2ERRA 1RWXB 2KXHA 2WVEA 4A8XA 2MEWA 2H5EA 3K7RA 1FT8A 5KFVA 2GIQA 1H6KX 3X3UA 2W2OP 5J2QA 1NDCA 5CCLA 2RJZA 1NDPA 3CPWR 3FBFA 2ZH2A 3RTVA 2RS2A 3D1OA 5DG7A 2LXUA 1R27B 2EBGA 3M4XA 2J8SA 4CTAA 3V4IB 2XEXA 2CQIA 1I3OB 2KKHA 3NAHA 2D3OR 2UXBF 3AA9A 3OL7A 4I69A 1X8DA 2UVRA 4JBCA 2NR0A 3MXHP 3PYEA 2F3JA 2LECA 3FCHA 5LSRA 2GCFA 1SXLA 4C8KA 4PXEA 3V6DA 5C42B 2UUBJ 4U8YA 3LGHA 1RAEB 4RUHA 1WC3A 3HVTA 2Z2YB 1YDLA 1GMWD 1D9DA 3WIUA 4ES3A 4NCGA 1VIXA 5L8RC 3V81A 4OYZA 3OTOJ 3PKMA 4WE1A 2MQQA 3SDEA 3DGVA 2OPQA 4WP3A 2DIUA 1HW9A 1TUGB 3OFHA 2CQ1A 5AXMA 1IWGA 1JJ2R 1WTBA 1DJ0A 3Q8PB 1QLNA 1WSRA 5F9NA 1MWQA 1U26A 2ZNZA 1WHXA 3M2UB 3BGRA 3PHEA 2FJWA 1Q4RA 3PXGa 3QLHA 5IC4B 5B0BA 3RB3A 4LR7A 1U0SA 4MKVA 1X4GA 4B3OA 2YKPA 2KYXA 3FFIB 4ILRA 3WC0A 2Y0SD 1NDKA 3CD6S 4QWBA 3G6XA 3KNAA 4MIWA 3HD1A 2W9CA 4PR6A 3R2DJ 4PQUA 1IBCB 2C1EB 2U1AA 2HLTA 3LTOA 2C3UA 2MQ8A 5HVGA 3P3DA 3IC1A 4J5OA 1ZZFA 5B0GA 3OFEA 3A3OB 1WI8A 3PTWA 2XS2A 2XC9A 2QG9B 1VRUB 3O3LA 1D1UA 2YX7A 1RLCL 3TZXA 3TARA 2ZC3A 3H2LA 1IUJA 3GFHA 2AEMA 2WVDA 2WRMA 2GA7A 3C16A 2LQ5A 2HG4A 2XY5A 2YX4A 5A76A 4LF2A 2I8EA 2E66A 1YLXA 1JXVA 2DGOA 4LF4F 1HBUA 2J7UA 1KVJA 1CULB 2VBYA 5HN0A 5EX3A 1QDUB 4X65J 4ES1A 2WCXA 2PA3A 4OZ3A 3D3BJ 3FC9A 1RJJA 4WYLA 3MEDA 3CMAS 2CNLB 4HT5A 2YTCA 2VKRA 2L9DA 3ULHA 2GVDB 2BE2B 4CDIA 4RW6B 1ULRA 5GMEA 4OYIA 1NO8A 3O6QA 4XO0A 4P71A 3PKYA 1R8HA 4EZ6A 1SQGA 1H38A 5HP1B 1NK0A 2EXUA 2W8LA 1UETA 4A8OA 4YB6A 2N7CA 1NBEB 1S9GB 4ZN1A 5GAEU 4R8UB 2CJ9A 4KKOB 3LAKA 4DSIA 4KFBA 2J0QD 5L1KA 1YWXA 6FD1A 4JYAJ 1QVGR 3R7BB 3H2VE 1NSQA 5E3CA 1GEHA 1IXKA 1RACB 4AQYF 2F63A 3VVUA 3OL9A 4PYAA 2HBYB 3QO9B 4ICLB 2Z58B 1N32J 4ZHRA 4M94A 4EO6A 2V63A 1N6QA 2KL8A 3BQ2A 3QSIA 1SC6A 2DEJA 3E01B 3WX8A 1QUVA 2FQQB 4TY8A 3HF5A 4JV5F 2YNIB 1UWAA 3EGZA 2HW3A 2UV8A 2CPYA 2PC6A 1IQZA 1FKOB 2XSFA 2FLPA 4YHHF 3QT8A 4URSA 5KFCA 1S76D 2DNMA 3HSGA 2VPZB 4K0KF 3ZZPA 3AFGA 5CD4A 3IGVA 1RBAA 1NRKA 3NCRA 1ZH5A 3THVA 4WFNQ 2ZOFA 4USKA 2EFGA 1PKUA 2W9BB 1FI4A 4EO8A 4P74A 1JLGB 2WB4A 2FC9A 4UY8T 3KUEA 2BVZA 2XSJA 2VFTA 4U67Q 4F02A 2O3DA 1FEHA 1WF2A 4M5KA 2Q3PA 2VV5A 3BGFA 4HDHA 4OHXA 3SXLA 5E7OB 3TZZA 4ZMMA 4O44A 3KWMA 1UVIA 2OAUA 2CADA 1B4SA 2ZBCA 4ITSA 3E8OA 1CC8A 2F9DA 2NXEA 4IR9A 1FA0A 2QZ8A 5GVQA 1JXEA 4J9UE 2AZ3A 4OYMA 3J7ZT 2I0XA 4DQIA 1S49A 4F4KA 4C98A 2K7JA 1KFDA 3CJTA 3AB4B 1GFWB 3NS7B 4KBIA 1S12A 5J2QB 4JI3J 1KLMB 1RWKB 3KMQA 4F50A 4X65F 4JP8A 1CJKB 3BEGB 5L39A 1LWEA 4QZVB 2DPJA 2M7SA 3MMBA 1WTFA 1WG1A 2HNDA 5DG8A 2MQMA 3Q8VA 2XZWA 3I87A 1MWYA 3IXQA 4NCAA 4NI2A 3ZZOA 1SIZA 1K1QA 5L38A 3KHGA 2KXFA 2VG7A 4FXWA 3V6DB 3OVAA 5C7PA 1AFIA 4P7TA 4U6PA 2AP6A 2NSBA 4PWDA 4USUA 3EGNA 4XK8C 5H9FK 4UOGA 2HQGA 1RTHA 4K4XA 4OJHA 1RWUA 3SDEB 3LO3A 1Y4ZB 2JRSA 1LOUA 4RNMA 4ZJOA 4ANEA 2KG1A 2DBBA 5DM6Q 4XDCA 1SL2A 1X0PA 3I31A 4HLBA 1VIOA 1ICEB 3BGRB 4N41A 3O8WA 4USWA 1R43A 2E1AA 1U0HB 1R6YA 3QLHB 1VQOS 1GX6A 4B3OB 2DHXA 3RB0A 3W62A 4JI7F 1VQYA 3POTB 1VCTA 4IFYA 4Q5VA 2MGZA 4KJIA 2BACA 3Q8RB 2CJKA 4OZ2A 2RDJA 4PQUB 3Q83A 2EC2A 3TA2A 2BMBA 2AF6A 4DHVA 4CYUA 4JI5J 4C8MA 4YUDA 4RWXA 2MHEA 2UUCJ 3MAQA 5IM0B 3IFEA 3F44A 3HHLC 1SH2A 5A8KB 2DD8S 2WHOA 4F36A 4GKKJ 3WDOA 5HL7Q 4HHUA 2DGQA 1SUQA 4N76A 5C2GA 1Y00A 3DHXA 5BXIA 4DV7F 1GXLA 1UWBA 4CO3A 5KT7A 3C16B 3GFYA 1IVZA 4BWMA 2C28A 1NJZA 4I6AA 1WDDA 4OYPA 1HBUB 1FXLA 4AT1B 4M5JA 1C1BB 4RW7B 5E3PA 5EWFA 4FYYB 2CPXA 3V6KA 3PDNA 3A8EA 2V0NA 4AFFA 4X62J 2BM0A 2ZH9A 2RKIB 3KLGA 2E5LJ 4C48A 4PYDA 3SSSA 3FGVA 1EKRA 4F67A 1XR7A 4A8KA 4DQQA 2MZJA 1NH7A 4NE9C 3M8QA 2P2CB 3EVWA 1CEZA 5D8HB 2L08A 2R2SA 1FDAA 3C6TA 1J5OA 1XJWB 3GB0A 1XMQJ 2WW4A 5E3RA 3M6UA 1DURA 5KOWA 1S7HA 3C8YA 3PEJA 2J7WA 2VPYB 2OTJS 3UI3A 3DOKA 1JLCB 1UPMB 1PIEA 4AUKA 4EUVA 2YKNA 2EG2A 2GNKA 4F2RA 4IUFA 3T9NA 2DITA 2GZOA 3DRPA 2W4CA 1JX4A 1LK5A 1G7CB 2AT1B 5F8LA 5EN1A 5DJBA 1ZETA 2C3OA 2E7WA 3SCIE 3JQMA 1S5ZA 4F26A 1L5UA 2R7OA 2OP5A 3KJFB 2EFOA 4O4RA 4O3SA 2UVWA 2AGPA 1YBTA 4W92B 4DF8A 5E33A 3W7BA 2O1PA 1Q95G 1WG5A 2Y0BB 2WB1D 2YNGA 3M8ZA 4CRJA 1N48A 3HXMA 2XO6A 2AEJA 4RR5A 4YR0A 4ECWA 2MJNA 2WK4A 4LUBA 4LRDA 4DL5A 4IFVA 4ZP9A 2HZVA 2PE8A 3UDLA 1LNQA 1C1CA 3NMAA 1T03B 2A18A 1UVJA 4G1QA 2AGQA 2QO3A 4CCHA 3Q8YA 4DS4A 4NXNJ 3BGUA 4GKJF 1K1SA 1H2TZ 4IRCA 1RLDA 1VC5A 5KFQA 5E3AA 5ETVA 2UXDF 5G0RB 2QSFA 1S0VA 1XQIA 3FNNA 2CQ4A 2XSJB 3LPYA 4TYAA 2I2YA 2OSQA 2ZBPA 5IT9Y 4E0DA 4XDDA 4JI5F 1K0TA 4NMXA 1XR5A 4ECSA 3I5CA 3M32A 2HFNA 2ZDPA 1EIYB 3QRQA 3UCGA 4EYIB 3HCXA 2HHHJ 1L3SA 2C2ZB 1DAXA 1U1PA 3NGRA 3M2VA 4AXJA 5FDLA 4KPCA 3CO9A 3PX0A 4WCEQ 1U6FA 4DR4F 3DC2A 3IA0A 2CFXA 1HD0A 4I1TA 2F7VA 4ZP7A 3BGLA 3BKTA 2VQFJ 1SH3A 1U1OA 2DNZA 3CGIA 2MQPA 1LWEB 3PW2A 1KD1T 3QYYA 4ED1A 1VYAA 3MMBB 3DLLQ 3H98A 1KVIA 2OFGX 1FFWB 2QL9B 4X4TA 3HMJG 2GHWA 4IRDA 4NI2B 3C15A 2PMHA 1EQ0A 3SZ2A 1VFJA 5ETTA 4DPWA 4U9RA 4B02A 1PC4A 3GIMA 2GS8A 1UVMA 2LU2A 1FJ7A 3OJUA 1S48A 3OW2R 4ZVUB 5LSLA 2KH9A 2ZJPQ 1Q53A 2CPDA 4DV2F 1XNQJ 4USTA 2HBQB 1KLNA 1HNWJ 3AB2B 1FRKA 4FF1A 2E1MC 5AE3A 3HT3A 3A3PB 2YVSA 5IOLA 4LF5J 1SV5B 4M5IA 2ALZA 2JOQA 4ELTA 2F9JA 3M9MB 4PPDA 1UEKA 2C2KB 1U1LA 2DNPA 3RAQA 4F0HA 5B0FA 4IQMA 1TUWA 1U6BA 4QR0A 3NS6A 2FHJA 2IC3A 3CCSS 5L9XA 4F4ZA 4Y28C 3I56S 3NG8A 3NMRA 2KM8B 4IFYB 2XO7A 4YB5A 3BYRA 1TMMA 2HQCA 4A46A 2EFVA 4OX9J 1LWFB 4O3NA 1HR0F 4C3MA 2EFPA 1VI7A 3KHRA 1RISA 4YY3F 4ZLPA 2F40A 2EVZA 5GAGI 3EPGA 2QGFB 1M5VC 1GH8A 3RAXA 3QAEA 4DEZA 3RBDA 3TI0A 1SUQB 3CDUA 5BYQA 2CJAA 4OZ1A 1IKXA 1Q8KA 2VG5B 2IBKA 4ED0A 2RF2A 3ZZTA 2IA6A 4Q0BA 4TKTA 2IM3A 4Q45A 5KFXA 1N4LA 4Q44A 1BY9A 1X4BA 3F0NA 1I1GA 2ZM6J 4B9UA 2BW7A 4LRBA 3IRWP 5C24B 3THTA 1FERA 4LF1A 3HM9A 4JI1F 4KHPF 1T9WA 3KLGB 3D0HE 4TLQA 1YJ9S 1TL7A 4FDFA 2KFNA 2UXCJ 2UUAF 4BBYA 3C3LA 1B0VA 1KQSR 4FYXB 3DOMA 2C3MA 3KLFB 3MHYA 1JXLA 1DQ9A 2XYPB 1TL1B 3D3CJ 5D4OA 4LSLB 4H4OA 4BC7A 1RHRB 4ZVGA 5D4NA 2M0GB 4EI2A 2B4UA 1J5OB 1D9AA 3D4JA 4MFBB 1I94F 1PAUB 3MEKA 3GCWP 1HBMB 2LLZA 3ETMA 4N5SA 3DOKB 1REVA 4I7FA 3RG6A 3M8PA 1TR0A 4ZVFA 2VQEF 2YKNB 4Q43A 1SKRA 5I3PA 1AZSA 1H72C 1AB8A 4FN5A 2CQBA 2IRYA 2FJAB 1RAHB 3K5PA 3O2IA 1XNQF 3K2YA 4K4WA 3BH7B 3FBEA 1H98A 2OMLA 4DWIA 3CCQS 2Q79A 2YNFA 3BQ1A 4NLGA 3KXDA 5IWAF 1NHUA 3UNGC 2K06A 1NK8A 2KZMA 4DR6F 3M6WA 4KV8A 1Y5LB 1C1CB 1FE4A 2EW9A 1ZOTA 4XTTA 3BSAA 4OZ5A 3JYTB 1QTMA 1Q78A 3DDIA 3CCZA 3BF4A 2GAGC 4LRAA 2A1BA 1S6UA 1G4CA 4EWTA 1S1XB 4MIBA 5J1EA 3MAHA 2RQ4A 4BWJA 5KG5A 2C2OB 3K5LA 1W25A 2QA2A 4RNNA 3BZQA 4LF8J 1PJ5A 1NK7A 1MROB 4PRFA 4HYKA 2JX2A 2OMOA 2B8PA 3UR0A 4QU6A 1DARA 4U7UD 3M32B 2BJ3A 3TP2A 4DV6F 4DG1B 3D6HB 4GC7A 1T9VA 4CT9A 3ISND 3TO8A 1HWJA 1UP1A 3BM7A 2MKJA 2V2VA 4ELVA 4IQXA 1LFPA 1RWNB 1UFLA 3UDEA 3V5RA 4LVOP 4Q7AA 2RSQA 3M2VB 1T95A 5FDLB 3M2RA 1WUUA 4RNHA 2MLXA 1EETA 4NXMF 4PPZA 4LFAJ 1PJ7A 3J7A1 4LSNA 2KG0A 1GMWA 2LCWA 3ILLA 5KFFA 4N56A 2BBEA 3TJ9A 2CA9A 1TL4A 2Z4PA 3BKFA 2LEAA 1HARA 1NK4A 3MDFA 4NEYA 1F9EB 3QGHA 2Y8WA 3CJSA 4IO1A 2QN6B 2MSSA 3RR7A 3OR2B 2EKNA 3KOAA 2ZUGA 2HAFA 2CQGA 3GYXB 2UXCF 3C15B 2G0JA 1YRXA 1TKZB 2RILA 1R31A 3P6YC 5I4MA 2HVIA 3MPVA 3NLCA 1CSJA 3FKBA 1DTQB 2GW8A 5HQMA 3OUYA 2IDLA 1FJCA 2LQ8A 3GYNA 4B9LA 2HZAA 4ANDA 4ETXA 2QSWA 2CNKB 5H9FJ 3BB5A 1S1WA 3KK2A 5KFEA 3DLKA 1M1KT 4UQGA 3PW5A 4DR2F 5IC6B 4PKDB 4DFPA 3GV5B 4FF2A 2ZE2B 1HWKA 1SB6A 4U7UK 3MM9A 4O4GA 3K58A 1X7VA 1RT3A 2F4VJ 2O67A 1YJUA 4EMDA 4MIAA 4V1Ak 2LQBA 4ZCMA 5EGYA 3S01A 3AXKA 2KXNB 3NP5A 2PI5A 3UPFA 1WC0A 5LMNJ 3W8GA 4DV1F 3DI6A 5KG1A 1KN6A 1RT6A 2VBZA 2AYBA 2E5IA 5IQ6A 1TKDA 3HHEA 3IAS9 4KO0A 4DR5F 3M8RA 3MM5A 4JI8F 2K2PA 2BKPA 4QYZK 2XZTB 1YX2A 2CUYA 1P6TA 1RT1A 2QMUB 3RW6A 2H9ZA 2L3MA 2DO4A 4Y2CA 3QRPA 2CWKA 5KG0A 3NNCA 4RUCA 4DN0A 3D0GE 1YIJS 2NYIA 2ZKTA 5L1JA 1T9TA 1B99A 1IKXB 1IR1A 3W5YA 1MN9A 1KP6A 3DRXA 2MQNA 2DGUA 4CM0A 2G2OA 4Z37A 1RT4B 4MKYA 3OJSA 4Q0BB 3OTEA 1OPZA 4DLEA 3PIPQ 2G1DA 4DDFA 1JWWA 4DL3A 4ZPCA 2CXEA 4WU3A 3QZ7A 1IBLF 3QIPA 2YXLA 1YI2S 1ZTWA 2VH7A 3LP0A 4LFAF 1RT5A 5LL6d 2DK2A 4ECRA 1OQ3A 4LQ9A 1IKVA 1OSCA 4JI2F 4AL6A 4DU8A 2BJ7A 4B3TJ 3L7OA 3X1LB 5GAGU 1A0OB 1NB2A 4BDPA 1FD8A 1M5HA 4KHMA 3SV3A 2AJ2A 4H4OB 3TA1A 1UMJA 2ALYB 1MLAA 3HPOA 3QT5A 2AD9A 5LSOA 1KDNA 3IWLA 1T8EA 1RE1B 3UWTA 5EHHA 4ID5A 4DZDA 4NZ6A 2IMWP 5HMZA 2DXDA 4RW8A 4M5HA 5LJ3Y 1K47A 4ZCLA 1KHVA 3DKDA 4I7FB 3VAIA 5M2PA 3CC7S 1NJWA 3TUIC 2IY5B 1F5CA 4C0HA 2H51B 3OTBA 1AZSB 5D0RA 2G2ZA 3MPUB 4Y00A 1XTZA 5HI7A 3U1NA 3IM8A 2DH8A 4OQJA 1NEEA 1VLYA 5G4DA 5KFDA 3G9CA 4XIUA 3AA8A 4NWBA 1VQ6S 1ELOA 1WHVA 1CJUA 3BO4A 3MEGA 3K8VA 3BBBA 1D8ZA 3G82B 2G4BA 3BN4A 4NLWA 3W9IA 2JFKA 3I32A 3TZYA 2KFZA 3L4BC 3DU5A 3HFKA 1YKWA 2OIHA 4ES2A 4DPTA 1MWZA 1DLOA 1JLFA 4DUYF 1S9EA 3EWGA 3PO4A 4ZLLA 4TY9A 2RDIA 4OHWA 5L1LA 3N5BA 4CP5A 2CDRB 1G3OA 1LWCB 1F5BA 1PILA 4OYXA 4ECQA 3EDQB 1FE0A 3E3XA 1O8BA 3HHLB 1TQLA 1E6YA 4KHRA 2ZHAA 4B3MF 2HGLA 4DPXA 4USJC 3JTNA 3SQGB 2LDYA 4DFKA 1H73A 3KYLA 1WD6A 1IJFB 4A8MP 1FJGF 2PMWA 2E7XA 4ZVEA 4TN2A 2CAJA 3M2RB 5THWA 1EETB 3KLIB 1T9YA 3OR1A 1B64A 4DSJA 2HNZB 2K3KA 2P9EA 2KT5A 2QFJA 2YWKA 2G9OA 2HBZB 3S8SA 5T41A 3K0JA 1UEUA 2DPIA 5SZTA 1AW0A 4B9NA 2V68A 2AJ1A 3R9LA 3T1YJ 2DNNA 5ITHA 4J9KA 1KOHA 2KO1A 1IJEB 3EUNA 3QGGA 2VD3A 1NZAA 4CH7A 4B3TF 1HA1A 3GQCA 1I6JA 5DM7Q 2V8PA 3JSMB 2HAIA 1J5EJ 3NBPA 3FBCA 2FLLA 2UU9F 3QT7A 3LUYA 4DZ6A 3OUYB 3OHBA 5F0WA 1DQ8A 2RU3A 3CJRA 3TAMA 2PGCA 3KK2B 4QWDA 1BC6A 3DLKB 3D6TB 3GLJA 4QJVA 1RHMB 4Z7CA 3IBCB 1HBNA 4P2MA 4WK1A 3FEZA 3UD4P 3MM9B 4O4GB 4ED2A 1XERA 4LF9J 4YQWA 3SSRA 1R7IA 2BX6A 3FJ2A 4X84A 5HATA 2JEGA 2AU0A 1MU2A 2Z2MA 3DXBA 5IZHA 1GAOA 2XMAA 1CS4B 2W4PA 1X0FA 3DI6B 3E51A 1RT6B 1F9HA 1PBUA 3NKYA 2ZVSA 4WKYA 3TVZA 3M8YA 1LWXA 2R8GA 4KO0B 2RHSB 4I6WA 2VPXB 4LR9A 5ETQA 4M5LA 4UF4A 1QVFR 2D69A 3I5AA 5GMDA 1RT1B 3VGTA 2CG8A 1FF2A 3NGSA 2FGOA 4OYWA 5I3UA 1R0BG 4W98A 5KFWA 5FIIA 2I9SA 2B3TB 1Q7LB 2V34A 4C11A 3F41A 3T41A 4Y2AA 4QIGA 3CCTA 2JSXA 1T9XA 4N7TA 2M52A 1KKHA 2G1HA 3KUHA 2CZ4A 3PYDA 1RT2A 4CQ1A 2CQCA 2BOPA 1QSLA 1WC1A 3LWLA 2HK3A 5HROB 1O6XA 3IMQJ 1EP4A 2XLIA 1N33F 5DO2A 4K4VA 3DMJA 2HHVA 1YQHA 3PZPA 2VJUA 3R6GB 1TL5A 1WDTA 2EK6A 2ADCA 4TU7A 1RT5B 4DUZF 4FS2A 2X1GA 1RBLA 4NLTA 1IKVB 3MM6B 1BGXT 1Q82T 1VQ9S 1FVSA 3PG9A 3PW7A 4ZLNA 2V9WA 3DOLA 1NCLA 7FDRA 4GO7X 4B3SF 2W2MP 3H20A 3KG4A 2RRNA 5KG7A 5HAOA 4DR3J 4DR1F 3PM9A 4ID5B 1TKXA 2QMWA 3MZIA 2N3LA 2R7TA 3Q2TC 1J5EF 2A6OA 2DKOB 4L74A 2NCKL 4W90B 1WC4A 1BQMA 5D15A 4FYDA 2VIHA 3GG0A 1RTDB 2VBWA 3CO0P 4X64F 2OI2A 3WIVA 4MK7A 2YWEA 2J76E 3FCVA 4DSKA 3D5MA 3G6ES 1AUDA 1Q8LA 3C6UA 4FF3A 3GMGA 1RCXB 1FFSB 1GX5A 1UA0A 2GC8A 4J9LA 1Q0NA 1NKEA 1RTJB 5KFAA 5KFMA 1CJUB 1PYOB 4A4JA 3P45B 3MEGB 3PCOB 4I56A 1QJHA 3VWSA 1UPPA 2GHVC 5ETOA 1C0UB 2VDHA 1RWVB 1YZ7A 1JLFB 1HQEA 2HHTA 1S9EB 3V6JA 2BQRA 4P72A 4KT0C 1FRLA 1XMBA 3BN7A 3FUYA 1ZM4A 3TQ1A 4ATNA 1M90T 5J2NA 1KBRA 1W2IA 3KDNA 4X4VA 1FRJA 1UL3A 5HBMB 4EBDA 4U7CA 2PA8D 1KONA 2R7VA 1TV6A 4JI0F 1BWEA 1RWWB 3GPAA 4NX9A 2MHNA 1WC6A 4O0IA 5HMXA 5IT4A 3L7PA 2QLBB 3KJVA 4K7QA 1LFWA 3KK1A 2LEPA 2M8HA 3RB6A 5F8MA 1S1VA 4PUOA 2IFXA 3FMWA 4DSFA 3OR1B 3BH6B 5L46A 2DIVA 1YBUA 5ADZA 2BW2A 2K1RA 3W64A 2GQCA 4LFCJ 1M5OC 3TWZA 4N47A 5F3ZA 2IRXA 1XWLA 3MECA 2KB2A 4ZPAA 5D78A 4DXLA 4ERDA 2QE5A 3QJPA 2IRUA 4N77A 1S79A 2CNNB 5F8GA 3MFIA 2ZC4A 1MNEA 5D6GA 4YR2A 2ABYA 4I68A 4LREA 2ROEA 5IV4A 3V4IA 2FZGB 4K5SA 1ZA1B 2DNOA 1U1MA 4NLSA 4WZQA 2A6MA 3DRSA 2GGPB 3NY0A 2XLKA 2HSEB 3NBPB 3AT1B 1VJWA 1RHQB 5D77A 2VB6A 1TFYA 4V19J 1APSA 1VS3A 3MPDA 5DDQC 4C8ZA 1OYDA 2VFVA 4RBVA 2NUHA 1FTRA 3RR8A 4LJMA 5F8HA 4B3RF 1M0SA 4HVZA 2LA4A 1HBNB 1HHTP 5CHCB 1AA1B 1S6QA 2XM3A 2RIJA 3SMZA 2KYZA 4OFZA 4J9RA 4AYBD 2DNHA 1WOPA 4DMZA 5KFYA 1TAQA 1FX2A 1R89A 4ELUA 6AT1B 2DHAA 3GZ7A 4X66J 4DV5J 5HVHA 3SV4A 2B4VA 3M2UA 2RUSA 3H0PA 1NLKL 4BCAA 2B0GA 2D3ZA 1M5PC 3I4HX 4RBUA 3FFIA 4QPXA 2IVMA 3HSJA 5EDWA 1GMUA 4OYOA 1GT8A 2ZH5A 4QYZJ 3T3FA 1BUXA 4OHVA 1GTEA 3DLJA 3QATA 3HKWA 2MPUA 3T5HA 4YFUA 3RRGA 1HNVB 3A4TA 2C42A 1UFKA 5I3UB 4F4WA 3J7Z5 4QIVA 1S4FA 4C11B 2I38A 5A2QY 2ZH7A 3KMSA 2BM1A 2FB0A 4XAKA 4R0JA 3J81Y 2MKHA 3DXSX 3A8IA 1RT2B 2W2NP 4C8OA 2RNEA 3ZO7A 2JDJA 3CCUS 4O3OA 2QA4S 4DFMA 1JLEA 3M8WA 3L3CA 3O1LA 1R0AB 5D4LA 2V5HG 1EP4B 4Z2XA 1QSSA 3DMJB 1PO6A 1B0TA 2CJQA 4HH0A 1AUSL 1VRTB 4TQSA 4ZVHA 1YRUA 4NLQA 3ZZYA 3GP9A 3T1HF 5RUBA 2UVUA 1VRQC 2V50A 1ZAXA 1XR6A 2R7UA 2AGOA 5F9LA 2Y9HA 3VAHA 1HNZF 4I0WA 3UVJB 1X60A 3HVAA 2XBPA 3B78A 2HFVA 3BDPA 2UXBJ 3UDVA 3OSPA 4UUXA 1U2FA 1VLOA 2PFDA 3TUPA 3TJ8A 2IDEA 2GVDA 3OD2A 4H4KA 4Q2MA 2JLFA 3MUVP 3KLHB 2J6TA 2AYGA 1I5OB 2J5AA 3QMQA 1NK6A 3JQKA 1TKXB 4PG5A 3VAJA 3DDKA 2ZH4A 3MCNA 1HHQA 3HI9A 4R25A 3LP2B 2HQDA 3HJVA 3QJLA 2LFVA 4R8UA 5KOXA 2CKWA 1YTYA 3FQKA 4DPYA 4LR8A 3AD7C 2QFIA 4OZLA 5KT5A 1G2EA 3N6NA 1SJQA 1UZDA 4OYAA 4FXVA 3DNCA 5MAOA 3GJTB 4DQRA 2XTJP 3QO9A 2FC8A 3GYGA 4CLSA 3MURP 3AQPA 2FJDB 2KRBA 1YG0A 4ZVTB 1VQSA 3UR3C 5CH7B 3VAKA 3E01A 3SCKE 3A13A 5AJ3F 1SKUB 4IYQA 4JUZA 2GJIA 3T5JA 4KPYA 1HIYA 3KK3A 2YNIA 4ZN3A 5J1PA 4C0OC 4GO5X 1QSYA 3CJ2A 2GO9A 1WKJA 2MQOA 1Q81T 4QPTA 2R3VA 1FKPA 5LOQA 1RDRA 5I42B 1MG7A 4RKUC 2VA2A 2L9WA 2DNLA 4U96A 2C2MB 2W9BA 3MM7B 1SCJB 3K5OA 3D0IE 5C2CA 5KAKA 1KQGB 3MEEA 1T94A 1TV6B 1N5VA 2DJWA 1RABB 4GMKA 3MPWA 3OLBA 1WEYA 2VA3A 2CPFA 1UVKA 2LVWA 3KDOA 3KJVB 2R7QA 4LF4J 3NGTA 2AYEA 3KK1B 3RBEA 4L3KA 3OTDA 4ED7A 3LAMA 4PUOB 2AWZA 3ILOA 2Y1RI 3Q8QB 4FVMA 7FD1A 4ED4A 3U1LA 4FZVA 1F3VA 1QM9A 2RMLA 5M2RA 4JV0A 3CJ4A 2P9CA 1A7GE 3G87A 3MECB 4UZCA 4ZPDA 5IT9U 1JMTA 4ZDNA 4OV1A 4FPIA 3C14B 2BOAA 1WOOA 1Q7YT 2E1RA 2HHPA 2HFOA 2ZD1A 1KLMA 1S4EA 2OD4A 2V4JA 5AXLA 1CJKA 2M2BA 3HHLD 4YDXA 4WTYA 4W4MA 2AX1A 3ETOA 3ITHA 2AZ1A 2U2FA 3FZBA 5CYJA 1SJFA 4J90A 3U27A 3BPSP 2E5HA 1N34J 1IM6A 3DRSB 2DNGA 2J9EA 5K8NA 2M70A 2HK2A 2BXJA 3FK4A 4LF6F 1I51B 4EU0A 1KOOA 4FKXA 1M1HA 1K9MT 3UNYA 3C66A 4AQYJ 2RVJA 4C3KA 4DJBA 5CYQB 1VBXA 5K9FA 4BLGA 1S6QB 3MR3A 3MCOA 1FXDA 4M5MA 1T3NA 5DQHA 2MKKA 4Y2MA 1FWKA 2ZBIA 4DFJA 2XMMA 2IHR1 4JV5J 1NSKL 4PZVA 3TYTA 1SBRA 2GMHA 5D3GB 3MF5A 1U0HA 4YHHJ 4LF7F 8ATCB 1HNXF 4BC9A 3KKFA 5H1SV 1RQ0A 3KFWX 4K0KJ 3GWCA 3RZAA 3POTA 5GAHI 1S57A 3TUJC 1HPZA 1K8AT 2HRUA 1N5YA 1O51A 3ADAC 3TA0A 3I9ZA 4QOTA 5T7LB 4KSEB 1N36F 4KGMA 1H3DA 2AJ4A 3M30B 3J7YI 4XPEA 2NYHA 1SI9A 3ENVA 4WIQA 3W60A 5IM0A 3GIIA 1TZ0A 3PJWA 2KHCA 5A8KA 1VC6A 2B6AB 3CW2C 4HEA9 4JOUA 2OKQA 2LYVA 4Q8EA 5DZ6A 2LU1A 2B43A 2AW0A 1S0OA 2V6AA 3SBMA 2XCPA 2QEXS 1JLEB 2R8JA 5HQ8A 3NCPA 3D54A 5A0YB 3FVYA 4LFBJ 2G13A 2RHQB 4IDKB 3RAMA 3G96A 3H8YA 4K4YA 1U8WA 4QR1A 1C1BA 4RW7A 2YWFA 3I9V9 2H1YA 1QD1A 4ZJLA 1SIWB 3QZ8A 2CZVC 2H3EB 2RKIA 2VL1A 5KFPA 4PQAA 3I0RB 2HFUA 4YDDB 4RNOA 3P8BB 5B7WA 2HQIA 2C2NA 4OX8A 3D67A 1M5KC 5KFKA 2EBEA 3BJYA 3EYZA 1Y3KA 3UD3P 4HKQA 1T7PA 3CWJA 3BBCA 2GAHC 2FLNA 2P6SA 3VVTA 4USMA 1N34F 1NPKA 1RK8A 1RGVA 4ED5A 2IMOA 2YPYA 3K5NA 2XHWA 3G8TA 5SUHA 1LW0A 1RAIB 3Q86A 2QC3A 2R2TA 3VF0B 1JLCA 4I4BA 1WC5A 5D0GA 4CO2A 3EZ5A 2Y8YA 3GJRB 1YJVA 3P4UB 4DSEA 1DZ5A 2MY7A 4KTQA 2V2KA 3CD5A 4HHHA 1TKTB 1NJYA 2AQ4A 4RO0A 3PFEA 1VMBA 1WHWA 2DGSA 4OZNA 4IRKA 3MM8A 3WZ0A 2FY1A 4AD6A 2HHWA 1T02A 4JI7J 3JS9A 3KK3B 3RBZA 1H2UX 3FBBA 3QWUA 1TAUA 4J37A 1LQ9A 3EX7B 8RUCA 3H42A 3VGVA 3H90A 1RU1A 2H65B 2R7SA 1W7WA 3NGKA 1FKPB 3MD3A 4O0NA 3QQCD 2KT2A 1C2PA 3JSRA 1N0UA 4ED6A 1T03A 3BO2A 4ER8A 4DS5A 2ACMA 2M4MA 1SJ4P 3Q89A 1HI1A 3FCWA 3GSDA 4F25A 1SC1B 3W63A 5FLXY 3J80Y 4FXDA 3HDSA 1ZA2B 4RPFA 3M1VA 3CUNA 4MKBA 5G0RA 2JC1A 3MEEB 4ZP8A 1O5JA 2Z8QA 4DV7J 3FQLA 2K3IA 2P9GA 3FSIA 3LALA 1RBOB 2FJVA 1PSDA 1HBOB 2CWXA 2ZBRA 2I6WA 1C0TA 2W9AA 5J1NA 3JAMY 3W5XA 1NM2A 2DCLA 1R3NA 2E1CA 2DHHA 3IG1B 4ILMA 1QAXA 2DCUB 2DY9A 2F65A 4GVLA 1RZMA 2X51A 5ETRA 2QYCA 5DDRC 4A8YA 2XMVA 3NL0A 2JEIA 2HVDA 4LFBF 1TL3A 4O3RA 3W65A 4I2QA 3FEXB 2J0WA 2ZD1B 3OT9A 4WWSA 3R5JB 1RHKB 4J9OA 2V4JB 4ZIVA 4M8LA 1N54B 4OI3A 3H40A 1WEXA 2R2RA 4OJGA 2XB2D 3ITHB 2OFHX 4AL7A 1FCAA 2APOA 1CPZA 1ZPWX 3GFZA 2D41A 1S7IA 2DRAA 1IR0A 1SPBP 2RDDA 3TVYA 2KZZA 4NZ7A 3QAUA 4DBQA 3A3NB 2B8QA 5K14A 1WI6A 3VZHA 3M9NB 2SXLA 2XWXA 1OY6A 2CPHA 1NUEA 2ZWOA 1F3FA 1GQEA 4E98A 5JJBA 2D74B 4C0BA 4CLTA 4ZLJA 4K8RA 3PX4A 2ZEJA 3JQJA 4OMFG 3OVSA 3T19A 1OO0B 2ZOMA 1RSCA 5KFTA 4DR7F 1SV5A 2JLGA 1RWPB 1ROFA 3D6FB 4WFXA 3CMES 1E6VB 2UUWA 2ILYA 1PYSB 3Q8SB 1HL6A 4XPCA 3QFWA 3CEDA 2KI2A 2DR6A 3LP1A 2VOOA 4PWWA 1JIHA 3TX0A 3T5KA 1HPZB 2M5YA 4GKJJ 4DSLA 3NGUA 1N5YB 2UXDJ 2CNOB 2QRRA 4AE5A 1LWFA 2KHDA 2XI2A 2H5IB 2V8DA 5DGBA 1HQ2A 4ZITA 2W4DA 3ET6A 2PO4A 4PG4A 4CO5A 2BE9B 4JV1A 1XNRF 1EHWA 3P5TL 4R5PA 3HULA 4JI6F 3GCXP 1WACA 2VZ9A 2BV3A 2VG5A 4P2XA 3LPEA 3OV7A 2Z2ZA 3MI7X 1RUSA 2VKZG 3KLEB 4CLKA 3WC2A 1MN7A 4DR4J 3VR1A 5LMUF 3H4BA 1NMEB 2KTQA 2QL7B 2Z2LA 5GAHU 4K4ZA 5C24A 2YBVA 3N5FA 1K44A 2L9NA 3JB9k 1DQAA 2UV8G 3EJMA 4LBPA 5B0DA 2PD1A 2YWWA 5E41A 1F2HA 2MZQA 3LA0A 3QPIA 4E2FB 3IGNA 1U24A 5HQLA 3J7YU 3T6JA 1IR2A 4URQU 5KG4A 3GFXA 4TLRA 3GE9A 1S6PA 2Z57B 4ZJQA 2RQCA 2YKQA 3IP0A 1RKJA 2J9DA 3NCQA 3KLFA 9ATCB 3KTQA 2NPIA 1T0TV 1TL1A 5KFJA 1DTTB 4LSLA 1FRIA 5LM7E 4LBIA 4OI2A 1Y10A 2Y1IA 4B17A 4BS2A 4MFBA 4KE5A 2OELA 4DV2J 1R8BA 2DNRA 1YJTA 5FJ4A 4A8SA 1LW0B 3D9BA 2CQ0A 2QIFA 3BSNA 1CJVB 1HBMA 2R9LA 5D0EA 1KR4A 1P27B 5C25A 2YKMA 3LGNA 2PIIA 3NRBA 2V4RA 3G6VA 2DXFA 2DR7A 2DHGA 4Y6IA 4ZPVR 1X4HA 2JVOA 3RBXA 1X4CA 3A8JA 3AJ2A 1SL0A 1REGX 2JLEA 4EYHB 1XMOF 3MM8B 1L3UA 1U7LA 3R5BA 4ANCA 3J81j 2BE7D 4HACB 4LIWA 4P7VA 1IBMJ 1W26A 2HHUA 2V67A 4QQBA 3QSYB 4QR2A 2IVFB 3PFOA 2MQLA 3US5A 2JEJA 2WZ1A 3UFCX 1ZS6A 3BR9A 3MD1A 4A47A 4F0KA 4CI0B 2JNJA 1HR0J 2NZ4A 2BJ9A 2YY3A 1F60B 4RWWA 4YY3J 1TVRA 1OQ6A 3JYTA 1PC5A 2F5GA 5HLFB 4C8LA 4RLEA 1GTHA 2ASYA 1S1XA 4GRSA 2XNQA 2V94A 3H2UB 3PW0A 3M1VB 2KVIA 1SC3B 2O66A 1UVNA 4L72B 3Q2SC 2PMZD 4MYUA 2OO4A 2EK1A 2B4OA 1MROA 4PXCA 2BJ1A 2LXFA 4E8UA 5BYRA 4UOCA 1C0TB 4DG1A 4L3NA 2ASDA 2PFFB 1DY3A 4KB7A 2Q43A 2C3YA 4DI6A 2VICA 3BSOA 3SFUA 2JH3A 3MAAB 4ECUA 3HVWA 4WFBQ 2WVFA 2R7XA 4P6QA 3CT9A 2EEYA 3IS9B 2MLZA 5T14A 4JI1J 4KHPJ 2ZNYA 1TL3B 3R1HA 2E9TA 4I2QB 2GMJA 2MYFA 4KAIA 2UUAJ 1T11A 1MMLA 3W1YC 4Y3CA 3T1AA 1SJRA 4RX6A 3D1HA 3CCLS 1HI8A 4RL1A 5HO4A 3TEGA 3KHHA 2YNHA 4JB8B 1VBZA 4OI1A 1VQKS 3CCVS 4WFYA 3OR2A 2F8HA 4H54A 4RBTA 2ZITA 1ZAWA 3W61A 1I94J 2J6SA 1TKZA 3AXMA 3I82A 1WKLA 1YZ6A 4IOBA 3SQOP 1TMJA 3H25A 1NNDA 4F8RA 1DTQA 1RAGB 2VQEJ 5K14B 2AYMA 4EK2A 1U02A 5KT6A 3OXGA 1RWMB 4B9TA 1KTVA 4F2SA 3RRHA 1CJTA 2RRAA 1YJRA 3G8SA 3OXFA 1BXNA 3D6MB 1YJNS 4WZMA 2ZE2A 5KFRA 2BABA 4K4UA 3GV7B 3A1YG 4WFZA 1JLBA 4USHA 5IWAJ 1XBWA 4GVBA 4DR6J 3UE2A 4WYWA 4ZVQB 5F0UA 1JKHA 3ICLA 2YQ0A 3IM9A 3ZTPA 1IBMF 3TEHB 3LP1B 5CAAA 3THPA 4IH6A 3N0VA 4QIEA 1KQKA 2J8AA 5B0AA 4C6AA 3EM1A 2HIYA 3CCRS 1JLQB 3RGIA 5CQGA 3QNWB 4DX5A 3ET6B 2D9PA 2CPJA 2YQ1A 1RYSA 4DV6J 4OJ3A 4WP8A 5EWEA 4IG3A 4CM2A 1ZM9A 2ZOGA 4NYOA 4QIFA 3HJFA 2B7CB 4R5PB 1WKKA 2FVSA 3UN3A 2DRDA 2FIUA 3NWRA 3KJNB 4QYRA 4H4MB 4NXMJ 3MTJA 1RT4A 2CVEA 1D09B 3OFGA 2C2EA 1KEKA 3R97A 4K50A 2DYAA 3R5DA 3SFGA 5KTQA 2VUGA 3Q8UA 3TVKA 3CIZA 5I3QA 3GIKA 3N28A 1M5SA 1Z2ZA 3K57A 1WNEA 4HTIA 4PCQA 4PABA 3M7VA 4WXWA 2POKA 3PJXA 4QWEA 9RUBA 4ZOSA 5ETPA 1S6PB 4UOFA 3FSXA 1NU4A 4KGZB 5DQIA 2IIHA 2X1FA 3G8QA 5M2UA 2J9DE 2OPPB 2P8IA 1X4AA 1HWUA 1UCNA 3B8HA 1VQNS 3KG0A 2W25A 2FHMA 5KG6A 1N5SA 5CYMA 4ZK7M 1EZZB 3MR2A 1JLAB 3SI8A 2OLWA 1WWHA 2P5VA 3MR6A 1GXTA 2E29A 2VFUA 2N7YA 4DR2J 4NCBA 5C25B 1DBDA 3N6MA 3SYZA 1FRMA 1RI7A 1NJXA 2HBRB 2MZSA 2YKMB 3CJQA 3LQVA 1UW9A 2FY8A 1Y11A 2QTWA 4X4OA 4RW9B 3DLEB 1HI0P 2ZH3A 4LRFA 3PRDA 3A12A 2R7WA 4WIIA 1L3VA 1UW4A 4MT1A 2M9KA 5KFIA 4DV1J 5B0CA 3JSYA 2ZJRQ 3TX8A 3RJMB 4O3QA 1LV5A 2FLOA 2V4QA 4ECYA 2ASLA 1T9UA 3WHIA 1KQFB 3L09A 1AROP 3I0SB 4DR5J 4WK3A 4JI8J 4GC6A 3G82A 5DGAA 2HWIA 3TW0A 1FD2A 3NOCA 3B4DA 1S0NA 5AE2A 1TVRB 4F4XA 3BO3A 1NSPA 1UA1A 2HFZA 2BRLA 1RYRA 4KGXB 3DYAA 2IAJB 1IWAA 1U09A 3FRZA 2QLFB 2DNQA 2XYHB 1LWCA 1R8CA 2FHOB 4DF4A 3PVXA 2VG6B 2CQHA 1CQMA 3HHLA 2QLXA 3PNIA 4I6YA 2FJBB 3AODA 2E9RX 4DV0J 2FVPA 1S1TA 4DCJB 3SQGA 3D28A 2YQ3A 4B9VA 2HMIB 2DT9A 4TU8A 3D68A 2DTJA 2P6TA 3PYFA 3D7SB 1IBLJ 4F7VA 2GIRA 1U4BA 3RYLA 4YB1P 3KLIA 2KJVA 5HMWA 1UAWA 2BANB 2HNZA 3VAMA 2PT0A 3VALA 1UJ5A 3IRXB 1ZPVA 3DGPA 4JI2J 2BEFA 4ZS6A 2MMYA 4X4SA 3W2VB 2DGWA 1LW2B 2UUBF 1MMNA 1S97A 3QT6A 2QT7A 2FVQA 3GONA 3ENWA 2YNHB 2QV6A 2O5DA 1Y5IB 4M95A 1NZ8A 4OHZA 4DOZA 2OEKA 4CNYA 4NLYA 1PG5B 5KT3A 3OTOF 4PG8A 4RJVA 3JSMA 4QWAA 2GV1A 2JEFA 3BKUA 2HQ3A 1R8PA 1X4DA 2VFSA 1C4AA 4L73A 4WBFA 2JJ4D 4QU7A 5J2PB 2WSFC 1CJTB 2QL5B 1O0PA 1SJ1A 2F8EX 4LVNP 3TR5A 2C3PA 1JNRB 5LT5A 4OL8A 2HEKA 2OPRA 5F41A 4M5DA 2KFYA 3ZNJ1 1JLBB 4UTGA 2MXYA 4IO9Q 1YRTA 2LQJA 4K5RA 2DHSA 3GV8B 4GVBB 1RTZA 1X4FA 1YHQS 4CLFA 1P8GA 4MKAA 3V4MA 1RT7B 1FXRA 3OVBA 3NWGA 1JKHB 1OY8A 1CS4A 2DY1A 4PXBA 3DM2A 2YKOA 1A9NB 2MDAA 3EZOA 2WONB 4DUYJ 4KRWA 2VBXA 4CT8A 3GIJA 2QLWA 5HK4A 1UFWA 3Q0AA 1NK5A 5HSPA 2K7KA 1V5VA 4DQPA 3MR7A 2ATCB 4B3MJ 2AIRB 5AXKA 5EWGA 3CSKA 4CIOA 4IG3B 2VC0A 4NEZA 1FFGB 5IFMA 4C2MA 1HYSA 2D3UA 5KT4A 5BR8J 2N82B 1FJGJ 2M88A 2HS0A 4DX7A 2CQ2A 3OPKA 4CTAB 2AX0A 4DV0F 2V8GA 4J9QA 2ADBA 1RAFB 1N52B 4ZVSB 4TQRA 1QUPA 3NNAA 5HROA 5LXYA 1CC7A 5DETA 5CA5A 1BE4A 5CABA 1Z1ZA 3IWNC 2QX0A 1HLWA 4B08A 1HD1A 2VJVA 3UN5A 3BBFA 3HVTB 1N0VC 2X3DA 4YN3B 3GR1A 5A2QU 2HHSA 2OUGA 3J81U 5H9EK 4HL9A 4NCGB 3MM6A 2RAQA 2XMJA 2LXIA 3V81B 1Y9OA 3IO1A 2ZVIA 2Q6BA 4DL0C 2F1FA 1S1UA 4WE1B 3UN2A 3T5LA 5LXRA 2OPQB 3AJ1A 4JYAF 1PBAA 2A10A 4PEOA 1VOMA 1VGYA 2UU9J 5CYMB 2GHPA 4CO1A 1URNA 4DLGA 1N32F 2GFFA 1S0MA 3DLGA 3W3SA 4C9DA 3OSNA 3DDNA 2W1BA 3C19A 1UEVA 4RU9A 1FKAF 4DL4A 1U2CA 5ETKA 2B9WA 1RTDA 2XQCA 2Y3YA 2Q66A 1FNMA 3CVKA 2W9CB 2LDIA 4EZ9A 1G1XA 3ZTRA 5DDOC 3H5XA 3I6PA 3I5BA 3VTIA 4P2SA 4DV3J 4QIWD 2IJNA 4ECXA 4YMEA 2LA6A 2RU9A 4OLOA 2WVCA 1RTJA 3H5SA 1CVJA 3CNQP 3P96A 2R7RA 2FJXA 3MMAA 2YKAA 4DPUA 1VQ5S 3RU0A 2KT3A 3D1QA 1KHWA 4MMOA 4RW4A 1C0UA 4IG0A 2XG8A 3UD5A 2ILZA 2MSTA 5GMKa 1VQLS 5IXUA 5ETSA 3DYAB 2BR0A 5JVHQ 4G6VB 3PW4A 3HKZD 2ZWPA 5HBMA 3JXOA 4M63A 2AHOB 3LGMA 2FJEB 4PAAA 3MEDB 1SC4B 4CLLA 2WVBA 1S77D 1S1TB 1V3ZA 2KU7A 2KRRA 4JI3F 1N33J 2MZ1A 5DS7A 3MCMA 2A0FB 4X4PA 1FEEA 1YGYA 5BR8F 3NS5A 3R8YA 2FTRA 1Q86T 3PV8A 2FZKB 2DISA 3RUBL 3AHPA 4DUZJ 3UDCA 4HTJA 2PN6A 2GVZA 1LKZA 2DNYA 3DGPB 1BQXA 3ELHA 2DB1A 1FVQA 2JFDA 4KFBB 1RWOB 2DH9A 2XMWA 2AJ0A 4LSZB 3KJQB 2BQUA 1HFEL 1RA7A 4FBTA 4B3SJ 1Z4UA 4NRTA 5KFZA 4DL7A 2YWHA 1V3RA 2KJWA 1SL1A 5BJRA 3VV2B 1UKUA 5DLGA 2H48B 4UZBA 4P2FA 5HJXA 4ZHRB 4DR1J 4A8FA 2MKCA 1X5TA 2BA9A 5KFNA 1N6QB 1FDNA 2E5JA 2I5JA 2GGPA 2V9KA 4TY8B 2ZFHA 2EFQA 1WHYA 4JV2A 2H4YB 5JMNA 1EARA 3UCZP 1OPIA 4DN9A 2A3JA 2NS1B 4EGLA 4X64J 1EQMA 2JWNA 2Z0GA 1V5IB 3CJ0A 2GIFA 3K59A 2DH7A 1HNIA 4IKAA 2DEIA 2OJ3A 1N5QA 2OPRB 2NSCA 3B82A 4M5DB 1U8SA 2CJXB 2CZ9A 4A8QA 1FWLA 1TP7A 2CYYA 2WBRA 2I1RA 3EMTA 1BMQB 1HKAA 2YH0A 3CIMA 1Q8BA 4O23A 3CTRA 4DV3F 3TRGA 3G6YA 1IM4A 1RADB 3DM2B 2GMLA 4WPAA 2UUCF 4O44B 4NPOA 4C97A 4WKRA 1VQPS 2AMCB 2BUNA 4FVCA 4GKKF 1HMVA 2R4FA 3R27A 2VC1A 3P5BP 4A48A 2GQQA 2AEFA 2IBOA 4M5GA 3CJ5A 3GR0A 4IH5A 2WAQD 3GTYX 1HNVA 5KFOA 4OJ1A 1YSJA 4JI0J 2OPSA 1HQUA 4WF9Q 2MKSA 5CZVA 1HYSB 5HANA 2V8HA 2ROGA 4YB7A 1W2BR 3RRKA 3CDAA 1N5TA 1F0XA 1YK9A 4X62F 3M9OB 4CH1A 1Q5YA 2R8HA 2HNDB 3HZEA 4NLRA 2XCAA 2E5LF 3MMJA 4KY3A 3IR5B 4FP9A 3ZZRA 3BS9A 2MTLA 1R0AA 2JVRA 2VG7B 5J2MA 3PIOQ 2XMTA 4ZPWR 1Y5NB 2D7SA 2EKYA 1VRTA 1C4CA 2W24A 1QAIA 1SQFA 3PR4A 3HZGA 4X4QA 2HWHA 2RS8A 4ZCIA 4YEAA 2NXCA 4EFAC 4PWDB 4G3IA 3C46A 3FDSA 1XMQF 4L6V3 3O5TB 2R8KA 4WU2A 2XYGB 4Y34A 3CDBA 3UVJA 2XY7A 2LMIA 3ZZZA 1RTHB 1S1UB 2G0CA 3F73A 1KRPA 3KHLA 4OV6A 3ZXWA 1U47A 3MCSA 3KLHA 3I96A 3W66A 1N8RT 3DLGB 1WG4A 2UP1A 4B3RJ 4FYVB 2J7KA 2QJ3A 4EBCA 2CDQA 3LP2A 3IR7B 1QAYA 3S6EA 2MGZB 3I55S 3L7UA 4ID8A 4DU7A 2WSEC 3BSCA 4RU2A 4MH8A 4CYUB 2R8IA 3BPDA 1RAJA 4QBUA 4YS2A 4Q8FA 4QWCA 4YP3A 3HX9A 4NXNF 5K8MA 1EKSA 1NKBA 4O3PA 3LOUA 2FYXA 1F5AA 1CG2A 2AV5A 5IS2A 3W2WA 4N8OA 1UWBB 5U47A 3MMAB 3CCWA 3HVRA 1B7FA 4OLPA 2LEBA 3H5YA 2KDOA 1VHFA 3K8WA 2XWYA 4AL5A 4RW4B 1K73T 2DR8A 3HFVA 2IJRA 4IG0B 5I42A 3QGIA 3ZFVA 4CLYA 2HHHF 1JQGA 4ETZA 1YJ7A 4P9SA 3M05A 4K2JA 2B5JA 2JC0A 2FHKA 3MM7A 2L48A 5DDPC 3H7HB 2R42A 4OI6A 1OSDA 1NSAA 2C2DA 1NDLA 1H74A 3VAGA 4LQ3A 3M8QB 4KQZA 4WTOB 2J0SD 2CQPA 2VQFF 4OHYA 3MMCA 4F4AA 4DL6A 4JI4J 3OBIA 4YOEA 3DRRA 3N79A 2RH3A 3C6TB 3T1HJ 1RA6A 1G6BA 4Y2KA 4J91A 2BJEA 4G1PA 3U02A 3J80U 2GVZB 5FLXU 1FJEB 2V2ZA 3QRRA 1HNZJ 5JUMA 1KNZA 3TOQA 1RTIA 3C14A 1F6TA 1EB0A 3DRPB 4ZPTR 2UZAA 5L1IA 3LW5C 4P10A 3E2EA 3JAMU 2HS3A 3TUZC 1HNWF 3NXZA 4HDGA 4I2PA 1KWMA
chains in the Genus database with same CATH topology
3KG1A 5C24A 4QWBA 3G6XA 2I5JB 3N5FA 3KNAA 4MIWA 2W9CA 2L9NA 3JB9k 4PR6A 3SQGB 1DQAA 2UV8G 4WFAQ 2LDYA 4PQUA 3MUTP 4DFKA 5B0DA 2PD1A 2U1AA 2HLTA 2YNGB 3KYLA 4LF5F 2C3UA 5E41A 2MZQA 3QPIA 1WD6A 1IJFB 4A8MP 1FJGF 1GNKA 3IC1A 1U25A 3P3DA 2E7XA 4J5OA 1ZZFA 5B0GA 5IT0A 3IGNA 1U24A 4ZVEA 3OFEA 3J7YU 4TN2A 3T6JA 3DLHA 1WI8A 4URQU 5KG4A 3M2RB 3GFXA 4D3GA 4TLRA 2XS2A 3GE9A 5THWA 1EETB 1S6PA 2XC9A 4NLOA 2RQCA 2E9ZA 3KLIB 2YKQA 1VRUB 4IFVB 1FDBA 3OR1A 1VQ7S 1RKJA 4DSJA 3HK2A 1B64A 2HNZB 2K3KA 2J9DA 2P9EA 3NCQA 2KT5A 3O3LA 3KLFA 2QFJA 3VCDA 2CPZA 1D1UA 3KTQA 2YWKA 3HHDA 2NPIA 2YX7A 2G9OA 4G1QB 1TL1A 3TARA 2ZC3A 3H2LA 5KFJA 1IUJA 3GFHA 1DTTB 4LSLA 1FRHA 2PSZA 5CYQA 1HNIB 2XGPA 1U6ZA 1Q8IA 1TUVA 1FRIA 3S8SA 3FRYA 2WRMA 4OI2A 5T41A 2GA7A 4CO4A 3G71S 2Y1IA 3K0JA 2CQDA 3UQSA 4B17A 4BS2A 2LQ5A 2HG4A 2HWTA 2XY5A 4FPRA 4NMLA 2YX4A 1UEUA 4MFBA 2DPIA 5SZTA 4KE5A 1AW0A 1R8BA 2DNRA 4B9NA 1YJTA 2I8EA 5FJ4A 2AJ1A 1P1TA 2E66A 4A8SA 1S99A 2DNNA 4NLUA 4OX9F 5ITHA 3EZUA 4J9KA 1KOHA 1LW0B 2CQ0A 2DGOA 4LF4F 2QIFA 3BSNA 2KO1A 1HBMA 1IJEB 3EUNA 2R9LA 1HBUA 1VQ4S 1KR4A 3QGGA 2VD3A 1U49A 1P27B 1RP5A 4MK8A 5C25A 1NZAA 5KFSA 5JVGQ 1NKCA 4CH7A 4UY85 2J7UA 5D3GA 1KVJA 4DL2A 2VBYA 2YKMA 3LGNA 5HN0A 4B3TF 1FHTA 1HA1A 3U7JA 2PI4A 2PIIA 3HP6A 2MY8A 3NRBA 3GQCA 2V4RA 5EX3A 1I6JA 3G6VA 5DM7Q 2DR7A 2DHGA 3JSMB 4ES1A 2ZZMA 2WCXA 2PA3A 4Y6IA 4ZPVR 1URRA 2HAIA 3NBPA 1X4HA 2JVOA 2R2UA 1HMVB 5KFGA 1RJJA 1MSWD 4D3HA 2FLLA 2UU9F 3LUYA 1X4CA 3NNHA 4WYLA 3AJ2A 3OUYB 1SL0A 3OHBA 2BJDA 3MEDA 5F0WA 2X1BA 1DQ8A 2JLEA 2UUTA 2RU3A 4EYHB 1SKWA 1XMOF 3MM8B 3CMAS 1L3UA 4HT5A 2YTCA 1U7LA 3R5BA 4LIWA 2VKRA 4P7VA 2L9DA 3ULHA 1JJHA 2BE2B 2HHUA 4QQBA 3TAMA 2PGCA 4RW6B 3KK2B 4QWDA 1BC6A 3DLKB 2JZ5A 4QR2A 3DN9A 2IVFB 5T7LA 1SH0A 4ECZA 5EUHA 4QJVA 2OPSB 3PFOA 1ULRA 5A8WA 3M30A 1NO8A 2MQLA 1HQUB 3O6QA 3H59A 3US5A 4XO0A 1Y7PA 3AY0A 1HBNA 2JEJA 4NYZA 1JB0C 4WK1A 3FEZA 2ZM6F 3UFCX 3PKYA 1R8HA 3UD4P 4K4SA 3BR9A 3MD1A 4A47A 4EZ6A 3MM9B 1H38A 4O4GB 3LANA 4OZ0A 2M3DA 4CI0B 5HP1B 4ED2A 2FDNA 1XERA 2NZ4A 4YQWA 2RD5C 3SSRA 1NK0A 2YY3A 1F60B 2W8LA 1UETA 4A8OA 4RWWA 4YB6A 1R7IA 1TVRA 2B6AA 1OQ6A 3FJ2A 4X84A 2N7CA 3JYTA 1S9GB 3OFFA 2JEGA 3BDEA 1PC5A 5GAEU 4R8UB 2CJ9A 2AU0A 4KKOB 3LAKA 4DSIA 1MU2A 4KFBA 5HLFB 2W7PA 2J0QD 2RQKA 4C8LA 2Z2MA 1J2VA 4RLEA 3LH2S 4QW8A 1GTHA 5L1KA 2ASYA 1S1XA 2XNQA 2V94A 3DXBA 5IZHA 1YWXA 1GAOA 2D1CA 3H2UB 6FD1A 3PW0A 3TNVA 4HT7A 4NA1A 2RUGA 2W4PA 3M1VB 2KVIA 1X0FA 1U1QA 1QVGR 3H2VE 3DI6B 5AE1A 5E3CA 3E51A 2XS7A 1H7XA 5J2MB 1IXKA 1RT6B 2O66A 1UVNA 5A0YA 3NKYA 4L72B 2ZVSA 3Q2SC 2PMZD 4AQYF 4MYUA 2OO4A 2EK1A 4IDKA 3OL9A 2B4OA 1MROA 4WKYA 4PXCA 3TVZA 4JI4F 2R8GA 3QO9B 4KO0B 2LXFA 4ICLB 2VONA 4ZHRA 4E8UA 4M94A 3N6LA 5BYRA 4I6WA 4EO6A 4UOCA 1C0TB 2VPXB 4DG1A 4L3NA 2ASDA 1N6QA 3BQ2A 5H9EJ 2PFFB 1JJ4A 1SC6A 4KB7A 3E01B 2Q43A 2C3YA 4N8NA 1QVFR 3I5AA 1QUVA 3NGDA 4X4RA 3BSOA 1RT1B 4TY8A 3HF5A 1FNOA 4JV5F 2YNIB 1FF2A 2FGOA 2ZDOA 3EGZA 3I0RA 5I3UA 3SFUA 3L95X 1KFSA 2JH3A 1V9OA 5KFWA 5KFLA 4ECUA 5FIIA 2I9SA 3HVWA 4WFBQ 2X3GA 2HW3A 2UV8A 2B3TB 2CPYA 2PC6A 3AAWB 2R7XA 1Q7LB 2B4PA 4P6QA 3CT9A 1IQZA 1FKOB 2XSFA 2FLPA 3IS9B 4PWUA 4C11A 3H4DA 3F41A 4OX6A 4RNFA 4YHHF 5E2QA 5T14A 4Y2AA 4QIGA 3CCTA 4URSA 5KFCA 1S76D 2XULA 1B0PA 2DNMA 2ZNYA 2JSXA 1KC8T 3S1TA 3PX6A 2VPZB 2M52A 1TL3B 4K0KF 3ZZPA 3N4WA 3R1HA 3IGVA 2E9TA 4I2QB 2JHEA 2VODA 2GMJA 1NRKA 3NCRA 1ZH5A 2CZ4A 2MYFA 4KAIA 1VK3A 4WFNQ 2ZOFA 1RT2A 4CQ1A 1MMLA 3THVA 2EFGA 2CQCA 4Y3CA 3T1AA 1SJRA 4RX6A 3CXCR 2BOPA 1QSLA 3LWLA 2W9BB 4C3LA 3D1HA 2YWGA 5HROB 3CCLS 4EO8A 3EPIA 1HI8A 1JLGB 2MZTA 1EP4A 5HO4A 2XLIA 1N33F 5DO2A 2WB4A 4K4VA 4LIRA 2IC3B 3DMJA 2FC9A 1YQHA 1FO1A 2YNHA 3KHHA 2BVZA 3PZPA 4UY8T 2HHVA 2XSJA 5E3QA 2C22A 1VBZA 4OI1A 2VFTA 4U67Q 4F02A 2EI5A 4HH1A 4MYTA 1VQKS 1TL5A 3CCVS 4WFYA 3OR2A 2O3DA 1FEHA 2VPWB 1WF2A 4J9PA 2F8HA 2Q3PA 4H54A 2VV5A 3BGFA 2NLWA 2ZITA 4HHJA 4RBTA 1ZAWA 5L9NA 4HDHA 4MJKA 2J6SA 4OHXA 2EK6A 1TKZA 2ADCA 3I82A 4TU7A 3IN5A 1T3OA 3SXLA 1RT5B 5E7OB 4ZMMA 4DUZF 4O44A 4FS2A 2X1GA 3FSYA 4IOBA 3KWMA 3M6VA 1UVIA 4OX7A 2OAUA 4NLTA 2BRKA 3H25A 1NNDA 1TKTA 4F8RA 2ZBCA 1DTQA 1IKVB 3MM6B 1BGXT 1Q82T 4ITSA 3E8OA 5K14B 4DV4F 1VQ9S 1FVSA 2CQ3A 1CC8A 2AYMA 4J9NA 1SKSA 2F9DA 3PW7A 4IR9A 3EXYA 1FA0A 1R8AA 1AXQA 5KT6A 3RB4A 2V9WA 2QZ8A 2XMUA 3OXGA 5GVQA 1JXEA 3DOLA 4B9TA 1KTVA 4F2SA 7FDRA 4GO7X 3RRHA 3J7ZT 4B3SF 2I0XA 4DQIA 1S49A 2RRAA 4F4KA 1YJRA 3H20A 4C98A 3W2WB 3KG4A 3G8SA 1WF0A 4LF8F 2K7JA 2RRNA 3OXFA 1KFDA 5KG7A 2OSRA 3AB4B 2RF2B 4PXDA 1S10A 3I4PA 4KBIA 1YJNS 5E0OA 2IM0A 5J2QB 4WZMA 1X9SA 4DR1F 1U1KA 3PM9A 4ID5B 2ZE2A 5KFRA 2ZH1A 1KLMB 2BABA 2QMWA 1TKXA 4K4UA 3GV7B 3MZIA 1MW7A 3KMQA 4BHQA 1LXNA 3A1YG 4F50A 2N3LA 4X65F 4WFZA 3BEGB 5L39A 2ZJQQ 1WF1A 1JLBA 1LWEA 4USHA 2R7TA 1Z2LA 3PO5A 3Q2TC 1XBWA 1J5EF 4QZVB 2DPJA 2M7SA 3MMBA 1WTFA 4CZCA 1WG1A 4J9SA 2HNDA 5DG8A 2MQMA 4W90B 3ENQA 2XZWA 3I87A 1BQMA 1MWYA 4FYDA 3GG0A 1RTDB 3OL6A 2VBWA 3UE2A 2B5JB 4WYWA 2B9YA 3IXQA 4NCAA 3ZZOA 5F0UA 4X64F 1JKHA 1SIZA 3ICLA 4A8FA 1K1QA 2NPFA 4MK7A 2YWEA 3K5MA 5L38A 3FZ2A 1IBMF 2J76E 3LP1B 3KHGA 2KXFA 2VG7A 4FXWA 2IA0A 3THPA 3V6DB 2MKIA 4DSKA 3D5MA 3OVAA 4IH6A 3G6ES 2Q1LA 1Q8LA 3C6UA 1AUDA 2EPIA 3TAPA 4FF3A 3N0VA 1AFIA 3GMGA 4P7TA 3P49B 1BD6A 1HBOA 1GX5A 4QIEA 1KQKA 4U6PA 1UA0A 2AP6A 2PDAA 4TNOA 2J8AA 2GC8A 2NSBA 4FNHA 5B0AA 4PWDA 4J9LA 2YX1A 1NKEA 1RKIA 3EGNA 1RTJB 5KFAA 3MMCB 4XK8C 5KFMA 3IBWA 3CCRS 3DRRB 1JLQB 5CQGA 4A4JA 3MEGB 4I56A 2D9PA 2CPJA 1QJHA 1RYSA 3IG1A 5K8OA 2CPIA 2A2CA 4OJ3A 5EWEA 1RTHA 3VWSA 4IG3A 4OJHA 1RWUA 3CDEA 4K4XA 2GHVC 3SDEB 3LO3A 1Y4ZB 2JRSA 1ZM9A 2XGQA 2ZZNA 1LOUA 4RNMA 2ZOGA 2FVRA 4NYOA 4QIFA 3HJFA 2B7CB 4NRUA 1C0UB 3C2PA 4R5PB 4IOAQ 2FVSA 2HGMA 2KG1A 2DBBA 5DM6Q 4XDCA 1JLFB 1SL2A 1HQEA 2ZH6A 2HHTA 1RTIB 1S9EB 1X0PA 3I31A 2FIUA 1REVB 4HLBA 3V6JA 2BQRA 1VIOA 3M8PB 3MGJA 4KT0C 5AXNA 3BGRB 1FRLA 1XMBA 4N41A 3BN7A 4QYRA 4H4MB 1PGZA 3O8WA 1R43A 2E1AA 1ZM4A 1R6YA 3QLHB 3MTJA 1RT4A 3TQ1A 2CVEA 3M8SA 1VQOS 4ATNA 1IQTA 1Y0HA 2BZ2A 1M90T 5J2NA 1GX6A 4I67A 4B3OB 3OFGA 4F3OA 4DPOA 2C2EA 1W2IA 2NQPA 1KEKA 4NL5A 2DHXA 4Y0FA 1FRJA 3RB0A 4X4VA 4K50A 1UL3A 5HBMB 4EBDA 4JI7F 4U7CA 1VQYA 2PA8D 3R5DA 1KONA 3POTB 2R7VA 4I2PB 3SFGA 5KTQA 1LK7A 1TV6A 2NXUA 2VUGA 4JI0F 3TVKA 3CIZA 5I3QA 4NOHA 1BWEA 4IFYA 4Q5VA 2MGZA 3GIKA 4KJIA 3N28A 2BACA 3Q8RB 4NX9A 2MHNA 2CJKA 1M5SA 1Z2ZA 4O0IA 3K57A 5HMXA 2RDJA 4PQUB 5IT4A 3L7PA 1WNEA 1Q79A 3TA2A 4HTIA 4PCQA 2YNFB 5BYSA 2E5GA 3BQ0A 4WXWA 3KJVA 2AF6A 1LFWA 3OTCA 4DHVA 2F4VF 1P1LA 2POKA 3UW1A 3KK1A 3PJXA 4ZP6A 1DFDA 1CQNA 2DGVA 4QWEA 4C8MA 4ZOSA 3CD7A 4YUDA 2LEPA 1S6PB 4RWXA 2M8HA 3FSXA 3RB6A 1NU4A 2MHEA 1S1VA 5DQIA 5F8MA 4PUOA 3MAQA 5IM0B 3IFEA 2IFXA 3FMWA 3F44A 4KV8B 4DSFA 3OR1B 2X1FA 3HHLC 2DIVA 1SH2A 5A8KB 2N4DA 3G8QA 1ZBTA 2DD8S 5M2UA 2J9DE 5ADZA 2BW2A 5LMNF 2OPPB 2K1RA 2WHOA 2GQCA 1X4AA 1HWUA 1M5OC 3WDOA 5HL7Q 3B8HA 4N47A 1VQNS 5F3ZA 2DGQA 3KG0A 1SUQA 2IRXA 2W25A 2FHMA 5KG6A 4N76A 1N5SA 1XWLA 5CYMA 1Y00A 3DHXA 4ZK7M 3MECA 4DV7F 1GXLA 1UWBA 3MR2A 2KB2A 1JLAB 4CO3A 3SI8A 2OLWA 5KT7A 1MMDA 5J1EB 2EFNA 1WWHA 4ZPAA 5D78A 3GFYA 5FD1A 4ERDA 4BWMA 2QE5A 2C28A 2HGNA 1NJZA 3QJPA 2IRUA 4N77A 1XK8A 2DGTA 1S79A 2IM2A 2XMKA 4K2XA 4CO0A 4I6AA 5F8GA 3MFIA 2ZC4A 2P5VA 1MNEA 3MR6A 5D6GA 2W8KA 1GXTA 2E29A 2VFUA 3N9UC 1HBUB 4YR2A 2N7YA 2DVIA 1FXLA 2ABYA 4I68A 4NCBA 5C25B 1DBDA 1C1BB 4RW7B 3N6MA 3SYZA 1FRMA 5E3PA 2ROEA 5EWFA 1E6VA 1RI7A 1NJXA 3V4IA 2CPXA 2MZSA 3V6KA 4K5SA 2YKMB 2DNOA 1U1MA 4NLSA 4DX8H 3LQVA 3PDNA 3A8EA 2WTFA 4WZQA 4Y2IA 2V0NA 4X4OA 4AFFA 3WX4A 4RW9B 3DRSA 2GGPB 3DLEB 2XLKA 2VASA 1HI0P 2BM0A 2X1AA 5CD4H 3NBPB 2ZH9A 2RKIB 2ZH3A 3KLGA 1VJWA 3PRDA 5D77A 2VB6A 2R7WA 1TFYA 4V19J 2IJFA 4WIIA 3SSSA 1L3VA 3FGVA 1ZM3A 4KR0B 4X4NA 1UW4A 4F67A 1XR7A 4A8KA 4DQQA 1APSA 2MZJA 3V2UC 2ATLA 2M9KA 1VS3A 1NH7A 5DDQC 5KFIA 4C8ZA 5B0CA 3M8QA 3JSYA 2ZJRQ 2VFVA 4RBVA 3TX8A 4ALZA 4O3QA 2NUHA 3SSQA 1LV5A 4LSNB 1FTRA 3RR8A 2FLOA 2V4QA 4ECYA 2ASLA