4JI4L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLLGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji4L00
5AJ3Q 1BKBA 4TQUS 4DV4Q 2AWOA 1AH9A 3ULPA 4DUZL 3J80i 2Z6KC 2RHQB 3PF5A 4GNXB 1MJEA 2JA9A 1VQMA 2OCEA 5M3MG 1HNZL 2CKZB 1XNRQ 1HZAA 2ZM6L 4DV6L 1A8VA 3M4PA 4BY1H 1A63A 1JMCA 1XMOQ 4IJHA 1N32Q 1A62A 1HR0W 2UUBQ 2KCMA 1Q46A 3AYHB 5K36G 1TWFH 1TWCH 5M5WH 3CMAA 4P71A 4DV7Q 2E5LQ 4A3GH 3GDEA 3ULJA 5GAGC 2L15A 3SGIA 3HOZH 2HIVA 4APVA 4A93G 3ZJYC 3I56A 4A3EH 2KCTA 2F4VQ 3TS2A 1VQAA 3F2DA 5FJ8H 3I2ZA 2VQFL 3NBHB 3BZCA 3KDFA 2R6GA 3E9IA 5BR8Q 2JA7G 4R4IA 3NEMA 1BBWA 4LF9Q 1XNQQ 1X65A 2ZM6Q 2YTXA 4LFBQ 1Z9FA 3EIVA 3CC7A 2BH2A 4EX5A 4A3IH 1OTCA 4DR4L 1PV4A 3RZOH 1W3SA 3KYHC 2VZAA 1JJ2A 2LSSA 2ALYB 4GOPB 4A3KH 4L5SA 4IFDI 1OXUA 2IHEA 3KJPA 1HZ9A 5BR8L 1Q12A 4DR7Q 5C44H 1Q1BA 2N49A 1V9PA 2OQ0A 4JC0A 4KLKA 3CCLA 2ASBA 4JBWA 4JI3L 4A3EG 4GKJQ 3UDGA 1CUKA 1HZCA 1VQBA 4JG2A 1I94Q 4A3MG 4B3SL 3PO2H 1L1OA 1EUJA 3JAMi 3S1NH 4PMWA 1NY4A 2K75A 4YCUA 1Q82C 1IZ6A 2NVXH 2BH8A 4DR2Q 2I5LX 1KC8C 4C3JH 2PQAA 3STBD 5LMNQ 1YI2A 1PYSB 2LXJA 1E1OA 3W5OA 1C9OA 1VS0A 1B7YB 1Y1WH 1FJGQ 1VQLA 4AQYL 2D0OA 1GKHA 4QGUA 1PH4A 4OXPA 1N33Q 1HNWQ 2AHOB 1K8AC 3I4OA 2D0PA 1XMOL 4HIOA 1I3QH 4DK3C 1LTLA 1Y14B 1J5EL 2YU9H 1R9TH 2MFIA 2JJQA 4UY8C 2I5MX 4P74A 2E2IH 2JEAI 1HH2P 3HOYG 2AKWB 4AYBE 1KD1C 5E7NA 1JJCB 2GVBA 3AQQA 2KHJA 1OXVA 3TEHB 3L2PA 1N36Q 4QY7A 2N8NA 4OONA 2AMCB 1YHAA 4DR2L 1QUQA 3FKIG 4JI0L 4X62L 1ASZA 3H3VH 1EWIA 1KHIA 1PYBA 5M3MH 2JQOA 4YCVA 4YCWA 4A3JG 2CCZA 4JI2Q 1IBLQ 4DV7L 1YJNA 3I4MH 4JBMA 4BBSH 4A3GG 2UUBL 4DR3L 1WCMG 4JI6Q 1IYJB 1NMGA 4DUZQ 4KHZA 5GAHC 3PIOA 1MKHA 3JC66 1YHBA 1M1KC 2YYZA 3S16H 3CD6A 3FHWA 4NPSA 1B8AA 4LFCL 4DR3Q 4DV5Q 2A1AA 1RIPA 4GN3B 1U0LA 5GAEC 5JJLA 1XJVA 2OTLA 4IPHA 3RLFA 3NENA 4XTCS 1TWGH 4KHPQ 3UE1A 3MXNB 2IX0A 1I94L 5LMNW 1YIJA 3LGJA 3CPFA 3CCQA 4DV5L 3I4MG 3S1QH 2UUCQ 1SLJA 1P8LA 4A93H 4OWWB 3CCEA 2PMZE 2VL6A 3F2BA 2N78A 4DV2L 3J81i 2IHFA 2HIXA 1VQPA 4P72A 4B3TL 3GTOH 4X66L 1LUZA 2K4KA 3OTOL 2QA4A 2JA5H 2UUAL 3D0FA 4X65L 1G291 3J81j 1G6PA 2PNHA 4AQYQ 4IPCA 1CKMA 4DUYL 1SFOH 4B3SQ 5HY6A 5IP9G 1K8GA 3TRZA 1K3RA 1VQDA 4POFA 5LMNL 1VQ6A 3M4OH 5JJKA 3CXCA 2HT1A 3AEVA 3S14H 2Y0SE 1E7ZA 1UWVA 3PV0A 2UXBQ 3I4NG 1N9WA 1XNQL 3CCRA 4PZ6A 4ALPA 1I5FA 2BA1A 4JBKA 1HNWL 4MNOA 1QVCA 4JOIA 2YTYA 3RZDH 4LF4L 2E5LL 4DR5L 1KIXA 1SMXA 4QL5A 1JB7A 3KLWA 3OTOQ 3G6EA 1UE5A 4DAMA 5C4JH 2EQSA 4Y52H 4DPGA 2ES2A 4A3DH 2UXCQ 2PQAB 2Z6KA 4DV6Q 1MIUA 3G71A 1IBML 2K14A 3A0JA 1N34Q 1EOVA 2HQLA 4LF5Q 4GKJL 2PI2A 3K80C 4DV3Q 1VQ7A 4UP7A 2ZTEA 2N3SA 1IBMQ 3MEFA 3PUYA 4R1JA 3HOUH 3WWVA 1L0WA 3OW2A 2K52A 4JCVE 4OO1G 4YWKA 1S40A 2VQFQ 3J81c 2ZJPA 2GVAA 1Y1VG 2QGQA 3PUWA 1QZGA 3UDIA 3GTJH 2ZTDA 4JOIC 2VQEQ 2V1CC 5ELOA 4AYBG 4OX9Q 1M90C 3D31A 5IY0A 3HOWG 2OWOA 2KBNA 4DK6C 4BXXG 5IYBG 4C2MH 3S1RH 1YBYA 4GLAC 3F2CA 4A4IA 4HJ7A 4DNIA 1PFSA 4X66Q 1D7QA 5IWAL 1NE3A 1BBUA 2JA6G 1UE7A 3ICEA 2NZHA 5C44G 2DUDA 1X56A 4JI8Q 5C0XI 1BVSA 5GQOA 4A3CG 2RF4A 4B3RL 1PVOA 4X65Q 3GTPH 2E8GA 2CQOA 3W1BA 4JYAQ 1UEBA 2WFWA 1Q86C 4ME3A 4MTNA 4IPDA 3RN2A 1CSPA 4P73A 1EQQA 1LYLA 4GOPA 3CCMA 2JEBI 2QEXA 1XPUA 2Q2HA 3HKSA 3E0EA 4JI8L 3M3YH 1FL0A 4LW1A 4A3BG 3OYYA 1CKOA 2WB1E 2JA8H 4GLVB 3TREA 4NB3A 3T1HQ 3K7AH 2K50A 3PO3H 1XNRL 1X55A 5M5XH 1XPRA 1RL2A 4GLXA 4IFDJ 2HHHL 4WJ3M 5IYCH 3T1HL 3Q8DA 4A3FG 4A76A 3HOVG 3PUXA 5FLMG 1N36L 2I5HA 1FVIA 3M4QA 3S24A 2IX1A 4A3CH 2KHIA 3CCJA 4DV3L 4KHPL 3KF8B 3RR5A 5FJ8G 1VCIA 5IP7H 1YJWA 4GKKQ 2MNAA 4DV0L 3G48A 3E9HA 3T1YQ 1X3FA 1EIYB 3I4NH 2R7DA 3RLNA 1E1TA 5FLXc 2I0QA 2JA8G 4IPGA 1WYDA 4NXML 1SRUA 4IFDG 3K0XA 3L0OA 4HJ5A 1GO3E 4POGA 3J80c 1N34L 3JAMc 4A3IG 1HNXQ 3KF6B 1NJIC 4DR4Q 4H02A 4O0AA 4OX9L 1QVGA 1NMFA 2NVQH 1VQ9A 1PH6A 2WAQE 3B6YA 3CW2C 3F8TA 1IBKL 4C3IH 1IXRA 1EIFA 3U50C 4LF4Q 2UXDL 1N32L 4GNXA 1TWAH 1CKNA 2XTIA 4JV5Q 2R7ZH 1UE6A 2JK8A 2AWNA 2CWPA 4KI0A 1KRTA 2NZOA 3HKZE 3UDXA 4R4TA 1KRSA 4YY3L 1PH2A 1ASYA 4JI3Q 1IBKQ 1GD7A 1QZHA 1YNXA 3KDFB 2B63H 4J15A 4YY3Q 4A3DG 5IYCG 4DR1Q 3DLLA 2DGYA 2F4VL 2A8VA 4EQ5A 1K9MC 1VQ4A 4HIDA 3S2DH 3KF6A 4O2DA 4IOCA 1OXTA 3HOUG 1VQHA 3EN2A 4JI7Q 4NXNQ 1L1OB 1GVPA 1AE3A 3CQZH 5M3FH 3RN5A 3A74A 1I50H 1L1OC 2K5HA 5EAYA 1XMQL 3S17H 4LWCA 3H0GG 3NELA 4HJ8A 4GOPC 2Y0SG 2NN6G 4JI1L 3FKIH 4B3ML 2CFMA 3DM3A 1WJJA 3PUZA 3ER0A 2GN5A 4IJLA 3GTMH 2R93G 3PIPA 2R92G 3HOWH 4NXNL 2EXDA 3KFUA 4AH6A 2R7ZG 3S2HH 1FGUA 2VUMG 4YWMA 1Q7YC 4OWXB 1C7YA 4DV1Q 3HOYH 2XGTA 4R4OA 1E22A 3CPWA 4DR5Q 2JA7H 4LUVA 1UE1A 1A0IA 3IRBA 4Y7NH 4GNXC 3FP9A 4WJ4A 1Z47A 3KJOA 3CMEA 4JYAL 1WCMH 3BU2A 1VQGA 3PGZA 4MZ9A 4RG1A 3RLOA 1JT8A 3H0GH 4IO9A 4OO1I 2MO0A 4L5TA 2R93H 1U5KA 3PSIA 4BA2I 4JI6L 4A3LG 4GN4B 1J6QA 2R92H 2Q2IA 5HGQA 1SN8A 3F1ZA 1XTDA 4DV4L 1E24A 1K83H 1P16A 1VQEA 4DV0Q 1K0RA 1AE2A 4JI0Q 3CC4A 4UP8A 2UUAQ 2PI2E 5M3FG 1X3GA 3M7NA 1OXSC 4BY1G 2VNUD 2E2HH 2RHSB 4DR6L 3BJUA 5C3EH 4DUYQ 2MO1A 3CF5A 5C0XG 4JI4Q 1FJGL 1MJCA 4UP9A 2Q2UA 2VS1A 5IWAQ 3S15H 2EIFA 5ELNA 4LF8Q 1N33L 3CCSA 1Y1VH 4L5QA 1IBLL 1S72A 1X3EA 1PH8A 4JI2L 2C35B 1VQIA 1NBWA 3K81C 3AFQA 2IY5B 2B3GA 4UPAA 3GTQH 1C0AA 2CWAA 2Z0SA 5GROA 5C0XJ 3BZKA 2ATWA 3M85A 2OQKA 3H3VI 1WOCA 5IYDG 1QVFA 5IP9H 4IOAA 4B3RQ 4LF6Q 2K5NA 5JJIA 4DR6Q 4DV1L 4BBSG 5H1SE 1KXLA 1V43A 3A5UA 2VQEL 3J7ZC 3GTKH 4LF7Q 4BY7H 5J3BA 1EQRA 1LM0A 3U58A 4YHHL 1Q8KA 4A3JH 1XPOA 1VQ5A 2Q2TA 3HKZG 2F52A 3G4SA 1X9NA 1J5EQ 2E2JH 3PUVA 3CCUA 4JI1Q 5FLMH 2K5VA 1HZBA 4X64L 4YWLA 1Q81C 1K73C 1HR0L 4B3MQ 1TWHH 4DR1L 5IE8A 4PZ7A 2VY3A 4TVAB 1H95A 2A19A 2B63G 1SROA 3PO3G 1S3OA 4DAYB 2WAQG 5JEAG 1PH7A 2JE6I 4XIGS 4JI5Q 3TQYA 3UDFA 3ULLA 4B3TQ 2UXCL 2ZJQA 4R4CA 1XMQQ 1X6OA 4K0KQ 1B70B 4QIWE 3HOXG 1PA6A 1PHJA 5IYDH 2NVYH 3GD7A 5IP7G 3CAMA 1Y1WG 3U4ZA 4LUZA 1OXXK 3K7UC 3GTLH 3UE0A 4GN5A 1E3PA 2UU9Q 1VQ8A 2MQHA 5JEAJ 3U4VA 2B29A 1KQSA 1Q1EA 3EBEA 1VQNA 4LF5L 2NVTH 4FDBA 1QUQB 1JJGA 4A3MH 5IYBH 1EYGA 4QQBX 3M9BA 3TS0A 5LMUL 1WFQA 4RMFA 1DGSA 1HNXL 4BBRG 4JBJA 4LFAQ 1PH9A 1YHQA 1HNZQ 4PG3A 4C3HH 1KAWA 2JA6H 4GKKL 1CKNB 5DLQE 1SE8A 4X6AH 1VQJA 3PCOB 2UUCL 4QJFA 4LFAL 3I7FA 2D62A 1W2BA 3CCVA 3HOZG 4LFBL 4JV5L 1YJ9A 2WB1G 2YTVA 1I6HH 3HFZB 2IT1A 4A3KG 2NN6I 4DV2Q 2UXDQ 1VQFA 2FXQA 3S1MH 1NTGA 2ZTCA 4BA1I 3L7ZC 4HIKA 1N8RC 2KENA 4A3FH 3HOVH 2UU9L 4LF8L 3H15A 1SR3A 3A5ZB 5IT9c 4HJAA 4DR7L 3GTGH 2VUMH 3T1YL 4A3BH 2VW9A 1PH1A 4HIMA 4JI5L 4JI7L 2RCNA 1PH3A 1IL2A 4LUOA 3I55A 2BA0A 4P75A 4BBRH 5C3EG 4LF9L 4LFCQ 5M5YH 3RNUA 2ID0A 1VQCA 1YEZA 4GS3A 2YV5A 4X64Q 1HR0Q 4LNQA 3PO2G 2UXBL 1L2FA 1V1QA 2HHHQ 4LF6L 1YZ6A 4R4QA 1EFWA 1D8LA 4HJ9A 1KL9A 3W1GA 4LF7L 4K0KL 1WI5A 1X54A 2OTJA 1YVCA 3ERSX 1YITA 4BY7G 4DKAC 4A3LH 2ZJRA 1HJPA 1GM5A 1CSQA 4X62Q 3KOJA 3GO5A 3CC2A 2LXKA 4NXMQ 1VQKA 1TXYA 1G51A 2F3IA 4BXXH 5C4XG 1O7IA 4OWTB 5AJ3L 3STBC 3AFPA 4YHHQ 4PZ8A 4A75A 5LMUQ 2H5XA 2R7FA 4L5RC 3CP0A 3K8AA 1VQOA 3J7A5 4AIMA 1PH5A 1JE5A 2WP8J 5GADC 3HOXH 2JA5G 5C4XH 3PF4A 3VDYA 1T9HA 4JI4L
chains in the Genus database with same CATH superfamily
1BKBA 1SE4A 3BS1A 1AH9A 3NK9A 3S9WA 1SE3A 3J80i 2Z6KC 3UI2A 5JAVA 4HMJA 1VQMA 4BY1H 3M4PA 1JMCA 2K03A 4XQQA 1N32Q 1A62A 2B2VA 2UUBQ 2QW7A 4DAYA 3OWFA 3GDEA 3ULJA 3HOZH 2HIVA 2O5IC 5JVH3 3I56A 1QCBD 3F2DA 1ZKOA 2FJ2A 1R9TB 1IKMA 4R4IA 3NEMA 1BBWA 2O2LD 5IT9E 1X65A 4NDXA 1EEID 1Z9FA 4ZLTF 3RZOH 3KYHC 2LSSA 2ALYB 4GOPB 4IFDI 3KJPA 1HZ9A 5BR8L 1ICFB 2K28A 1Q12A 5DM63 4OEMB 2OQ0A 2ASBA 1EZ6A 4GKJQ 1SYCA 2XN9C 1Q3LA 4B3SL 4QF4A 1HXYD 1L1OA 1LT6D 3JAMi 4PMWA 3SK5A 2F1MA 5CORA 4RCNA 4ZUIA 1YI2A 3W5OA 5M5XB 1QE6A 3A8JE 1B7YB 1Y1WH 4IURA 4AQYL 4HEDA 3D4DA 1TWAB 2D0OA 4QGUA 1GUWA 4OXPA 2TMPA 1UNSA 3I4LA 3I4OA 2D0PA 1SNMA 1XMOL 4DK3C 1SXTA 2MFIA 1NR2A 5EGTA 1KD1C 1JJCB 3KF8A 2N8NA 2AMCB 1SDFA 1WTRA 3MXUA 4YCVA 1YJNA 2WIIB 4RAUC 2UUBL 4DR3L 1IYJB 1GUTA 4OIKA 3EA6A 4N9TA 1MKHA 2OXPA 5EKKA 3JC66 4C56C 1DD2A 1HFGA 1CHQD 1MHWC 5C3EB 1B8AA 1KNAA 4DV5Q 1HTLD 3RLFA 4RHSA 2NBFA 1YNNC 3LGJA 3I4MG 2MHVA 1STBA 1GUNA 1SLJA 4IUPA 2K05A 1E2VA 3CCEA 2K6AA 3K5LA 4DV2L 3J81i 2Z1CA 1ET6A 1X3QA 1BO0A 1O7YA 5EPLA 4H13C 2PNHA 4V190 2A69C 1RODA 1VQDA 4POFA 2HT1A 3AEVA 3S14H 2Y0SE 1HUMA 1E7ZA 5T1GA 1PZKD 2K32A 3LWUA 1N9WA 3I4NG 2Z9HA 2ZXPA 4ALPA 4JBKA 1B50A 4MNOA 1WTVA 4LF4L 3GTKB 2FINB 2E5LL 4RH6A 3NP8A 5CR3A 2R92B 1U4LA 2EQSA 4IFDH 1TR5A 5C4HA 2UXCQ 1JB3A 2Z6KA 1D5MC 1YNJC 1A2TA 2LY7A 3PUYA 5HGTA 2QKIC 2E2IB 2JA7B 1L0WA 2K52A 3M7GA 4JCVE 3TSSA 4YWKA 4DK1A 2GVAA 5IGDA 3K7AB 3PUWA 3PO3B 4J6HA 1HQRD 5ELOA 4HCEA 4AYBG 5TSSA 4OX9Q 3D31A 4DXGA 2B2TC 2KBNA 1EQVA 4DK6C 2OWOA 5IYBG 4C2MH 3S1RH 2NVQB 3ZYYX 2CH4W 3R2IA 2NTTA 1XX8A 2JA6G 3ICEA 5C44G 4B9XA 4JI8Q 5C0XI 4B3RL 2RF4A 1PTOD 2CQOA 5JOBA 1SYEA 3V05A 4ABNA 4P73A 1LYLA 4GOPA 3CCMA 2QEXA 5COYA 2B2WC 5LL6S 2Q2HA 3FDTA 4N8FA 4LW1A 4X3UA 3VA7A 4A3BG 3OYYA 4P2CB 2MP1A 1WTPA 4GLVB 4NB3A 4KD4A 1XNRL 2BE5C 3OMCA 4GLXA 2F0SA 5IGGA 5CV9A 3HOVG 3PUXA 5FLMG 1VF5C 4QB4A 3VR2A 4DXFA 3KF8B 4GKKQ 5FJ8G 2X6GA 2XVSA 3T1YQ 1X3FA 4YIJA 2R7DA 2JA8G 3S1MB 1U9RA 2AQ1B 2KJXA 1B1ZA 5KNCA 4HJ5A 4DR4Q 3I91A 3KF6B 3H09A 3RZDB 1NJIC 4OX9L 2BOSA 4CKBA 1EQTA 1LTRD 2JA6B 3PMFA 1VQ9A 3HRZC 3SK6A 4V0BA 2JYOA 1ILPA 3WOEA 3FPUB 4K8JA 2ENBA 3NQTA 1HA5A 2R7ZH 1UE6A 2FFKB 2NVTB 4YY3L 1KRTA 1KRSA 4IUUA 5EBDA 1GD7A 1YNXA 2B63H 4J15A 5KRUA 1AW7A 2DGYA 2R93B 2JP1A 3S2DH 3KF6A 4IOCA 2IX3A 2XWJB 3EN2A 2PPBC 3CQZH 1AE3A 1STEA 3RN5A 3A74A 1XMQL 2NN6G 2R93G 4IJLA 5ELBA 2R92G 2VB3X 5CC4A 4NXNL 2EXDA 3S2HH 4FXKC 3C3LA 5ELEA 4YWMA 4LJZC 4DNRB 2RDFA 2ZXOA 3QJYA 2XRQD 4R4OA 4KK7A 1F2LA 3SK4A 3WDNA 2JN4A 4LUVA 3IRBA 4Y7NH 3EJIA 4GNXC 3FP9A 4WJ4A 4I7ZC 1Z47A 4JYAL 3VYSA 1WCMH 3BU2A 4KTAA 1BBXC 3H0GH 1DCZA 2MO0A 1U5KA 3E5SA 3PSIA 4KD3A 5E3FA 1CI3M 3VR6A 1IHZA 4A3LG 1CK1A 1KLGD 1XTDA 4DN4M 1O7LA 3MHBA 3LX0A 1FYCA 1AE2A 1O80A 2UUAQ 2PI2E 1OXSC 2E2JB 4DR6L 3BJUA 5C3EH 1IW7C 3T16A 4BY7B 2E2HB 1MJCA 4UP9A 2Q2UA 1E2WA 1F9RA 1VQIA 3K81C 3QWNA 1PTOF 2E74C 3GTQH 3FEWX 1ML0D 1WVLA 1Y8PB 1CHPD 4ULLA 4LF7Q 5J3BA 3KUPA 1Q8KA 2B2UC 2K04A 2Z4HA 3SDZA 3HKZG 2CQAA 1X9NA 3ONAB 1H9JA 2A6HC 4JI1Q 1Q81C 1HR0L 2FHTA 4DR1L 1BCPC 4PZ7A 4WORA 4U673 2DJFC 3PO3G 2WAQG 2O4XA 1NUCA 3CKIB 4R4CA 3GQBA 4K0KQ 3HGBA 5CMDA 1DYQA 4TSSA 1PA6A 2NVYH 5IP7G 4LUZA 1JWUD 1OXXK 3K7UC 4K6LA 3FPPA 1LT3D 4HAEA 2F0FA 3P1HA 4K14A 1Q1EA 1VQNA 2VXWA 4FDBA 2F0TA 1EYGA 4FXGC 2K5WA 1WFQA 4KY5A 1WTXA 1HNXL 4BBRG 4JBJA 2CH4A 2K1BA 1YHQA 4C3HH 4FNFA 4GKKL 2F3WA 3PCOB 1QNUA 3DEPA 3G7LA 1WD1A 3I7FA 3CCVA 3HOZG 1JOQA 1JWSD 3P20A 1EY0A 3CQZB 4DV2Q 5E4XA 4TKOB 2C5CA 3SEBA 5FLXL 4A3DB 4LF8L 3A5ZB 5IT9c 2BE5D 3BDOA 1D5ZC 3KLSA 5C4ZA 2VW9A 1GUSA 1LTTD 4JI5L 1TY2A 1UAPA 1KDBA 3HZXA 2Z6BA 2BA0A 3MEHA 5D65A 1LTGD 3K0YA 3NBIA 5A35A 4X64Q 4GS3A 4O42A 1PFNA 4R4QA 1EFWA 4L6TB 1D8LA 3LWEA 3HG9A 1X54A 3ERSX 4BY7G 3E0JA 1A6XA 3NWSA 3S1NB 3PO2B 1EY5A 5DM73 2R3ZA 3NTKA 2JA5B 3GTPB 1RCVD 2F3IA 4Q0FA 4BXXH 4K5WA 4A3FB 1O7IA 2L4NA 4OO1H 3AFPA 4YHHQ 1FNVA 5EKLA 2R7FA 2F0NA 1VDZA 2OEOA 1DOKA 3J7A5 4C1NK 3NSWA 3VDYA 4FVMA 3HOYB 5AJ3Q 4TQUS 4A3KB 4FF2A 4BWGB 3EVQA 4DV4Q 4DUZL 3PF5A 2QILA 1BDOA 1MJEA 3H3VC 4HN7A 2JA9A 2ZT9C 2F0QA 2OCEA 1HZAA 2LMCB 1I4QA 5KNBA 1XMOQ 2VUMB 1PRTD 2B39A 3M4YA 2EYLA 2KCMA 1Q46A 1Z7TA 5K36G 4KJOA 3BDLA 4A3GH 1DM0B 4H7BA 5GAGC 5I6WA 1WTQA 4APVA 3ZJYC 3TS2A 3QB3A 5FJ8H 2VQFL 3NBHB 4CHTB 2NZ1D 2R6GA 4WJWA 1I3QB 5JVG3 1XNQQ 3T4AC 1CA5A 2L5TA 3EIVA 3CC7A 2BH2A 4EX5A 4A3IH 1OTCA 1PV4A 1JJ2A 2VZAA 1MI2A 4QMGA 4A3KH 1OXUA 5C4XB 2DY7A 3TP7A 1U4RA 2N49A 3Q0AA 2AQ2B 1CUKA 1HZCA 1VQBA 1I94Q 3PO2H 4K5XA 1EUJA 2PW5A 4M8AA 3S1NH 5I9PA 4YCUA 1IZ6A 2I5LX 2X69A 1KABA 5LMNQ 1PYSB 5I4DA 1E1OA 3K5NA 2A73B 2K7VA 1FJGQ 1PH4A 1XXGA 3MFGA 3M4OB 1HNWQ 2PZUA 4HIOA 1I3QH 1Y14B 1F77A 2YU9H 2JA8B 4C3JB 1W6JA 4P74A 2E2IH 4KKSA 3MZ5A 4AYBE 2GVBA 1OXVA 1N36Q 1K8MA 3N52A 3I4MB 1QUQA 5M9OA 1JQYD 4JI0L 1EWIA 1PYBA 5CYUA 4JI5Q 2JQOA 4YCWA 4A3JG 2A6HD 1IBLQ 1J8IA 2PNRC 1WCMG 1NMGA 3D3RA 4KHZA 3NBHA 4LK1C 1YHBA 3K59A 1D1KA 4NMZA 3S16H 3P75A 3FHWA 4NPSA 3NPPA 1EU3A 2A1AA 3OMGA 1U0LA 5LHY1 4IPHA 2F0LA 3NENA 1D5XC 1I94L 2L55A 3CCQA 1B53A 1SJHD 2UUCQ 2SOBA 3BZDB 5M3FB 1GUOA 3IL8A 5KIXA 3H0GB 2EY1A 1R4QB 2IHFA 1RDPD 4B3TL 1LUZA 1SE2A 3MXNA 2K01A 1G291 4QUFA 1JOKA 1CKMA 1SFOH 3S1RB 5CBAE 1XTCD 3M4OH 1SMYD 4ZUJA 2DNEA 3DWAA 5ISRA 2F0EA 5K36H 2MPMA 3M3YB 2D5DA 3CCRA 1G91A 1I5FA 4ILWA 3TBIB 1SMXA 3KLWA 4DPGA 1TVXA 4DV6Q 1QWYA 2K14A 3GTQB 1EOVA 2HQLA 3MVVA 3OHXC 4LF5Q 3I4NB 3A7AB 5JEAH 4DV3Q 1VQ7A 2N3SA 1IBMQ 3MEFA 4R1JA 3R2TA 1HA6A 1ESFA 1KLUD 1D6EC 4OO1G 1ENFA 1PRTC 5L37A 1I4XA 4K6DA 1Y1VG 2QGQA 1M8AA 2VQEQ 1SYGA 1YNND 5IY0A 3NTHA 5G3LF 1YBYA 4GLAC 3F2CA 4A4IA 4OHJA 2R61A 4DNIA 3VYUA 1D7QA 3BG3A 3J81L 1UE7A 1ZXTA 4OL7A 4XXEA 1BVSA 2AUKA 1WCMB 2E8GA 4RKLA 4CJ1B 2N55A 2WFWA 1LACA 4IPDA 3RN2A 1EQQA 2EVBA 4JI8L 5DEHA 1MSHA 3V2TA 1CKOA 2HCCA 4CDCC 3TREA 3T1HQ 2K50A 1XPRA 4IFDJ 2HHHL 4WJ3M 3T1HL 2EY5A 4A3FG 4A76A 1BF4A 1SYDA 3C1FA 2F0WA 3S24A 2PCFB 1Y8OB 4K5VA 2Q8IB 3AB9A 4DV3L 3NTIA 3RR5A 1VF7A 2NB0A 1YJWA 4A3BB 4JPBW 2MNAA 3A55A 3G48A 3E9HA 1EIYB 4FF1A 3I4NH 3RLNA 4QCLA 5FO9B 4IPGA 1WYDA 1SRUA 3HEJA 2IWHA 4IN3A 1HNXQ 4XYOA 3DM1A 2QDBA 3U9SA 3NE5B 4DFAA 2KCNA 2WAQE 3PIO3 2IL8A 4C3IH 4LF4Q 3U50C 1N32L 4GNXA 1TWAH 5BN3A 5C3XA 2XTIA 1X32A 1HQMC 1Y1WB 2AWNA 2CWPA 3UDXA 4DA2A 3HKZE 1C4QA 2KHSA 4J8QA 4A3EB 2DY8A 2M00A 3KDFB 5IYCG 3DLLA 1VQ4A 1TT2A 4HIDA 3F2UA 1BCPD 4O2DA 4HMIA 1OXTA 4NXNQ 4JI7Q 1QNKA 1GVPA 1L1OC 4LWCA 3NELA 4GOPC 1FGBD 3FKIH 3GTMH 2CFMA 1WJJA 1CFMA 5JPNC 1G8ZD 4LMQD 3PIPA 3HOWH 3KFUA 4AH6A 1SNQA 1BOSA 2MUYA 1STNA 2HCIA 4DV1Q 1F9SA 1D1IA 3HOYH 2WKCA 2OF1A 1U4MA 2FMCA 4HSPA 3MWYW 1UE1A 1SNPA 3J80L 2NYZD 3J7AF 3CMEA 1PZID 3X3NA 1JWMD 2PO4A 4MZ9A 3RLOA 4E6IA 1JT8A 4L8JA 2WINB 4OO1I 2MJ8A 3GTGB 4GZYC 4BA2I 3L3OC 4A3GB 3S2DB 1JC7A 2Q2IA 1SN8A 4ZK9B 2FMMA 1I6HB 4MHEA 4BY1G 4EGVA 2VNUD 4MIUA 1AN8A 1FJGL 2EE1A 5T1IA 2VS1A 3S15H 1N33L 3CCSA 3KBXA 5FLXE 1Y1VH 4L5QA 4JI2L 1X3EA 1EZ8A 3AFQA 1PFBA 3V96A 3JAME 1C0AA 2SDFA 5GROA 3BZKA 5IYDG 3VR3A 1QVFA 5JJIA 4OIJA 4DV1L 1V43A 3BVGA 3A5UA 5KNDA 3GTKH 4F87A 4BY7H 1PRTB 3L9AX 3U58A 4YHHL 4A3JH 3T51B 2Q2TA 3C1EA 2E2JH 4WRDA 3CCUA 1OO9B 4X64L 1HZBA 4YWLA 5IE8A 1KAAA 2VY3A 3OPOA 1IYVA 2B63G 1PDQA 3IFTA 1K83B 2KA7A 5ELDA 4XIGS 3D6CA 2UXCL 3KLRA 2ZJQA 1B9MA 4XQJA 3NQIA 2A69D 2CVRA 5EPKA 1Y1WG 1WTOA 1KTKA 1B9NA 2A6ED 5J1ZA 3GTLH 1DJRD 3UE0A 4GN5A 1E3PA 2UU9Q 2MQHA 5JEAJ 2B29A 5FK9C 1K28A 1QUQB 2J0TD 4ZKCB 4IUVA 3DEOA 1TY0A 5LMUL 4DR4L 1Y8NB 4LFAQ 1JE4A 1CKNB 5DLQE 1SE8A 1VQJA 4ZCKA 1SNDA 2UUCL 2D62A 1MD2D 2IT1A 4A3KG 1AFPA 3MAQA 1SNOA 1NTGA 2CW0C 1F9QA 5C3WA 5LL6X 4A3FH 2NVYB 4DR7L 4MTKA 3VR5A 4KY7A 1BCPF 2K5QA 4HIMA 1KDAA 3W2DA 1BNZA 4RA8A 4JI7L 1PH3A 4F8MA 1LTBD 5KEEA 4BBRH 5C3EG 1A3UA 5C5MA 3I8ZA 5I2YA 2ID0A 1HR0Q 2YV5A 3U9OA 2UXBL 1CZWA 1L2FA 4LF6L 3RD4A 2I07B 4B08A 1WI5A 5J39A 1YVCA 4DKAC 2ZJRA 2H4OA 1GM5A 3GTOB 1CSQA 2SNSA 1VQKA 1TXYA 1BQQT 3QIAA 1GHJA 1RF2D 4OWTB 2X6LA 4PZ8A 1VMCA 4A75A 3CP0A 1VQOA 1PH5A 1JE5A 2WP8J 5GADC 4EQNA 3HOXH 5EJWA 4CJ0B 4LNQA 2LKVA 2RKSA 1AP0A 5DAUA 2AWOA 5CV4A 4UHVA 3GV3A 2EYPA 4GNXB 1EYDA 1E2ZA 4X3SA 1HNZL 4DV6L 4R9WA 2LS01 3QOLA 4RCOA 4G57A 3AYHB 3BYYB 4KV6A 2E5LQ 4IUNA 1UEAB 4CBVA 3SGIA 3A7LA 1LV9A 1AZQA 2Q8TA 4A3EH 2F4VQ 1EOTA 2H1EA 5AFWA 5IGFA 4Y7NB 2XWBB 4R8NA 2R7ZB 3BZCA 1NCVA 5EQ0A 3BVMA 3E9IA 2WAQB 2JA7G 4LF9Q 1FNUA 1V8QA 4RGNA 2F0PA 3RUZA 3MC0B 2C9OA 1NNXA 3R8BA 2IHEA 1PTOB 1V9PA 2EZVA 4KLKA 3CCLA 1EU4A 4JBWA 3GTLB 3A56A 2M9VA 1TQOA 3RMHA 1XYIA 4RHRA 5JJZA 3UDGA 4JG2A 1ZYRC 4XDXA 5DNFA 2WV6D 1NY4A 2K75A 1Q82C 4CJ2C 2BH8A 4DR2Q 2PQAA 3A54A 4LAAA 1C9OA 1V1OA 3R3OA 3J7YW 1O78A 1GKHA 1R4PB 2L1BA 1PFMA 3H6MA 1J9OA 3IFDA 2JJQA 3S17B 2I5MX 2AKWB 2KEEA 3TEHB 2KECA 4QY7A 4OONA 1YHAA 4DR2L 4J1MA 1AZPA 3K57A 4X62L 1KHIA 5M3MH 4BBSH 2SNMA 2CCZA 1S5CD 4JI2Q 4DV7L 2RVLA 2BDOA 1DZ1A 2PQEA 4DUZQ 4DF7A 3PIOA 5F2DA 3Q22A 3G6JB 1EY7A 5D3DA 2EOTA 4F7XA 1MBYA 2KEDA 5GAEC 4NP5A 1I4PA 1XJVA 4XTCS 4A3MB 1TWGH 1BXTA 2IX0A 5LMNW 3S1QH 2RDHA 2PYKA 2F0UA 2KOLA 3O13A 1P8LA 4A93H 1EYCA 5C0XH 4OWWB 2VL6A 1B3QA 2XNAC 2F0HA 5EPJA 1VQPA 4CDDC 3PQIA 4P72A 3GTOH 3DWQA 2JA5H 4KHVA 5KYLA 1MSGA 3D0FA 4X65L 3J81j 1Y1VB 3S1QB 5NUCA 3H91A 2F0VA 3D4RA 4DUYL 1T5EA 4B3SQ 5IP9G 3D6WA 5LMNL 1VQ6A 5JJKA 3WOFA 2NTSA 1UWVA 1GHKA 1HUNA 1I4GA 1HNWL 4JOIA 4FF4A 3VYTA 1G2SA 3DHQA 4DR5L 4QL5A 1JB7A 3I3CA 4Y52H 5M3MB 1MIUA 4I7AA 3G71A 2F03A 3A0JA 1N34Q 4GKJL 2F0IA 1HCZA 3HOUH 2LFNA 2HD3A 2ZJPA 1ICWA 4HR7B 1QZGA 3GTJH 2ZTDA 3C2PA 2V1CC 3A8KE 3TMEA 1M90C 4NKLA 3SVMA 2B2TA 4BXXG 1ENAA 1F2ZA 1IKLA 1PFSA 4KN4C 3KLSX 1BBUA 2NZHA 3DMUA 1X56A 4KY6A 1PVOA 1G2TA 2D9UA 3W1BA 4JW0A 1UEBA 1Q86C 2WKDA 1CSPA 1TS2A 4O1NA 3M3YH 1STYA 3DUZA 2WB1E 2RSOA 1EIHA 1S5FD 5FO7B 1Y69U 1D2BA 1X55A 1RL2A 2EJGC 2A68C 3Q8DA 2I5HA 2IX1A 4A3CH 4RKBA 2KHIA 3CCJA 2O5JC 2BDNA 2JSOA 1VCIA 3LNNA 3I70A 5FLXc 2HUGA 2I0QA 1F2YA 3EQLC 4FYDA 4IFDG 1EFID 3EFXD 3J80c 4POGA 3JAMc 3K5OA 4A3IG 1CQVA 3QO2A 1QVGA 1NMFA 3ITPA 3F8TA 3CW2C 2B2WA 1IBKL 1X3PA 3SR1A 2UXDL 1W6KA 1CKNA 2Q8RE 4DNTB 4KI0A 1NAPA 2NZOA 2A68D 1SFOB 1RTNA 1ASYA 4JI3Q 3OSOA 3HOXB 3BYTB 1QG7A 1QZHA 3VA5A 4HSVA 4A3DG 4YY3Q 2F0OA 3Q23A 2L12A 4EQ5A 4K8IA 1EWHA 5C4JB 3QOJA 1L1OB 1ESRA 1IW7D 5M3FH 2RBMA 2HDLA 2K5HA 5EAYA 3S17H 4G7OC 2JA8H 2Y0SG 4JI1L 3URYA 4ZKBB 3PUZA 3ER0A 2GN5A 3JAML 4FF3A 3OOCA 1FGUA 4KMUC 5D3IB 3CRLC 1C7YA 1EIGA 1F9PA 1EWCA 1DXMA 3D4WA 1E22A 3S16B 2L9HA 2AQ3B 3DXJC 3IAYA 4DR5Q 1SJED 2Z8LA 3OWEB 1A0IA 4MN3A 1LLRD 5CV7A 3PGZA 4G4KA 4IO9A 2KVMA 1UUPA 4RFBA 4JI6L 4FO2A 2B63B 5HGQA 3F1ZA 4B9WA 4KKTA 1DOLA 3GP7A 1VQEA 2J4XA 5C6AA 1K0RA 1TWHB 2F4IA 2G9DA 4UP8A 5M3FG 2YU9B 1X3GA 3HP3A 2E2HH 3KBGA 4G7ZC 3A8IE 2MO1A 2EXZA 4ZAIA 3X3MA 1WTWA 1S5DD 1G6ZA 2EIFA 4LF8Q 2XRSD 1GUGA 4HTHA 1IBLL 3R93A 1S72A 1EY6A 1PH8A 1MGSA 2C35B 1EL0A 1SAPA 4DAPA 1Z6HA 2Z0SA 5C0XJ 2K33A 2ATWA 2XIWA 3TP5A 1B4OA 2OQKA 1GOZA 4B3RQ 5IP9H 2QF7A 4DR6Q 4I65A 3J7ZC 5ELFA 1ZEQX 1HRJA 4C3HG 1EQRA 3RZOB 1VQ5A 1CT1D 2F52A 3G4SA 5C4XG 3PUVA 1EY8A 2F0DA 4L5RC 2B8FA 1TWHH 4H44C 1T5XD 1S5ED 1H9KA 2A19A 2XSCA 5M5YB 1PH7A 5JEAG 2JE6I 3UDFA 3MA2B 3ULLA 4B3TQ 1ENCA 2EYHA 1PYWD 1X6OA 1B70B 3HOXG 3HOZB 3OIQA 5I9OA 4EVOA 3U4ZA 5KGUA 4PQXA 2RA4A 3U4VA 2EJFC 2NVTH 1JJGA 2KUMA 4A3MH 3KK7A 5IYBH 1LTSD 3M9BA 4RGMA 4RMFA 1HNZQ 2K5DA 1CQFA 1KAWA 2L11A 4X6AH 3E6ZX 4QJFA 1W2BA 1A3VA 1I6HH 2WB1G 3QR8A 3HFZB 1VQFA 1FR3A 2FXQA 3K5MA 2ZTCA 4BA1I 3L7ZC 1N8RC 2KENA 1TWFB 5M5WB 3HOVH 4EQPA 3H15A 1SR3A 4HJAA 4PMBA 3GTGH 4IALA 1ILQA 2WACA 4A3BH 1RJTA 1BCPB 4Z9CB 2RCNA 1IL2A 1PLFA 4LF9L 4LFCQ 3RNUA 1V1PA 3PO2G 3ND9A 2DNCA 2A74C 4ODGA 2HHHQ 1YZ6A 5BN5A 4HJ9A 3S14B 4HCSA 3W1GA 5IGBA 4LF7L 4K0KL 4JVZA 1JICA 1YITA 2G5DA 1SBBB 4A3LH 2QEJC 1HJPA 2NUCA 5G3LD 3FKIB 3GTMB 4XT3B 3KOJA 3GO5A 1A3TA 5CGKA 3MFYA 4PNYA 2LXKA 4IUQA 4NXMQ 2OT2A 1G51A 5CBEE 1IYUA 2E75C 2A6EC 2D2CC 3STBC 4C3IG 2H5XA 3DWPA 2EY6A 5E4WC 3MTSA 2JA5G 2IW3A 2HDMA 1T9HA 2PZWA 3GTJB 2DJGC 2F0GA 2WB1B 3ULPA 1GXDC 4DAVA 2RHQB 4RWSC 1U4PA 5HURA 5M3MG 1LTID 2CKZB 1XNRQ 2ZM6L 1A2UA 3C46A 1A8VA 1A63A 1ET9A 4IJHA 3T53B 1HR0W 5KYIA 1NSNS 3HS0C 1TWFH 1TWCH 5M5WH 3CMAA 4P71A 4DV7Q 2NWGA 5A2QL 1WD0A 4A93G 2L15A 3N6RA 5IOCA 1TWCB 1H9MA 2KCTA 1VQAA 3S15B 1EYAA 3I2ZA 5EBCA 3MXPA 1I6VC 3BDCA 5FKAC 1II3A 3KDFA 2PZTA 5BR8Q 1Q8IA 4LFBQ 2ZM6Q 4JK1C 2YTXA 5E1FA 4ZYSA 1SYBA 4K2LA 1W3SA 1B44D 2M2LA 5IGCA 3GV6A 4L5SA 5C5LA 4OGQC 3T56B 3FRPB 4DR7Q 5C44H 2EYMA 2KQ3A 1Q1BA 4JC0A 2QDLA 4JI3L 4A3EG 4R8IA 5K5PA 1JR0D 4ME5A 3CU7A 4A3MG 3FVQA 2N88A 2NVXH 2EYOA 1CM9A 1Q90A 2PW7A 1KC8C 4C3JH 3STBD 2ICEC 1A15A 2LXJA 1VS0A 1AEXA 1S5BD 1VQLA 3OIPA 1YNJD 1N33Q 2AHOB 1CA6A 2F0KA 5IIFA 1K8AC 4XQNA 4A3JB 1LTLA 1J5EL 1R9TH 4UY8C 2JEAI 1HH2P 3J81E 4QUCA 3HOYG 1GJXA 5E7NA 1PMRA 3L2PA 3AQQA 2KHJA 1DOMA 3CRKC 5J22A 3Q24A 4KKUA 4ZQ3A 1PXUA 1LT5D 1STHA 3FKIG 2PMZB 1ASZA 3H3VH 4IOAA 3I4MH 4JBMA 3I73A 3Q6SA 4A3GG 4C2MB 3OW7A 4JI6Q 3W3AA 3NWTA 4WFN3 5GAHC 1L0XB 3MXGA 4DU9A 1M1KC 2YYZA 1L0YB 3CD6A 4DK0A 1PTOC 1HPCA 4X3KA 1EY4A 4LFCL 4DR3Q 1M4VA 1RIPA 4GN3B 5JJLA 2OTLA 2EY2A 3VR4A 4KHPQ 3NUCA 3MXNB 3UE1A 1TKWB 4C1NI 1YIJA 3CPFA 4DV5L 4UDUC 1I50B 4RGTA 2PMZE 2A5HA 5IT9L 4XYQA 3F2BA 2N78A 2HIXA 1RD9D 3EROA 4X66L 2K4KA 3OTOL 2QA4A 2UUAL 1G6PA 4AQYQ 4IPCA 3SK8A 2HQEA 5HY6A 1K8GA 1C8CA 3TRZA 1K3RA 2RSNA 1PZJD 3CXCA 2F0JA 3PV0A 2UXBQ 3ND8A 1XNQL 2IJ0A 4PZ6A 2G9HD 2BA1A 1QVCA 2YTYA 3RZDH 3J80E 1KIXA 3OTOQ 3G6EA 1TS3A 2SEBD 1UE5A 2MGSA 4DAMA 5C4JH 2ES2A 4A3DH 2PQAB 1IBML 2PI2A 3K80C 1RHPA 2GA4B 5I2XA 4UP7A 2ZTEA 3WWVA 1TIID 3OW2A 3SXHA 1S40A 3TP8A 3K58A 2VQFQ 3J81c 4X3TA 2EDGA 3UDIA 1LABA 4JOIC 2P5ZX 1SYFA 1JORA 1C48A 2V4DA 4C3IB 5FO8B 3HOWG 1O7ZA 3NXWA 4HJ7A 1H9RA 2Z4IA 4X66Q 5IWAL 1NE3A 2TSSA 2DUDA 4QIWB 5GQOA 4CGYB 4A3CG 4X65Q 3GTPH 1RTOA 3D8GA 4JYAQ 1TS5A 4ME3A 4MTNA 2JEBI 1XPUA 1I4RA 3HKSA 3E0EA 1XWEA 1FL0A 1H9SB 2E76C 3I90A 1DONA 4BS9A 3K7AH 3PO3H 4C3JG 5M5XH 3TP6A 5IYCH 3TZDA 1N36L 4UAIA 1FVIA 3M4QA 3IKJA 2NVXB 4DGZA 1CZGA 4KHPL 5IP7H 4DV0L 5ELCA 1E1TA 2AUJD 2EPBA 4FP5D 5FOBB 4NXML 3TDQA 3K0XA 4M1UB 3L0OA 1GO3E 1STAA 2KCCA 3SE0A 1N34L 4H02A 4O0AA 1STGA 2NVQH 1EY9A 1PH6A 3PIP3 1HTPA 1B3AA 2IPKD 3B6YA 1IXRA 1EIFA 4JV5Q 2EYJA 3I72A 2JK8A 3HOUB 1PH2A 4R4TA 1HHVA 1IBKQ 2B2VC 1B2TA 2F3VA 4DR1Q 2F4VL 3TZUA 2A8VA 5CV6A 1K9MC 2B2UA 1RKNA 3HOUG 1VQHA 1QJOA 1KDCA 3P7JA 1F2MA 5JPMC 1I50H 4HJ8A 3H0GG 1ONLA 3HKZB 4B3ML 3DM3A 2R7ZG 3BVZA 2BCOA 3SHLA 2VUMG 1LTAD 1Q7YC 4OWXB 5IGEA 2XGTA 1FD7D 3CPWA 4KN7C 2CHBD 2JA7H 4IZ8A 4CKCA 4PMCA 3J7AV 3KJOA 4ZRZA 2E2DC 1VQGA 1BUVT 4RG1A 1IL8A 1K0SA 5EKIA 4L5TA 2R93H 2NN6H 3VYRA 4GN4B 1J6QA 2R92H 4FXDA 4DV4L 1E24A 1K83H 1P16A 1WTHA 4PV1C 4DV0Q 2ICIA 3K6OA 4JI0Q 4F88A 3CC4A 5IODA 3M7NA 2I46A 2RHSB 4L63B 4OELB 4DUYQ 3TN2A 4CDEC 3CF5A 1VMPA 5C0XG 4JI4Q 3CHBD 1ZYRD 4H0LC 5IWAQ 5ELNA 2CW0D 1NBWA 2IY5B 1SMYC 2B3GA 4UPAA 1SEBD 1CTMA 1EEFD 4KJNA 4RGOS 5D14A 2CWAA 3M85A 3H3VI 2B8GA 1WOCA 4K2KA 4LF6Q 2K5NA 4BBSG 5H1SE 4IQZA 5C44B 1KXLA 2VQEL 2RQXA 3AMUA 1LM0A 4EQOA 1XPOA 2JXMB 2Y0SB 1J5EQ 4ID6A 4XT1B 5FLMH 4B3MQ 2K5VA 3HOWB 1K73C 2ZXRA 1H95A 1S4ZA 4TVAB 1KNEA 1SROA 4NW2A 4BBRB 3NHHA 3QG1A 1S3OA 4DAYB 2EJMA 2J7ZA 3TQYA 1V1PB 2B2YA 3AU7A 1XMQQ 4QIWE 1PHJA 2RCFA 5IYDH 4CDFC 3GD7A 3CAMA 4N9PA 2F0MA 4A93B 1TWGB 1BR9A 3E3XA 1VQ8A 1KQSA 2QCPX 3EBEA 4U68A 4LF5L 1TS4A 4TRDA 4G7HC 1JOOA 1QOHA 4QQBX 3TS0A 1SSOA 3T13A 4CKEA 1FNWA 4A3IB 5CV5A 1DGSA 1NR4A 1PH9A 2JA6H 4PG3A 1K8OA 3FMCA 1LT4D 4LFAL 4LFBL 1TU2B 4JV5L 1YJ9A 2YTVA 2NN6I 2UXDQ 3S1MH 1K3BC 4HIKA 2RDGA 2UU9L 4BBSB 3H94A 2VUMH 3T1YL 1PH1A 4LUOA 3I55A 4P75A 4C3HB 5M5YH 1VQCA 1YEZA 5BN4A 2VB2X 1E0BA 1V1QA 5A2QE 2B2YC 1I4HA 1KL9A 3S2HB 2OTJA 2L0CA 1SNCA 4X62Q 1H9SA 3CC2A 2DN8A 5I6YA 5CV8A 1LO5D 3HOVB 5AJ3L 4S3SA 4IUTA 4AYBB 1HFNA 1JCKB 1PTOH 5LMUQ 4N8X1 1PRTF 3K8AA 2EYFA 3ERQA 4Q5VA 4AIMA 4BY1B 1QILA 1QB5D 5C4XH 3PF4A 4JI4L
chains in the Genus database with same CATH topology
5AJ3Q 1BKBA 4TQUS 4DV4Q 2AWOA 1AH9A 3ULPA 4DUZL 3J80i 2Z6KC 2RHQB 3PF5A 4GNXB 1MJEA 2JA9A 1VQMA 2OCEA 5M3MG 1HNZL 2CKZB 1XNRQ 1HZAA 2ZM6L 4DV6L 1A8VA 3M4PA 4BY1H 1A63A 1JMCA 1XMOQ 4IJHA 1N32Q 1A62A 1HR0W 2UUBQ 2KCMA 1Q46A 3AYHB 5K36G 1TWFH 1TWCH 5M5WH 3CMAA 4P71A 4DV7Q 2E5LQ 4A3GH 3GDEA 3ULJA 5GAGC 2L15A 3SGIA 3HOZH 2HIVA 4APVA 4A93G 3ZJYC 3I56A 4A3EH 2KCTA 2F4VQ 3TS2A 1VQAA 3F2DA 5FJ8H 3I2ZA 2VQFL 3NBHB 3BZCA 3KDFA 2R6GA 3E9IA 5BR8Q 2JA7G 4R4IA 3NEMA 1BBWA 4LF9Q 1XNQQ 1X65A 2ZM6Q 2YTXA 4LFBQ 1Z9FA 3EIVA 3CC7A 2BH2A 4EX5A 4A3IH 1OTCA 4DR4L 1PV4A 3RZOH 1W3SA 3KYHC 2VZAA 1JJ2A 2LSSA 2ALYB 4GOPB 4A3KH 4L5SA 4IFDI 1OXUA 2IHEA 3KJPA 1HZ9A 5BR8L 1Q12A 4DR7Q 5C44H 1Q1BA 2N49A 1V9PA 2OQ0A 4JC0A 4KLKA 3CCLA 2ASBA 4JBWA 4JI3L 4A3EG 4GKJQ 3UDGA 1CUKA 1HZCA 1VQBA 4JG2A 1I94Q 4A3MG 4B3SL 3PO2H 1L1OA 1EUJA 3JAMi 3S1NH 4PMWA 1NY4A 2K75A 4YCUA 1Q82C 1IZ6A 2NVXH 2BH8A 4DR2Q 2I5LX 1KC8C 4C3JH 2PQAA 3STBD 5LMNQ 1YI2A 1PYSB 2LXJA 1E1OA 3W5OA 1C9OA 1VS0A 1B7YB 1Y1WH 1FJGQ 1VQLA 4AQYL 2D0OA 1GKHA 4QGUA 1PH4A 4OXPA 1N33Q 1HNWQ 2AHOB 1K8AC 3I4OA 2D0PA 1XMOL 4HIOA 1I3QH 4DK3C 1LTLA 1Y14B 1J5EL 2YU9H 1R9TH 2MFIA 2JJQA 4UY8C 2I5MX 4P74A 2E2IH 2JEAI 1HH2P 3HOYG 2AKWB 4AYBE 1KD1C 5E7NA 1JJCB 2GVBA 3AQQA 2KHJA 1OXVA 3TEHB 3L2PA 1N36Q 4QY7A 2N8NA 4OONA 2AMCB 1YHAA 4DR2L 1QUQA 3FKIG 4JI0L 4X62L 1ASZA 3H3VH 1EWIA 1KHIA 1PYBA 5M3MH 2JQOA 4YCVA 4YCWA 4A3JG 2CCZA 4JI2Q 1IBLQ 4DV7L 1YJNA 3I4MH 4JBMA 4BBSH 4A3GG 2UUBL 4DR3L 1WCMG 4JI6Q 1IYJB 1NMGA 4DUZQ 4KHZA 5GAHC 3PIOA 1MKHA 3JC66 1YHBA 1M1KC 2YYZA 3S16H 3CD6A 3FHWA 4NPSA 1B8AA 4LFCL 4DR3Q 4DV5Q 2A1AA 1RIPA 4GN3B 1U0LA 5GAEC 5JJLA 1XJVA 2OTLA 4IPHA 3RLFA 3NENA 4XTCS 1TWGH 4KHPQ 3UE1A 3MXNB 2IX0A 1I94L 5LMNW 1YIJA 3LGJA 3CPFA 3CCQA 4DV5L 3I4MG 3S1QH 2UUCQ 1SLJA 1P8LA 4A93H 4OWWB 3CCEA 2PMZE 2VL6A 3F2BA 2N78A 4DV2L 3J81i 2IHFA 2HIXA 1VQPA 4P72A 4B3TL 3GTOH 4X66L 1LUZA 2K4KA 3OTOL 2QA4A 2JA5H 2UUAL 3D0FA 4X65L 1G291 3J81j 1G6PA 2PNHA 4AQYQ 4IPCA 1CKMA 4DUYL 1SFOH 4B3SQ 5HY6A 5IP9G 1K8GA 3TRZA 1K3RA 1VQDA 4POFA 5LMNL 1VQ6A 3M4OH 5JJKA 3CXCA 2HT1A 3AEVA 3S14H 2Y0SE 1E7ZA 1UWVA 3PV0A 2UXBQ 3I4NG 1N9WA 1XNQL 3CCRA 4PZ6A 4ALPA 1I5FA 2BA1A 4JBKA 1HNWL 4MNOA 1QVCA 4JOIA 2YTYA 3RZDH 4LF4L 2E5LL 4DR5L 1KIXA 1SMXA 4QL5A 1JB7A 3KLWA 3OTOQ 3G6EA 1UE5A 4DAMA 5C4JH 2EQSA 4Y52H 4DPGA 2ES2A 4A3DH 2UXCQ 2PQAB 2Z6KA 4DV6Q 1MIUA 3G71A 1IBML 2K14A 3A0JA 1N34Q 1EOVA 2HQLA 4LF5Q 4GKJL 2PI2A 3K80C 4DV3Q 1VQ7A 4UP7A 2ZTEA 2N3SA 1IBMQ 3MEFA 3PUYA 4R1JA 3HOUH 3WWVA 1L0WA 3OW2A 2K52A 4JCVE 4OO1G 4YWKA 1S40A 2VQFQ 3J81c 2ZJPA 2GVAA 1Y1VG 2QGQA 3PUWA 1QZGA 3UDIA 3GTJH 2ZTDA 4JOIC 2VQEQ 2V1CC 5ELOA 4AYBG 4OX9Q 1M90C 3D31A 5IY0A 3HOWG 2OWOA 2KBNA 4DK6C 4BXXG 5IYBG 4C2MH 3S1RH 1YBYA 4GLAC 3F2CA 4A4IA 4HJ7A 4DNIA 1PFSA 4X66Q 1D7QA 5IWAL 1NE3A 1BBUA 2JA6G 1UE7A 3ICEA 2NZHA 5C44G 2DUDA 1X56A 4JI8Q 5C0XI 1BVSA 5GQOA 4A3CG 2RF4A 4B3RL 1PVOA 4X65Q 3GTPH 2E8GA 2CQOA 3W1BA 4JYAQ 1UEBA 2WFWA 1Q86C 4ME3A 4MTNA 4IPDA 3RN2A 1CSPA 4P73A 1EQQA 1LYLA 4GOPA 3CCMA 2JEBI 2QEXA 1XPUA 2Q2HA 3HKSA 3E0EA 4JI8L 3M3YH 1FL0A 4LW1A 4A3BG 3OYYA 1CKOA 2WB1E 2JA8H 4GLVB 3TREA 4NB3A 3T1HQ 3K7AH 2K50A 3PO3H 1XNRL 1X55A 5M5XH 1XPRA 1RL2A 4GLXA 4IFDJ 2HHHL 4WJ3M 5IYCH 3T1HL 3Q8DA 4A3FG 4A76A 3HOVG 3PUXA 5FLMG 1N36L 2I5HA 1FVIA 3M4QA 3S24A 2IX1A 4A3CH 2KHIA 3CCJA 4DV3L 4KHPL 3KF8B 3RR5A 5FJ8G 1VCIA 5IP7H 1YJWA 4GKKQ 2MNAA 4DV0L 3G48A 3E9HA 3T1YQ 1X3FA 1EIYB 3I4NH 2R7DA 3RLNA 1E1TA 5FLXc 2I0QA 2JA8G 4IPGA 1WYDA 4NXML 1SRUA 4IFDG 3K0XA 3L0OA 4HJ5A 1GO3E 4POGA 3J80c 1N34L 3JAMc 4A3IG 1HNXQ 3KF6B 1NJIC 4DR4Q 4H02A 4O0AA 4OX9L 1QVGA 1NMFA 2NVQH 1VQ9A 1PH6A 2WAQE 3B6YA 3CW2C 3F8TA 1IBKL 4C3IH 1IXRA 1EIFA 3U50C 4LF4Q 2UXDL 1N32L 4GNXA 1TWAH 1CKNA 2XTIA 4JV5Q 2R7ZH 1UE6A 2JK8A 2AWNA 2CWPA 4KI0A 1KRTA 2NZOA 3HKZE 3UDXA 4R4TA 1KRSA 4YY3L 1PH2A 1ASYA 4JI3Q 1IBKQ 1GD7A 1QZHA 1YNXA 3KDFB 2B63H 4J15A 4YY3Q 4A3DG 5IYCG 4DR1Q 3DLLA 2DGYA 2F4VL 2A8VA 4EQ5A 1K9MC 1VQ4A 4HIDA 3S2DH 3KF6A 4O2DA 4IOCA 1OXTA 3HOUG 1VQHA 3EN2A 4JI7Q 4NXNQ 1L1OB 1GVPA 1AE3A 3CQZH 5M3FH 3RN5A 3A74A 1I50H 1L1OC 2K5HA 5EAYA 1XMQL 3S17H 4LWCA 3H0GG 3NELA 4HJ8A 4GOPC 2Y0SG 2NN6G 4JI1L 3FKIH 4B3ML 2CFMA 3DM3A 1WJJA 3PUZA 3ER0A 2GN5A 4IJLA 3GTMH 2R93G 3PIPA 2R92G 3HOWH 4NXNL 2EXDA 3KFUA 4AH6A 2R7ZG 3S2HH 1FGUA 2VUMG 4YWMA 1Q7YC 4OWXB 1C7YA 4DV1Q 3HOYH 2XGTA 4R4OA 1E22A 3CPWA 4DR5Q 2JA7H 4LUVA 1UE1A 1A0IA 3IRBA 4Y7NH 4GNXC 3FP9A 4WJ4A 1Z47A 3KJOA 3CMEA 4JYAL 1WCMH 3BU2A 1VQGA 3PGZA 4MZ9A 4RG1A 3RLOA 1JT8A 3H0GH 4IO9A 4OO1I 2MO0A 4L5TA 2R93H 1U5KA 3PSIA 4BA2I 4JI6L 4A3LG 4GN4B 1J6QA 2R92H 2Q2IA 5HGQA 1SN8A 3F1ZA 1XTDA 4DV4L 1E24A 1K83H 1P16A 1VQEA 4DV0Q 1K0RA 1AE2A 4JI0Q 3CC4A 4UP8A 2UUAQ 2PI2E 5M3FG 1X3GA 3M7NA 1OXSC 4BY1G 2VNUD 2E2HH 2RHSB 4DR6L 3BJUA 5C3EH 4DUYQ 2MO1A 3CF5A 5C0XG 4JI4Q 1FJGL 1MJCA 4UP9A 2Q2UA 2VS1A 5IWAQ 3S15H 2EIFA 5ELNA 4LF8Q 1N33L 3CCSA 1Y1VH 4L5QA 1IBLL 1S72A 1X3EA 1PH8A 4JI2L 2C35B 1VQIA 1NBWA 3K81C 3AFQA 2IY5B 2B3GA 4UPAA 3GTQH 1C0AA 2CWAA 2Z0SA 5GROA 5C0XJ 3BZKA 2ATWA 3M85A 2OQKA 3H3VI 1WOCA 5IYDG 1QVFA 5IP9H 4IOAA 4B3RQ 4LF6Q 2K5NA 5JJIA 4DR6Q 4DV1L 4BBSG 5H1SE 1KXLA 1V43A 3A5UA 2VQEL 3J7ZC 3GTKH 4LF7Q 4BY7H 5J3BA 1EQRA 1LM0A 3U58A 4YHHL 1Q8KA 4A3JH 1XPOA 1VQ5A 2Q2TA 3HKZG 2F52A 3G4SA 1X9NA 1J5EQ 2E2JH 3PUVA 3CCUA 4JI1Q 5FLMH 2K5VA 1HZBA 4X64L 4YWLA 1Q81C 1K73C 1HR0L 4B3MQ 1TWHH 4DR1L 5IE8A 4PZ7A 2VY3A 4TVAB 1H95A 2A19A 2B63G 1SROA 3PO3G 1S3OA 4DAYB 2WAQG 5JEAG 1PH7A 2JE6I 4XIGS 4JI5Q 3TQYA 3UDFA 3ULLA 4B3TQ 2UXCL 2ZJQA 4R4CA 1XMQQ 1X6OA 4K0KQ 1B70B 4QIWE 3HOXG 1PA6A 1PHJA 5IYDH 2NVYH 3GD7A 5IP7G 3CAMA 1Y1WG 3U4ZA 4LUZA 1OXXK 3K7UC 3GTLH 3UE0A 4GN5A 1E3PA 2UU9Q 1VQ8A 2MQHA 5JEAJ 3U4VA 2B29A 1KQSA 1Q1EA 3EBEA 1VQNA 4LF5L 2NVTH 4FDBA 1QUQB 1JJGA 4A3MH 5IYBH 1EYGA 4QQBX 3M9BA 3TS0A 5LMUL 1WFQA 4RMFA 1DGSA 1HNXL 4BBRG 4JBJA 4LFAQ 1PH9A 1YHQA 1HNZQ 4PG3A 4C3HH 1KAWA 2JA6H 4GKKL 1CKNB 5DLQE 1SE8A 4X6AH 1VQJA 3PCOB 2UUCL 4QJFA 4LFAL 3I7FA 2D62A 1W2BA 3CCVA 3HOZG 4LFBL 4JV5L 1YJ9A 2WB1G 2YTVA 1I6HH 3HFZB 2IT1A 4A3KG 2NN6I 4DV2Q 2UXDQ 1VQFA 2FXQA 3S1MH 1NTGA 2ZTCA 4BA1I 3L7ZC 4HIKA 1N8RC 2KENA 4A3FH 3HOVH 2UU9L 4LF8L 3H15A 1SR3A 3A5ZB 5IT9c 4HJAA 4DR7L 3GTGH 2VUMH 3T1YL 4A3BH 2VW9A 1PH1A 4HIMA 4JI5L 4JI7L 2RCNA 1PH3A 1IL2A 4LUOA 3I55A 2BA0A 4P75A 4BBRH 5C3EG 4LF9L 4LFCQ 5M5YH 3RNUA 2ID0A 1VQCA 1YEZA 4GS3A 2YV5A 4X64Q 1HR0Q 4LNQA 3PO2G 2UXBL 1L2FA 1V1QA 2HHHQ 4LF6L 1YZ6A 4R4QA 1EFWA 1D8LA 4HJ9A 1KL9A 3W1GA 4LF7L 4K0KL 1WI5A 1X54A 2OTJA 1YVCA 3ERSX 1YITA 4BY7G 4DKAC 4A3LH 2ZJRA 1HJPA 1GM5A 1CSQA 4X62Q 3KOJA 3GO5A 3CC2A 2LXKA 4NXMQ 1VQKA 1TXYA 1G51A 2F3IA 4BXXH 5C4XG 1O7IA 4OWTB 5AJ3L 3STBC 3AFPA 4YHHQ 4PZ8A 4A75A 5LMUQ 2H5XA 2R7FA 4L5RC 3CP0A 3K8AA 1VQOA 3J7A5 4AIMA 1PH5A 1JE5A 2WP8J 5GADC 3HOXH 2JA5G 5C4XH 3PF4A 3VDYA 1T9HA 4JI4L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AJ3 Q;  1BKB A;  4TQU S;  4DV4 Q;  2AWO A;  1AH9 A;  3ULP A;  4DUZ L;  3J80 i;  2Z6K C;  2RHQ B;  3PF5 A;  4GNX B;  1MJE A;  2JA9 A;  1VQM A;  2OCE A;  5M3M G;  1HNZ L;  2CKZ B;  1XNR Q;  1HZA A;  2ZM6 L;  4DV6 L;  1A8V A;  3M4P A;  4BY1 H;  1A63 A;  1JMC A;  1XMO Q;  4IJH A;  1N32 Q;  1A62 A;  1HR0 W;  2UUB Q;  2KCM A;  1Q46 A;  3AYH B;  5K36 G;  1TWF H;  1TWC H;  5M5W H;  3CMA A;  4P71 A;  4DV7 Q;  2E5L Q;  4A3G H;  3GDE A;  3ULJ A;  5GAG C;  2L15 A;  3SGI A;  3HOZ H;  2HIV A;  4APV A;  4A93 G;  3ZJY C;  3I56 A;  4A3E H;  2KCT A;  2F4V Q;  3TS2 A;  1VQA A;  3F2D A;  5FJ8 H;  3I2Z A;  2VQF L;  3NBH B;  3BZC A;  3KDF A;  2R6G A;  3E9I A;  5BR8 Q;  2JA7 G;  4R4I A;  3NEM A;  1BBW A;  4LF9 Q;  1XNQ Q;  1X65 A;  2ZM6 Q;  2YTX A;  4LFB Q;  1Z9F A;  3EIV A;  3CC7 A;  2BH2 A;  4EX5 A;  4A3I H;  1OTC A;  4DR4 L;  1PV4 A;  3RZO H;  1W3S A;  3KYH C;  2VZA A;  1JJ2 A;  2LSS A;  2ALY B;  4GOP B;  4A3K H;  4L5S A;  4IFD I;  1OXU A;  2IHE A;  3KJP A;  1HZ9 A;  5BR8 L;  1Q12 A;  4DR7 Q;  5C44 H;  1Q1B A;  2N49 A;  1V9P A;  2OQ0 A;  4JC0 A;  4KLK A;  3CCL A;  2ASB A;  4JBW A;  4JI3 L;  4A3E G;  4GKJ Q;  3UDG A;  1CUK A;  1HZC A;  1VQB A;  4JG2 A;  1I94 Q;  4A3M G;  4B3S L;  3PO2 H;  1L1O A;  1EUJ A;  3JAM i;  3S1N H;  4PMW A;  1NY4 A;  2K75 A;  4YCU A;  1Q82 C;  1IZ6 A;  2NVX H;  2BH8 A;  4DR2 Q;  2I5L X;  1KC8 C;  4C3J H;  2PQA A;  3STB D;  5LMN Q;  1YI2 A;  1PYS B;  2LXJ A;  1E1O A;  3W5O A;  1C9O A;  1VS0 A;  1B7Y B;  1Y1W H;  1FJG Q;  1VQL A;  4AQY L;  2D0O A;  1GKH A;  4QGU A;  1PH4 A;  4OXP A;  1N33 Q;  1HNW Q;  2AHO B;  1K8A C;  3I4O A;  2D0P A;  1XMO L;  4HIO A;  1I3Q H;  4DK3 C;  1LTL A;  1Y14 B;  1J5E L;  2YU9 H;  1R9T H;  2MFI A;  2JJQ A;  4UY8 C;  2I5M X;  4P74 A;  2E2I H;  2JEA I;  1HH2 P;  3HOY G;  2AKW B;  4AYB E;  1KD1 C;  5E7N A;  1JJC B;  2GVB A;  3AQQ A;  2KHJ A;  1OXV A;  3TEH B;  3L2P A;  1N36 Q;  4QY7 A;  2N8N A;  4OON A;  2AMC B;  1YHA A;  4DR2 L;  1QUQ A;  3FKI G;  4JI0 L;  4X62 L;  1ASZ A;  3H3V H;  1EWI A;  1KHI A;  1PYB A;  5M3M H;  2JQO A;  4YCV A;  4YCW A;  4A3J G;  2CCZ A;  4JI2 Q;  1IBL Q;  4DV7 L;  1YJN A;  3I4M H;  4JBM A;  4BBS H;  4A3G G;  2UUB L;  4DR3 L;  1WCM G;  4JI6 Q;  1IYJ B;  1NMG A;  4DUZ Q;  4KHZ A;  5GAH C;  3PIO A;  1MKH A;  3JC6 6;  1YHB A;  1M1K C;  2YYZ A;  3S16 H;  3CD6 A;  3FHW A;  4NPS A;  1B8A A;  4LFC L;  4DR3 Q;  4DV5 Q;  2A1A A;  1RIP A;  4GN3 B;  1U0L A;  5GAE C;  5JJL A;  1XJV A;  2OTL A;  4IPH A;  3RLF A;  3NEN A;  4XTC S;  1TWG H;  4KHP Q;  3UE1 A;  3MXN B;  2IX0 A;  1I94 L;  5LMN W;  1YIJ A;  3LGJ A;  3CPF A;  3CCQ A;  4DV5 L;  3I4M G;  3S1Q H;  2UUC Q;  1SLJ A;  1P8L A;  4A93 H;  4OWW B;  3CCE A;  2PMZ E;  2VL6 A;  3F2B A;  2N78 A;  4DV2 L;  3J81 i;  2IHF A;  2HIX A;  1VQP A;  4P72 A;  4B3T L;  3GTO H;  4X66 L;  1LUZ A;  2K4K A;  3OTO L;  2QA4 A;  2JA5 H;  2UUA L;  3D0F A;  4X65 L;  1G29 1;  3J81 j;  1G6P A;  2PNH A;  4AQY Q;  4IPC A;  1CKM A;  4DUY L;  1SFO H;  4B3S Q;  5HY6 A;  5IP9 G;  1K8G A;  3TRZ A;  1K3R A;  1VQD A;  4POF A;  5LMN L;  1VQ6 A;  3M4O H;  5JJK A;  3CXC A;  2HT1 A;  3AEV A;  3S14 H;  2Y0S E;  1E7Z A;  1UWV A;  3PV0 A;  2UXB Q;  3I4N G;  1N9W A;  1XNQ L;  3CCR A;  4PZ6 A;  4ALP A;  1I5F A;  2BA1 A;  4JBK A;  1HNW L;  4MNO A;  1QVC A;  4JOI A;  2YTY A;  3RZD H;  4LF4 L;  2E5L L;  4DR5 L;  1KIX A;  1SMX A;  4QL5 A;  1JB7 A;  3KLW A;  3OTO Q;  3G6E A;  1UE5 A;  4DAM A;  5C4J H;  2EQS A;  4Y52 H;  4DPG A;  2ES2 A;  4A3D H;  2UXC Q;  2PQA B;  2Z6K A;  4DV6 Q;  1MIU A;  3G71 A;  1IBM L;  2K14 A;  3A0J A;  1N34 Q;  1EOV A;  2HQL A;  4LF5 Q;  4GKJ L;  2PI2 A;  3K80 C;  4DV3 Q;  1VQ7 A;  4UP7 A;  2ZTE A;  2N3S A;  1IBM Q;  3MEF A;  3PUY A;  4R1J A;  3HOU H;  3WWV A;  1L0W A;  3OW2 A;  2K52 A;  4JCV E;  4OO1 G;  4YWK A;  1S40 A;  2VQF Q;  3J81 c;  2ZJP A;  2GVA A;  1Y1V G;  2QGQ A;  3PUW A;  1QZG A;  3UDI A;  3GTJ H;  2ZTD A;  4JOI C;  2VQE Q;  2V1C C;  5ELO A;  4AYB G;  4OX9 Q;  1M90 C;  3D31 A;  5IY0 A;  3HOW G;  2OWO A;  2KBN A;  4DK6 C;  4BXX G;  5IYB G;  4C2M H;  3S1R H;  1YBY A;  4GLA C;  3F2C A;  4A4I A;  4HJ7 A;  4DNI A;  1PFS A;  4X66 Q;  1D7Q A;  5IWA L;  1NE3 A;  1BBU A;  2JA6 G;  1UE7 A;  3ICE A;  2NZH A;  5C44 G;  2DUD A;  1X56 A;  4JI8 Q;  5C0X I;  1BVS A;  5GQO A;  4A3C G;  2RF4 A;  4B3R L;  1PVO A;  4X65 Q;  3GTP H;  2E8G A;  2CQO A;  3W1B A;  4JYA Q;  1UEB A;  2WFW A;  1Q86 C;  4ME3 A;  4MTN A;  4IPD A;  3RN2 A;  1CSP A;  4P73 A;  1EQQ A;  1LYL A;  4GOP A;  3CCM A;  2JEB I;  2QEX A;  1XPU A;  2Q2H A;  3HKS A;  3E0E A;  4JI8 L;  3M3Y H;  1FL0 A;  4LW1 A;  4A3B G;  3OYY A;  1CKO A;  2WB1 E;  2JA8 H;  4GLV B;  3TRE A;  4NB3 A;  3T1H Q;  3K7A H;  2K50 A;  3PO3 H;  1XNR L;  1X55 A;  5M5X H;  1XPR A;  1RL2 A;  4GLX A;  4IFD J;  2HHH L;  4WJ3 M;  5IYC H;  3T1H L;  3Q8D A;  4A3F G;  4A76 A;  3HOV G;  3PUX A;  5FLM G;  1N36 L;  2I5H A;  1FVI A;  3M4Q A;  3S24 A;  2IX1 A;  4A3C H;  2KHI A;  3CCJ A;  4DV3 L;  4KHP L;  3KF8 B;  3RR5 A;  5FJ8 G;  1VCI A;  5IP7 H;  1YJW A;  4GKK Q;  2MNA A;  4DV0 L;  3G48 A;  3E9H A;  3T1Y Q;  1X3F A;  1EIY B;  3I4N H;  2R7D A;  3RLN A;  1E1T A;  5FLX c;  2I0Q A;  2JA8 G;  4IPG A;  1WYD A;  4NXM L;  1SRU A;  4IFD G;  3K0X A;  3L0O A;  4HJ5 A;  1GO3 E;  4POG A;  3J80 c;  1N34 L;  3JAM c;  4A3I G;  1HNX Q;  3KF6 B;  1NJI C;  4DR4 Q;  4H02 A;  4O0A A;  4OX9 L;  1QVG A;  1NMF A;  2NVQ H;  1VQ9 A;  1PH6 A;  2WAQ E;  3B6Y A;  3CW2 C;  3F8T A;  1IBK L;  4C3I H;  1IXR A;  1EIF A;  3U50 C;  4LF4 Q;  2UXD L;  1N32 L;  4GNX A;  1TWA H;  1CKN A;  2XTI A;  4JV5 Q;  2R7Z H;  1UE6 A;  2JK8 A;  2AWN A;  2CWP A;  4KI0 A;  1KRT A;  2NZO A;  3HKZ E;  3UDX A;  4R4T A;  1KRS A;  4YY3 L;  1PH2 A;  1ASY A;  4JI3 Q;  1IBK Q;  1GD7 A;  1QZH A;  1YNX A;  3KDF B;  2B63 H;  4J15 A;  4YY3 Q;  4A3D G;  5IYC G;  4DR1 Q;  3DLL A;  2DGY A;  2F4V L;  2A8V A;  4EQ5 A;  1K9M C;  1VQ4 A;  4HID A;  3S2D H;  3KF6 A;  4O2D A;  4IOC A;  1OXT A;  3HOU G;  1VQH A;  3EN2 A;  4JI7 Q;  4NXN Q;  1L1O B;  1GVP A;  1AE3 A;  3CQZ H;  5M3F H;  3RN5 A;  3A74 A;  1I50 H;  1L1O C;  2K5H A;  5EAY A;  1XMQ L;  3S17 H;  4LWC A;  3H0G G;  3NEL A;  4HJ8 A;  4GOP C;  2Y0S G;  2NN6 G;  4JI1 L;  3FKI H;  4B3M L;  2CFM A;  3DM3 A;  1WJJ A;  3PUZ A;  3ER0 A;  2GN5 A;  4IJL A;  3GTM H;  2R93 G;  3PIP A;  2R92 G;  3HOW H;  4NXN L;  2EXD A;  3KFU A;  4AH6 A;  2R7Z G;  3S2H H;  1FGU A;  2VUM G;  4YWM A;  1Q7Y C;  4OWX B;  1C7Y A;  4DV1 Q;  3HOY H;  2XGT A;  4R4O A;  1E22 A;  3CPW A;  4DR5 Q;  2JA7 H;  4LUV A;  1UE1 A;  1A0I A;  3IRB A;  4Y7N H;  4GNX C;  3FP9 A;  4WJ4 A;  1Z47 A;  3KJO A;  3CME A;  4JYA L;  1WCM H;  3BU2 A;  1VQG A;  3PGZ A;  4MZ9 A;  4RG1 A;  3RLO A;  1JT8 A;  3H0G H;  4IO9 A;  4OO1 I;  2MO0 A;  4L5T A;  2R93 H;  1U5K A;  3PSI A;  4BA2 I;  4JI6 L;  4A3L G;  4GN4 B;  1J6Q A;  2R92 H;  2Q2I A;  5HGQ A;  1SN8 A;  3F1Z A;  1XTD A;  4DV4 L;  1E24 A;  1K83 H;  1P16 A;  1VQE A;  4DV0 Q;  1K0R A;  1AE2 A;  4JI0 Q;  3CC4 A;  4UP8 A;  2UUA Q;  2PI2 E;  5M3F G;  1X3G A;  3M7N A;  1OXS C;  4BY1 G;  2VNU D;  2E2H H;  2RHS B;  4DR6 L;  3BJU A;  5C3E H;  4DUY Q;  2MO1 A;  3CF5 A;  5C0X G;  4JI4 Q;  1FJG L;  1MJC A;  4UP9 A;  2Q2U A;  2VS1 A;  5IWA Q;  3S15 H;  2EIF A;  5ELN A;  4LF8 Q;  1N33 L;  3CCS A;  1Y1V H;  4L5Q A;  1IBL L;  1S72 A;  1X3E A;  1PH8 A;  4JI2 L;  2C35 B;  1VQI A;  1NBW A;  3K81 C;  3AFQ A;  2IY5 B;  2B3G A;  4UPA A;  3GTQ H;  1C0A A;  2CWA A;  2Z0S A;  5GRO A;  5C0X J;  3BZK A;  2ATW A;  3M85 A;  2OQK A;  3H3V I;  1WOC A;  5IYD G;  1QVF A;  5IP9 H;  4IOA A;  4B3R Q;  4LF6 Q;  2K5N A;  5JJI A;  4DR6 Q;  4DV1 L;  4BBS G;  5H1S E;  1KXL A;  1V43 A;  3A5U A;  2VQE L;  3J7Z C;  3GTK H;  4LF7 Q;  4BY7 H;  5J3B A;  1EQR A;  1LM0 A;  3U58 A;  4YHH L;  1Q8K A;  4A3J H;  1XPO A;  1VQ5 A;  2Q2T A;  3HKZ G;  2F52 A;  3G4S A;  1X9N A;  1J5E Q;  2E2J H;  3PUV A;  3CCU A;  4JI1 Q;  5FLM H;  2K5V A;  1HZB A;  4X64 L;  4YWL A;  1Q81 C;  1K73 C;  1HR0 L;  4B3M Q;  1TWH H;  4DR1 L;  5IE8 A;  4PZ7 A;  2VY3 A;  4TVA B;  1H95 A;  2A19 A;  2B63 G;  1SRO A;  3PO3 G;  1S3O A;  4DAY B;  2WAQ G;  5JEA G;  1PH7 A;  2JE6 I;  4XIG S;  4JI5 Q;  3TQY A;  3UDF A;  3ULL A;  4B3T Q;  2UXC L;  2ZJQ A;  4R4C A;  1XMQ Q;  1X6O A;  4K0K Q;  1B70 B;  4QIW E;  3HOX G;  1PA6 A;  1PHJ A;  5IYD H;  2NVY H;  3GD7 A;  5IP7 G;  3CAM A;  1Y1W G;  3U4Z A;  4LUZ A;  1OXX K;  3K7U C;  3GTL H;  3UE0 A;  4GN5 A;  1E3P A;  2UU9 Q;  1VQ8 A;  2MQH A;  5JEA J;  3U4V A;  2B29 A;  1KQS A;  1Q1E A;  3EBE A;  1VQN A;  4LF5 L;  2NVT H;  4FDB A;  1QUQ B;  1JJG A;  4A3M H;  5IYB H;  1EYG A;  4QQB X;  3M9B A;  3TS0 A;  5LMU L;  1WFQ A;  4RMF A;  1DGS A;  1HNX L;  4BBR G;  4JBJ A;  4LFA Q;  1PH9 A;  1YHQ A;  1HNZ Q;  4PG3 A;  4C3H H;  1KAW A;  2JA6 H;  4GKK L;  1CKN B;  5DLQ E;  1SE8 A;  4X6A H;  1VQJ A;  3PCO B;  2UUC L;  4QJF A;  4LFA L;  3I7F A;  2D62 A;  1W2B A;  3CCV A;  3HOZ G;  4LFB L;  4JV5 L;  1YJ9 A;  2WB1 G;  2YTV A;  1I6H H;  3HFZ B;  2IT1 A;  4A3K G;  2NN6 I;  4DV2 Q;  2UXD Q;  1VQF A;  2FXQ A;  3S1M H;  1NTG A;  2ZTC A;  4BA1 I;  3L7Z C;  4HIK A;  1N8R C;  2KEN A;  4A3F H;  3HOV H;  2UU9 L;  4LF8 L;  3H15 A;  1SR3 A;  3A5Z B;  5IT9 c;  4HJA A;  4DR7 L;  3GTG H;  2VUM H;  3T1Y L;  4A3B H;  2VW9 A;  1PH1 A;  4HIM A;  4JI5 L;  4JI7 L;  2RCN A;  1PH3 A;  1IL2 A;  4LUO A;  3I55 A;  2BA0 A;  4P75 A;  4BBR H;  5C3E G;  4LF9 L;  4LFC Q;  5M5Y H;  3RNU A;  2ID0 A;  1VQC A;  1YEZ A;  4GS3 A;  2YV5 A;  4X64 Q;  1HR0 Q;  4LNQ A;  3PO2 G;  2UXB L;  1L2F A;  1V1Q A;  2HHH Q;  4LF6 L;  1YZ6 A;  4R4Q A;  1EFW A;  1D8L A;  4HJ9 A;  1KL9 A;  3W1G A;  4LF7 L;  4K0K L;  1WI5 A;  1X54 A;  2OTJ A;  1YVC A;  3ERS X;  1YIT A;  4BY7 G;  4DKA C;  4A3L H;  2ZJR A;  1HJP A;  1GM5 A;  1CSQ A;  4X62 Q;  3KOJ A;  3GO5 A;  3CC2 A;  2LXK A;  4NXM Q;  1VQK A;  1TXY A;  1G51 A;  2F3I A;  4BXX H;  5C4X G;  1O7I A;  4OWT B;  5AJ3 L;  3STB C;  3AFP A;  4YHH Q;  4PZ8 A;  4A75 A;  5LMU Q;  2H5X A;  2R7F A;  4L5R C;  3CP0 A;  3K8A A;  1VQO A;  3J7A 5;  4AIM A;  1PH5 A;  1JE5 A;  2WP8 J;  5GAD C;  3HOX H;  2JA5 G;  5C4X H;  3PF4 A;  3VDY A;  1T9H A;  4JI4 L; 
#chains in the Genus database with same CATH topology
 1BKB A;  1SE4 A;  3BS1 A;  1AH9 A;  3NK9 A;  3S9W A;  1SE3 A;  3J80 i;  2Z6K C;  3UI2 A;  5JAV A;  4HMJ A;  1VQM A;  4BY1 H;  3M4P A;  1JMC A;  2K03 A;  4XQQ A;  1N32 Q;  1A62 A;  2B2V A;  2UUB Q;  2QW7 A;  4DAY A;  3OWF A;  3GDE A;  3ULJ A;  3HOZ H;  2HIV A;  2O5I C;  5JVH 3;  3I56 A;  1QCB D;  3F2D A;  1ZKO A;  2FJ2 A;  1R9T B;  1IKM A;  4R4I A;  3NEM A;  1BBW A;  2O2L D;  5IT9 E;  1X65 A;  4NDX A;  1EEI D;  1Z9F A;  4ZLT F;  3RZO H;  3KYH C;  2LSS A;  2ALY B;  4GOP B;  4IFD I;  3KJP A;  1HZ9 A;  5BR8 L;  1ICF B;  2K28 A;  1Q12 A;  5DM6 3;  4OEM B;  2OQ0 A;  2ASB A;  1EZ6 A;  4GKJ Q;  1SYC A;  2XN9 C;  1Q3L A;  4B3S L;  4QF4 A;  1HXY D;  1L1O A;  1LT6 D;  3JAM i;  4PMW A;  3SK5 A;  2F1M A;  5COR A;  4RCN A;  4ZUI A;  1YI2 A;  3W5O A;  5M5X B;  1QE6 A;  3A8J E;  1B7Y B;  1Y1W H;  4IUR A;  4AQY L;  4HED A;  3D4D A;  1TWA B;  2D0O A;  4QGU A;  1GUW A;  4OXP A;  2TMP A;  1UNS A;  3I4L A;  3I4O A;  2D0P A;  1SNM A;  1XMO L;  4DK3 C;  1SXT A;  2MFI A;  1NR2 A;  5EGT A;  1KD1 C;  1JJC B;  3KF8 A;  2N8N A;  2AMC B;  1SDF A;  1WTR A;  3MXU A;  4YCV A;  1YJN A;  2WII B;  4RAU C;  2UUB L;  4DR3 L;  1IYJ B;  1GUT A;  4OIK A;  3EA6 A;  4N9T A;  1MKH A;  2OXP A;  5EKK A;  3JC6 6;  4C56 C;  1DD2 A;  1HFG A;  1CHQ D;  1MHW C;  5C3E B;  1B8A A;  1KNA A;  4DV5 Q;  1HTL D;  3RLF A;  4RHS A;  2NBF A;  1YNN C;  3LGJ A;  3I4M G;  2MHV A;  1STB A;  1GUN A;  1SLJ A;  4IUP A;  2K05 A;  1E2V A;  3CCE A;  2K6A A;  3K5L A;  4DV2 L;  3J81 i;  2Z1C A;  1ET6 A;  1X3Q A;  1BO0 A;  1O7Y A;  5EPL A;  4H13 C;  2PNH A;  4V19 0;  2A69 C;  1ROD A;  1VQD A;  4POF A;  2HT1 A;  3AEV A;  3S14 H;  2Y0S E;  1HUM A;  1E7Z A;  5T1G A;  1PZK D;  2K32 A;  3LWU A;  1N9W A;  3I4N G;  2Z9H A;  2ZXP A;  4ALP A;  4JBK A;  1B50 A;  4MNO A;  1WTV A;  4LF4 L;  3GTK B;  2FIN B;  2E5L L;  4RH6 A;  3NP8 A;  5CR3 A;  2R92 B;  1U4L A;  2EQS A;  4IFD H;  1TR5 A;  5C4H A;  2UXC Q;  1JB3 A;  2Z6K A;  1D5M C;  1YNJ C;  1A2T A;  2LY7 A;  3PUY A;  5HGT A;  2QKI C;  2E2I B;  2JA7 B;  1L0W A;  2K52 A;  3M7G A;  4JCV E;  3TSS A;  4YWK A;  4DK1 A;  2GVA A;  5IGD A;  3K7A B;  3PUW A;  3PO3 B;  4J6H A;  1HQR D;  5ELO A;  4HCE A;  4AYB G;  5TSS A;  4OX9 Q;  3D31 A;  4DXG A;  2B2T C;  2KBN A;  1EQV A;  4DK6 C;  2OWO A;  5IYB G;  4C2M H;  3S1R H;  2NVQ B;  3ZYY X;  2CH4 W;  3R2I A;  2NTT A;  1XX8 A;  2JA6 G;  3ICE A;  5C44 G;  4B9X A;  4JI8 Q;  5C0X I;  4B3R L;  2RF4 A;  1PTO D;  2CQO A;  5JOB A;  1SYE A;  3V05 A;  4ABN A;  4P73 A;  1LYL A;  4GOP A;  3CCM A;  2QEX A;  5COY A;  2B2W C;  5LL6 S;  2Q2H A;  3FDT A;  4N8F A;  4LW1 A;  4X3U A;  3VA7 A;  4A3B G;  3OYY A;  4P2C B;  2MP1 A;  1WTP A;  4GLV B;  4NB3 A;  4KD4 A;  1XNR L;  2BE5 C;  3OMC A;  4GLX A;  2F0S A;  5IGG A;  5CV9 A;  3HOV G;  3PUX A;  5FLM G;  1VF5 C;  4QB4 A;  3VR2 A;  4DXF A;  3KF8 B;  4GKK Q;  5FJ8 G;  2X6G A;  2XVS A;  3T1Y Q;  1X3F A;  4YIJ A;  2R7D A;  2JA8 G;  3S1M B;  1U9R A;  2AQ1 B;  2KJX A;  1B1Z A;  5KNC A;  4HJ5 A;  4DR4 Q;  3I91 A;  3KF6 B;  3H09 A;  3RZD B;  1NJI C;  4OX9 L;  2BOS A;  4CKB A;  1EQT A;  1LTR D;  2JA6 B;  3PMF A;  1VQ9 A;  3HRZ C;  3SK6 A;  4V0B A;  2JYO A;  1ILP A;  3WOE A;  3FPU B;  4K8J A;  2ENB A;  3NQT A;  1HA5 A;  2R7Z H;  1UE6 A;  2FFK B;  2NVT B;  4YY3 L;  1KRT A;  1KRS A;  4IUU A;  5EBD A;  1GD7 A;  1YNX A;  2B63 H;  4J15 A;  5KRU A;  1AW7 A;  2DGY A;  2R93 B;  2JP1 A;  3S2D H;  3KF6 A;  4IOC A;  2IX3 A;  2XWJ B;  3EN2 A;  2PPB C;  3CQZ H;  1AE3 A;  1STE A;  3RN5 A;  3A74 A;  1XMQ L;  2NN6 G;  2R93 G;  4IJL A;  5ELB A;  2R92 G;  2VB3 X;  5CC4 A;  4NXN L;  2EXD A;  3S2H H;  4FXK C;  3C3L A;  5ELE A;  4YWM A;  4LJZ C;  4DNR B;  2RDF A;  2ZXO A;  3QJY A;  2XRQ D;  4R4O A;  4KK7 A;  1F2L A;  3SK4 A;  3WDN A;  2JN4 A;  4LUV A;  3IRB A;  4Y7N H;  3EJI A;  4GNX C;  3FP9 A;  4WJ4 A;  4I7Z C;  1Z47 A;  4JYA L;  3VYS A;  1WCM H;  3BU2 A;  4KTA A;  1BBX C;  3H0G H;  1DCZ A;  2MO0 A;  1U5K A;  3E5S A;  3PSI A;  4KD3 A;  5E3F A;  1CI3 M;  3VR6 A;  1IHZ A;  4A3L G;  1CK1 A;  1KLG D;  1XTD A;  4DN4 M;  1O7L A;  3MHB A;  3LX0 A;  1FYC A;  1AE2 A;  1O80 A;  2UUA Q;  2PI2 E;  1OXS C;  2E2J B;  4DR6 L;  3BJU A;  5C3E H;  1IW7 C;  3T16 A;  4BY7 B;  2E2H B;  1MJC A;  4UP9 A;  2Q2U A;  1E2W A;  1F9R A;  1VQI A;  3K81 C;  3QWN A;  1PTO F;  2E74 C;  3GTQ H;  3FEW X;  1ML0 D;  1WVL A;  1Y8P B;  1CHP D;  4ULL A;  4LF7 Q;  5J3B A;  3KUP A;  1Q8K A;  2B2U C;  2K04 A;  2Z4H A;  3SDZ A;  3HKZ G;  2CQA A;  1X9N A;  3ONA B;  1H9J A;  2A6H C;  4JI1 Q;  1Q81 C;  1HR0 L;  2FHT A;  4DR1 L;  1BCP C;  4PZ7 A;  4WOR A;  4U67 3;  2DJF C;  3PO3 G;  2WAQ G;  2O4X A;  1NUC A;  3CKI B;  4R4C A;  3GQB A;  4K0K Q;  3HGB A;  5CMD A;  1DYQ A;  4TSS A;  1PA6 A;  2NVY H;  5IP7 G;  4LUZ A;  1JWU D;  1OXX K;  3K7U C;  4K6L A;  3FPP A;  1LT3 D;  4HAE A;  2F0F A;  3P1H A;  4K14 A;  1Q1E A;  1VQN A;  2VXW A;  4FDB A;  2F0T A;  1EYG A;  4FXG C;  2K5W A;  1WFQ A;  4KY5 A;  1WTX A;  1HNX L;  4BBR G;  4JBJ A;  2CH4 A;  2K1B A;  1YHQ A;  4C3H H;  4FNF A;  4GKK L;  2F3W A;  3PCO B;  1QNU A;  3DEP A;  3G7L A;  1WD1 A;  3I7F A;  3CCV A;  3HOZ G;  1JOQ A;  1JWS D;  3P20 A;  1EY0 A;  3CQZ B;  4DV2 Q;  5E4X A;  4TKO B;  2C5C A;  3SEB A;  5FLX L;  4A3D B;  4LF8 L;  3A5Z B;  5IT9 c;  2BE5 D;  3BDO A;  1D5Z C;  3KLS A;  5C4Z A;  2VW9 A;  1GUS A;  1LTT D;  4JI5 L;  1TY2 A;  1UAP A;  1KDB A;  3HZX A;  2Z6B A;  2BA0 A;  3MEH A;  5D65 A;  1LTG D;  3K0Y A;  3NBI A;  5A35 A;  4X64 Q;  4GS3 A;  4O42 A;  1PFN A;  4R4Q A;  1EFW A;  4L6T B;  1D8L A;  3LWE A;  3HG9 A;  1X54 A;  3ERS X;  4BY7 G;  3E0J A;  1A6X A;  3NWS A;  3S1N B;  3PO2 B;  1EY5 A;  5DM7 3;  2R3Z A;  3NTK A;  2JA5 B;  3GTP B;  1RCV D;  2F3I A;  4Q0F A;  4BXX H;  4K5W A;  4A3F B;  1O7I A;  2L4N A;  4OO1 H;  3AFP A;  4YHH Q;  1FNV A;  5EKL A;  2R7F A;  2F0N A;  1VDZ A;  2OEO A;  1DOK A;  3J7A 5;  4C1N K;  3NSW A;  3VDY A;  4FVM A;  3HOY B;  5AJ3 Q;  4TQU S;  4A3K B;  4FF2 A;  4BWG B;  3EVQ A;  4DV4 Q;  4DUZ L;  3PF5 A;  2QIL A;  1BDO A;  1MJE A;  3H3V C;  4HN7 A;  2JA9 A;  2ZT9 C;  2F0Q A;  2OCE A;  1HZA A;  2LMC B;  1I4Q A;  5KNB A;  1XMO Q;  2VUM B;  1PRT D;  2B39 A;  3M4Y A;  2EYL A;  2KCM A;  1Q46 A;  1Z7T A;  5K36 G;  4KJO A;  3BDL A;  4A3G H;  1DM0 B;  4H7B A;  5GAG C;  5I6W A;  1WTQ A;  4APV A;  3ZJY C;  3TS2 A;  3QB3 A;  5FJ8 H;  2VQF L;  3NBH B;  4CHT B;  2NZ1 D;  2R6G A;  4WJW A;  1I3Q B;  5JVG 3;  1XNQ Q;  3T4A C;  1CA5 A;  2L5T A;  3EIV A;  3CC7 A;  2BH2 A;  4EX5 A;  4A3I H;  1OTC A;  1PV4 A;  1JJ2 A;  2VZA A;  1MI2 A;  4QMG A;  4A3K H;  1OXU A;  5C4X B;  2DY7 A;  3TP7 A;  1U4R A;  2N49 A;  3Q0A A;  2AQ2 B;  1CUK A;  1HZC A;  1VQB A;  1I94 Q;  3PO2 H;  4K5X A;  1EUJ A;  2PW5 A;  4M8A A;  3S1N H;  5I9P A;  4YCU A;  1IZ6 A;  2I5L X;  2X69 A;  1KAB A;  5LMN Q;  1PYS B;  5I4D A;  1E1O A;  3K5N A;  2A73 B;  2K7V A;  1FJG Q;  1PH4 A;  1XXG A;  3MFG A;  3M4O B;  1HNW Q;  2PZU A;  4HIO A;  1I3Q H;  1Y14 B;  1F77 A;  2YU9 H;  2JA8 B;  4C3J B;  1W6J A;  4P74 A;  2E2I H;  4KKS A;  3MZ5 A;  4AYB E;  2GVB A;  1OXV A;  1N36 Q;  1K8M A;  3N52 A;  3I4M B;  1QUQ A;  5M9O A;  1JQY D;  4JI0 L;  1EWI A;  1PYB A;  5CYU A;  4JI5 Q;  2JQO A;  4YCW A;  4A3J G;  2A6H D;  1IBL Q;  1J8I A;  2PNR C;  1WCM G;  1NMG A;  3D3R A;  4KHZ A;  3NBH A;  4LK1 C;  1YHB A;  3K59 A;  1D1K A;  4NMZ A;  3S16 H;  3P75 A;  3FHW A;  4NPS A;  3NPP A;  1EU3 A;  2A1A A;  3OMG A;  1U0L A;  5LHY 1;  4IPH A;  2F0L A;  3NEN A;  1D5X C;  1I94 L;  2L55 A;  3CCQ A;  1B53 A;  1SJH D;  2UUC Q;  2SOB A;  3BZD B;  5M3F B;  1GUO A;  3IL8 A;  5KIX A;  3H0G B;  2EY1 A;  1R4Q B;  2IHF A;  1RDP D;  4B3T L;  1LUZ A;  1SE2 A;  3MXN A;  2K01 A;  1G29 1;  4QUF A;  1JOK A;  1CKM A;  1SFO H;  3S1R B;  5CBA E;  1XTC D;  3M4O H;  1SMY D;  4ZUJ A;  2DNE A;  3DWA A;  5ISR A;  2F0E A;  5K36 H;  2MPM A;  3M3Y B;  2D5D A;  3CCR A;  1G91 A;  1I5F A;  4ILW A;  3TBI B;  1SMX A;  3KLW A;  4DPG A;  1TVX A;  4DV6 Q;  1QWY A;  2K14 A;  3GTQ B;  1EOV A;  2HQL A;  3MVV A;  3OHX C;  4LF5 Q;  3I4N B;  3A7A B;  5JEA H;  4DV3 Q;  1VQ7 A;  2N3S A;  1IBM Q;  3MEF A;  4R1J A;  3R2T A;  1HA6 A;  1ESF A;  1KLU D;  1D6E C;  4OO1 G;  1ENF A;  1PRT C;  5L37 A;  1I4X A;  4K6D A;  1Y1V G;  2QGQ A;  1M8A A;  2VQE Q;  1SYG A;  1YNN D;  5IY0 A;  3NTH A;  5G3L F;  1YBY A;  4GLA C;  3F2C A;  4A4I A;  4OHJ A;  2R61 A;  4DNI A;  3VYU A;  1D7Q A;  3BG3 A;  3J81 L;  1UE7 A;  1ZXT A;  4OL7 A;  4XXE A;  1BVS A;  2AUK A;  1WCM B;  2E8G A;  4RKL A;  4CJ1 B;  2N55 A;  2WFW A;  1LAC A;  4IPD A;  3RN2 A;  1EQQ A;  2EVB A;  4JI8 L;  5DEH A;  1MSH A;  3V2T A;  1CKO A;  2HCC A;  4CDC C;  3TRE A;  3T1H Q;  2K50 A;  1XPR A;  4IFD J;  2HHH L;  4WJ3 M;  3T1H L;  2EY5 A;  4A3F G;  4A76 A;  1BF4 A;  1SYD A;  3C1F A;  2F0W A;  3S24 A;  2PCF B;  1Y8O B;  4K5V A;  2Q8I B;  3AB9 A;  4DV3 L;  3NTI A;  3RR5 A;  1VF7 A;  2NB0 A;  1YJW A;  4A3B B;  4JPB W;  2MNA A;  3A55 A;  3G48 A;  3E9H A;  1EIY B;  4FF1 A;  3I4N H;  3RLN A;  4QCL A;  5FO9 B;  4IPG A;  1WYD A;  1SRU A;  3HEJ A;  2IWH A;  4IN3 A;  1HNX Q;  4XYO A;  3DM1 A;  2QDB A;  3U9S A;  3NE5 B;  4DFA A;  2KCN A;  2WAQ E;  3PIO 3;  2IL8 A;  4C3I H;  4LF4 Q;  3U50 C;  1N32 L;  4GNX A;  1TWA H;  5BN3 A;  5C3X A;  2XTI A;  1X32 A;  1HQM C;  1Y1W B;  2AWN A;  2CWP A;  3UDX A;  4DA2 A;  3HKZ E;  1C4Q A;  2KHS A;  4J8Q A;  4A3E B;  2DY8 A;  2M00 A;  3KDF B;  5IYC G;  3DLL A;  1VQ4 A;  1TT2 A;  4HID A;  3F2U A;  1BCP D;  4O2D A;  4HMI A;  1OXT A;  4NXN Q;  4JI7 Q;  1QNK A;  1GVP A;  1L1O C;  4LWC A;  3NEL A;  4GOP C;  1FGB D;  3FKI H;  3GTM H;  2CFM A;  1WJJ A;  1CFM A;  5JPN C;  1G8Z D;  4LMQ D;  3PIP A;  3HOW H;  3KFU A;  4AH6 A;  1SNQ A;  1BOS A;  2MUY A;  1STN A;  2HCI A;  4DV1 Q;  1F9S A;  1D1I A;  3HOY H;  2WKC A;  2OF1 A;  1U4M A;  2FMC A;  4HSP A;  3MWY W;  1UE1 A;  1SNP A;  3J80 L;  2NYZ D;  3J7A F;  3CME A;  1PZI D;  3X3N A;  1JWM D;  2PO4 A;  4MZ9 A;  3RLO A;  4E6I A;  1JT8 A;  4L8J A;  2WIN B;  4OO1 I;  2MJ8 A;  3GTG B;  4GZY C;  4BA2 I;  3L3O C;  4A3G B;  3S2D B;  1JC7 A;  2Q2I A;  1SN8 A;  4ZK9 B;  2FMM A;  1I6H B;  4MHE A;  4BY1 G;  4EGV A;  2VNU D;  4MIU A;  1AN8 A;  1FJG L;  2EE1 A;  5T1I A;  2VS1 A;  3S15 H;  1N33 L;  3CCS A;  3KBX A;  5FLX E;  1Y1V H;  4L5Q A;  4JI2 L;  1X3E A;  1EZ8 A;  3AFQ A;  1PFB A;  3V96 A;  3JAM E;  1C0A A;  2SDF A;  5GRO A;  3BZK A;  5IYD G;  3VR3 A;  1QVF A;  5JJI A;  4OIJ A;  4DV1 L;  1V43 A;  3BVG A;  3A5U A;  5KND A;  3GTK H;  4F87 A;  4BY7 H;  1PRT B;  3L9A X;  3U58 A;  4YHH L;  4A3J H;  3T51 B;  2Q2T A;  3C1E A;  2E2J H;  4WRD A;  3CCU A;  1OO9 B;  4X64 L;  1HZB A;  4YWL A;  5IE8 A;  1KAA A;  2VY3 A;  3OPO A;  1IYV A;  2B63 G;  1PDQ A;  3IFT A;  1K83 B;  2KA7 A;  5ELD A;  4XIG S;  3D6C A;  2UXC L;  3KLR A;  2ZJQ A;  1B9M A;  4XQJ A;  3NQI A;  2A69 D;  2CVR A;  5EPK A;  1Y1W G;  1WTO A;  1KTK A;  1B9N A;  2A6E D;  5J1Z A;  3GTL H;  1DJR D;  3UE0 A;  4GN5 A;  1E3P A;  2UU9 Q;  2MQH A;  5JEA J;  2B29 A;  5FK9 C;  1K28 A;  1QUQ B;  2J0T D;  4ZKC B;  4IUV A;  3DEO A;  1TY0 A;  5LMU L;  4DR4 L;  1Y8N B;  4LFA Q;  1JE4 A;  1CKN B;  5DLQ E;  1SE8 A;  1VQJ A;  4ZCK A;  1SND A;  2UUC L;  2D62 A;  1MD2 D;  2IT1 A;  4A3K G;  1AFP A;  3MAQ A;  1SNO A;  1NTG A;  2CW0 C;  1F9Q A;  5C3W A;  5LL6 X;  4A3F H;  2NVY B;  4DR7 L;  4MTK A;  3VR5 A;  4KY7 A;  1BCP F;  2K5Q A;  4HIM A;  1KDA A;  3W2D A;  1BNZ A;  4RA8 A;  4JI7 L;  1PH3 A;  4F8M A;  1LTB D;  5KEE A;  4BBR H;  5C3E G;  1A3U A;  5C5M A;  3I8Z A;  5I2Y A;  2ID0 A;  1HR0 Q;  2YV5 A;  3U9O A;  2UXB L;  1CZW A;  1L2F A;  4LF6 L;  3RD4 A;  2I07 B;  4B08 A;  1WI5 A;  5J39 A;  1YVC A;  4DKA C;  2ZJR A;  2H4O A;  1GM5 A;  3GTO B;  1CSQ A;  2SNS A;  1VQK A;  1TXY A;  1BQQ T;  3QIA A;  1GHJ A;  1RF2 D;  4OWT B;  2X6L A;  4PZ8 A;  1VMC A;  4A75 A;  3CP0 A;  1VQO A;  1PH5 A;  1JE5 A;  2WP8 J;  5GAD C;  4EQN A;  3HOX H;  5EJW A;  4CJ0 B;  4LNQ A;  2LKV A;  2RKS A;  1AP0 A;  5DAU A;  2AWO A;  5CV4 A;  4UHV A;  3GV3 A;  2EYP A;  4GNX B;  1EYD A;  1E2Z A;  4X3S A;  1HNZ L;  4DV6 L;  4R9W A;  2LS0 1;  3QOL A;  4RCO A;  4G57 A;  3AYH B;  3BYY B;  4KV6 A;  2E5L Q;  4IUN A;  1UEA B;  4CBV A;  3SGI A;  3A7L A;  1LV9 A;  1AZQ A;  2Q8T A;  4A3E H;  2F4V Q;  1EOT A;  2H1E A;  5AFW A;  5IGF A;  4Y7N B;  2XWB B;  4R8N A;  2R7Z B;  3BZC A;  1NCV A;  5EQ0 A;  3BVM A;  3E9I A;  2WAQ B;  2JA7 G;  4LF9 Q;  1FNU A;  1V8Q A;  4RGN A;  2F0P A;  3RUZ A;  3MC0 B;  2C9O A;  1NNX A;  3R8B A;  2IHE A;  1PTO B;  1V9P A;  2EZV A;  4KLK A;  3CCL A;  1EU4 A;  4JBW A;  3GTL B;  3A56 A;  2M9V A;  1TQO A;  3RMH A;  1XYI A;  4RHR A;  5JJZ A;  3UDG A;  4JG2 A;  1ZYR C;  4XDX A;  5DNF A;  2WV6 D;  1NY4 A;  2K75 A;  1Q82 C;  4CJ2 C;  2BH8 A;  4DR2 Q;  2PQA A;  3A54 A;  4LAA A;  1C9O A;  1V1O A;  3R3O A;  3J7Y W;  1O78 A;  1GKH A;  1R4P B;  2L1B A;  1PFM A;  3H6M A;  1J9O A;  3IFD A;  2JJQ A;  3S17 B;  2I5M X;  2AKW B;  2KEE A;  3TEH B;  2KEC A;  4QY7 A;  4OON A;  1YHA A;  4DR2 L;  4J1M A;  1AZP A;  3K57 A;  4X62 L;  1KHI A;  5M3M H;  4BBS H;  2SNM A;  2CCZ A;  1S5C D;  4JI2 Q;  4DV7 L;  2RVL A;  2BDO A;  1DZ1 A;  2PQE A;  4DUZ Q;  4DF7 A;  3PIO A;  5F2D A;  3Q22 A;  3G6J B;  1EY7 A;  5D3D A;  2EOT A;  4F7X A;  1MBY A;  2KED A;  5GAE C;  4NP5 A;  1I4P A;  1XJV A;  4XTC S;  4A3M B;  1TWG H;  1BXT A;  2IX0 A;  5LMN W;  3S1Q H;  2RDH A;  2PYK A;  2F0U A;  2KOL A;  3O13 A;  1P8L A;  4A93 H;  1EYC A;  5C0X H;  4OWW B;  2VL6 A;  1B3Q A;  2XNA C;  2F0H A;  5EPJ A;  1VQP A;  4CDD C;  3PQI A;  4P72 A;  3GTO H;  3DWQ A;  2JA5 H;  4KHV A;  5KYL A;  1MSG A;  3D0F A;  4X65 L;  3J81 j;  1Y1V B;  3S1Q B;  5NUC A;  3H91 A;  2F0V A;  3D4R A;  4DUY L;  1T5E A;  4B3S Q;  5IP9 G;  3D6W A;  5LMN L;  1VQ6 A;  5JJK A;  3WOF A;  2NTS A;  1UWV A;  1GHK A;  1HUN A;  1I4G A;  1HNW L;  4JOI A;  4FF4 A;  3VYT A;  1G2S A;  3DHQ A;  4DR5 L;  4QL5 A;  1JB7 A;  3I3C A;  4Y52 H;  5M3M B;  1MIU A;  4I7A A;  3G71 A;  2F03 A;  3A0J A;  1N34 Q;  4GKJ L;  2F0I A;  1HCZ A;  3HOU H;  2LFN A;  2HD3 A;  2ZJP A;  1ICW A;  4HR7 B;  1QZG A;  3GTJ H;  2ZTD A;  3C2P A;  2V1C C;  3A8K E;  3TME A;  1M90 C;  4NKL A;  3SVM A;  2B2T A;  4BXX G;  1ENA A;  1F2Z A;  1IKL A;  1PFS A;  4KN4 C;  3KLS X;  1BBU A;  2NZH A;  3DMU A;  1X56 A;  4KY6 A;  1PVO A;  1G2T A;  2D9U A;  3W1B A;  4JW0 A;  1UEB A;  1Q86 C;  2WKD A;  1CSP A;  1TS2 A;  4O1N A;  3M3Y H;  1STY A;  3DUZ A;  2WB1 E;  2RSO A;  1EIH A;  1S5F D;  5FO7 B;  1Y69 U;  1D2B A;  1X55 A;  1RL2 A;  2EJG C;  2A68 C;  3Q8D A;  2I5H A;  2IX1 A;  4A3C H;  4RKB A;  2KHI A;  3CCJ A;  2O5J C;  2BDN A;  2JSO A;  1VCI A;  3LNN A;  3I70 A;  5FLX c;  2HUG A;  2I0Q A;  1F2Y A;  3EQL C;  4FYD A;  4IFD G;  1EFI D;  3EFX D;  3J80 c;  4POG A;  3JAM c;  3K5O A;  4A3I G;  1CQV A;  3QO2 A;  1QVG A;  1NMF A;  3ITP A;  3F8T A;  3CW2 C;  2B2W A;  1IBK L;  1X3P A;  3SR1 A;  2UXD L;  1W6K A;  1CKN A;  2Q8R E;  4DNT B;  4KI0 A;  1NAP A;  2NZO A;  2A68 D;  1SFO B;  1RTN A;  1ASY A;  4JI3 Q;  3OSO A;  3HOX B;  3BYT B;  1QG7 A;  1QZH A;  3VA5 A;  4HSV A;  4A3D G;  4YY3 Q;  2F0O A;  3Q23 A;  2L12 A;  4EQ5 A;  4K8I A;  1EWH A;  5C4J B;  3QOJ A;  1L1O B;  1ESR A;  1IW7 D;  5M3F H;  2RBM A;  2HDL A;  2K5H A;  5EAY A;  3S17 H;  4G7O C;  2JA8 H;  2Y0S G;  4JI1 L;  3URY A;  4ZKB B;  3PUZ A;  3ER0 A;  2GN5 A;  3JAM L;  4FF3 A;  3OOC A;  1FGU A;  4KMU C;  5D3I B;  3CRL C;  1C7Y A;  1EIG A;  1F9P A;  1EWC A;  1DXM A;  3D4W A;  1E22 A;  3S16 B;  2L9H A;  2AQ3 B;  3DXJ C;  3IAY A;  4DR5 Q;  1SJE D;  2Z8L A;  3OWE B;  1A0I A;  4MN3 A;  1LLR D;  5CV7 A;  3PGZ A;  4G4K A;  4IO9 A;  2KVM A;  1UUP A;  4RFB A;  4JI6 L;  4FO2 A;  2B63 B;  5HGQ A;  3F1Z A;  4B9W A;  4KKT A;  1DOL A;  3GP7 A;  1VQE A;  2J4X A;  5C6A A;  1K0R A;  1TWH B;  2F4I A;  2G9D A;  4UP8 A;  5M3F G;  2YU9 B;  1X3G A;  3HP3 A;  2E2H H;  3KBG A;  4G7Z C;  3A8I E;  2MO1 A;  2EXZ A;  4ZAI A;  3X3M A;  1WTW A;  1S5D D;  1G6Z A;  2EIF A;  4LF8 Q;  2XRS D;  1GUG A;  4HTH A;  1IBL L;  3R93 A;  1S72 A;  1EY6 A;  1PH8 A;  1MGS A;  2C35 B;  1EL0 A;  1SAP A;  4DAP A;  1Z6H A;  2Z0S A;  5C0X J;  2K33 A;  2ATW A;  2XIW A;  3TP5 A;  1B4O A;  2OQK A;  1GOZ A;  4B3R Q;  5IP9 H;  2QF7 A;  4DR6 Q;  4I65 A;  3J7Z C;  5ELF A;  1ZEQ X;  1HRJ A;  4C3H G;  1EQR A;  3RZO B;  1VQ5 A;  1CT1 D;  2F52 A;  3G4S A;  5C4X G;  3PUV A;  1EY8 A;  2F0D A;  4L5R C;  2B8F A;  1TWH H;  4H44 C;  1T5X D;  1S5E D;  1H9K A;  2A19 A;  2XSC A;  5M5Y B;  1PH7 A;  5JEA G;  2JE6 I;  3UDF A;  3MA2 B;  3ULL A;  4B3T Q;  1ENC A;  2EYH A;  1PYW D;  1X6O A;  1B70 B;  3HOX G;  3HOZ B;  3OIQ A;  5I9O A;  4EVO A;  3U4Z A;  5KGU A;  4PQX A;  2RA4 A;  3U4V A;  2EJF C;  2NVT H;  1JJG A;  2KUM A;  4A3M H;  3KK7 A;  5IYB H;  1LTS D;  3M9B A;  4RGM A;  4RMF A;  1HNZ Q;  2K5D A;  1CQF A;  1KAW A;  2L11 A;  4X6A H;  3E6Z X;  4QJF A;  1W2B A;  1A3V A;  1I6H H;  2WB1 G;  3QR8 A;  3HFZ B;  1VQF A;  1FR3 A;  2FXQ A;  3K5M A;  2ZTC A;  4BA1 I;  3L7Z C;  1N8R C;  2KEN A;  1TWF B;  5M5W B;  3HOV H;  4EQP A;  3H15 A;  1SR3 A;  4HJA A;  4PMB A;  3GTG H;  4IAL A;  1ILQ A;  2WAC A;  4A3B H;  1RJT A;  1BCP B;  4Z9C B;  2RCN A;  1IL2 A;  1PLF A;  4LF9 L;  4LFC Q;  3RNU A;  1V1P A;  3PO2 G;  3ND9 A;  2DNC A;  2A74 C;  4ODG A;  2HHH Q;  1YZ6 A;  5BN5 A;  4HJ9 A;  3S14 B;  4HCS A;  3W1G A;  5IGB A;  4LF7 L;  4K0K L;  4JVZ A;  1JIC A;  1YIT A;  2G5D A;  1SBB B;  4A3L H;  2QEJ C;  1HJP A;  2NUC A;  5G3L D;  3FKI B;  3GTM B;  4XT3 B;  3KOJ A;  3GO5 A;  1A3T A;  5CGK A;  3MFY A;  4PNY A;  2LXK A;  4IUQ A;  4NXM Q;  2OT2 A;  1G51 A;  5CBE E;  1IYU A;  2E75 C;  2A6E C;  2D2C C;  3STB C;  4C3I G;  2H5X A;  3DWP A;  2EY6 A;  5E4W C;  3MTS A;  2JA5 G;  2IW3 A;  2HDM A;  1T9H A;  2PZW A;  3GTJ B;  2DJG C;  2F0G A;  2WB1 B;  3ULP A;  1GXD C;  4DAV A;  2RHQ B;  4RWS C;  1U4P A;  5HUR A;  5M3M G;  1LTI D;  2CKZ B;  1XNR Q;  2ZM6 L;  1A2U A;  3C46 A;  1A8V A;  1A63 A;  1ET9 A;  4IJH A;  3T53 B;  1HR0 W;  5KYI A;  1NSN S;  3HS0 C;  1TWF H;  1TWC H;  5M5W H;  3CMA A;  4P71 A;  4DV7 Q;  2NWG A;  5A2Q L;  1WD0 A;  4A93 G;  2L15 A;  3N6R A;  5IOC A;  1TWC B;  1H9M A;  2KCT A;  1VQA A;  3S15 B;  1EYA A;  3I2Z A;  5EBC A;  3MXP A;  1I6V C;  3BDC A;  5FKA C;  1II3 A;  3KDF A;  2PZT A;  5BR8 Q;  1Q8I A;  4LFB Q;  2ZM6 Q;  4JK1 C;  2YTX A;  5E1F A;  4ZYS A;  1SYB A;  4K2L A;  1W3S A;  1B44 D;  2M2L A;  5IGC A;  3GV6 A;  4L5S A;  5C5L A;  4OGQ C;  3T56 B;  3FRP B;  4DR7 Q;  5C44 H;  2EYM A;  2KQ3 A;  1Q1B A;  4JC0 A;  2QDL A;  4JI3 L;  4A3E G;  4R8I A;  5K5P A;  1JR0 D;  4ME5 A;  3CU7 A;  4A3M G;  3FVQ A;  2N88 A;  2NVX H;  2EYO A;  1CM9 A;  1Q90 A;  2PW7 A;  1KC8 C;  4C3J H;  3STB D;  2ICE C;  1A15 A;  2LXJ A;  1VS0 A;  1AEX A;  1S5B D;  1VQL A;  3OIP A;  1YNJ D;  1N33 Q;  2AHO B;  1CA6 A;  2F0K A;  5IIF A;  1K8A C;  4XQN A;  4A3J B;  1LTL A;  1J5E L;  1R9T H;  4UY8 C;  2JEA I;  1HH2 P;  3J81 E;  4QUC A;  3HOY G;  1GJX A;  5E7N A;  1PMR A;  3L2P A;  3AQQ A;  2KHJ A;  1DOM A;  3CRK C;  5J22 A;  3Q24 A;  4KKU A;  4ZQ3 A;  1PXU A;  1LT5 D;  1STH A;  3FKI G;  2PMZ B;  1ASZ A;  3H3V H;  4IOA A;  3I4M H;  4JBM A;  3I73 A;  3Q6S A;  4A3G G;  4C2M B;  3OW7 A;  4JI6 Q;  3W3A A;  3NWT A;  4WFN 3;  5GAH C;  1L0X B;  3MXG A;  4DU9 A;  1M1K C;  2YYZ A;  1L0Y B;  3CD6 A;  4DK0 A;  1PTO C;  1HPC A;  4X3K A;  1EY4 A;  4LFC L;  4DR3 Q;  1M4V A;  1RIP A;  4GN3 B;  5JJL A;  2OTL A;  2EY2 A;  3VR4 A;  4KHP Q;  3NUC A;  3MXN B;  3UE1 A;  1TKW B;  4C1N I;  1YIJ A;  3CPF A;  4DV5 L;  4UDU C;  1I50 B;  4RGT A;  2PMZ E;  2A5H A;  5IT9 L;  4XYQ A;  3F2B A;  2N78 A;  2HIX A;  1RD9 D;  3ERO A;  4X66 L;  2K4K A;  3OTO L;  2QA4 A;  2UUA L;  1G6P A;  4AQY Q;  4IPC A;  3SK8 A;  2HQE A;  5HY6 A;  1K8G A;  1C8C A;  3TRZ A;  1K3R A;  2RSN A;  1PZJ D;  3CXC A;  2F0J A;  3PV0 A;  2UXB Q;  3ND8 A;  1XNQ L;  2IJ0 A;  4PZ6 A;  2G9H D;  2BA1 A;  1QVC A;  2YTY A;  3RZD H;  3J80 E;  1KIX A;  3OTO Q;  3G6E A;  1TS3 A;  2SEB D;  1UE5 A;  2MGS A;  4DAM A;  5C4J H;  2ES2 A;  4A3D H;  2PQA B;  1IBM L;  2PI2 A;  3K80 C;  1RHP A;  2GA4 B;  5I2X A;  4UP7 A;  2ZTE A;  3WWV A;  1TII D;  3OW2 A;  3SXH A;  1S40 A;  3TP8 A;  3K58 A;  2VQF Q;  3J81 c;  4X3T A;  2EDG A;  3UDI A;  1LAB A;  4JOI C;  2P5Z X;  1SYF A;  1JOR A;  1C48 A;  2V4D A;  4C3I B;  5FO8 B;  3HOW G;  1O7Z A;  3NXW A;  4HJ7 A;  1H9R A;  2Z4I A;  4X66 Q;  5IWA L;  1NE3 A;  2TSS A;  2DUD A;  4QIW B;  5GQO A;  4CGY B;  4A3C G;  4X65 Q;  3GTP H;  1RTO A;  3D8G A;  4JYA Q;  1TS5 A;  4ME3 A;  4MTN A;  2JEB I;  1XPU A;  1I4R A;  3HKS A;  3E0E A;  1XWE A;  1FL0 A;  1H9S B;  2E76 C;  3I90 A;  1DON A;  4BS9 A;  3K7A H;  3PO3 H;  4C3J G;  5M5X H;  3TP6 A;  5IYC H;  3TZD A;  1N36 L;  4UAI A;  1FVI A;  3M4Q A;  3IKJ A;  2NVX B;  4DGZ A;  1CZG A;  4KHP L;  5IP7 H;  4DV0 L;  5ELC A;  1E1T A;  2AUJ D;  2EPB A;  4FP5 D;  5FOB B;  4NXM L;  3TDQ A;  3K0X A;  4M1U B;  3L0O A;  1GO3 E;  1STA A;  2KCC A;  3SE0 A;  1N34 L;  4H02 A;  4O0A A;  1STG A;  2NVQ H;  1EY9 A;  1PH6 A;  3PIP 3;  1HTP A;  1B3A A;  2IPK D;  3B6Y A;  1IXR A;  1EIF A;  4JV5 Q;  2EYJ A;  3I72 A;  2JK8 A;  3HOU B;  1PH2 A;  4R4T A;  1HHV A;  1IBK Q;  2B2V C;  1B2T A;  2F3V A;  4DR1 Q;  2F4V L;  3TZU A;  2A8V A;  5CV6 A;  1K9M C;  2B2U A;  1RKN A;  3HOU G;  1VQH A;  1QJO A;  1KDC A;  3P7J A;  1F2M A;  5JPM C;  1I50 H;  4HJ8 A;  3H0G G;  1ONL A;  3HKZ B;  4B3M L;  3DM3 A;  2R7Z G;  3BVZ A;  2BCO A;  3SHL A;  2VUM G;  1LTA D;  1Q7Y C;  4OWX B;  5IGE A;  2XGT A;  1FD7 D;  3CPW A;  4KN7 C;  2CHB D;  2JA7 H;  4IZ8 A;  4CKC A;  4PMC A;  3J7A V;  3KJO A;  4ZRZ A;  2E2D C;  1VQG A;  1BUV T;  4RG1 A;  1IL8 A;  1K0S A;  5EKI A;  4L5T A;  2R93 H;  2NN6 H;  3VYR A;  4GN4 B;  1J6Q A;  2R92 H;  4FXD A;  4DV4 L;  1E24 A;  1K83 H;  1P16 A;  1WTH A;  4PV1 C;  4DV0 Q;  2ICI A;  3K6O A;  4JI0 Q;  4F88 A;  3CC4 A;  5IOD A;  3M7N A;  2I46 A;  2RHS B;  4L63 B;  4OEL B;  4DUY Q;  3TN2 A;  4CDE C;  3CF5 A;  1VMP A;  5C0X G;  4JI4 Q;  3CHB D;  1ZYR D;  4H0L C;  5IWA Q;  5ELN A;  2CW0 D;  1NBW A;  2IY5 B;  1SMY C;  2B3G A;  4UPA A;  1SEB D;  1CTM A;  1EEF D;  4KJN A;  4RGO S;  5D14 A;  2CWA A;  3M85 A;  3H3V I;  2B8G A;  1WOC A;  4K2K A;  4LF6 Q;  2K5N A;  4BBS G;  5H1S E;  4IQZ A;  5C44 B;  1KXL A;  2VQE L;  2RQX A;  3AMU A;  1LM0 A;  4EQO A;  1XPO A;  2JXM B;  2Y0S B;  1J5E Q;  4ID6 A;  4XT1 B;  5FLM H;  4B3M Q;  2K5V A;  3HOW B;  1K73 C;  2ZXR A;  1H95 A;  1S4Z A;  4TVA B;  1KNE A;  1SRO A;  4NW2 A;  4BBR B;  3NHH A;  3QG1 A;  1S3O A;  4DAY B;  2EJM A;  2J7Z A;  3TQY A;  1V1P B;  2B2Y A;  3AU7 A;  1XMQ Q;  4QIW E;  1PHJ A;  2RCF A;  5IYD H;  4CDF C;  3GD7 A;  3CAM A;  4N9P A;  2F0M A;  4A93 B;  1TWG B;  1BR9 A;  3E3X A;  1VQ8 A;  1KQS A;  2QCP X;  3EBE A;  4U68 A;  4LF5 L;  1TS4 A;  4TRD A;  4G7H C;  1JOO A;  1QOH A;  4QQB X;  3TS0 A;  1SSO A;  3T13 A;  4CKE A;  1FNW A;  4A3I B;  5CV5 A;  1DGS A;  1NR4 A;  1PH9 A;  2JA6 H;  4PG3 A;  1K8O A;  3FMC A;  1LT4 D;  4LFA L;  4LFB L;  1TU2 B;  4JV5 L;  1YJ9 A;  2YTV A;  2NN6 I;  2UXD Q;  3S1M H;  1K3B C;  4HIK A;  2RDG A;  2UU9 L;  4BBS B;  3H94 A;  2VUM H;  3T1Y L;  1PH1 A;  4LUO A;  3I55 A;  4P75 A;  4C3H B;  5M5Y H;  1VQC A;  1YEZ A;  5BN4 A;  2VB2 X;  1E0B A;  1V1Q A;  5A2Q E;  2B2Y C;  1I4H A;  1KL9 A;  3S2H B;  2OTJ A;  2L0C A;  1SNC A;  4X62 Q;  1H9S A;  3CC2 A;  2DN8 A;  5I6Y A;  5CV8 A;  1LO5 D;  3HOV B;  5AJ3 L;  4S3S A;  4IUT A;  4AYB B;  1HFN A;  1JCK B;  1PTO H;  5LMU Q;  4N8X 1;  1PRT F;  3K8A A;  2EYF A;  3ERQ A;  4Q5V A;  4AIM A;  4BY1 B;  1QIL A;  1QB5 D;  5C4X H;  3PF4 A;  4JI4 L; 
#chains in the Genus database with same CATH homology
 5AJ3 Q;  1BKB A;  4TQU S;  4DV4 Q;  2AWO A;  1AH9 A;  3ULP A;  4DUZ L;  3J80 i;  2Z6K C;  2RHQ B;  3PF5 A;  4GNX B;  1MJE A;  2JA9 A;  1VQM A;  2OCE A;  5M3M G;  1HNZ L;  2CKZ B;  1XNR Q;  1HZA A;  2ZM6 L;  4DV6 L;  1A8V A;  3M4P A;  4BY1 H;  1A63 A;  1JMC A;  1XMO Q;  4IJH A;  1N32 Q;  1A62 A;  1HR0 W;  2UUB Q;  2KCM A;  1Q46 A;  3AYH B;  5K36 G;  1TWF H;  1TWC H;  5M5W H;  3CMA A;  4P71 A;  4DV7 Q;  2E5L Q;  4A3G H;  3GDE A;  3ULJ A;  5GAG C;  2L15 A;  3SGI A;  3HOZ H;  2HIV A;  4APV A;  4A93 G;  3ZJY C;  3I56 A;  4A3E H;  2KCT A;  2F4V Q;  3TS2 A;  1VQA A;  3F2D A;  5FJ8 H;  3I2Z A;  2VQF L;  3NBH B;  3BZC A;  3KDF A;  2R6G A;  3E9I A;  5BR8 Q;  2JA7 G;  4R4I A;  3NEM A;  1BBW A;  4LF9 Q;  1XNQ Q;  1X65 A;  2ZM6 Q;  2YTX A;  4LFB Q;  1Z9F A;  3EIV A;  3CC7 A;  2BH2 A;  4EX5 A;  4A3I H;  1OTC A;  4DR4 L;  1PV4 A;  3RZO H;  1W3S A;  3KYH C;  2VZA A;  1JJ2 A;  2LSS A;  2ALY B;  4GOP B;  4A3K H;  4L5S A;  4IFD I;  1OXU A;  2IHE A;  3KJP A;  1HZ9 A;  5BR8 L;  1Q12 A;  4DR7 Q;  5C44 H;  1Q1B A;  2N49 A;  1V9P A;  2OQ0 A;  4JC0 A;  4KLK A;  3CCL A;  2ASB A;  4JBW A;  4JI3 L;  4A3E G;  4GKJ Q;  3UDG A;  1CUK A;  1HZC A;  1VQB A;  4JG2 A;  1I94 Q;  4A3M G;  4B3S L;  3PO2 H;  1L1O A;  1EUJ A;  3JAM i;  3S1N H;  4PMW A;  1NY4 A;  2K75 A;  4YCU A;  1Q82 C;  1IZ6 A;  2NVX H;  2BH8 A;  4DR2 Q;  2I5L X;  1KC8 C;  4C3J H;  2PQA A;  3STB D;  5LMN Q;  1YI2 A;  1PYS B;  2LXJ A;  1E1O A;  3W5O A;  1C9O A;  1VS0 A;  1B7Y B;  1Y1W H;  1FJG Q;  1VQL A;  4AQY L;  2D0O A;  1GKH A;  4QGU A;  1PH4 A;  4OXP A;  1N33 Q;  1HNW Q;  2AHO B;  1K8A C;  3I4O A;  2D0P A;  1XMO L;  4HIO A;  1I3Q H;  4DK3 C;  1LTL A;  1Y14 B;  1J5E L;  2YU9 H;  1R9T H;  2MFI A;  2JJQ A;  4UY8 C;  2I5M X;  4P74 A;  2E2I H;  2JEA I;  1HH2 P;  3HOY G;  2AKW B;  4AYB E;  1KD1 C;  5E7N A;  1JJC B;  2GVB A;  3AQQ A;  2KHJ A;  1OXV A;  3TEH B;  3L2P A;  1N36 Q;  4QY7 A;  2N8N A;  4OON A;  2AMC B;  1YHA A;  4DR2 L;  1QUQ A;  3FKI G;  4JI0 L;  4X62 L;  1ASZ A;  3H3V H;  1EWI A;  1KHI A;  1PYB A;  5M3M H;  2JQO A;  4YCV A;  4YCW A;  4A3J G;  2CCZ A;  4JI2 Q;  1IBL Q;  4DV7 L;  1YJN A;  3I4M H;  4JBM A;  4BBS H;  4A3G G;  2UUB L;  4DR3 L;  1WCM G;  4JI6 Q;  1IYJ B;  1NMG A;  4DUZ Q;  4KHZ A;  5GAH C;  3PIO A;  1MKH A;  3JC6 6;  1YHB A;  1M1K C;  2YYZ A;  3S16 H;  3CD6 A;  3FHW A;  4NPS A;  1B8A A;  4LFC L;  4DR3 Q;  4DV5 Q;  2A1A A;  1RIP A;  4GN3 B;  1U0L A;  5GAE C;  5JJL A;  1XJV A;  2OTL A;  4IPH A;  3RLF A;  3NEN A;  4XTC S;  1TWG H;  4KHP Q;  3UE1 A;  3MXN B;  2IX0 A;  1I94 L;  5LMN W;  1YIJ A;  3LGJ A;  3CPF A;  3CCQ A;  4DV5 L;  3I4M G;  3S1Q H;  2UUC Q;  1SLJ A;  1P8L A;  4A93 H;  4OWW B;  3CCE A;  2PMZ E;  2VL6 A;  3F2B A;  2N78 A;  4DV2 L;  3J81 i;  2IHF A;  2HIX A;  1VQP A;  4P72 A;  4B3T L;  3GTO H;  4X66 L;  1LUZ A;  2K4K A;  3OTO L;  2QA4 A;  2JA5 H;  2UUA L;  3D0F A;  4X65 L;  1G29 1;  3J81 j;  1G6P A;  2PNH A;  4AQY Q;  4IPC A;  1CKM A;  4DUY L;  1SFO H;  4B3S Q;  5HY6 A;  5IP9 G;  1K8G A;  3TRZ A;  1K3R A;  1VQD A;  4POF A;  5LMN L;  1VQ6 A;  3M4O H;  5JJK A;  3CXC A;  2HT1 A;  3AEV A;  3S14 H;  2Y0S E;  1E7Z A;  1UWV A;  3PV0 A;  2UXB Q;  3I4N G;  1N9W A;  1XNQ L;  3CCR A;  4PZ6 A;  4ALP A;  1I5F A;  2BA1 A;  4JBK A;  1HNW L;  4MNO A;  1QVC A;  4JOI A;  2YTY A;  3RZD H;  4LF4 L;  2E5L L;  4DR5 L;  1KIX A;  1SMX A;  4QL5 A;  1JB7 A;  3KLW A;  3OTO Q;  3G6E A;  1UE5 A;  4DAM A;  5C4J H;  2EQS A;  4Y52 H;  4DPG A;  2ES2 A;  4A3D H;  2UXC Q;  2PQA B;  2Z6K A;  4DV6 Q;  1MIU A;  3G71 A;  1IBM L;  2K14 A;  3A0J A;  1N34 Q;  1EOV A;  2HQL A;  4LF5 Q;  4GKJ L;  2PI2 A;  3K80 C;  4DV3 Q;  1VQ7 A;  4UP7 A;  2ZTE A;  2N3S A;  1IBM Q;  3MEF A;  3PUY A;  4R1J A;  3HOU H;  3WWV A;  1L0W A;  3OW2 A;  2K52 A;  4JCV E;  4OO1 G;  4YWK A;  1S40 A;  2VQF Q;  3J81 c;  2ZJP A;  2GVA A;  1Y1V G;  2QGQ A;  3PUW A;  1QZG A;  3UDI A;  3GTJ H;  2ZTD A;  4JOI C;  2VQE Q;  2V1C C;  5ELO A;  4AYB G;  4OX9 Q;  1M90 C;  3D31 A;  5IY0 A;  3HOW G;  2OWO A;  2KBN A;  4DK6 C;  4BXX G;  5IYB G;  4C2M H;  3S1R H;  1YBY A;  4GLA C;  3F2C A;  4A4I A;  4HJ7 A;  4DNI A;  1PFS A;  4X66 Q;  1D7Q A;  5IWA L;  1NE3 A;  1BBU A;  2JA6 G;  1UE7 A;  3ICE A;  2NZH A;  5C44 G;  2DUD A;  1X56 A;  4JI8 Q;  5C0X I;  1BVS A;  5GQO A;  4A3C G;  2RF4 A;  4B3R L;  1PVO A;  4X65 Q;  3GTP H;  2E8G A;  2CQO A;  3W1B A;  4JYA Q;  1UEB A;  2WFW A;  1Q86 C;  4ME3 A;  4MTN A;  4IPD A;  3RN2 A;  1CSP A;  4P73 A;  1EQQ A;  1LYL A;  4GOP A;  3CCM A;  2JEB I;  2QEX A;  1XPU A;  2Q2H A;  3HKS A;  3E0E A;  4JI8 L;  3M3Y H;  1FL0 A;  4LW1 A;  4A3B G;  3OYY A;  1CKO A;  2WB1 E;  2JA8 H;  4GLV B;  3TRE A;  4NB3 A;  3T1H Q;  3K7A H;  2K50 A;  3PO3 H;  1XNR L;  1X55 A;  5M5X H;  1XPR A;  1RL2 A;  4GLX A;  4IFD J;  2HHH L;  4WJ3 M;  5IYC H;  3T1H L;  3Q8D A;  4A3F G;  4A76 A;  3HOV G;  3PUX A;  5FLM G;  1N36 L;  2I5H A;  1FVI A;  3M4Q A;  3S24 A;  2IX1 A;  4A3C H;  2KHI A;  3CCJ A;  4DV3 L;  4KHP L;  3KF8 B;  3RR5 A;  5FJ8 G;  1VCI A;  5IP7 H;  1YJW A;  4GKK Q;  2MNA A;  4DV0 L;  3G48 A;  3E9H A;  3T1Y Q;  1X3F A;  1EIY B;  3I4N H;  2R7D A;  3RLN A;  1E1T A;  5FLX c;  2I0Q A;  2JA8 G;  4IPG A;  1WYD A;  4NXM L;  1SRU A;  4IFD G;  3K0X A;  3L0O A;  4HJ5 A;  1GO3 E;  4POG A;  3J80 c;  1N34 L;  3JAM c;  4A3I G;  1HNX Q;  3KF6 B;  1NJI C;  4DR4 Q;  4H02 A;  4O0A A;  4OX9 L;  1QVG A;  1NMF A;  2NVQ H;  1VQ9 A;  1PH6 A;  2WAQ E;  3B6Y A;  3CW2 C;  3F8T A;  1IBK L;  4C3I H;  1IXR A;  1EIF A;  3U50 C;  4LF4 Q;  2UXD L;  1N32 L;  4GNX A;  1TWA H;  1CKN A;  2XTI A;  4JV5 Q;  2R7Z H;  1UE6 A;  2JK8 A;  2AWN A;  2CWP A;  4KI0 A;  1KRT A;  2NZO A;  3HKZ E;  3UDX A;  4R4T A;  1KRS A;  4YY3 L;  1PH2 A;  1ASY A;  4JI3 Q;  1IBK Q;  1GD7 A;  1QZH A;  1YNX A;  3KDF B;  2B63 H;  4J15 A;  4YY3 Q;  4A3D G;  5IYC G;  4DR1 Q;  3DLL A;  2DGY A;  2F4V L;  2A8V A;  4EQ5 A;  1K9M C;  1VQ4 A;  4HID A;  3S2D H;  3KF6 A;  4O2D A;  4IOC A;  1OXT A;  3HOU G;  1VQH A;  3EN2 A;  4JI7 Q;  4NXN Q;  1L1O B;  1GVP A;  1AE3 A;  3CQZ H;  5M3F H;  3RN5 A;  3A74 A;  1I50 H;  1L1O C;  2K5H A;  5EAY A;  1XMQ L;  3S17 H;  4LWC A;  3H0G G;  3NEL A;  4HJ8 A;  4GOP C;  2Y0S G;  2NN6 G;  4JI1 L;  3FKI H;  4B3M L;  2CFM A;  3DM3 A;  1WJJ A;  3PUZ A;  3ER0 A;  2GN5 A;  4IJL A;  3GTM H;  2R93 G;  3PIP A;  2R92 G;  3HOW H;  4NXN L;  2EXD A;  3KFU A;  4AH6 A;  2R7Z G;  3S2H H;  1FGU A;  2VUM G;  4YWM A;  1Q7Y C;  4OWX B;  1C7Y A;  4DV1 Q;  3HOY H;  2XGT A;  4R4O A;  1E22 A;  3CPW A;  4DR5 Q;  2JA7 H;  4LUV A;  1UE1 A;  1A0I A;  3IRB A;  4Y7N H;  4GNX C;  3FP9 A;  4WJ4 A;  1Z47 A;  3KJO A;  3CME A;  4JYA L;  1WCM H;  3BU2 A;  1VQG A;  3PGZ A;  4MZ9 A;  4RG1 A;  3RLO A;  1JT8 A;  3H0G H;  4IO9 A;  4OO1 I;  2MO0 A;  4L5T A;  2R93 H;  1U5K A;  3PSI A;  4BA2 I;  4JI6 L;  4A3L G;  4GN4 B;  1J6Q A;  2R92 H;  2Q2I A;  5HGQ A;  1SN8 A;  3F1Z A;  1XTD A;  4DV4 L;  1E24 A;  1K83 H;  1P16 A;  1VQE A;  4DV0 Q;  1K0R A;  1AE2 A;  4JI0 Q;  3CC4 A;  4UP8 A;  2UUA Q;  2PI2 E;  5M3F G;  1X3G A;  3M7N A;  1OXS C;  4BY1 G;  2VNU D;  2E2H H;  2RHS B;  4DR6 L;  3BJU A;  5C3E H;  4DUY Q;  2MO1 A;  3CF5 A;  5C0X G;  4JI4 Q;  1FJG L;  1MJC A;  4UP9 A;  2Q2U A;  2VS1 A;  5IWA Q;  3S15 H;  2EIF A;  5ELN A;  4LF8 Q;  1N33 L;  3CCS A;  1Y1V H;  4L5Q A;  1IBL L;  1S72 A;  1X3E A;  1PH8 A;  4JI2 L;  2C35 B;  1VQI A;  1NBW A;  3K81 C;  3AFQ A;  2IY5 B;  2B3G A;  4UPA A;  3GTQ H;  1C0A A;  2CWA A;  2Z0S A;  5GRO A;  5C0X J;  3BZK A;  2ATW A;  3M85 A;  2OQK A;  3H3V I;  1WOC A;  5IYD G;  1QVF A;  5IP9 H;  4IOA A;  4B3R Q;  4LF6 Q;  2K5N A;  5JJI A;  4DR6 Q;  4DV1 L;  4BBS G;  5H1S E;  1KXL A;  1V43 A;  3A5U A;  2VQE L;  3J7Z C;  3GTK H;  4LF7 Q;  4BY7 H;  5J3B A;  1EQR A;  1LM0 A;  3U58 A;  4YHH L;  1Q8K A;  4A3J H;  1XPO A;  1VQ5 A;  2Q2T A;  3HKZ G;  2F52 A;  3G4S A;  1X9N A;  1J5E Q;  2E2J H;  3PUV A;  3CCU A;  4JI1 Q;  5FLM H;  2K5V A;  1HZB A;  4X64 L;  4YWL A;  1Q81 C;  1K73 C;  1HR0 L;  4B3M Q;  1TWH H;  4DR1 L;  5IE8 A;  4PZ7 A;  2VY3 A;  4TVA B;  1H95 A;  2A19 A;  2B63 G;  1SRO A;  3PO3 G;  1S3O A;  4DAY B;  2WAQ G;  5JEA G;  1PH7 A;  2JE6 I;  4XIG S;  4JI5 Q;  3TQY A;  3UDF A;  3ULL A;  4B3T Q;  2UXC L;  2ZJQ A;  4R4C A;  1XMQ Q;  1X6O A;  4K0K Q;  1B70 B;  4QIW E;  3HOX G;  1PA6 A;  1PHJ A;  5IYD H;  2NVY H;  3GD7 A;  5IP7 G;  3CAM A;  1Y1W G;  3U4Z A;  4LUZ A;  1OXX K;  3K7U C;  3GTL H;  3UE0 A;  4GN5 A;  1E3P A;  2UU9 Q;  1VQ8 A;  2MQH A;  5JEA J;  3U4V A;  2B29 A;  1KQS A;  1Q1E A;  3EBE A;  1VQN A;  4LF5 L;  2NVT H;  4FDB A;  1QUQ B;  1JJG A;  4A3M H;  5IYB H;  1EYG A;  4QQB X;  3M9B A;  3TS0 A;  5LMU L;  1WFQ A;  4RMF A;  1DGS A;  1HNX L;  4BBR G;  4JBJ A;  4LFA Q;  1PH9 A;  1YHQ A;  1HNZ Q;  4PG3 A;  4C3H H;  1KAW A;  2JA6 H;  4GKK L;  1CKN B;  5DLQ E;  1SE8 A;  4X6A H;  1VQJ A;  3PCO B;  2UUC L;  4QJF A;  4LFA L;  3I7F A;  2D62 A;  1W2B A;  3CCV A;  3HOZ G;  4LFB L;  4JV5 L;  1YJ9 A;  2WB1 G;  2YTV A;  1I6H H;  3HFZ B;  2IT1 A;  4A3K G;  2NN6 I;  4DV2 Q;  2UXD Q;  1VQF A;  2FXQ A;  3S1M H;  1NTG A;  2ZTC A;  4BA1 I;  3L7Z C;  4HIK A;  1N8R C;  2KEN A;  4A3F H;  3HOV H;  2UU9 L;  4LF8 L;  3H15 A;  1SR3 A;  3A5Z B;  5IT9 c;  4HJA A;  4DR7 L;  3GTG H;  2VUM H;  3T1Y L;  4A3B H;  2VW9 A;  1PH1 A;  4HIM A;  4JI5 L;  4JI7 L;  2RCN A;  1PH3 A;  1IL2 A;  4LUO A;  3I55 A;  2BA0 A;  4P75 A;  4BBR H;  5C3E G;  4LF9 L;  4LFC Q;  5M5Y H;  3RNU A;  2ID0 A;  1VQC A;  1YEZ A;  4GS3 A;  2YV5 A;  4X64 Q;  1HR0 Q;  4LNQ A;  3PO2 G;  2UXB L;  1L2F A;  1V1Q A;  2HHH Q;  4LF6 L;  1YZ6 A;  4R4Q A;  1EFW A;  1D8L A;  4HJ9 A;  1KL9 A;  3W1G A;  4LF7 L;  4K0K L;  1WI5 A;  1X54 A;  2OTJ A;  1YVC A;  3ERS X;  1YIT A;  4BY7 G;  4DKA C;  4A3L H;  2ZJR A;  1HJP A;  1GM5 A;  1CSQ A;  4X62 Q;  3KOJ A;  3GO5 A;  3CC2 A;  2LXK A;  4NXM Q;  1VQK A;  1TXY A;  1G51 A;  2F3I A;  4BXX H;  5C4X G;  1O7I A;  4OWT B;  5AJ3 L;  3STB C;  3AFP A;  4YHH Q;  4PZ8 A;  4A75 A;  5LMU Q;  2H5X A;  2R7F A;  4L5R C;  3CP0 A;  3K8A A;  1VQO A;  3J7A 5;  4AIM A;  1PH5 A;  1JE5 A;  2WP8 J;  5GAD C;  3HOX H;  2JA5 G;  5C4X H;  3PF4 A;  3VDY A;  1T9H A;  4JI4 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...