4JI4L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLLGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji4L00
3F8TA 1LUZA 1VQFA 4NXML 4DR7Q 2K14A 4X64Q 3M4OH 3UDFA 2JA7H 4JI3L 3CPWA 4P74A 4HIKA 3K8AA 3W1BA 5IY0A 1MIUA 4DR5Q 1X9NA 4A4IA 4UP7A 4LF6L 1HH2P 3T1HL 4YY3L 4A3EG 4A3LH 1NY4A 3NEMA 4IJHA 4A3GH 4OXPA 4P72A 4QY7A 4OWWB 4A3BH 2DGYA 4JG2A 4BBRG 1JE5A 2JJQA 2K5HA 4LF5Q 2JA8H 2AKWB 2DUDA 1HZ9A 3K80C 5GQOA 4AQYQ 3TS2A 4DR6Q 5FLMG 2D0OA 4OX9Q 4IPHA 3S15H 2H5XA 3ULLA 4AQYL 3DM3A 2UUCQ 2ZJQA 2IHEA 3EIVA 4A3DG 1G51A 4OX9L 2BA0A 1G6PA 3HOXH 2KHIA 3KOJA 2R92H 2HIVA 2XTIA 4GLVB 2MQHA 3M85A 3HOWH 3S1NH 3RZDH 1WI5A 5IP7G 2UUCL 5J3BA 4A3MH 3HOVH 1VQBA 1Y1WH 3RZOH 3I7FA 4C3IH 4DAYB 3F2BA 2Q2HA 3CCJA 3W1GA 3L0OA 1CKNA 1QUQA 1Y1VH 3S2HH 3J7ZC 1I3QH 2YYZA 4BY7G 1I50H 1HZAA 1YVCA 2OCEA 4BY1H 4IOAA 4QQBX 4AYBE 1TWCH 2HQLA 4C3JH 3UDGA 1HNXQ 1IBLQ 1VQCA 1N32Q 4POFA 3J80c 4HJ9A 1CKOA 5JJIA 5JJLA 4P73A 3K7UC 1Z9FA 2VZAA 5C0XJ 4JOIA 2CCZA 4BA1I 1A0IA 1K83H 2JA9A 4APVA 1QVCA 4X65Q 5GADC 1KAWA 1XMQQ 1FGUA 2WB1G 1XMOQ 4B3MQ 2B63G 1N32L 1SROA 3OYYA 4XTCS 1QZHA 2QEXA 4LF4L 4XIGS 1BBUA 2UUAL 4JI1Q 1VQGA 4X65L 1XMQL 4A76A 2PNHA 4A3JG 3S14H 4B3ML 1HNWL 2D0PA 4OO1G 3KFUA 3CCQA 3CC4A 4LF8L 3DLLA 4P75A 3RNUA 4X6AH 1A8VA 4L5QA 5FLXc 1N34Q 4JI1L 2UXBL 2NZHA 2JEAI 1VQAA 4KI0A 1K8GA 2Q2IA 1LTLA 2R7ZH 2VQEQ 1YI2A 3U58A 4GKKQ 2KENA 5H1SE 4A3IG 1N34L 4PMWA 4JYAQ 3HKZG 1SN8A 1CKNB 1QUQB 3BZCA 1UE1A 4BBRH 1UWVA 4YCWA 3L2PA 3CF5A 1PH1A 4LUZA 4JI0Q 4LW1A 4OONA 4GKKL 1NBWA 4LF7L 3RLNA 5GROA 4JI5Q 3PO3G 2VNUD 5IE8A 5FLMH 4IFDJ 3CPFA 3HOYG 1X54A 1H95A 2GVAA 5C3EG 4JI8Q 1N33Q 2Z6KA 4DK3C 1QVFA 1NMGA 4R4CA 3STBD 4HJAA 4A3DH 2AHOB 1KQSA 1OXUA 1IBLL 4NXNQ 2Q2TA 2MNAA 1UEBA 3T1YQ 1JJ2A 1M1KC 1Q1BA 4A3KG 4GN5A 4KHZA 4JBKA 4DV6Q 1FVIA 1HNZQ 1VQEA 5IP9G 4BY7H 2UXCQ 4K0KQ 1E7ZA 1P8LA 4YCVA 3CC7A 3STBC 1PH8A 3ICEA 2OWOA 4DV6L 1K0RA 2YU9H 5GAGC 1EIFA 4QIWE 3CC2A 4JI2L 4AIMA 1WFQA 4DPGA 4DV0Q 4IOCA 3H3VH 4K0KL 2UXCL 3BZKA 1CSPA 1OTCA 1JB7A 2KCMA 3H3VI 4HJ7A 3LGJA 3J80i 4A3FG 4DR1Q 5M5YH 4DV0L 4HIDA 1ASYA 3I56A 3A5UA 5JEAJ 2K5NA 5IWAL 3Q8DA 2CKZB 3CCEA 1GD7A 1I5FA 5LMNL 2ES2A 4A3CG 4HIOA 1BKBA 1SRUA 3M7NA 1EWIA 1DGSA 4DAMA 4B3TQ 1FJGQ 4DR1L 4JV5Q 4TVAB 1HR0W 4DV4L 2LXKA 2K52A 1Y14B 4O0AA 1VQPA 3M3YH 1YIJA 4OO1I 1A62A 3IRBA 4GOPA 5BR8Q 3GTGH 1E1OA 2A8VA 1FJGL 4LFBL 1A63A 2K4KA 4X66Q 1VQLA 3GTJH 4LF9Q 2LSSA 2R7DA 3A0JA 4DV7Q 2N3SA 4IJLA 5BR8L 4GNXC 1K3RA 4PZ7A 4X66L 1YJNA 4DR7L 2PI2A 5M3FG 4LF9L 1XPUA 3AEVA 1VQOA 3CD6A 4X64L 3PO3H 4DV7L 2OTJA 2GVBA 1N36Q 3OW2A 3EBEA 2UXDQ 3U50C 4LFCQ 1J6QA 3I4OA 4DR5L 1HJPA 5M5WH 1KXLA 2VUMG 4UY8C 2VL6A 2OQ0A 2ZTCA 1EIYB 4A75A 2R7FA 1MJCA 4DV5Q 5C44H 2UXDL 2IY5B 2EIFA 1EUJA 4LFCL 2R93G 3GD7A 1Q1EA 3S1RH 4JI4Q 4ALPA 1HR0Q 4B3SQ 4DV3Q 1E3PA 4LF5L 2VW9A 1G291 4A3KH 1VQMA 2E5LQ 1TWHH 2JA6H 4DR6L 1TWAH 1CSQA 4JI4L 2BH2A 2MO0A 1QVGA 4BXXH 1XNQQ 3HOUG 4GOPB 4X62Q 2ZTEA 1SLJA 4POGA 3GTPH 2WB1E 3I4MH 3S17H 3NBHB 1FL0A 5GAEC 4HIMA 3PF5A 2ZJPA 3ULJA 4X62L 5K36G 1C0AA 3K81C 4GS3A 3GO5A 3OTOQ 1SFOH 2UU9Q 4A3FH 4BBSH 4YHHQ 1XTDA 3H0GG 4WJ4A 4Y7NH 2OTLA 4A3CH 3FHWA 1KHIA 1S40A 2JE6I 1IYJB 3MXNB 3OTOL 1LM0A 1PH7A 4JBWA 3HKZE 1S3OA 4DV1Q 2RHQB 1HNXL 4KHPQ 4BA2I 1JJGA 2WAQG 3E9HA 3F2DA 2NN6G 3HFZB 3UDXA 4DV2Q 4DR2Q 3J7A5 4DV1L 4KHPL 3PCOB 2F52A 3GDEA 5M5XH 1XMOL 2VQFQ 3E0EA 5JJKA 2R6GA 3L7ZC 4DV2L 2PQAB 4DR2L 3RN5A 1PV4A 1M90C 5M3FH 2JK8A 3KF6A 3AFQA 3I4NG 3I2ZA 1S72A 5IT9c 1XNRQ 4A3EH 3U4ZA 3KLWA 1WJJA 1KRSA 3KF8B 1XPOA 1WOCA 1X56A 3KYHC 4NB3A 3D0FA 3CCMA 3FKIG 1XNRL 5M3MG 4LFAQ 4JI6Q 4QJFA 2VQEL 4JI7Q 1UE7A 2R93H 1EFWA 3TREA 2NVQH 1J5EQ 1X55A 5AJ3Q 1GM5A 4JYAL 1GVPA 2FXQA 5IYDG 1IBKQ 4JI0L 1PHJA 2K75A 3B6YA 3GTKH 2CFMA 1JT8A 2ZTDA 4LFAL 3PGZA 3A5ZB 4B3RQ 3RN2A 1VQ6A 3PSIA 1L1OC 2IHFA 4JI5L 2HHHQ 4EQ5A 1X65A 2QA4A 1J5EL 3G48A 5GAHC 1TXYA 1V43A 1IBKL 3HOUH 1N33L 4JI8L 4IO9A 3CCUA 3UE0A 4DUZQ 4DKAC 4IPCA 1AE2A 3KDFA 5IP7H 3RLFA 2RCNA 4HJ8A 4KLKA 3PUZA 4LUVA 4YWMA 5IYBG 1RL2A 1E22A 1UE6A 3BJUA 1PH2A 4NXNL 1I94Q 4L5RC 4IFDG 3CCRA 1OXTA 3CW2C 4DUZL 3T1YL 2IT1A 3K7AH 4JBJA 2I5HA 1MJEA 3KF6B 2VY3A 1I6HH 1PH9A 1I94L 4R4IA 3PUYA 3CMAA 3H0GH 1HNZL 4A3GG 3PIPA 1IBMQ 2N49A 3NENA 4GN3B 1NJIC 4YWKA 4A3BG 1K73C 2RHSB 2JA8G 1HZBA 5ELNA 2E2JH 1N8RC 4A93G 4C2MH 1VS0A 4AH6A 1IBML 1B70B 2B63H 1YHQA 4GKJQ 1SMXA 3A74A 3KJPA 1YNXA 3G6EA 3PO2G 1QZGA 1VCIA 1WCMG 1Q81C 3GTMH 2NN6I 1LYLA 1JJCB 4A3JH 3CXCA 1VQ9A 2V1CC 4DUYQ 3PF4A 3UE1A 4GKJL 1PYSB 2BH8A 3JC66 3F1ZA 5FJ8G 2YTVA 3HOWG 3KDFB 1Q46A 1N9WA 3GTLH 4GOPC 3HOVG 1R9TH 4A3MG 4DUYL 3I4NH 1Y1WG 4B3TL 2F3IA 4JV5L 2PI2E 2KHJA 1PH5A 1TWGH 1Z47A 4A3IH 1Q82C 2EXDA 5JEAG 3FKIH 2WFWA 4QL5A 3HOZG 3CCLA 1EOVA 2NZOA 1MKHA 1W3SA 1OXVA 2F4VQ 1HNWQ 1BBWA 4LUOA 2Q2UA 3MEFA 2ASBA 3HOYH 1U5KA 2A1AA 5IYDH 2E2IH 4PZ6A 5C3EH 2YV5A 3ULPA 3UDIA 1AE3A 1WYDA 4MTNA 4R4TA 4TQUS 3SGIA 1JMCA 2AWNA 4R1JA 2UXBQ 1U0LA 1N36L 4JI3Q 3M4QA 2GN5A 2IX1A 2ID0A 3CCSA 1CKMA 1B8AA 1NTGA 5HGQA 5IYBH 3TS0A 4LF6Q 2K50A 4DV5L 3T1HQ 1X6OA 4YY3Q 4GNXA 4IPDA 2PMZE 2I5LX 1HZCA 4MNOA 5DLQE 1Q12A 3J81c 4O2DA 1VQJA 1HR0L 4B3SL 5IP9H 4DV3L 4IFDI 1P16A 2E5LL 2PQAA 2WAQE 1GKHA 2R7ZG 1PVOA 3BU2A 1VQHA 1PFSA 2Y0SG 2ZM6Q 1XNQL 3S24A 2JA5G 4LWCA 3K0XA 4A93H 3RLOA 2I5MX 3PV0A 2ZM6L 2EQSA 3PO2H 3CCVA 1PH3A 1VQKA 1WCMH 1GO3E 3ER0A 1C7YA 1Q86C 2N8NA 1X3FA 1E1TA 2MO1A 4L5SA 1SE8A 4IPGA 1VQ7A 2UU9L 3TQYA 4JOIC 1VQIA 2ALYB 4YHHL 3G4SA 1D7QA 5FJ8H 3NELA 3J81j 4HJ5A 3S1QH 3RR5A 2C35B 1VQ5A 4FDBA 1E24A 3AFPA 3GTQH 5ELOA 2KCTA 4GNXB 2JEBI 3S1MH 1B7YB 1EQQA 2RF4A 1YHAA 1IZ6A 3TEHB 3PUVA 4L5TA 1VQ4A 4H02A 4GLAC 1KL9A 3HOZH 1NE3A 4PZ8A 1YBYA 2QGQA 3H15A 1Q8KA 5C0XG 1KIXA 2VQFL 1PA6A 4UP8A 2AWOA 1ASZA 1BVSA 2BA1A 4LF4Q 5IYCG 3F2CA 2YTXA 2UUAQ 2NVTH 2VUMH 3CQZH 1YZ6A 1NMFA 2HIXA 4NPSA 4LNQA 4LF8Q 2MFIA 3ERSX 3AYHB 4OWTB 4ME3A 5C4XG 4J15A 2HT1A 4R4QA 1OXXK 1YEZA 2JQOA 1Q7YC 3JAMi 2ZJRA 3PIOA 2B3GA 3M9BA 1IXRA 2Z6KC 4JI6L 4JI7L 3U4VA 4OWXB 1D8LA 5EAYA 5AJ3L 1VQNA 4AYBG 4DR3Q 1K8AC 1PH4A 4GN4B 3WWVA 1VQ8A 4UPAA 4Y52H 1AH9A 4B3RL 3PUWA 4LF7Q 4RG1A 3J81i 3D31A 2JA7G 4DR3L 2VS1A 2JA5H 4EX5A 3M4PA 4JC0A 4YWLA 2KBNA 4DK6C 1TWFH 2NVXH 3S16H 2IX0A 3PUXA 1VQDA 5LMNW 2ATWA 1YJ9A 1XPRA 4A3LG 4R4OA 3HKSA 1YITA 2K5VA 1YJWA 2N78A 2A19A 4DR4Q 1L1OA 1CUKA 3EN2A 5E7NA 3W5OA 5C44G 1O7IA 4GLXA 2B29A 2UUBQ 4DR4L 3G71A 2YTYA 1UE5A 2WP8J 3I55A 1YHBA 2CQOA 1EQRA 1V1QA 2D62A 2LXJA 3KJOA 2UUBL 2JA6G 2E8GA 4C3HH 1IL2A 5HY6A 4JI2Q 2HHHL 3TRZA 1EYGA 4BXXG 3HOXG 4P71A 1KRTA 2R92G 3AQQA 5LMUQ 3I4MG 2Z0SA 1XJVA 1RIPA 2OQKA 1W2BA 4UP9A 2I0QA 2XGTA 3FP9A 5IYCH 1PYBA 4RMFA 5C0XI 5LMUL 5IWAQ 5LMNQ 4QGUA 4YCUA 4JCVE 1Y1VG 1T9HA 5M3MH 3ZJYC 1SR3A 1X3GA 4BY1G 3S2DH 1X3EA 4BBSG 4DV4Q 5C4XH 2CWPA 2L15A 1PH6A 1KC8C 4PG3A 1L0WA 1L1OB 1C9OA 3CMEA 1L2FA 3CAMA 2E2HH 1V9PA 2NVYH 4LFBQ 3GTOH 2Y0SE 2CWAA 1OXSC 1K9MC 4NXMQ 3JAMc 2F4VL 3CP0A 4WJ3M 4JBMA 2AMCB 3VDYA 5C4JH 1KD1C 4MZ9A 4DNIA 3E9IA
chains in the Genus database with same CATH superfamily
1U4MA 4X64Q 2JA7H 4DAYA 1EZ6A 1PZJD 5I6WA 4OL7A 4J1MA 4ZLTF 4A4IA 2F0KA 1HH2P 4YY3L 1NY4A 4IJHA 4QY7A 4A3BH 2DGYA 3LNNA 1EY0A 2JJQA 4M8AA 4LF5Q 2JA8H 2DUDA 1HZ9A 3TS2A 5LL6X 5FLMG 3EQLC 5G3LD 1LTAD 3S15H 5LL6S 4RFBA 4AQYL 1AP0A 3SVMA 2EJGC 1IHZA 1TQOA 3HOXH 4RGMA 1AN8A 2R92H 2LY7A 1CZGA 1CQVA 3R2IA 3RZOH 2UUCL 3HOVH 4A3MH 4KD3A 4DAYB 3F2BA 3T13A 2FMMA 2SDFA 2YYZA 4IOAA 1YVCA 3BYYB 4QQBX 1TWCH 2HQLA 1C4QA 1EY5A 2F0WA 4ABNA 1I4QA 4A3DB 1VQCA 1N32Q 4DA2A 1CKOA 3A7AB 1EIGA 5C0XJ 5EBCA 4X65Q 1HNWQ 5GADC 1KAWA 3I4LA 4NKLA 1XMOQ 3EROA 2B63G 1SROA 1F9PA 2QEXA 4LF4L 3WOEA 2WINB 1BBUA 2E2DC 2DN8A 3S14H 1B3AA 4FF3A 2PNHA 2MP1A 1I6HB 2KOLA 4BY7B 4XQJA 4LF8L 4P75A 3RNUA 1A8VA 5FLXc 1N34Q 5D65A 5DNFA 2AQ3B 4GKKQ 3U58A 2A6HD 4A3IG 1RDPD 4F7XA 4DGZA 3HKZG 3BZCA 1GUNA 1LLRD 4YCWA 4LUZA 4LW1A 3OWFA 1LTID 3PIO3 2AQ1B 2L5TA 2EZVA 4A3JB 1HRJA 1HTPA 1TS5A 3HOYG 1SYBA 1X54A 2GVAA 3D4RA 1J9OA 3X3NA 2D2CC 4IUTA 1E0BA 3DWPA 3ERQA 4MN3A 5CBEE 3L3OC 1JJ2A 2EJFC 1Q1BA 1F2ZA 4XYOA 5EPLA 4N8X1 1FVIA 3J7YW 4U68A 4LMQD 4CBVA 1JOQA 1P8LA 4YCVA 1PH8A 4DV6L 1S5CD 5GAGC 3GV6A 1PFBA 3CC2A 1A2UA 4IQZA 1WFQA 4DPGA 4DV0Q 1IW7C 1OTCA 2ZXOA 1XXGA 4HJ7A 2L1BA 1DXMA 3LGJA 4A3FG 4HIDA 2CKZB 1EIHA 4B3TQ 1T5EA 3S17B 4OO1I 3BVMA 4N8FA 3GTGH 2K4KA 3NBHA 4LF9Q 1JWMD 1WTHA 4IJLA 1JE4A 5BR8L 1WTQA 3ND8A 4X66L 1YJNA 2PI2A 2QW7A 3PO3H 3VR3A 4DV7L 4K8JA 1N36Q 1FGBD 1SE2A 1J6QA 4Z9CB 1LTBD 4DR5L 3S1QB 4EGVA 3I73A 1EIYB 4A75A 1GUGA 2QILA 1CT1D 4DV5Q 3HEJA 3QG1A 2UXDL 2F0QA 3GD7A 1HA6A 2F0PA 2PCFB 1BO0A 2VW9A 1G291 2RDHA 4X3TA 4BXXH 2A6EC 5I2YA 1XNQQ 4POGA 2I07B 5IT9L 1PTOH 4CDEC 2NVTB 3NBHB 3PF5A 1ICWA 1PRTC 5K36G 1C0AA 3K81C 5C6AA 5FOBB 4HAEA 2UU9Q 3VR2A 4CJ2C 3HOUB 4KKSA 3MXNB 2QDLA 1PH7A 3HKZE 3IFDA 1S3OA 1K8OA 1U9RA 5I2XA 3A55A 2NN6G 3HFZB 1FD7D 2F0VA 4HMIA 2JP1A 1VF5C 4KHPL 4L6TB 5M5XH 1STNA 2VQFQ 5JJKA 3H0GB 4G57A 2IPKD 1UAPA 3I2ZA 2A68C 3K5MA 5FO7B 3KLWA 1LTTD 3U4ZA 5KNCA 2IJ0A 1X56A 4NB3A 3D0FA 3FKIG 1RD9D 1EYDA 5CV6A 4LFAQ 3GTMB 1GM5A 5IYDG 4JI0L 3GTKH 1S5FD 2ZTDA 1L1OC 2DNCA 1V43A 4IO9A 3CCUA 4IPCA 1QJOA 3NBIA 1DZ1A 4KLKA 3BJUA 4IFDG 1OXTA 2PW7A 2I5HA 5FLXE 1PH9A 4R4IA 1H9KA 3ND9A 4K5WA 4RKLA 3CMAA 1IBMQ 2N49A 1Y8PB 2FHTA 5CV9A 5L37A 4A93G 4C2MH 1ZEQX 1S5BD 3FEWX 1YHQA 4GKJQ 1X3QA 1YNXA 3BZDB 4DNTB 3R2TA 1VCIA 1QZGA 2WACA 3EVQA 1Q81C 1SYCA 3CXCA 1SYDA 1QG7A 2RSNA 1ET6A 4PMBA 2QDBA 3F1ZA 3VYRA 4A3BB 4GZYC 4GOPC 4JV5L 3I4NH 2JA8B 4CKBA 1PH5A 1TWGH 1Z47A 2XWBB 3PO2B 2SOBA 3S15B 3E3XA 4L63B 2F4VQ 3DMUA 2I46A 4EQOA 1PRTF 5C3EH 3HOXB 2R92B 1F9QA 4XT3B 1AE3A 3SGIA 3W3AA 1JMCA 3GTQB 3HOVB 1D6EC 4R1JA 4A3MB 1LT4D 1ZYRC 3AB9A 2F0UA 3OPOA 1SJED 3S1MB 4HSVA 3GP7A 4B9WA 2IX1A 4KD4A 5D3IB 2KECA 4JPBW 4EVOA 5HGQA 2KHSA 4BS9A 2K50A 3T1HQ 1X6OA 1PFMA 3F2UA 2O2LD 4IPDA 2I5LX 1HZCA 3MZ5A 3VR4A 5BN3A 4O2DA 1HR0L 5IP9H 4I7AA 1GKHA 3OHXC 3NPPA 1NCVA 1WTVA 2PQEA 3AU7A 5C3WA 1ET9A 4LWCA 2F4IA 1SNMA 2X6GA 3CCVA 1VQKA 3HP3A 2MO1A 1E1TA 1D5XC 4UDUC 2EDGA 4JOIC 1A15A 1D7QA 4HJ5A 1HCZA 2PW5A 3SDZA 2HQEA 1KNEA 2MGSA 5C4HA 1OO9B 2KJXA 2N55A 2VB3X 3NHHA 4K6DA 4C3HG 3TEHB 2XRSD 1NE3A 2P5ZX 2SNMA 5C0XG 5AFWA 4K2LA 1PA6A 4UP8A 1ASZA 1BVSA 1LTRD 1K8MA 1QWYA 2UUAQ 4I7ZC 1YZ6A 3K6OA 5CYUA 1PYWD 1GHJA 3DEOA 2MFIA 3RUZA 3AYHB 5CV7A 1WD1A 1ILQA 1OXXK 3QR8A 1DCZA 4DK0A 4JI6L 4RWSC 2JYOA 1XYIA 4OWXB 1D8LA 1VQNA 1K8AC 2ZXPA 2H1EA 4UPAA 2Z4IA 1PRTB 1KNAA 4FXDA 3J7AV 2RVLA 2JA5H 1TY0A 2KBNA 3H6MA 1CA6A 1DM0B 4X3SA 2NVXH 1TWFH 1XWEA 3PUXA 1V1PA 1JOOA 2XN9C 4ZYSA 3TBIB 4R4OA 3HKSA 1YITA 4DR4Q 2Z6BA 2A19A 4FYDA 1L1OA 3EN2A 2HD3A 3GTGB 5A35A 4HTHA 4IALA 2Q8TA 5C44G 2QEJC 4TRDA 3NTIA 3M4OB 2F0FA 1SDFA 3OIPA 1CK1A 1RJTA 2CQOA 2JA6G 2K32A 2LXJA 4DF7A 1ZKOA 2E8GA 1IL2A 5HY6A 1EYGA 3RMHA 1H9RA 1V1OA 2EYOA 2HDLA 2Z0SA 1E2WA 3KLSX 4TKOB 1KDBA 2WKCA 2XGTA 2RDGA 1PYBA 1SYEA 5IWAQ 5TSSA 1V1PB 2EVBA 5M3MH 1SR3A 3P75A 5C4XH 1PH6A 1L1OB 3CMEA 2IW3A 1V9PA 2CWAA 3I72A 1K9MC 3S1NB 4JBMA 3MC0B 3MXGA 2CW0C 5C4JH 4LAAA 3F8TA 5E4WC 4NXML 2K14A 3UDFA 4KY5A 1I50B 4BY1B 4MIUA 4IUPA 3CPWA 4HIKA 3W1BA 1TS3A 5IY0A 1BBXC 2F3VA 1IL8A 4UP7A 4OXPA 4P72A 1JE5A 2O5IC 2BDNA 4IZ8A 4DR6Q 5M5XB 1STEA 2D0OA 1KDAA 4IPHA 3NQTA 1LV9A 2Z1CA 3H94A 4OHJA 4A3DG 1W6KA 1G51A 1B9NA 1TU2B 1G6PA 1T5XD 4IUQA 4GLVB 2MQHA 3M85A 3HOWH 4BBRB 5IP7G 2A69C 5J3BA 1Y1WH 4C1NK 4C3IH 4O42A 1SE4A 5DEHA 1CKNA 1EL0A 3S2HH 1GUWA 1I3QH 4BY7G 2OCEA 4CJ0B 1DOLA 1EOTA 3V96A 4C3JH 1HNXQ 1IBLQ 1LABA 4KTAA 4HJ9A 3J80c 2K6AA 3DXJC 5I9OA 3I8ZA 4JOIA 1K83H 4APVA 2JA9A 1KLGD 2G9HD 4EQNA 1N32L 2WV6D 1SMYC 4DXGA 2OXPA 3MVVA 4JI1Q 1VQGA 4X65L 1HNWL 4A3JG 2D0PA 3C1EA 4OIKA 2HUGA 2YU9B 4L5QA 3N6RA 1VQAA 4KI0A 1K8GA 2NTSA 2VQEQ 4P2CB 5H1SE 1N34L 4HCSA 4PMWA 1CKNB 1PH1A 1ILPA 5EKKA 4OONA 4GKKL 1NBWA 3ONAB 4B08A 5ISRA 3RLNA 2VNUD 4JI5Q 5FLMH 4IFDJ 4RGTA 1H95A 1N33Q 4JI8Q 5C3XA 1PMRA 3M3YB 2AHOB 2K04A 3I4NB 1CFMA 4ZAIA 1VMPA 2MNAA 2A73B 2L55A 2LMCB 3T1YQ 4DN4M 3TMEA 4M1UB 2WIIB 4UAIA 2HDMA 5CV4A 4CKCA 1HNZQ 2K03A 3QB3A 1VQEA 5C3EB 4K0KQ 2XSCA 3OIQA 4AIMA 1JWSD 5IIFA 3H3VH 1CSPA 1LACA 3E0JA 2XRQD 5EKLA 3H3VI 3WDNA 4A3KB 3J80i 1K28A 5M5YH 4DV0L 1TWAB 3MXUA 2ES2A 3VA5A 5IOCA 3KLSA 3M7NA 1GJXA 1EWIA 1FJGQ 4TVAB 1HR0W 1Y14B 1VQPA 2AQ2B 1A62A 3IRBA 1Q8IA 3SK8A 3K5OA 4LFBL 2R7DA 4S3SA 1SFOB 2N3SA 5CV8A 2RBMA 4DR7L 4LF9L 1XPUA 2PNRC 3S9WA 2GVBA 3OW2A 3EBEA 3U50C 1HJPA 5M5WH 1KXLA 4UY8C 1SEBD 1H9JA 4G4KA 2NZ1D 2EIFA 3DEPA 3S1RH 1PRTD 2F0LA 4JI4Q 1DJRD 3K0YA 3VR5A 2B2VA 4XQNA 4DV3Q 1S4ZA 1VQMA 2E5LQ 4O1NA 5M3FB 1TWHH 1CSQA 5CBAE 2MO0A 1QVGA 4OGQC 5ELFA 3HOUG 4X62Q 3GTPH 3I4MH 4KY7A 4RA8A 1WTWA 2OEOA 2ZJPA 2R93B 4RGOS 1KAAA 2F0HA 3NUCA 5FKAC 1QOHA 3GO5A 3OTOQ 4A3FH 2X6LA 4FF2A 3P7JA 3H0GG 1KHIA 3KUPA 2TSSA 4JBWA 2X69A 2RSOA 4DV1Q 4UHVA 4WRDA 1RCVD 1H9MA 4KMUC 3UDXA 3A8IE 4LJZC 4DV2Q 4DR2Q 2B2TC 3GDEA 2QKIC 3E0EA 5IGEA 5K5PA 2F3WA 2K05A 3RN5A 4HN7A 2PMZB 4IUUA 1WVLA 2DJFC 1MGSA 1S72A 4A3EH 1KRSA 2WAQB 3KYHC 3D3RA 2CVRA 3OMGA 4QJFA 4JI7Q 3Q23A 2NVQH 1J5EQ 1HXYD 1X55A 5AJ3Q 1AZPA 4JYAL 1EY9A 1JT8A 1PHJA 2CFMA 3J80E 4LFAL 4CJ1B 3D8GA 2CHBD 3PSIA 2HHHQ 4EQ5A 1X65A 3G48A 5GAHC 1TXYA 2E76C 3C1FA 4DUZQ 4DKAC 4ZKBB 4HJ8A 1B44D 2DJGC 5IYBG 1I94Q 1GUOA 5M3MB 4L5RC 4NXNL 1BCPF 4IUVA 2IT1A 2RQXA 4JBJA 1MJEA 1DOMA 1HTLD 1CM9A 3PUYA 2SNSA 3HG9A 3PIPA 4A3BG 4KKUA 1DONA 1SXTA 3M4YA 2BE5C 2RHSB 2JA8G 1HZBA 2E2JH 1VDZA 2EYJA 4AH6A 1A3UA 5J1ZA 1IBML 1B70B 2L0CA 1O7ZA 2MHVA 5EQ0A 2NN6H 3A74A 3KJPA 3PO2G 2B39A 4KKTA 5ELEA 4WJWA 1PXUA 4KJOA 2NN6I 2CH4A 4OO1H 2V1CC 1SNPA 2EOTA 2BH8A 2D9UA 5FJ8G 1TS4A 3U9OA 3GTLH 3HGBA 4K14A 3HOVG 4A3MG 3TZUA 2PI2E 1FR3A 1ZYRD 1NR2A 3GQBA 5KRUA 2EXDA 3FKIH 1KABA 1WCMB 4QL5A 3HOZG 1EOVA 3TP8A 1MKHA 1W3SA 1OXVA 1GXDC 3MEFA 5IYDH 2E2IH 4PZ6A 3MHBA 4FNFA 3UDIA 1J8IA 1WYDA 1ONLA 3HOWB 4MTNA 4R4TA 4TQUS 1B1ZA 2AWNA 3MXNA 1CQFA 1U0LA 2GA4B 4ZCKA 3M4QA 1Y1WB 2GN5A 3L9AX 4C3IB 1F9RA 2F0GA 2XNAC 4ZUJA 4CDDC 3CCSA 1CKMA 2F0OA 2AUKA 1NTGA 1I3QB 5FO9B 4YY3Q 4IFDH 1IKLA 1Q12A 4B3SL 1EY6A 3R93A 4IFDI 3LWUA 1K83B 1VQHA 1PFSA 2HCCA 3G7LA 3S24A 2K1BA 4TSSA 4A93H 3FDTA 3NQIA 3RLOA 2B2YC 3PV0A 1EEFD 3NXWA 3BS1A 2B2WC 1BCPB 2N8NA 4KK7A 1SE8A 2KEEA 4YHHL 2KCNA 3HRZC 3NELA 2Y0SB 3QO2A 3J81j 2C35B 4WFN3 1HFGA 2KCTA 2JEBI 1B7YB 4FF1A 3S16B 5CORA 1MD2D 1YHAA 1IZ6A 5E4XA 2IWHA 4RHRA 4PZ8A 5ELBA 1KIXA 4ZQ3A 2AWOA 2BA1A 4LF4Q 1M8AA 5IYCG 2XIWA 2VUMH 2PYKA 3CQZH 4NPSA 4LNQA 4LF8Q 3ERSX 4OWTB 4ME3A 2HT1A 2JQOA 4H44C 3NSWA 3JAMi 2KQ3A 3PIOA 2ZJRA 1IXRA 3BVZA 5HURA 2Z6KC 2ZT9C 3D6CA 3BDOA 4DR3Q 1PH4A 1PTOC 1JWUD 4GN4B 1FNVA 1VQ8A 1JOKA 5E1FA 4Y52H 4B3RL 3PUWA 3M7GA 4RG1A 3O13A 1STYA 3VYUA 4HR7B 1VMCA 1PFNA 4EX5A 3M4PA 4JC0A 4MTKA 4YWLA 1E2VA 1WTOA 1XPRA 4A3LG 2N78A 4AYBB 1CUKA 3IKJA 1O7IA 3T53B 4XDXA 2UUBQ 1SE3A 4RHSA 4DR4L 1IKMA 2JA7B 1UE5A 1UNSA 4DU9A 1HQRD 4C3HH 4BXXG 4PNYA 1F9SA 5M5WB 3SK4A 5C0XH 2OQKA 4UP9A 2VXWA 2V4DA 2CW0D 4RMFA 5C0XI 3A56A 4QGUA 1Y8NB 1Y1VG 3MEHA 5DAUA 4CDFC 1X3GA 4BY1G 3S2DH 1TWHB 2CWPA 2L15A 1KC8C 3A8KE 3CAMA 2E2HH 1RODA 2NVYH 3GTPB 1A6XA 3GTOH 3I4MB 1OXSC 1SNCA 3CP0A 3RZOB 1KLUD 4KN4C 2F0EA 1KD1C 1X3PA 3OSOA 3E9IA 4DNIA 3SK5A 3P20A 2FINB 2RCFA 4JI3L 2DY7A 2KVMA 4P74A 1NSNS 1TWCB 4DR5Q 5C5LA 3TZDA 3E6ZX 4BWGB 4LF6L 3J80L 3NEMA 4A3GH 4OWWB 1MSGA 1O7YA 4BBRG 3I70A 3MA2B 2K5HA 2A69D 4QIWB 1WTPA 2FMCA 3S14B 3K80C 2O5JC 4OX9Q 5CR3A 1A2TA 2H5XA 4FVMA 3MFYA 2BA0A 4A3EB 2OT2A 3KOJA 1NR4A 2XTIA 3RZDH 1WI5A 3K58A 4KJNA 3I7FA 2NVQB 2Q2HA 3L0OA 1SBBB 1EY7A 1PTOF 1QUQA 3E5SA 2J0TD 5CGKA 1CHQD 1HZAA 3J7AF 3K5NA 4IUNA 5I4DA 1Y69U 5JJIA 4QCLA 4P73A 3K7UC 3C46A 2VZAA 2CCZA 4BA1I 1A0IA 1IBLL 1XMQQ 1QVCA 2FJ2A 4B3MQ 3A7LA 4XTCS 1EQTA 1V8QA 1QZHA 5IGFA 2UXBQ 4I65A 3LWEA 3CC4A 2F1MA 3HS0C 1EU3A 3T51B 1O78A 4JI1L 2N88A 3OMCA 2R7ZH 1YI2A 3BYTB 3Q22A 2WB1B 4FF4A 1SN8A 1QUQB 3L2PA 4JI0Q 3EJIA 4LF7L 5GROA 1LT5D 1SNDA 5IE8A 3K5LA 1CI3M 3HZXA 3QOJA 3DWAA 5C3EG 2Z6KA 4DK3C 2WKDA 4R4CA 4HJAA 4A3DH 4HMJA 1KQSA 1DYQA 1UEBA 2XVSA 2K7VA 4A3KG 3FPUB 4GN5A 3SK6A 4JBKA 1F2MA 1EYCA 3PO3B 1BQQT 5IP9G 4BY7H 2UXCQ 1E7ZA 3CC7A 3STBC 4C56C 1D5ZC 1BCPD 1EIFA 4XT1B 4JI2L 2EY6A 5EKIA 4K0KL 5KYLA 1JC7A 1WTRA 1JB7A 1O80A 3MWYW 2KCMA 3VYTA 1A3TA 4DR1Q 1BR9A 4R8NA 1LTGD 1LO5D 5LMNL 2K28A 3Q8DA 4A3CG 3TP7A 1I5FA 3J81L 4HIOA 1ENCA 1SRUA 4JV5Q 1DGSA 4DAMA 1PTOB 4DV4L 2LXKA 4RKBA 2K52A 4O0AA 5HGTA 4DAVA 1YIJA 4GOPA 1FJGL 1JR0D 4RCNA 1VQLA 2E74C 3X3MA 5KYIA 3A0JA 1Q3LA 4PMCA 2DY8A 4GNXC 1WD0A 5T1IA 1K3RA 4PZ7A 3CRLC 2MPMA 5M3FG 3AEVA 3CD6A 4X64L 3KLRA 2J7ZA 4LFCQ 5IODA 5DM73 2OQ0A 2R7FA 1EUJA 2R93G 3N52A 4RCOA 3TN2A 4Q5VA 4ALPA 2RDFA 5JJZA 1HR0Q 3QJYA 1H9SA 4LF5L 1YNJC 1SYFA 4JI4L 2HCIA 3DHQA 4DNRB 4K8IA 2BH2A 4GOPB 1SLJA 3S17H 2AUJD 4J6HA 2VUMB 3CQZB 1DD2A 2F0JA 5GAEC 4XQQA 3ULJA 4X62L 3KF8A 2K5DA 4JW0A 4GS3A 3CCEA 3GTKB 4BBSH 3BVGA 1TVXA 1XTDA 4WJ4A 4Y7NH 5EJWA 2OTLA 3C3LA 3FHWA 1S40A 1IYJB 3OTOL 1LM0A 2RHQB 4BA2I 1PDQA 2EYFA 2WAQG 4FP5D 3EFXD 4X3UA 4FXGC 1H9SB 1D5MC 4OEMB 2B8FA 2Q8RE 3KBXA 3J7A5 4DV1L 3PCOB 1YNNC 1XMOL 4HEDA 2R6GA 3L7ZC 4DV2L 2PQAB 4DR2L 1PV4A 1M90C 1Z6HA 2JK8A 3AFQA 1XNRQ 4C2MB 1WJJA 3KF8B 1KTKA 3CHBD 1XPOA 1WOCA 1HFNA 4QMGA 5CC4A 5ELDA 5M3MG 4JI6Q 1K0SA 1I4GA 1JQYD 1EFWA 3TREA 1U4PA 1GVPA 1IBKQ 3B6YA 3PGZA 3A5ZB 1BXTA 1VQ6A 1J5EL 3OW7A 3HOUH 1TWGB 1U4LA 2BE5D 5FK9C 1STGA 1IW7D 3KDFA 2HHHL 2G5DA 3RLFA 3PUZA 2F0DA 1RL2A 2OF1A 1EQVA 1PH2A 1EY8A 3CW2C 4DUZL 3K7AH 1M4VA 2C9OA 5I9PA 2VY3A 2E2HB 1I94L 2NVYB 3A54A 3H0GH 2EYLA 3NENA 4GN3B 3JAML 1NJIC 5EBDA 2R3ZA 3D4DA 1WTXA 1N8RC 1FYCA 2B63H 2EY2A 1SMXA 3OOCA 2KCCA 1WCMG 4ODGA 3GTMH 5COYA 1LYLA 1JJCB 4DUYQ 1AEXA 2EYMA 3UE1A 1PYSB 3JC66 4A3GB 2JN4A 3HOWG 3KDFB 1Q46A 1AFPA 1R9TH 1Y1WG 4B3TL 2F3IA 2KHJA 1I4HA 4C3IG 4A3IH 1VF7A 1Q82C 2RA4A 5JPNC 5ELCA 5JEAG 2WFWA 3QWNA 3CCLA 2NZOA 3W2DA 1BBWA 3CU7A 2Q2UA 1EU4A 2ASBA 3HOYH 1U5KA 2A6ED 4RGNA 2YV5A 4YIJA 3ULPA 1HUMA 2ZXRA 3URYA 5BN5A 1N36L 2D5DA 5T1GA 2ID0A 4KY6A 1G8ZD 1QE6A 5IYBH 5EPKA 3TS0A 3BDLA 2CH4W 4QUFA 4DV5L 3RD4A 4GNXA 2PMZE 3J81c 1SNOA 4WORA 5DLQE 1EZ8A 4H13C 2WAQE 1PVOA 1I6VC 3BU2A 4MHEA 1R4QB 1EYAA 2Y0SG 3H3VC 2ZM6Q 2E75C 1XNQL 4ZKCB 3VA7A 1RKNA 3GV3A 2I5MX 3T16A 3PO2H 2EYPA 3ER0A 1D2BA 3CRKC 3MAQA 1TR5A 1X3FA 3V2TA 4L5SA 1VQ7A 2UU9L 4X3KA 3TQYA 2R7ZB 2A68D 1VQIA 2PZUA 5FJ8H 3RR5A 4FDBA 1E24A 3GTQH 4ME5A 2R61A 2JA5B 2Z9HA 1PZKD 4GNXB 1RTNA 1SJHD 3NK9A 3S1MH 2NVXB 1TWFB 1MBYA 3PUVA 4L5TA 2JXMB 3HOZH 5JVH3 4XYQA 2QGQA 2PZWA 2VQFL 3R3OA 1PTOD 1BF4A 2YTXA 4K2KA 3DUZA 3EA6A 2B3GA 3U4VA 3SR1A 4IURA 4AYBG 1ML0D 1B53A 2ICIA 3WWVA 1B50A 1W6JA 1Q90A 2M2LA 1ESRA 2A5HA 1JORA 3J81i 3D31A 2JA7G 4DR3L 2VS1A 4B9XA 1LT3D 2ENBA 5KNDA 5K36H 5C4XB 4RH6A 5A2QL 4DK6C 1VQDA 5LMNW 2ATWA 3H91A 2NB0A 2K5VA 5E7NA 5C4JB 1AZQA 1PZID 1CZWA 3KK7A 3AMUA 5CMDA 3G71A 1ESFA 2YTYA 2WP8J 1HA5A 1V1QA 2D62A 4Q0FA 3KJOA 5CV5A 2UUBL 4GKJL 1B3QA 3TRZA 3HOXG 4P71A 1KRTA 2R92G 5LMUQ 3I4MG 1G6ZA 1XJVA 1RIPA 2K5WA 3FP9A 5IYCH 4F8MA 1SNQA 4V190 4K6LA 2M9VA 4YCUA 1T9HA 2F0IA 3ZJYC 3BG3A 5FO8B 5NUCA 2Z8LA 3LX0A 1L0WA 1C9OA 1EY4A 1MI2A 1NNXA 1E2ZA 4LFBQ 1SAPA 2Y0SE 2JSOA 1F2YA 3JAMc 2F4VL 2AMCB 4MZ9A 1EFID 1LUZA 1VQFA 4IN3A 4DR7Q 3S2HB 3M4OH 5C5MA 5KNBA 4BBSB 4G7OC 3I3CA 4C3JB 1D1IA 1QCBD 3K8AA 2NBFA 1MIUA 4PV1C 2Q8IB 3TSSA 4Y7NB 1X9NA 2F0SA 5IGBA 3T1HL 4KN7C 3NWTA 5LHY1 4A3EG 4A3LH 4JG2A 1K3BC 1I4RA 1QNUA 2IX3A 4E6IA 2AKWB 1II3A 2Z4HA 5GQOA 4AQYQ 1ZXTA 1ICFB 2QCPX 1NAPA 2L11A 3ULLA 5C4ZA 3DM3A 5EPJA 2UUCQ 2IHEA 3EIVA 4NDXA 2ZJQA 4OX9L 2KHIA 2HIVA 3S1NH 2K33A 3WOFA 1VQBA 4K5VA 2O4XA 3CCJA 3W1GA 3G6JB 3I91A 3J81E 1Y1VH 3J7ZC 5JJLA 1I50H 2EY1A 2QF7A 4BY1H 2EYHA 4AYBE 3UDGA 2BOSA 2F0TA 4POFA 1BOSA 2RKSA 4JK1C 1Z9FA 4NP5A 1GUSA 1F2LA 1FGUA 2WB1G 3PQIA 3OYYA 3VYSA 4XIGS 5F2DA 1XTCD 2UUAL 3K7AB 2B2TA 4A76A 1XMQL 4B3ML 4OO1G 3KFUA 3D4WA 3CCQA 1FNUA 4LK1C 3DLLA 3TP5A 4X6AH 4KHVA 2UXBL 3BDCA 2NZHA 2JEAI 2Q2IA 5JVG3 1LTLA 1D1KA 2KENA 3IFTA 2B63B 4JYAQ 4U673 4BBRH 1UE1A 1UWVA 5M5YB 3CF5A 1BDOA 3PO3G 3T56B 3IL8A 3CPFA 1U4RA 1Y8OB 5I6YA 1QVFA 4DFAA 1NMGA 1B4OA 5IGGA 3STBD 1R9TB 1OXUA 4NXNQ 2A6HC 4A3IB 2LKVA 3HKZB 1M1KC 2BCOA 3V05A 3NTHA 1EWCA 4JVZA 4KHZA 4DV6Q 1G91A 4FXKC 3HOYB 3ICEA 4R8IA 2OWOA 2YU9H 1K0RA 2F0MA 2PZTA 1SYGA 4QIWE 2KUMA 1C8CA 2PO4A 4IOCA 2UXCL 3S1RB 3BZKA 4ZRZA 2M00A 3IAYA 4V0BA 1ASYA 3I56A 3A5UA 5JEAJ 2K5NA 4N9TA 1XX8A 4CDCC 1TT2A 1GD7A 5IWAL 3Q0AA 1TKWB 1BKBA 4DR1L 5JAVA 2TMPA 2SEBD 3NTKA 5J39A 3M3YH 1JCKB 1GHKA 1HHVA 2A74C 5BR8Q 1E1OA 1GOZA 2A8VA 4R9WA 1A63A 4F87A 4X66Q 3GTJH 2LSSA 1KDCA 4DV7Q 1B9MA 4A3FB 1RTOA 1DOKA 1YNJD 5J22A 2NTTA 1VQOA 3QOLA 2OTJA 5KGUA 1A3VA 2UXDQ 3I4OA 5G3LF 3FRPB 2VUMG 2VL6A 2ZTCA 2K01A 1MJCA 4HSPA 5C44H 2IY5B 2LS01 4LFCL 4QF4A 1QILA 3ITPA 1Q1EA 1TIID 1TY2A 2FFKB 3Q6SA 4G7HC 4B3SQ 3OWEB 1E3PA 4A3KH 3HOZB 2JA6H 4DR6L 1TWAH 3U9SA 3JAME 3UI2A 3SHLA 2ZTEA 2WB1E 1BUVT 2NYZD 1FL0A 4HIMA 1SMYD 1X32A 4ID6A 3QIAA 2B2YA 1SFOH 1YNND 4YHHQ 2B2WA 1G2TA 4A3CH 1UEAB 2JE6I 1UUPA 4KHPQ 1HNXL 1JJGA 3E9HA 3F2DA 1HPCA 3MFGA 2F52A 5M9OA 2NWGA 1EWHA 3K59A 4HCEA 5M3FH 5IGDA 3KF6A 1LT6D 4NMZA 3I4NG 4ILWA 5IT9c 2ICEC 2E2JB 4DK1A 4QB4A 3K57A 3CCMA 1XNRL 3PMFA 2VQEL 1UE7A 2R93H 3NP8A 2FXQA 1I4PA 2K75A 3R8BA 4B3RQ 3RN2A 1L0XB 2IHFA 1EEID 4JI5L 3GTLB 3FMCA 2QA4A 1IBKL 1JICA 1AW7A 1N33L 4JI8L 1GUTA 2MUYA 3UE0A 1AE2A 5IP7H 2MJ8A 1JB3A 2RCNA 2Q2TA 4YWMA 4LUVA 5JOBA 3FKIB 1UE6A 1E22A 1NUCA 1CA5A 3CCRA 3H09A 3T1YL 2DNEA 3KF6B 2E2IB 2F03A 2EXZA 1I6HH 1IYVA 3MTSA 1HNZL 4A3GG 3VR6A 3FPPA 4YWKA 1L0YB 1K73C 1STBA 5ELNA 2B2UC 1MSHA 5JPMC 1G2SA 1VS0A 5D14A 4ZK9B 5EGTA 3G6EA 2EY5A 2KA7A 4A3JH 4EQPA 1VQ9A 3NWSA 3PF4A 3MXPA 2K5QA 2YTVA 3D6WA 1N9WA 2G9DA 1CHPD 4DUYL 2EPBA 4A93B 4NW2A 2IL8A 4CHTB 1C48A 3FVQA 4LUOA 2A1AA 1RF2D 4JI3Q 3TP6A 4N9PA 1ENAA 5A2QE 1B8AA 1ENFA 1Y1VB 2B2VC 5E3FA 4LF6Q 2LFNA 3P1HA 4MNOA 2KEDA 1VQJA 4DV3L 5DM63 1P16A 2E5LL 4KV6A 1SSOA 2PQAA 2R7ZG 1QB5D 1FNWA 2EE1A 2JA5G 3K0XA 4QUCA 2EJMA 5BN4A 5IGCA 4H7BA 2ZM6L 2EQSA 4DXFA 3C2PA 1PH3A 1WCMH 5KIXA 1GO3E 1C7YA 1Q86C 4F88A 5FLXL 4IPGA 1B2TA 1S5DD 2ALYB 4C1NI 3G4SA 3SE0A 3S1QH 1QNKA 1VQ5A 3AFPA 2CQAA 5ELOA 3SEBA 2B8GA 3T4AC 2RF4A 1EQQA 2H4OA 1LTSD 5JEAH 1VQ4A 4H02A 4GLAC 1KL9A 1YBYA 3H15A 1Q8KA 4ZUIA 2F0NA 3Q24A 2J4XA 3A8JE 3F2CA 3I90A 2L4NA 1I4XA 3NE5B 2NVTH 3SXHA 1NMFA 2HIXA 4XXEA 2C5CA 5C4XG 4J15A 4R4QA 1YEZA 1Q7YC 4C3HB 3M9BA 3TDQA 4OELB 3KBGA 4JI7L 1STHA 3DWQA 4FO2A 5EAYA 5AJ3L 2L12A 1AH9A 2L9HA 4LF7Q 1STAA 1F77A 2NUCA 3S2DB 4G7ZC 2BDOA 3ZYYX 3S16H 2IX0A 3GTOB 4RAUC 1YJ9A 1HUNA 4J8QA 1RHPA 3CKIB 4CKEA 5IT9E 1YJWA 2VB2X 2PPBC 1HQMC 3W5OA 4GLXA 3GTJB 2B29A 1O7LA 1PLFA 3I55A 1YHBA 1EQRA 4H0LC 4JI2Q 3PIP3 3AQQA 4CGYB 1S5ED 1W2BA 1TS2A 2I0QA 5C44B 4DAPA 1BNZA 2B2UA 5LMUL 5D3DA 4OIJA 5LMNQ 4JCVE 3DM1A 4BBSG 1X3EA 2JA6B 4C3JG 4DV4Q 4PG3A 1L2FA 5KEEA 4L8JA 1Z7TA 1IYUA 4K5XA 4PQXA 4NXMQ 4ULLA 1BCPC 3RZDB 4WJ3M 1MHWC 1CTMA 1R4PB 3VDYA 2XWJB
chains in the Genus database with same CATH topology
3F8TA 1LUZA 1VQFA 4NXML 4DR7Q 2K14A 4X64Q 3M4OH 3UDFA 2JA7H 4JI3L 3CPWA 4P74A 4HIKA 3K8AA 3W1BA 5IY0A 1MIUA 4DR5Q 1X9NA 4A4IA 4UP7A 4LF6L 1HH2P 3T1HL 4YY3L 4A3EG 4A3LH 1NY4A 3NEMA 4IJHA 4A3GH 4OXPA 4P72A 4QY7A 4OWWB 4A3BH 2DGYA 4JG2A 4BBRG 1JE5A 2JJQA 2K5HA 4LF5Q 2JA8H 2AKWB 2DUDA 1HZ9A 3K80C 5GQOA 4AQYQ 3TS2A 4DR6Q 5FLMG 2D0OA 4OX9Q 4IPHA 3S15H 2H5XA 3ULLA 4AQYL 3DM3A 2UUCQ 2ZJQA 2IHEA 3EIVA 4A3DG 1G51A 4OX9L 2BA0A 1G6PA 3HOXH 2KHIA 3KOJA 2R92H 2HIVA 2XTIA 4GLVB 2MQHA 3M85A 3HOWH 3S1NH 3RZDH 1WI5A 5IP7G 2UUCL 5J3BA 4A3MH 3HOVH 1VQBA 1Y1WH 3RZOH 3I7FA 4C3IH 4DAYB 3F2BA 2Q2HA 3CCJA 3W1GA 3L0OA 1CKNA 1QUQA 1Y1VH 3S2HH 3J7ZC 1I3QH 2YYZA 4BY7G 1I50H 1HZAA 1YVCA 2OCEA 4BY1H 4IOAA 4QQBX 4AYBE 1TWCH 2HQLA 4C3JH 3UDGA 1HNXQ 1IBLQ 1VQCA 1N32Q 4POFA 3J80c 4HJ9A 1CKOA 5JJIA 5JJLA 4P73A 3K7UC 1Z9FA 2VZAA 5C0XJ 4JOIA 2CCZA 4BA1I 1A0IA 1K83H 2JA9A 4APVA 1QVCA 4X65Q 5GADC 1KAWA 1XMQQ 1FGUA 2WB1G 1XMOQ 4B3MQ 2B63G 1N32L 1SROA 3OYYA 4XTCS 1QZHA 2QEXA 4LF4L 4XIGS 1BBUA 2UUAL 4JI1Q 1VQGA 4X65L 1XMQL 4A76A 2PNHA 4A3JG 3S14H 4B3ML 1HNWL 2D0PA 4OO1G 3KFUA 3CCQA 3CC4A 4LF8L 3DLLA 4P75A 3RNUA 4X6AH 1A8VA 4L5QA 5FLXc 1N34Q 4JI1L 2UXBL 2NZHA 2JEAI 1VQAA 4KI0A 1K8GA 2Q2IA 1LTLA 2R7ZH 2VQEQ 1YI2A 3U58A 4GKKQ 2KENA 5H1SE 4A3IG 1N34L 4PMWA 4JYAQ 3HKZG 1SN8A 1CKNB 1QUQB 3BZCA 1UE1A 4BBRH 1UWVA 4YCWA 3L2PA 3CF5A 1PH1A 4LUZA 4JI0Q 4LW1A 4OONA 4GKKL 1NBWA 4LF7L 3RLNA 5GROA 4JI5Q 3PO3G 2VNUD 5IE8A 5FLMH 4IFDJ 3CPFA 3HOYG 1X54A 1H95A 2GVAA 5C3EG 4JI8Q 1N33Q 2Z6KA 4DK3C 1QVFA 1NMGA 4R4CA 3STBD 4HJAA 4A3DH 2AHOB 1KQSA 1OXUA 1IBLL 4NXNQ 2Q2TA 2MNAA 1UEBA 3T1YQ 1JJ2A 1M1KC 1Q1BA 4A3KG 4GN5A 4KHZA 4JBKA 4DV6Q 1FVIA 1HNZQ 1VQEA 5IP9G 4BY7H 2UXCQ 4K0KQ 1E7ZA 1P8LA 4YCVA 3CC7A 3STBC 1PH8A 3ICEA 2OWOA 4DV6L 1K0RA 2YU9H 5GAGC 1EIFA 4QIWE 3CC2A 4JI2L 4AIMA 1WFQA 4DPGA 4DV0Q 4IOCA 3H3VH 4K0KL 2UXCL 3BZKA 1CSPA 1OTCA 1JB7A 2KCMA 3H3VI 4HJ7A 3LGJA 3J80i 4A3FG 4DR1Q 5M5YH 4DV0L 4HIDA 1ASYA 3I56A 3A5UA 5JEAJ 2K5NA 5IWAL 3Q8DA 2CKZB 3CCEA 1GD7A 1I5FA 5LMNL 2ES2A 4A3CG 4HIOA 1BKBA 1SRUA 3M7NA 1EWIA 1DGSA 4DAMA 4B3TQ 1FJGQ 4DR1L 4JV5Q 4TVAB 1HR0W 4DV4L 2LXKA 2K52A 1Y14B 4O0AA 1VQPA 3M3YH 1YIJA 4OO1I 1A62A 3IRBA 4GOPA 5BR8Q 3GTGH 1E1OA 2A8VA 1FJGL 4LFBL 1A63A 2K4KA 4X66Q 1VQLA 3GTJH 4LF9Q 2LSSA 2R7DA 3A0JA 4DV7Q 2N3SA 4IJLA 5BR8L 4GNXC 1K3RA 4PZ7A 4X66L 1YJNA 4DR7L 2PI2A 5M3FG 4LF9L 1XPUA 3AEVA 1VQOA 3CD6A 4X64L 3PO3H 4DV7L 2OTJA 2GVBA 1N36Q 3OW2A 3EBEA 2UXDQ 3U50C 4LFCQ 1J6QA 3I4OA 4DR5L 1HJPA 5M5WH 1KXLA 2VUMG 4UY8C 2VL6A 2OQ0A 2ZTCA 1EIYB 4A75A 2R7FA 1MJCA 4DV5Q 5C44H 2UXDL 2IY5B 2EIFA 1EUJA 4LFCL 2R93G 3GD7A 1Q1EA 3S1RH 4JI4Q 4ALPA 1HR0Q 4B3SQ 4DV3Q 1E3PA 4LF5L 2VW9A 1G291 4A3KH 1VQMA 2E5LQ 1TWHH 2JA6H 4DR6L 1TWAH 1CSQA 4JI4L 2BH2A 2MO0A 1QVGA 4BXXH 1XNQQ 3HOUG 4GOPB 4X62Q 2ZTEA 1SLJA 4POGA 3GTPH 2WB1E 3I4MH 3S17H 3NBHB 1FL0A 5GAEC 4HIMA 3PF5A 2ZJPA 3ULJA 4X62L 5K36G 1C0AA 3K81C 4GS3A 3GO5A 3OTOQ 1SFOH 2UU9Q 4A3FH 4BBSH 4YHHQ 1XTDA 3H0GG 4WJ4A 4Y7NH 2OTLA 4A3CH 3FHWA 1KHIA 1S40A 2JE6I 1IYJB 3MXNB 3OTOL 1LM0A 1PH7A 4JBWA 3HKZE 1S3OA 4DV1Q 2RHQB 1HNXL 4KHPQ 4BA2I 1JJGA 2WAQG 3E9HA 3F2DA 2NN6G 3HFZB 3UDXA 4DV2Q 4DR2Q 3J7A5 4DV1L 4KHPL 3PCOB 2F52A 3GDEA 5M5XH 1XMOL 2VQFQ 3E0EA 5JJKA 2R6GA 3L7ZC 4DV2L 2PQAB 4DR2L 3RN5A 1PV4A 1M90C 5M3FH 2JK8A 3KF6A 3AFQA 3I4NG 3I2ZA 1S72A 5IT9c 1XNRQ 4A3EH 3U4ZA 3KLWA 1WJJA 1KRSA 3KF8B 1XPOA 1WOCA 1X56A 3KYHC 4NB3A 3D0FA 3CCMA 3FKIG 1XNRL 5M3MG 4LFAQ 4JI6Q 4QJFA 2VQEL 4JI7Q 1UE7A 2R93H 1EFWA 3TREA 2NVQH 1J5EQ 1X55A 5AJ3Q 1GM5A 4JYAL 1GVPA 2FXQA 5IYDG 1IBKQ 4JI0L 1PHJA 2K75A 3B6YA 3GTKH 2CFMA 1JT8A 2ZTDA 4LFAL 3PGZA 3A5ZB 4B3RQ 3RN2A 1VQ6A 3PSIA 1L1OC 2IHFA 4JI5L 2HHHQ 4EQ5A 1X65A 2QA4A 1J5EL 3G48A 5GAHC 1TXYA 1V43A 1IBKL 3HOUH 1N33L 4JI8L 4IO9A 3CCUA 3UE0A 4DUZQ 4DKAC 4IPCA 1AE2A 3KDFA 5IP7H 3RLFA 2RCNA 4HJ8A 4KLKA 3PUZA 4LUVA 4YWMA 5IYBG 1RL2A 1E22A 1UE6A 3BJUA 1PH2A 4NXNL 1I94Q 4L5RC 4IFDG 3CCRA 1OXTA 3CW2C 4DUZL 3T1YL 2IT1A 3K7AH 4JBJA 2I5HA 1MJEA 3KF6B 2VY3A 1I6HH 1PH9A 1I94L 4R4IA 3PUYA 3CMAA 3H0GH 1HNZL 4A3GG 3PIPA 1IBMQ 2N49A 3NENA 4GN3B 1NJIC 4YWKA 4A3BG 1K73C 2RHSB 2JA8G 1HZBA 5ELNA 2E2JH 1N8RC 4A93G 4C2MH 1VS0A 4AH6A 1IBML 1B70B 2B63H 1YHQA 4GKJQ 1SMXA 3A74A 3KJPA 1YNXA 3G6EA 3PO2G 1QZGA 1VCIA 1WCMG 1Q81C 3GTMH 2NN6I 1LYLA 1JJCB 4A3JH 3CXCA 1VQ9A 2V1CC 4DUYQ 3PF4A 3UE1A 4GKJL 1PYSB 2BH8A 3JC66 3F1ZA 5FJ8G 2YTVA 3HOWG 3KDFB 1Q46A 1N9WA 3GTLH 4GOPC 3HOVG 1R9TH 4A3MG 4DUYL 3I4NH 1Y1WG 4B3TL 2F3IA 4JV5L 2PI2E 2KHJA 1PH5A 1TWGH 1Z47A 4A3IH 1Q82C 2EXDA 5JEAG 3FKIH 2WFWA 4QL5A 3HOZG 3CCLA 1EOVA 2NZOA 1MKHA 1W3SA 1OXVA 2F4VQ 1HNWQ 1BBWA 4LUOA 2Q2UA 3MEFA 2ASBA 3HOYH 1U5KA 2A1AA 5IYDH 2E2IH 4PZ6A 5C3EH 2YV5A 3ULPA 3UDIA 1AE3A 1WYDA 4MTNA 4R4TA 4TQUS 3SGIA 1JMCA 2AWNA 4R1JA 2UXBQ 1U0LA 1N36L 4JI3Q 3M4QA 2GN5A 2IX1A 2ID0A 3CCSA 1CKMA 1B8AA 1NTGA 5HGQA 5IYBH 3TS0A 4LF6Q 2K50A 4DV5L 3T1HQ 1X6OA 4YY3Q 4GNXA 4IPDA 2PMZE 2I5LX 1HZCA 4MNOA 5DLQE 1Q12A 3J81c 4O2DA 1VQJA 1HR0L 4B3SL 5IP9H 4DV3L 4IFDI 1P16A 2E5LL 2PQAA 2WAQE 1GKHA 2R7ZG 1PVOA 3BU2A 1VQHA 1PFSA 2Y0SG 2ZM6Q 1XNQL 3S24A 2JA5G 4LWCA 3K0XA 4A93H 3RLOA 2I5MX 3PV0A 2ZM6L 2EQSA 3PO2H 3CCVA 1PH3A 1VQKA 1WCMH 1GO3E 3ER0A 1C7YA 1Q86C 2N8NA 1X3FA 1E1TA 2MO1A 4L5SA 1SE8A 4IPGA 1VQ7A 2UU9L 3TQYA 4JOIC 1VQIA 2ALYB 4YHHL 3G4SA 1D7QA 5FJ8H 3NELA 3J81j 4HJ5A 3S1QH 3RR5A 2C35B 1VQ5A 4FDBA 1E24A 3AFPA 3GTQH 5ELOA 2KCTA 4GNXB 2JEBI 3S1MH 1B7YB 1EQQA 2RF4A 1YHAA 1IZ6A 3TEHB 3PUVA 4L5TA 1VQ4A 4H02A 4GLAC 1KL9A 3HOZH 1NE3A 4PZ8A 1YBYA 2QGQA 3H15A 1Q8KA 5C0XG 1KIXA 2VQFL 1PA6A 4UP8A 2AWOA 1ASZA 1BVSA 2BA1A 4LF4Q 5IYCG 3F2CA 2YTXA 2UUAQ 2NVTH 2VUMH 3CQZH 1YZ6A 1NMFA 2HIXA 4NPSA 4LNQA 4LF8Q 2MFIA 3ERSX 3AYHB 4OWTB 4ME3A 5C4XG 4J15A 2HT1A 4R4QA 1OXXK 1YEZA 2JQOA 1Q7YC 3JAMi 2ZJRA 3PIOA 2B3GA 3M9BA 1IXRA 2Z6KC 4JI6L 4JI7L 3U4VA 4OWXB 1D8LA 5EAYA 5AJ3L 1VQNA 4AYBG 4DR3Q 1K8AC 1PH4A 4GN4B 3WWVA 1VQ8A 4UPAA 4Y52H 1AH9A 4B3RL 3PUWA 4LF7Q 4RG1A 3J81i 3D31A 2JA7G 4DR3L 2VS1A 2JA5H 4EX5A 3M4PA 4JC0A 4YWLA 2KBNA 4DK6C 1TWFH 2NVXH 3S16H 2IX0A 3PUXA 1VQDA 5LMNW 2ATWA 1YJ9A 1XPRA 4A3LG 4R4OA 3HKSA 1YITA 2K5VA 1YJWA 2N78A 2A19A 4DR4Q 1L1OA 1CUKA 3EN2A 5E7NA 3W5OA 5C44G 1O7IA 4GLXA 2B29A 2UUBQ 4DR4L 3G71A 2YTYA 1UE5A 2WP8J 3I55A 1YHBA 2CQOA 1EQRA 1V1QA 2D62A 2LXJA 3KJOA 2UUBL 2JA6G 2E8GA 4C3HH 1IL2A 5HY6A 4JI2Q 2HHHL 3TRZA 1EYGA 4BXXG 3HOXG 4P71A 1KRTA 2R92G 3AQQA 5LMUQ 3I4MG 2Z0SA 1XJVA 1RIPA 2OQKA 1W2BA 4UP9A 2I0QA 2XGTA 3FP9A 5IYCH 1PYBA 4RMFA 5C0XI 5LMUL 5IWAQ 5LMNQ 4QGUA 4YCUA 4JCVE 1Y1VG 1T9HA 5M3MH 3ZJYC 1SR3A 1X3GA 4BY1G 3S2DH 1X3EA 4BBSG 4DV4Q 5C4XH 2CWPA 2L15A 1PH6A 1KC8C 4PG3A 1L0WA 1L1OB 1C9OA 3CMEA 1L2FA 3CAMA 2E2HH 1V9PA 2NVYH 4LFBQ 3GTOH 2Y0SE 2CWAA 1OXSC 1K9MC 4NXMQ 3JAMc 2F4VL 3CP0A 4WJ3M 4JBMA 2AMCB 3VDYA 5C4JH 1KD1C 4MZ9A 4DNIA 3E9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F8T A;  1LUZ A;  1VQF A;  4NXM L;  4DR7 Q;  2K14 A;  4X64 Q;  3M4O H;  3UDF A;  2JA7 H;  4JI3 L;  3CPW A;  4P74 A;  4HIK A;  3K8A A;  3W1B A;  5IY0 A;  1MIU A;  4DR5 Q;  1X9N A;  4A4I A;  4UP7 A;  4LF6 L;  1HH2 P;  3T1H L;  4YY3 L;  4A3E G;  4A3L H;  1NY4 A;  3NEM A;  4IJH A;  4A3G H;  4OXP A;  4P72 A;  4QY7 A;  4OWW B;  4A3B H;  2DGY A;  4JG2 A;  4BBR G;  1JE5 A;  2JJQ A;  2K5H A;  4LF5 Q;  2JA8 H;  2AKW B;  2DUD A;  1HZ9 A;  3K80 C;  5GQO A;  4AQY Q;  3TS2 A;  4DR6 Q;  5FLM G;  2D0O A;  4OX9 Q;  4IPH A;  3S15 H;  2H5X A;  3ULL A;  4AQY L;  3DM3 A;  2UUC Q;  2ZJQ A;  2IHE A;  3EIV A;  4A3D G;  1G51 A;  4OX9 L;  2BA0 A;  1G6P A;  3HOX H;  2KHI A;  3KOJ A;  2R92 H;  2HIV A;  2XTI A;  4GLV B;  2MQH A;  3M85 A;  3HOW H;  3S1N H;  3RZD H;  1WI5 A;  5IP7 G;  2UUC L;  5J3B A;  4A3M H;  3HOV H;  1VQB A;  1Y1W H;  3RZO H;  3I7F A;  4C3I H;  4DAY B;  3F2B A;  2Q2H A;  3CCJ A;  3W1G A;  3L0O A;  1CKN A;  1QUQ A;  1Y1V H;  3S2H H;  3J7Z C;  1I3Q H;  2YYZ A;  4BY7 G;  1I50 H;  1HZA A;  1YVC A;  2OCE A;  4BY1 H;  4IOA A;  4QQB X;  4AYB E;  1TWC H;  2HQL A;  4C3J H;  3UDG A;  1HNX Q;  1IBL Q;  1VQC A;  1N32 Q;  4POF A;  3J80 c;  4HJ9 A;  1CKO A;  5JJI A;  5JJL A;  4P73 A;  3K7U C;  1Z9F A;  2VZA A;  5C0X J;  4JOI A;  2CCZ A;  4BA1 I;  1A0I A;  1K83 H;  2JA9 A;  4APV A;  1QVC A;  4X65 Q;  5GAD C;  1KAW A;  1XMQ Q;  1FGU A;  2WB1 G;  1XMO Q;  4B3M Q;  2B63 G;  1N32 L;  1SRO A;  3OYY A;  4XTC S;  1QZH A;  2QEX A;  4LF4 L;  4XIG S;  1BBU A;  2UUA L;  4JI1 Q;  1VQG A;  4X65 L;  1XMQ L;  4A76 A;  2PNH A;  4A3J G;  3S14 H;  4B3M L;  1HNW L;  2D0P A;  4OO1 G;  3KFU A;  3CCQ A;  3CC4 A;  4LF8 L;  3DLL A;  4P75 A;  3RNU A;  4X6A H;  1A8V A;  4L5Q A;  5FLX c;  1N34 Q;  4JI1 L;  2UXB L;  2NZH A;  2JEA I;  1VQA A;  4KI0 A;  1K8G A;  2Q2I A;  1LTL A;  2R7Z H;  2VQE Q;  1YI2 A;  3U58 A;  4GKK Q;  2KEN A;  5H1S E;  4A3I G;  1N34 L;  4PMW A;  4JYA Q;  3HKZ G;  1SN8 A;  1CKN B;  1QUQ B;  3BZC A;  1UE1 A;  4BBR H;  1UWV A;  4YCW A;  3L2P A;  3CF5 A;  1PH1 A;  4LUZ A;  4JI0 Q;  4LW1 A;  4OON A;  4GKK L;  1NBW A;  4LF7 L;  3RLN A;  5GRO A;  4JI5 Q;  3PO3 G;  2VNU D;  5IE8 A;  5FLM H;  4IFD J;  3CPF A;  3HOY G;  1X54 A;  1H95 A;  2GVA A;  5C3E G;  4JI8 Q;  1N33 Q;  2Z6K A;  4DK3 C;  1QVF A;  1NMG A;  4R4C A;  3STB D;  4HJA A;  4A3D H;  2AHO B;  1KQS A;  1OXU A;  1IBL L;  4NXN Q;  2Q2T A;  2MNA A;  1UEB A;  3T1Y Q;  1JJ2 A;  1M1K C;  1Q1B A;  4A3K G;  4GN5 A;  4KHZ A;  4JBK A;  4DV6 Q;  1FVI A;  1HNZ Q;  1VQE A;  5IP9 G;  4BY7 H;  2UXC Q;  4K0K Q;  1E7Z A;  1P8L A;  4YCV A;  3CC7 A;  3STB C;  1PH8 A;  3ICE A;  2OWO A;  4DV6 L;  1K0R A;  2YU9 H;  5GAG C;  1EIF A;  4QIW E;  3CC2 A;  4JI2 L;  4AIM A;  1WFQ A;  4DPG A;  4DV0 Q;  4IOC A;  3H3V H;  4K0K L;  2UXC L;  3BZK A;  1CSP A;  1OTC A;  1JB7 A;  2KCM A;  3H3V I;  4HJ7 A;  3LGJ A;  3J80 i;  4A3F G;  4DR1 Q;  5M5Y H;  4DV0 L;  4HID A;  1ASY A;  3I56 A;  3A5U A;  5JEA J;  2K5N A;  5IWA L;  3Q8D A;  2CKZ B;  3CCE A;  1GD7 A;  1I5F A;  5LMN L;  2ES2 A;  4A3C G;  4HIO A;  1BKB A;  1SRU A;  3M7N A;  1EWI A;  1DGS A;  4DAM A;  4B3T Q;  1FJG Q;  4DR1 L;  4JV5 Q;  4TVA B;  1HR0 W;  4DV4 L;  2LXK A;  2K52 A;  1Y14 B;  4O0A A;  1VQP A;  3M3Y H;  1YIJ A;  4OO1 I;  1A62 A;  3IRB A;  4GOP A;  5BR8 Q;  3GTG H;  1E1O A;  2A8V A;  1FJG L;  4LFB L;  1A63 A;  2K4K A;  4X66 Q;  1VQL A;  3GTJ H;  4LF9 Q;  2LSS A;  2R7D A;  3A0J A;  4DV7 Q;  2N3S A;  4IJL A;  5BR8 L;  4GNX C;  1K3R A;  4PZ7 A;  4X66 L;  1YJN A;  4DR7 L;  2PI2 A;  5M3F G;  4LF9 L;  1XPU A;  3AEV A;  1VQO A;  3CD6 A;  4X64 L;  3PO3 H;  4DV7 L;  2OTJ A;  2GVB A;  1N36 Q;  3OW2 A;  3EBE A;  2UXD Q;  3U50 C;  4LFC Q;  1J6Q A;  3I4O A;  4DR5 L;  1HJP A;  5M5W H;  1KXL A;  2VUM G;  4UY8 C;  2VL6 A;  2OQ0 A;  2ZTC A;  1EIY B;  4A75 A;  2R7F A;  1MJC A;  4DV5 Q;  5C44 H;  2UXD L;  2IY5 B;  2EIF A;  1EUJ A;  4LFC L;  2R93 G;  3GD7 A;  1Q1E A;  3S1R H;  4JI4 Q;  4ALP A;  1HR0 Q;  4B3S Q;  4DV3 Q;  1E3P A;  4LF5 L;  2VW9 A;  1G29 1;  4A3K H;  1VQM A;  2E5L Q;  1TWH H;  2JA6 H;  4DR6 L;  1TWA H;  1CSQ A;  4JI4 L;  2BH2 A;  2MO0 A;  1QVG A;  4BXX H;  1XNQ Q;  3HOU G;  4GOP B;  4X62 Q;  2ZTE A;  1SLJ A;  4POG A;  3GTP H;  2WB1 E;  3I4M H;  3S17 H;  3NBH B;  1FL0 A;  5GAE C;  4HIM A;  3PF5 A;  2ZJP A;  3ULJ A;  4X62 L;  5K36 G;  1C0A A;  3K81 C;  4GS3 A;  3GO5 A;  3OTO Q;  1SFO H;  2UU9 Q;  4A3F H;  4BBS H;  4YHH Q;  1XTD A;  3H0G G;  4WJ4 A;  4Y7N H;  2OTL A;  4A3C H;  3FHW A;  1KHI A;  1S40 A;  2JE6 I;  1IYJ B;  3MXN B;  3OTO L;  1LM0 A;  1PH7 A;  4JBW A;  3HKZ E;  1S3O A;  4DV1 Q;  2RHQ B;  1HNX L;  4KHP Q;  4BA2 I;  1JJG A;  2WAQ G;  3E9H A;  3F2D A;  2NN6 G;  3HFZ B;  3UDX A;  4DV2 Q;  4DR2 Q;  3J7A 5;  4DV1 L;  4KHP L;  3PCO B;  2F52 A;  3GDE A;  5M5X H;  1XMO L;  2VQF Q;  3E0E A;  5JJK A;  2R6G A;  3L7Z C;  4DV2 L;  2PQA B;  4DR2 L;  3RN5 A;  1PV4 A;  1M90 C;  5M3F H;  2JK8 A;  3KF6 A;  3AFQ A;  3I4N G;  3I2Z A;  1S72 A;  5IT9 c;  1XNR Q;  4A3E H;  3U4Z A;  3KLW A;  1WJJ A;  1KRS A;  3KF8 B;  1XPO A;  1WOC A;  1X56 A;  3KYH C;  4NB3 A;  3D0F A;  3CCM A;  3FKI G;  1XNR L;  5M3M G;  4LFA Q;  4JI6 Q;  4QJF A;  2VQE L;  4JI7 Q;  1UE7 A;  2R93 H;  1EFW A;  3TRE A;  2NVQ H;  1J5E Q;  1X55 A;  5AJ3 Q;  1GM5 A;  4JYA L;  1GVP A;  2FXQ A;  5IYD G;  1IBK Q;  4JI0 L;  1PHJ A;  2K75 A;  3B6Y A;  3GTK H;  2CFM A;  1JT8 A;  2ZTD A;  4LFA L;  3PGZ A;  3A5Z B;  4B3R Q;  3RN2 A;  1VQ6 A;  3PSI A;  1L1O C;  2IHF A;  4JI5 L;  2HHH Q;  4EQ5 A;  1X65 A;  2QA4 A;  1J5E L;  3G48 A;  5GAH C;  1TXY A;  1V43 A;  1IBK L;  3HOU H;  1N33 L;  4JI8 L;  4IO9 A;  3CCU A;  3UE0 A;  4DUZ Q;  4DKA C;  4IPC A;  1AE2 A;  3KDF A;  5IP7 H;  3RLF A;  2RCN A;  4HJ8 A;  4KLK A;  3PUZ A;  4LUV A;  4YWM A;  5IYB G;  1RL2 A;  1E22 A;  1UE6 A;  3BJU A;  1PH2 A;  4NXN L;  1I94 Q;  4L5R C;  4IFD G;  3CCR A;  1OXT A;  3CW2 C;  4DUZ L;  3T1Y L;  2IT1 A;  3K7A H;  4JBJ A;  2I5H A;  1MJE A;  3KF6 B;  2VY3 A;  1I6H H;  1PH9 A;  1I94 L;  4R4I A;  3PUY A;  3CMA A;  3H0G H;  1HNZ L;  4A3G G;  3PIP A;  1IBM Q;  2N49 A;  3NEN A;  4GN3 B;  1NJI C;  4YWK A;  4A3B G;  1K73 C;  2RHS B;  2JA8 G;  1HZB A;  5ELN A;  2E2J H;  1N8R C;  4A93 G;  4C2M H;  1VS0 A;  4AH6 A;  1IBM L;  1B70 B;  2B63 H;  1YHQ A;  4GKJ Q;  1SMX A;  3A74 A;  3KJP A;  1YNX A;  3G6E A;  3PO2 G;  1QZG A;  1VCI A;  1WCM G;  1Q81 C;  3GTM H;  2NN6 I;  1LYL A;  1JJC B;  4A3J H;  3CXC A;  1VQ9 A;  2V1C C;  4DUY Q;  3PF4 A;  3UE1 A;  4GKJ L;  1PYS B;  2BH8 A;  3JC6 6;  3F1Z A;  5FJ8 G;  2YTV A;  3HOW G;  3KDF B;  1Q46 A;  1N9W A;  3GTL H;  4GOP C;  3HOV G;  1R9T H;  4A3M G;  4DUY L;  3I4N H;  1Y1W G;  4B3T L;  2F3I A;  4JV5 L;  2PI2 E;  2KHJ A;  1PH5 A;  1TWG H;  1Z47 A;  4A3I H;  1Q82 C;  2EXD A;  5JEA G;  3FKI H;  2WFW A;  4QL5 A;  3HOZ G;  3CCL A;  1EOV A;  2NZO A;  1MKH A;  1W3S A;  1OXV A;  2F4V Q;  1HNW Q;  1BBW A;  4LUO A;  2Q2U A;  3MEF A;  2ASB A;  3HOY H;  1U5K A;  2A1A A;  5IYD H;  2E2I H;  4PZ6 A;  5C3E H;  2YV5 A;  3ULP A;  3UDI A;  1AE3 A;  1WYD A;  4MTN A;  4R4T A;  4TQU S;  3SGI A;  1JMC A;  2AWN A;  4R1J A;  2UXB Q;  1U0L A;  1N36 L;  4JI3 Q;  3M4Q A;  2GN5 A;  2IX1 A;  2ID0 A;  3CCS A;  1CKM A;  1B8A A;  1NTG A;  5HGQ A;  5IYB H;  3TS0 A;  4LF6 Q;  2K50 A;  4DV5 L;  3T1H Q;  1X6O A;  4YY3 Q;  4GNX A;  4IPD A;  2PMZ E;  2I5L X;  1HZC A;  4MNO A;  5DLQ E;  1Q12 A;  3J81 c;  4O2D A;  1VQJ A;  1HR0 L;  4B3S L;  5IP9 H;  4DV3 L;  4IFD I;  1P16 A;  2E5L L;  2PQA A;  2WAQ E;  1GKH A;  2R7Z G;  1PVO A;  3BU2 A;  1VQH A;  1PFS A;  2Y0S G;  2ZM6 Q;  1XNQ L;  3S24 A;  2JA5 G;  4LWC A;  3K0X A;  4A93 H;  3RLO A;  2I5M X;  3PV0 A;  2ZM6 L;  2EQS A;  3PO2 H;  3CCV A;  1PH3 A;  1VQK A;  1WCM H;  1GO3 E;  3ER0 A;  1C7Y A;  1Q86 C;  2N8N A;  1X3F A;  1E1T A;  2MO1 A;  4L5S A;  1SE8 A;  4IPG A;  1VQ7 A;  2UU9 L;  3TQY A;  4JOI C;  1VQI A;  2ALY B;  4YHH L;  3G4S A;  1D7Q A;  5FJ8 H;  3NEL A;  3J81 j;  4HJ5 A;  3S1Q H;  3RR5 A;  2C35 B;  1VQ5 A;  4FDB A;  1E24 A;  3AFP A;  3GTQ H;  5ELO A;  2KCT A;  4GNX B;  2JEB I;  3S1M H;  1B7Y B;  1EQQ A;  2RF4 A;  1YHA A;  1IZ6 A;  3TEH B;  3PUV A;  4L5T A;  1VQ4 A;  4H02 A;  4GLA C;  1KL9 A;  3HOZ H;  1NE3 A;  4PZ8 A;  1YBY A;  2QGQ A;  3H15 A;  1Q8K A;  5C0X G;  1KIX A;  2VQF L;  1PA6 A;  4UP8 A;  2AWO A;  1ASZ A;  1BVS A;  2BA1 A;  4LF4 Q;  5IYC G;  3F2C A;  2YTX A;  2UUA Q;  2NVT H;  2VUM H;  3CQZ H;  1YZ6 A;  1NMF A;  2HIX A;  4NPS A;  4LNQ A;  4LF8 Q;  2MFI A;  3ERS X;  3AYH B;  4OWT B;  4ME3 A;  5C4X G;  4J15 A;  2HT1 A;  4R4Q A;  1OXX K;  1YEZ A;  2JQO A;  1Q7Y C;  3JAM i;  2ZJR A;  3PIO A;  2B3G A;  3M9B A;  1IXR A;  2Z6K C;  4JI6 L;  4JI7 L;  3U4V A;  4OWX B;  1D8L A;  5EAY A;  5AJ3 L;  1VQN A;  4AYB G;  4DR3 Q;  1K8A C;  1PH4 A;  4GN4 B;  3WWV A;  1VQ8 A;  4UPA A;  4Y52 H;  1AH9 A;  4B3R L;  3PUW A;  4LF7 Q;  4RG1 A;  3J81 i;  3D31 A;  2JA7 G;  4DR3 L;  2VS1 A;  2JA5 H;  4EX5 A;  3M4P A;  4JC0 A;  4YWL A;  2KBN A;  4DK6 C;  1TWF H;  2NVX H;  3S16 H;  2IX0 A;  3PUX A;  1VQD A;  5LMN W;  2ATW A;  1YJ9 A;  1XPR A;  4A3L G;  4R4O A;  3HKS A;  1YIT A;  2K5V A;  1YJW A;  2N78 A;  2A19 A;  4DR4 Q;  1L1O A;  1CUK A;  3EN2 A;  5E7N A;  3W5O A;  5C44 G;  1O7I A;  4GLX A;  2B29 A;  2UUB Q;  4DR4 L;  3G71 A;  2YTY A;  1UE5 A;  2WP8 J;  3I55 A;  1YHB A;  2CQO A;  1EQR A;  1V1Q A;  2D62 A;  2LXJ A;  3KJO A;  2UUB L;  2JA6 G;  2E8G A;  4C3H H;  1IL2 A;  5HY6 A;  4JI2 Q;  2HHH L;  3TRZ A;  1EYG A;  4BXX G;  3HOX G;  4P71 A;  1KRT A;  2R92 G;  3AQQ A;  5LMU Q;  3I4M G;  2Z0S A;  1XJV A;  1RIP A;  2OQK A;  1W2B A;  4UP9 A;  2I0Q A;  2XGT A;  3FP9 A;  5IYC H;  1PYB A;  4RMF A;  5C0X I;  5LMU L;  5IWA Q;  5LMN Q;  4QGU A;  4YCU A;  4JCV E;  1Y1V G;  1T9H A;  5M3M H;  3ZJY C;  1SR3 A;  1X3G A;  4BY1 G;  3S2D H;  1X3E A;  4BBS G;  4DV4 Q;  5C4X H;  2CWP A;  2L15 A;  1PH6 A;  1KC8 C;  4PG3 A;  1L0W A;  1L1O B;  1C9O A;  3CME A;  1L2F A;  3CAM A;  2E2H H;  1V9P A;  2NVY H;  4LFB Q;  3GTO H;  2Y0S E;  2CWA A;  1OXS C;  1K9M C;  4NXM Q;  3JAM c;  2F4V L;  3CP0 A;  4WJ3 M;  4JBM A;  2AMC B;  3VDY A;  5C4J H;  1KD1 C;  4MZ9 A;  4DNI A;  3E9I A; 
#chains in the Genus database with same CATH topology
 1U4M A;  4X64 Q;  2JA7 H;  4DAY A;  1EZ6 A;  1PZJ D;  5I6W A;  4OL7 A;  4J1M A;  4ZLT F;  4A4I A;  2F0K A;  1HH2 P;  4YY3 L;  1NY4 A;  4IJH A;  4QY7 A;  4A3B H;  2DGY A;  3LNN A;  1EY0 A;  2JJQ A;  4M8A A;  4LF5 Q;  2JA8 H;  2DUD A;  1HZ9 A;  3TS2 A;  5LL6 X;  5FLM G;  3EQL C;  5G3L D;  1LTA D;  3S15 H;  5LL6 S;  4RFB A;  4AQY L;  1AP0 A;  3SVM A;  2EJG C;  1IHZ A;  1TQO A;  3HOX H;  4RGM A;  1AN8 A;  2R92 H;  2LY7 A;  1CZG A;  1CQV A;  3R2I A;  3RZO H;  2UUC L;  3HOV H;  4A3M H;  4KD3 A;  4DAY B;  3F2B A;  3T13 A;  2FMM A;  2SDF A;  2YYZ A;  4IOA A;  1YVC A;  3BYY B;  4QQB X;  1TWC H;  2HQL A;  1C4Q A;  1EY5 A;  2F0W A;  4ABN A;  1I4Q A;  4A3D B;  1VQC A;  1N32 Q;  4DA2 A;  1CKO A;  3A7A B;  1EIG A;  5C0X J;  5EBC A;  4X65 Q;  1HNW Q;  5GAD C;  1KAW A;  3I4L A;  4NKL A;  1XMO Q;  3ERO A;  2B63 G;  1SRO A;  1F9P A;  2QEX A;  4LF4 L;  3WOE A;  2WIN B;  1BBU A;  2E2D C;  2DN8 A;  3S14 H;  1B3A A;  4FF3 A;  2PNH A;  2MP1 A;  1I6H B;  2KOL A;  4BY7 B;  4XQJ A;  4LF8 L;  4P75 A;  3RNU A;  1A8V A;  5FLX c;  1N34 Q;  5D65 A;  5DNF A;  2AQ3 B;  4GKK Q;  3U58 A;  2A6H D;  4A3I G;  1RDP D;  4F7X A;  4DGZ A;  3HKZ G;  3BZC A;  1GUN A;  1LLR D;  4YCW A;  4LUZ A;  4LW1 A;  3OWF A;  1LTI D;  3PIO 3;  2AQ1 B;  2L5T A;  2EZV A;  4A3J B;  1HRJ A;  1HTP A;  1TS5 A;  3HOY G;  1SYB A;  1X54 A;  2GVA A;  3D4R A;  1J9O A;  3X3N A;  2D2C C;  4IUT A;  1E0B A;  3DWP A;  3ERQ A;  4MN3 A;  5CBE E;  3L3O C;  1JJ2 A;  2EJF C;  1Q1B A;  1F2Z A;  4XYO A;  5EPL A;  4N8X 1;  1FVI A;  3J7Y W;  4U68 A;  4LMQ D;  4CBV A;  1JOQ A;  1P8L A;  4YCV A;  1PH8 A;  4DV6 L;  1S5C D;  5GAG C;  3GV6 A;  1PFB A;  3CC2 A;  1A2U A;  4IQZ A;  1WFQ A;  4DPG A;  4DV0 Q;  1IW7 C;  1OTC A;  2ZXO A;  1XXG A;  4HJ7 A;  2L1B A;  1DXM A;  3LGJ A;  4A3F G;  4HID A;  2CKZ B;  1EIH A;  4B3T Q;  1T5E A;  3S17 B;  4OO1 I;  3BVM A;  4N8F A;  3GTG H;  2K4K A;  3NBH A;  4LF9 Q;  1JWM D;  1WTH A;  4IJL A;  1JE4 A;  5BR8 L;  1WTQ A;  3ND8 A;  4X66 L;  1YJN A;  2PI2 A;  2QW7 A;  3PO3 H;  3VR3 A;  4DV7 L;  4K8J A;  1N36 Q;  1FGB D;  1SE2 A;  1J6Q A;  4Z9C B;  1LTB D;  4DR5 L;  3S1Q B;  4EGV A;  3I73 A;  1EIY B;  4A75 A;  1GUG A;  2QIL A;  1CT1 D;  4DV5 Q;  3HEJ A;  3QG1 A;  2UXD L;  2F0Q A;  3GD7 A;  1HA6 A;  2F0P A;  2PCF B;  1BO0 A;  2VW9 A;  1G29 1;  2RDH A;  4X3T A;  4BXX H;  2A6E C;  5I2Y A;  1XNQ Q;  4POG A;  2I07 B;  5IT9 L;  1PTO H;  4CDE C;  2NVT B;  3NBH B;  3PF5 A;  1ICW A;  1PRT C;  5K36 G;  1C0A A;  3K81 C;  5C6A A;  5FOB B;  4HAE A;  2UU9 Q;  3VR2 A;  4CJ2 C;  3HOU B;  4KKS A;  3MXN B;  2QDL A;  1PH7 A;  3HKZ E;  3IFD A;  1S3O A;  1K8O A;  1U9R A;  5I2X A;  3A55 A;  2NN6 G;  3HFZ B;  1FD7 D;  2F0V A;  4HMI A;  2JP1 A;  1VF5 C;  4KHP L;  4L6T B;  5M5X H;  1STN A;  2VQF Q;  5JJK A;  3H0G B;  4G57 A;  2IPK D;  1UAP A;  3I2Z A;  2A68 C;  3K5M A;  5FO7 B;  3KLW A;  1LTT D;  3U4Z A;  5KNC A;  2IJ0 A;  1X56 A;  4NB3 A;  3D0F A;  3FKI G;  1RD9 D;  1EYD A;  5CV6 A;  4LFA Q;  3GTM B;  1GM5 A;  5IYD G;  4JI0 L;  3GTK H;  1S5F D;  2ZTD A;  1L1O C;  2DNC A;  1V43 A;  4IO9 A;  3CCU A;  4IPC A;  1QJO A;  3NBI A;  1DZ1 A;  4KLK A;  3BJU A;  4IFD G;  1OXT A;  2PW7 A;  2I5H A;  5FLX E;  1PH9 A;  4R4I A;  1H9K A;  3ND9 A;  4K5W A;  4RKL A;  3CMA A;  1IBM Q;  2N49 A;  1Y8P B;  2FHT A;  5CV9 A;  5L37 A;  4A93 G;  4C2M H;  1ZEQ X;  1S5B D;  3FEW X;  1YHQ A;  4GKJ Q;  1X3Q A;  1YNX A;  3BZD B;  4DNT B;  3R2T A;  1VCI A;  1QZG A;  2WAC A;  3EVQ A;  1Q81 C;  1SYC A;  3CXC A;  1SYD A;  1QG7 A;  2RSN A;  1ET6 A;  4PMB A;  2QDB A;  3F1Z A;  3VYR A;  4A3B B;  4GZY C;  4GOP C;  4JV5 L;  3I4N H;  2JA8 B;  4CKB A;  1PH5 A;  1TWG H;  1Z47 A;  2XWB B;  3PO2 B;  2SOB A;  3S15 B;  3E3X A;  4L63 B;  2F4V Q;  3DMU A;  2I46 A;  4EQO A;  1PRT F;  5C3E H;  3HOX B;  2R92 B;  1F9Q A;  4XT3 B;  1AE3 A;  3SGI A;  3W3A A;  1JMC A;  3GTQ B;  3HOV B;  1D6E C;  4R1J A;  4A3M B;  1LT4 D;  1ZYR C;  3AB9 A;  2F0U A;  3OPO A;  1SJE D;  3S1M B;  4HSV A;  3GP7 A;  4B9W A;  2IX1 A;  4KD4 A;  5D3I B;  2KEC A;  4JPB W;  4EVO A;  5HGQ A;  2KHS A;  4BS9 A;  2K50 A;  3T1H Q;  1X6O A;  1PFM A;  3F2U A;  2O2L D;  4IPD A;  2I5L X;  1HZC A;  3MZ5 A;  3VR4 A;  5BN3 A;  4O2D A;  1HR0 L;  5IP9 H;  4I7A A;  1GKH A;  3OHX C;  3NPP A;  1NCV A;  1WTV A;  2PQE A;  3AU7 A;  5C3W A;  1ET9 A;  4LWC A;  2F4I A;  1SNM A;  2X6G A;  3CCV A;  1VQK A;  3HP3 A;  2MO1 A;  1E1T A;  1D5X C;  4UDU C;  2EDG A;  4JOI C;  1A15 A;  1D7Q A;  4HJ5 A;  1HCZ A;  2PW5 A;  3SDZ A;  2HQE A;  1KNE A;  2MGS A;  5C4H A;  1OO9 B;  2KJX A;  2N55 A;  2VB3 X;  3NHH A;  4K6D A;  4C3H G;  3TEH B;  2XRS D;  1NE3 A;  2P5Z X;  2SNM A;  5C0X G;  5AFW A;  4K2L A;  1PA6 A;  4UP8 A;  1ASZ A;  1BVS A;  1LTR D;  1K8M A;  1QWY A;  2UUA Q;  4I7Z C;  1YZ6 A;  3K6O A;  5CYU A;  1PYW D;  1GHJ A;  3DEO A;  2MFI A;  3RUZ A;  3AYH B;  5CV7 A;  1WD1 A;  1ILQ A;  1OXX K;  3QR8 A;  1DCZ A;  4DK0 A;  4JI6 L;  4RWS C;  2JYO A;  1XYI A;  4OWX B;  1D8L A;  1VQN A;  1K8A C;  2ZXP A;  2H1E A;  4UPA A;  2Z4I A;  1PRT B;  1KNA A;  4FXD A;  3J7A V;  2RVL A;  2JA5 H;  1TY0 A;  2KBN A;  3H6M A;  1CA6 A;  1DM0 B;  4X3S A;  2NVX H;  1TWF H;  1XWE A;  3PUX A;  1V1P A;  1JOO A;  2XN9 C;  4ZYS A;  3TBI B;  4R4O A;  3HKS A;  1YIT A;  4DR4 Q;  2Z6B A;  2A19 A;  4FYD A;  1L1O A;  3EN2 A;  2HD3 A;  3GTG B;  5A35 A;  4HTH A;  4IAL A;  2Q8T A;  5C44 G;  2QEJ C;  4TRD A;  3NTI A;  3M4O B;  2F0F A;  1SDF A;  3OIP A;  1CK1 A;  1RJT A;  2CQO A;  2JA6 G;  2K32 A;  2LXJ A;  4DF7 A;  1ZKO A;  2E8G A;  1IL2 A;  5HY6 A;  1EYG A;  3RMH A;  1H9R A;  1V1O A;  2EYO A;  2HDL A;  2Z0S A;  1E2W A;  3KLS X;  4TKO B;  1KDB A;  2WKC A;  2XGT A;  2RDG A;  1PYB A;  1SYE A;  5IWA Q;  5TSS A;  1V1P B;  2EVB A;  5M3M H;  1SR3 A;  3P75 A;  5C4X H;  1PH6 A;  1L1O B;  3CME A;  2IW3 A;  1V9P A;  2CWA A;  3I72 A;  1K9M C;  3S1N B;  4JBM A;  3MC0 B;  3MXG A;  2CW0 C;  5C4J H;  4LAA A;  3F8T A;  5E4W C;  4NXM L;  2K14 A;  3UDF A;  4KY5 A;  1I50 B;  4BY1 B;  4MIU A;  4IUP A;  3CPW A;  4HIK A;  3W1B A;  1TS3 A;  5IY0 A;  1BBX C;  2F3V A;  1IL8 A;  4UP7 A;  4OXP A;  4P72 A;  1JE5 A;  2O5I C;  2BDN A;  4IZ8 A;  4DR6 Q;  5M5X B;  1STE A;  2D0O A;  1KDA A;  4IPH A;  3NQT A;  1LV9 A;  2Z1C A;  3H94 A;  4OHJ A;  4A3D G;  1W6K A;  1G51 A;  1B9N A;  1TU2 B;  1G6P A;  1T5X D;  4IUQ A;  4GLV B;  2MQH A;  3M85 A;  3HOW H;  4BBR B;  5IP7 G;  2A69 C;  5J3B A;  1Y1W H;  4C1N K;  4C3I H;  4O42 A;  1SE4 A;  5DEH A;  1CKN A;  1EL0 A;  3S2H H;  1GUW A;  1I3Q H;  4BY7 G;  2OCE A;  4CJ0 B;  1DOL A;  1EOT A;  3V96 A;  4C3J H;  1HNX Q;  1IBL Q;  1LAB A;  4KTA A;  4HJ9 A;  3J80 c;  2K6A A;  3DXJ C;  5I9O A;  3I8Z A;  4JOI A;  1K83 H;  4APV A;  2JA9 A;  1KLG D;  2G9H D;  4EQN A;  1N32 L;  2WV6 D;  1SMY C;  4DXG A;  2OXP A;  3MVV A;  4JI1 Q;  1VQG A;  4X65 L;  1HNW L;  4A3J G;  2D0P A;  3C1E A;  4OIK A;  2HUG A;  2YU9 B;  4L5Q A;  3N6R A;  1VQA A;  4KI0 A;  1K8G A;  2NTS A;  2VQE Q;  4P2C B;  5H1S E;  1N34 L;  4HCS A;  4PMW A;  1CKN B;  1PH1 A;  1ILP A;  5EKK A;  4OON A;  4GKK L;  1NBW A;  3ONA B;  4B08 A;  5ISR A;  3RLN A;  2VNU D;  4JI5 Q;  5FLM H;  4IFD J;  4RGT A;  1H95 A;  1N33 Q;  4JI8 Q;  5C3X A;  1PMR A;  3M3Y B;  2AHO B;  2K04 A;  3I4N B;  1CFM A;  4ZAI A;  1VMP A;  2MNA A;  2A73 B;  2L55 A;  2LMC B;  3T1Y Q;  4DN4 M;  3TME A;  4M1U B;  2WII B;  4UAI A;  2HDM A;  5CV4 A;  4CKC A;  1HNZ Q;  2K03 A;  3QB3 A;  1VQE A;  5C3E B;  4K0K Q;  2XSC A;  3OIQ A;  4AIM A;  1JWS D;  5IIF A;  3H3V H;  1CSP A;  1LAC A;  3E0J A;  2XRQ D;  5EKL A;  3H3V I;  3WDN A;  4A3K B;  3J80 i;  1K28 A;  5M5Y H;  4DV0 L;  1TWA B;  3MXU A;  2ES2 A;  3VA5 A;  5IOC A;  3KLS A;  3M7N A;  1GJX A;  1EWI A;  1FJG Q;  4TVA B;  1HR0 W;  1Y14 B;  1VQP A;  2AQ2 B;  1A62 A;  3IRB A;  1Q8I A;  3SK8 A;  3K5O A;  4LFB L;  2R7D A;  4S3S A;  1SFO B;  2N3S A;  5CV8 A;  2RBM A;  4DR7 L;  4LF9 L;  1XPU A;  2PNR C;  3S9W A;  2GVB A;  3OW2 A;  3EBE A;  3U50 C;  1HJP A;  5M5W H;  1KXL A;  4UY8 C;  1SEB D;  1H9J A;  4G4K A;  2NZ1 D;  2EIF A;  3DEP A;  3S1R H;  1PRT D;  2F0L A;  4JI4 Q;  1DJR D;  3K0Y A;  3VR5 A;  2B2V A;  4XQN A;  4DV3 Q;  1S4Z A;  1VQM A;  2E5L Q;  4O1N A;  5M3F B;  1TWH H;  1CSQ A;  5CBA E;  2MO0 A;  1QVG A;  4OGQ C;  5ELF A;  3HOU G;  4X62 Q;  3GTP H;  3I4M H;  4KY7 A;  4RA8 A;  1WTW A;  2OEO A;  2ZJP A;  2R93 B;  4RGO S;  1KAA A;  2F0H A;  3NUC A;  5FKA C;  1QOH A;  3GO5 A;  3OTO Q;  4A3F H;  2X6L A;  4FF2 A;  3P7J A;  3H0G G;  1KHI A;  3KUP A;  2TSS A;  4JBW A;  2X69 A;  2RSO A;  4DV1 Q;  4UHV A;  4WRD A;  1RCV D;  1H9M A;  4KMU C;  3UDX A;  3A8I E;  4LJZ C;  4DV2 Q;  4DR2 Q;  2B2T C;  3GDE A;  2QKI C;  3E0E A;  5IGE A;  5K5P A;  2F3W A;  2K05 A;  3RN5 A;  4HN7 A;  2PMZ B;  4IUU A;  1WVL A;  2DJF C;  1MGS A;  1S72 A;  4A3E H;  1KRS A;  2WAQ B;  3KYH C;  3D3R A;  2CVR A;  3OMG A;  4QJF A;  4JI7 Q;  3Q23 A;  2NVQ H;  1J5E Q;  1HXY D;  1X55 A;  5AJ3 Q;  1AZP A;  4JYA L;  1EY9 A;  1JT8 A;  1PHJ A;  2CFM A;  3J80 E;  4LFA L;  4CJ1 B;  3D8G A;  2CHB D;  3PSI A;  2HHH Q;  4EQ5 A;  1X65 A;  3G48 A;  5GAH C;  1TXY A;  2E76 C;  3C1F A;  4DUZ Q;  4DKA C;  4ZKB B;  4HJ8 A;  1B44 D;  2DJG C;  5IYB G;  1I94 Q;  1GUO A;  5M3M B;  4L5R C;  4NXN L;  1BCP F;  4IUV A;  2IT1 A;  2RQX A;  4JBJ A;  1MJE A;  1DOM A;  1HTL D;  1CM9 A;  3PUY A;  2SNS A;  3HG9 A;  3PIP A;  4A3B G;  4KKU A;  1DON A;  1SXT A;  3M4Y A;  2BE5 C;  2RHS B;  2JA8 G;  1HZB A;  2E2J H;  1VDZ A;  2EYJ A;  4AH6 A;  1A3U A;  5J1Z A;  1IBM L;  1B70 B;  2L0C A;  1O7Z A;  2MHV A;  5EQ0 A;  2NN6 H;  3A74 A;  3KJP A;  3PO2 G;  2B39 A;  4KKT A;  5ELE A;  4WJW A;  1PXU A;  4KJO A;  2NN6 I;  2CH4 A;  4OO1 H;  2V1C C;  1SNP A;  2EOT A;  2BH8 A;  2D9U A;  5FJ8 G;  1TS4 A;  3U9O A;  3GTL H;  3HGB A;  4K14 A;  3HOV G;  4A3M G;  3TZU A;  2PI2 E;  1FR3 A;  1ZYR D;  1NR2 A;  3GQB A;  5KRU A;  2EXD A;  3FKI H;  1KAB A;  1WCM B;  4QL5 A;  3HOZ G;  1EOV A;  3TP8 A;  1MKH A;  1W3S A;  1OXV A;  1GXD C;  3MEF A;  5IYD H;  2E2I H;  4PZ6 A;  3MHB A;  4FNF A;  3UDI A;  1J8I A;  1WYD A;  1ONL A;  3HOW B;  4MTN A;  4R4T A;  4TQU S;  1B1Z A;  2AWN A;  3MXN A;  1CQF A;  1U0L A;  2GA4 B;  4ZCK A;  3M4Q A;  1Y1W B;  2GN5 A;  3L9A X;  4C3I B;  1F9R A;  2F0G A;  2XNA C;  4ZUJ A;  4CDD C;  3CCS A;  1CKM A;  2F0O A;  2AUK A;  1NTG A;  1I3Q B;  5FO9 B;  4YY3 Q;  4IFD H;  1IKL A;  1Q12 A;  4B3S L;  1EY6 A;  3R93 A;  4IFD I;  3LWU A;  1K83 B;  1VQH A;  1PFS A;  2HCC A;  3G7L A;  3S24 A;  2K1B A;  4TSS A;  4A93 H;  3FDT A;  3NQI A;  3RLO A;  2B2Y C;  3PV0 A;  1EEF D;  3NXW A;  3BS1 A;  2B2W C;  1BCP B;  2N8N A;  4KK7 A;  1SE8 A;  2KEE A;  4YHH L;  2KCN A;  3HRZ C;  3NEL A;  2Y0S B;  3QO2 A;  3J81 j;  2C35 B;  4WFN 3;  1HFG A;  2KCT A;  2JEB I;  1B7Y B;  4FF1 A;  3S16 B;  5COR A;  1MD2 D;  1YHA A;  1IZ6 A;  5E4X A;  2IWH A;  4RHR A;  4PZ8 A;  5ELB A;  1KIX A;  4ZQ3 A;  2AWO A;  2BA1 A;  4LF4 Q;  1M8A A;  5IYC G;  2XIW A;  2VUM H;  2PYK A;  3CQZ H;  4NPS A;  4LNQ A;  4LF8 Q;  3ERS X;  4OWT B;  4ME3 A;  2HT1 A;  2JQO A;  4H44 C;  3NSW A;  3JAM i;  2KQ3 A;  3PIO A;  2ZJR A;  1IXR A;  3BVZ A;  5HUR A;  2Z6K C;  2ZT9 C;  3D6C A;  3BDO A;  4DR3 Q;  1PH4 A;  1PTO C;  1JWU D;  4GN4 B;  1FNV A;  1VQ8 A;  1JOK A;  5E1F A;  4Y52 H;  4B3R L;  3PUW A;  3M7G A;  4RG1 A;  3O13 A;  1STY A;  3VYU A;  4HR7 B;  1VMC A;  1PFN A;  4EX5 A;  3M4P A;  4JC0 A;  4MTK A;  4YWL A;  1E2V A;  1WTO A;  1XPR A;  4A3L G;  2N78 A;  4AYB B;  1CUK A;  3IKJ A;  1O7I A;  3T53 B;  4XDX A;  2UUB Q;  1SE3 A;  4RHS A;  4DR4 L;  1IKM A;  2JA7 B;  1UE5 A;  1UNS A;  4DU9 A;  1HQR D;  4C3H H;  4BXX G;  4PNY A;  1F9S A;  5M5W B;  3SK4 A;  5C0X H;  2OQK A;  4UP9 A;  2VXW A;  2V4D A;  2CW0 D;  4RMF A;  5C0X I;  3A56 A;  4QGU A;  1Y8N B;  1Y1V G;  3MEH A;  5DAU A;  4CDF C;  1X3G A;  4BY1 G;  3S2D H;  1TWH B;  2CWP A;  2L15 A;  1KC8 C;  3A8K E;  3CAM A;  2E2H H;  1ROD A;  2NVY H;  3GTP B;  1A6X A;  3GTO H;  3I4M B;  1OXS C;  1SNC A;  3CP0 A;  3RZO B;  1KLU D;  4KN4 C;  2F0E A;  1KD1 C;  1X3P A;  3OSO A;  3E9I A;  4DNI A;  3SK5 A;  3P20 A;  2FIN B;  2RCF A;  4JI3 L;  2DY7 A;  2KVM A;  4P74 A;  1NSN S;  1TWC B;  4DR5 Q;  5C5L A;  3TZD A;  3E6Z X;  4BWG B;  4LF6 L;  3J80 L;  3NEM A;  4A3G H;  4OWW B;  1MSG A;  1O7Y A;  4BBR G;  3I70 A;  3MA2 B;  2K5H A;  2A69 D;  4QIW B;  1WTP A;  2FMC A;  3S14 B;  3K80 C;  2O5J C;  4OX9 Q;  5CR3 A;  1A2T A;  2H5X A;  4FVM A;  3MFY A;  2BA0 A;  4A3E B;  2OT2 A;  3KOJ A;  1NR4 A;  2XTI A;  3RZD H;  1WI5 A;  3K58 A;  4KJN A;  3I7F A;  2NVQ B;  2Q2H A;  3L0O A;  1SBB B;  1EY7 A;  1PTO F;  1QUQ A;  3E5S A;  2J0T D;  5CGK A;  1CHQ D;  1HZA A;  3J7A F;  3K5N A;  4IUN A;  5I4D A;  1Y69 U;  5JJI A;  4QCL A;  4P73 A;  3K7U C;  3C46 A;  2VZA A;  2CCZ A;  4BA1 I;  1A0I A;  1IBL L;  1XMQ Q;  1QVC A;  2FJ2 A;  4B3M Q;  3A7L A;  4XTC S;  1EQT A;  1V8Q A;  1QZH A;  5IGF A;  2UXB Q;  4I65 A;  3LWE A;  3CC4 A;  2F1M A;  3HS0 C;  1EU3 A;  3T51 B;  1O78 A;  4JI1 L;  2N88 A;  3OMC A;  2R7Z H;  1YI2 A;  3BYT B;  3Q22 A;  2WB1 B;  4FF4 A;  1SN8 A;  1QUQ B;  3L2P A;  4JI0 Q;  3EJI A;  4LF7 L;  5GRO A;  1LT5 D;  1SND A;  5IE8 A;  3K5L A;  1CI3 M;  3HZX A;  3QOJ A;  3DWA A;  5C3E G;  2Z6K A;  4DK3 C;  2WKD A;  4R4C A;  4HJA A;  4A3D H;  4HMJ A;  1KQS A;  1DYQ A;  1UEB A;  2XVS A;  2K7V A;  4A3K G;  3FPU B;  4GN5 A;  3SK6 A;  4JBK A;  1F2M A;  1EYC A;  3PO3 B;  1BQQ T;  5IP9 G;  4BY7 H;  2UXC Q;  1E7Z A;  3CC7 A;  3STB C;  4C56 C;  1D5Z C;  1BCP D;  1EIF A;  4XT1 B;  4JI2 L;  2EY6 A;  5EKI A;  4K0K L;  5KYL A;  1JC7 A;  1WTR A;  1JB7 A;  1O80 A;  3MWY W;  2KCM A;  3VYT A;  1A3T A;  4DR1 Q;  1BR9 A;  4R8N A;  1LTG D;  1LO5 D;  5LMN L;  2K28 A;  3Q8D A;  4A3C G;  3TP7 A;  1I5F A;  3J81 L;  4HIO A;  1ENC A;  1SRU A;  4JV5 Q;  1DGS A;  4DAM A;  1PTO B;  4DV4 L;  2LXK A;  4RKB A;  2K52 A;  4O0A A;  5HGT A;  4DAV A;  1YIJ A;  4GOP A;  1FJG L;  1JR0 D;  4RCN A;  1VQL A;  2E74 C;  3X3M A;  5KYI A;  3A0J A;  1Q3L A;  4PMC A;  2DY8 A;  4GNX C;  1WD0 A;  5T1I A;  1K3R A;  4PZ7 A;  3CRL C;  2MPM A;  5M3F G;  3AEV A;  3CD6 A;  4X64 L;  3KLR A;  2J7Z A;  4LFC Q;  5IOD A;  5DM7 3;  2OQ0 A;  2R7F A;  1EUJ A;  2R93 G;  3N52 A;  4RCO A;  3TN2 A;  4Q5V A;  4ALP A;  2RDF A;  5JJZ A;  1HR0 Q;  3QJY A;  1H9S A;  4LF5 L;  1YNJ C;  1SYF A;  4JI4 L;  2HCI A;  3DHQ A;  4DNR B;  4K8I A;  2BH2 A;  4GOP B;  1SLJ A;  3S17 H;  2AUJ D;  4J6H A;  2VUM B;  3CQZ B;  1DD2 A;  2F0J A;  5GAE C;  4XQQ A;  3ULJ A;  4X62 L;  3KF8 A;  2K5D A;  4JW0 A;  4GS3 A;  3CCE A;  3GTK B;  4BBS H;  3BVG A;  1TVX A;  1XTD A;  4WJ4 A;  4Y7N H;  5EJW A;  2OTL A;  3C3L A;  3FHW A;  1S40 A;  1IYJ B;  3OTO L;  1LM0 A;  2RHQ B;  4BA2 I;  1PDQ A;  2EYF A;  2WAQ G;  4FP5 D;  3EFX D;  4X3U A;  4FXG C;  1H9S B;  1D5M C;  4OEM B;  2B8F A;  2Q8R E;  3KBX A;  3J7A 5;  4DV1 L;  3PCO B;  1YNN C;  1XMO L;  4HED A;  2R6G A;  3L7Z C;  4DV2 L;  2PQA B;  4DR2 L;  1PV4 A;  1M90 C;  1Z6H A;  2JK8 A;  3AFQ A;  1XNR Q;  4C2M B;  1WJJ A;  3KF8 B;  1KTK A;  3CHB D;  1XPO A;  1WOC A;  1HFN A;  4QMG A;  5CC4 A;  5ELD A;  5M3M G;  4JI6 Q;  1K0S A;  1I4G A;  1JQY D;  1EFW A;  3TRE A;  1U4P A;  1GVP A;  1IBK Q;  3B6Y A;  3PGZ A;  3A5Z B;  1BXT A;  1VQ6 A;  1J5E L;  3OW7 A;  3HOU H;  1TWG B;  1U4L A;  2BE5 D;  5FK9 C;  1STG A;  1IW7 D;  3KDF A;  2HHH L;  2G5D A;  3RLF A;  3PUZ A;  2F0D A;  1RL2 A;  2OF1 A;  1EQV A;  1PH2 A;  1EY8 A;  3CW2 C;  4DUZ L;  3K7A H;  1M4V A;  2C9O A;  5I9P A;  2VY3 A;  2E2H B;  1I94 L;  2NVY B;  3A54 A;  3H0G H;  2EYL A;  3NEN A;  4GN3 B;  3JAM L;  1NJI C;  5EBD A;  2R3Z A;  3D4D A;  1WTX A;  1N8R C;  1FYC A;  2B63 H;  2EY2 A;  1SMX A;  3OOC A;  2KCC A;  1WCM G;  4ODG A;  3GTM H;  5COY A;  1LYL A;  1JJC B;  4DUY Q;  1AEX A;  2EYM A;  3UE1 A;  1PYS B;  3JC6 6;  4A3G B;  2JN4 A;  3HOW G;  3KDF B;  1Q46 A;  1AFP A;  1R9T H;  1Y1W G;  4B3T L;  2F3I A;  2KHJ A;  1I4H A;  4C3I G;  4A3I H;  1VF7 A;  1Q82 C;  2RA4 A;  5JPN C;  5ELC A;  5JEA G;  2WFW A;  3QWN A;  3CCL A;  2NZO A;  3W2D A;  1BBW A;  3CU7 A;  2Q2U A;  1EU4 A;  2ASB A;  3HOY H;  1U5K A;  2A6E D;  4RGN A;  2YV5 A;  4YIJ A;  3ULP A;  1HUM A;  2ZXR A;  3URY A;  5BN5 A;  1N36 L;  2D5D A;  5T1G A;  2ID0 A;  4KY6 A;  1G8Z D;  1QE6 A;  5IYB H;  5EPK A;  3TS0 A;  3BDL A;  2CH4 W;  4QUF A;  4DV5 L;  3RD4 A;  4GNX A;  2PMZ E;  3J81 c;  1SNO A;  4WOR A;  5DLQ E;  1EZ8 A;  4H13 C;  2WAQ E;  1PVO A;  1I6V C;  3BU2 A;  4MHE A;  1R4Q B;  1EYA A;  2Y0S G;  3H3V C;  2ZM6 Q;  2E75 C;  1XNQ L;  4ZKC B;  3VA7 A;  1RKN A;  3GV3 A;  2I5M X;  3T16 A;  3PO2 H;  2EYP A;  3ER0 A;  1D2B A;  3CRK C;  3MAQ A;  1TR5 A;  1X3F A;  3V2T A;  4L5S A;  1VQ7 A;  2UU9 L;  4X3K A;  3TQY A;  2R7Z B;  2A68 D;  1VQI A;  2PZU A;  5FJ8 H;  3RR5 A;  4FDB A;  1E24 A;  3GTQ H;  4ME5 A;  2R61 A;  2JA5 B;  2Z9H A;  1PZK D;  4GNX B;  1RTN A;  1SJH D;  3NK9 A;  3S1M H;  2NVX B;  1TWF B;  1MBY A;  3PUV A;  4L5T A;  2JXM B;  3HOZ H;  5JVH 3;  4XYQ A;  2QGQ A;  2PZW A;  2VQF L;  3R3O A;  1PTO D;  1BF4 A;  2YTX A;  4K2K A;  3DUZ A;  3EA6 A;  2B3G A;  3U4V A;  3SR1 A;  4IUR A;  4AYB G;  1ML0 D;  1B53 A;  2ICI A;  3WWV A;  1B50 A;  1W6J A;  1Q90 A;  2M2L A;  1ESR A;  2A5H A;  1JOR A;  3J81 i;  3D31 A;  2JA7 G;  4DR3 L;  2VS1 A;  4B9X A;  1LT3 D;  2ENB A;  5KND A;  5K36 H;  5C4X B;  4RH6 A;  5A2Q L;  4DK6 C;  1VQD A;  5LMN W;  2ATW A;  3H91 A;  2NB0 A;  2K5V A;  5E7N A;  5C4J B;  1AZQ A;  1PZI D;  1CZW A;  3KK7 A;  3AMU A;  5CMD A;  3G71 A;  1ESF A;  2YTY A;  2WP8 J;  1HA5 A;  1V1Q A;  2D62 A;  4Q0F A;  3KJO A;  5CV5 A;  2UUB L;  4GKJ L;  1B3Q A;  3TRZ A;  3HOX G;  4P71 A;  1KRT A;  2R92 G;  5LMU Q;  3I4M G;  1G6Z A;  1XJV A;  1RIP A;  2K5W A;  3FP9 A;  5IYC H;  4F8M A;  1SNQ A;  4V19 0;  4K6L A;  2M9V A;  4YCU A;  1T9H A;  2F0I A;  3ZJY C;  3BG3 A;  5FO8 B;  5NUC A;  2Z8L A;  3LX0 A;  1L0W A;  1C9O A;  1EY4 A;  1MI2 A;  1NNX A;  1E2Z A;  4LFB Q;  1SAP A;  2Y0S E;  2JSO A;  1F2Y A;  3JAM c;  2F4V L;  2AMC B;  4MZ9 A;  1EFI D;  1LUZ A;  1VQF A;  4IN3 A;  4DR7 Q;  3S2H B;  3M4O H;  5C5M A;  5KNB A;  4BBS B;  4G7O C;  3I3C A;  4C3J B;  1D1I A;  1QCB D;  3K8A A;  2NBF A;  1MIU A;  4PV1 C;  2Q8I B;  3TSS A;  4Y7N B;  1X9N A;  2F0S A;  5IGB A;  3T1H L;  4KN7 C;  3NWT A;  5LHY 1;  4A3E G;  4A3L H;  4JG2 A;  1K3B C;  1I4R A;  1QNU A;  2IX3 A;  4E6I A;  2AKW B;  1II3 A;  2Z4H A;  5GQO A;  4AQY Q;  1ZXT A;  1ICF B;  2QCP X;  1NAP A;  2L11 A;  3ULL A;  5C4Z A;  3DM3 A;  5EPJ A;  2UUC Q;  2IHE A;  3EIV A;  4NDX A;  2ZJQ A;  4OX9 L;  2KHI A;  2HIV A;  3S1N H;  2K33 A;  3WOF A;  1VQB A;  4K5V A;  2O4X A;  3CCJ A;  3W1G A;  3G6J B;  3I91 A;  3J81 E;  1Y1V H;  3J7Z C;  5JJL A;  1I50 H;  2EY1 A;  2QF7 A;  4BY1 H;  2EYH A;  4AYB E;  3UDG A;  2BOS A;  2F0T A;  4POF A;  1BOS A;  2RKS A;  4JK1 C;  1Z9F A;  4NP5 A;  1GUS A;  1F2L A;  1FGU A;  2WB1 G;  3PQI A;  3OYY A;  3VYS A;  4XIG S;  5F2D A;  1XTC D;  2UUA L;  3K7A B;  2B2T A;  4A76 A;  1XMQ L;  4B3M L;  4OO1 G;  3KFU A;  3D4W A;  3CCQ A;  1FNU A;  4LK1 C;  3DLL A;  3TP5 A;  4X6A H;  4KHV A;  2UXB L;  3BDC A;  2NZH A;  2JEA I;  2Q2I A;  5JVG 3;  1LTL A;  1D1K A;  2KEN A;  3IFT A;  2B63 B;  4JYA Q;  4U67 3;  4BBR H;  1UE1 A;  1UWV A;  5M5Y B;  3CF5 A;  1BDO A;  3PO3 G;  3T56 B;  3IL8 A;  3CPF A;  1U4R A;  1Y8O B;  5I6Y A;  1QVF A;  4DFA A;  1NMG A;  1B4O A;  5IGG A;  3STB D;  1R9T B;  1OXU A;  4NXN Q;  2A6H C;  4A3I B;  2LKV A;  3HKZ B;  1M1K C;  2BCO A;  3V05 A;  3NTH A;  1EWC A;  4JVZ A;  4KHZ A;  4DV6 Q;  1G91 A;  4FXK C;  3HOY B;  3ICE A;  4R8I A;  2OWO A;  2YU9 H;  1K0R A;  2F0M A;  2PZT A;  1SYG A;  4QIW E;  2KUM A;  1C8C A;  2PO4 A;  4IOC A;  2UXC L;  3S1R B;  3BZK A;  4ZRZ A;  2M00 A;  3IAY A;  4V0B A;  1ASY A;  3I56 A;  3A5U A;  5JEA J;  2K5N A;  4N9T A;  1XX8 A;  4CDC C;  1TT2 A;  1GD7 A;  5IWA L;  3Q0A A;  1TKW B;  1BKB A;  4DR1 L;  5JAV A;  2TMP A;  2SEB D;  3NTK A;  5J39 A;  3M3Y H;  1JCK B;  1GHK A;  1HHV A;  2A74 C;  5BR8 Q;  1E1O A;  1GOZ A;  2A8V A;  4R9W A;  1A63 A;  4F87 A;  4X66 Q;  3GTJ H;  2LSS A;  1KDC A;  4DV7 Q;  1B9M A;  4A3F B;  1RTO A;  1DOK A;  1YNJ D;  5J22 A;  2NTT A;  1VQO A;  3QOL A;  2OTJ A;  5KGU A;  1A3V A;  2UXD Q;  3I4O A;  5G3L F;  3FRP B;  2VUM G;  2VL6 A;  2ZTC A;  2K01 A;  1MJC A;  4HSP A;  5C44 H;  2IY5 B;  2LS0 1;  4LFC L;  4QF4 A;  1QIL A;  3ITP A;  1Q1E A;  1TII D;  1TY2 A;  2FFK B;  3Q6S A;  4G7H C;  4B3S Q;  3OWE B;  1E3P A;  4A3K H;  3HOZ B;  2JA6 H;  4DR6 L;  1TWA H;  3U9S A;  3JAM E;  3UI2 A;  3SHL A;  2ZTE A;  2WB1 E;  1BUV T;  2NYZ D;  1FL0 A;  4HIM A;  1SMY D;  1X32 A;  4ID6 A;  3QIA A;  2B2Y A;  1SFO H;  1YNN D;  4YHH Q;  2B2W A;  1G2T A;  4A3C H;  1UEA B;  2JE6 I;  1UUP A;  4KHP Q;  1HNX L;  1JJG A;  3E9H A;  3F2D A;  1HPC A;  3MFG A;  2F52 A;  5M9O A;  2NWG A;  1EWH A;  3K59 A;  4HCE A;  5M3F H;  5IGD A;  3KF6 A;  1LT6 D;  4NMZ A;  3I4N G;  4ILW A;  5IT9 c;  2ICE C;  2E2J B;  4DK1 A;  4QB4 A;  3K57 A;  3CCM A;  1XNR L;  3PMF A;  2VQE L;  1UE7 A;  2R93 H;  3NP8 A;  2FXQ A;  1I4P A;  2K75 A;  3R8B A;  4B3R Q;  3RN2 A;  1L0X B;  2IHF A;  1EEI D;  4JI5 L;  3GTL B;  3FMC A;  2QA4 A;  1IBK L;  1JIC A;  1AW7 A;  1N33 L;  4JI8 L;  1GUT A;  2MUY A;  3UE0 A;  1AE2 A;  5IP7 H;  2MJ8 A;  1JB3 A;  2RCN A;  2Q2T A;  4YWM A;  4LUV A;  5JOB A;  3FKI B;  1UE6 A;  1E22 A;  1NUC A;  1CA5 A;  3CCR A;  3H09 A;  3T1Y L;  2DNE A;  3KF6 B;  2E2I B;  2F03 A;  2EXZ A;  1I6H H;  1IYV A;  3MTS A;  1HNZ L;  4A3G G;  3VR6 A;  3FPP A;  4YWK A;  1L0Y B;  1K73 C;  1STB A;  5ELN A;  2B2U C;  1MSH A;  5JPM C;  1G2S A;  1VS0 A;  5D14 A;  4ZK9 B;  5EGT A;  3G6E A;  2EY5 A;  2KA7 A;  4A3J H;  4EQP A;  1VQ9 A;  3NWS A;  3PF4 A;  3MXP A;  2K5Q A;  2YTV A;  3D6W A;  1N9W A;  2G9D A;  1CHP D;  4DUY L;  2EPB A;  4A93 B;  4NW2 A;  2IL8 A;  4CHT B;  1C48 A;  3FVQ A;  4LUO A;  2A1A A;  1RF2 D;  4JI3 Q;  3TP6 A;  4N9P A;  1ENA A;  5A2Q E;  1B8A A;  1ENF A;  1Y1V B;  2B2V C;  5E3F A;  4LF6 Q;  2LFN A;  3P1H A;  4MNO A;  2KED A;  1VQJ A;  4DV3 L;  5DM6 3;  1P16 A;  2E5L L;  4KV6 A;  1SSO A;  2PQA A;  2R7Z G;  1QB5 D;  1FNW A;  2EE1 A;  2JA5 G;  3K0X A;  4QUC A;  2EJM A;  5BN4 A;  5IGC A;  4H7B A;  2ZM6 L;  2EQS A;  4DXF A;  3C2P A;  1PH3 A;  1WCM H;  5KIX A;  1GO3 E;  1C7Y A;  1Q86 C;  4F88 A;  5FLX L;  4IPG A;  1B2T A;  1S5D D;  2ALY B;  4C1N I;  3G4S A;  3SE0 A;  3S1Q H;  1QNK A;  1VQ5 A;  3AFP A;  2CQA A;  5ELO A;  3SEB A;  2B8G A;  3T4A C;  2RF4 A;  1EQQ A;  2H4O A;  1LTS D;  5JEA H;  1VQ4 A;  4H02 A;  4GLA C;  1KL9 A;  1YBY A;  3H15 A;  1Q8K A;  4ZUI A;  2F0N A;  3Q24 A;  2J4X A;  3A8J E;  3F2C A;  3I90 A;  2L4N A;  1I4X A;  3NE5 B;  2NVT H;  3SXH A;  1NMF A;  2HIX A;  4XXE A;  2C5C A;  5C4X G;  4J15 A;  4R4Q A;  1YEZ A;  1Q7Y C;  4C3H B;  3M9B A;  3TDQ A;  4OEL B;  3KBG A;  4JI7 L;  1STH A;  3DWQ A;  4FO2 A;  5EAY A;  5AJ3 L;  2L12 A;  1AH9 A;  2L9H A;  4LF7 Q;  1STA A;  1F77 A;  2NUC A;  3S2D B;  4G7Z C;  2BDO A;  3ZYY X;  3S16 H;  2IX0 A;  3GTO B;  4RAU C;  1YJ9 A;  1HUN A;  4J8Q A;  1RHP A;  3CKI B;  4CKE A;  5IT9 E;  1YJW A;  2VB2 X;  2PPB C;  1HQM C;  3W5O A;  4GLX A;  3GTJ B;  2B29 A;  1O7L A;  1PLF A;  3I55 A;  1YHB A;  1EQR A;  4H0L C;  4JI2 Q;  3PIP 3;  3AQQ A;  4CGY B;  1S5E D;  1W2B A;  1TS2 A;  2I0Q A;  5C44 B;  4DAP A;  1BNZ A;  2B2U A;  5LMU L;  5D3D A;  4OIJ A;  5LMN Q;  4JCV E;  3DM1 A;  4BBS G;  1X3E A;  2JA6 B;  4C3J G;  4DV4 Q;  4PG3 A;  1L2F A;  5KEE A;  4L8J A;  1Z7T A;  1IYU A;  4K5X A;  4PQX A;  4NXM Q;  4ULL A;  1BCP C;  3RZD B;  4WJ3 M;  1MHW C;  1CTM A;  1R4P B;  3VDY A;  2XWJ B; 
#chains in the Genus database with same CATH homology
 3F8T A;  1LUZ A;  1VQF A;  4NXM L;  4DR7 Q;  2K14 A;  4X64 Q;  3M4O H;  3UDF A;  2JA7 H;  4JI3 L;  3CPW A;  4P74 A;  4HIK A;  3K8A A;  3W1B A;  5IY0 A;  1MIU A;  4DR5 Q;  1X9N A;  4A4I A;  4UP7 A;  4LF6 L;  1HH2 P;  3T1H L;  4YY3 L;  4A3E G;  4A3L H;  1NY4 A;  3NEM A;  4IJH A;  4A3G H;  4OXP A;  4P72 A;  4QY7 A;  4OWW B;  4A3B H;  2DGY A;  4JG2 A;  4BBR G;  1JE5 A;  2JJQ A;  2K5H A;  4LF5 Q;  2JA8 H;  2AKW B;  2DUD A;  1HZ9 A;  3K80 C;  5GQO A;  4AQY Q;  3TS2 A;  4DR6 Q;  5FLM G;  2D0O A;  4OX9 Q;  4IPH A;  3S15 H;  2H5X A;  3ULL A;  4AQY L;  3DM3 A;  2UUC Q;  2ZJQ A;  2IHE A;  3EIV A;  4A3D G;  1G51 A;  4OX9 L;  2BA0 A;  1G6P A;  3HOX H;  2KHI A;  3KOJ A;  2R92 H;  2HIV A;  2XTI A;  4GLV B;  2MQH A;  3M85 A;  3HOW H;  3S1N H;  3RZD H;  1WI5 A;  5IP7 G;  2UUC L;  5J3B A;  4A3M H;  3HOV H;  1VQB A;  1Y1W H;  3RZO H;  3I7F A;  4C3I H;  4DAY B;  3F2B A;  2Q2H A;  3CCJ A;  3W1G A;  3L0O A;  1CKN A;  1QUQ A;  1Y1V H;  3S2H H;  3J7Z C;  1I3Q H;  2YYZ A;  4BY7 G;  1I50 H;  1HZA A;  1YVC A;  2OCE A;  4BY1 H;  4IOA A;  4QQB X;  4AYB E;  1TWC H;  2HQL A;  4C3J H;  3UDG A;  1HNX Q;  1IBL Q;  1VQC A;  1N32 Q;  4POF A;  3J80 c;  4HJ9 A;  1CKO A;  5JJI A;  5JJL A;  4P73 A;  3K7U C;  1Z9F A;  2VZA A;  5C0X J;  4JOI A;  2CCZ A;  4BA1 I;  1A0I A;  1K83 H;  2JA9 A;  4APV A;  1QVC A;  4X65 Q;  5GAD C;  1KAW A;  1XMQ Q;  1FGU A;  2WB1 G;  1XMO Q;  4B3M Q;  2B63 G;  1N32 L;  1SRO A;  3OYY A;  4XTC S;  1QZH A;  2QEX A;  4LF4 L;  4XIG S;  1BBU A;  2UUA L;  4JI1 Q;  1VQG A;  4X65 L;  1XMQ L;  4A76 A;  2PNH A;  4A3J G;  3S14 H;  4B3M L;  1HNW L;  2D0P A;  4OO1 G;  3KFU A;  3CCQ A;  3CC4 A;  4LF8 L;  3DLL A;  4P75 A;  3RNU A;  4X6A H;  1A8V A;  4L5Q A;  5FLX c;  1N34 Q;  4JI1 L;  2UXB L;  2NZH A;  2JEA I;  1VQA A;  4KI0 A;  1K8G A;  2Q2I A;  1LTL A;  2R7Z H;  2VQE Q;  1YI2 A;  3U58 A;  4GKK Q;  2KEN A;  5H1S E;  4A3I G;  1N34 L;  4PMW A;  4JYA Q;  3HKZ G;  1SN8 A;  1CKN B;  1QUQ B;  3BZC A;  1UE1 A;  4BBR H;  1UWV A;  4YCW A;  3L2P A;  3CF5 A;  1PH1 A;  4LUZ A;  4JI0 Q;  4LW1 A;  4OON A;  4GKK L;  1NBW A;  4LF7 L;  3RLN A;  5GRO A;  4JI5 Q;  3PO3 G;  2VNU D;  5IE8 A;  5FLM H;  4IFD J;  3CPF A;  3HOY G;  1X54 A;  1H95 A;  2GVA A;  5C3E G;  4JI8 Q;  1N33 Q;  2Z6K A;  4DK3 C;  1QVF A;  1NMG A;  4R4C A;  3STB D;  4HJA A;  4A3D H;  2AHO B;  1KQS A;  1OXU A;  1IBL L;  4NXN Q;  2Q2T A;  2MNA A;  1UEB A;  3T1Y Q;  1JJ2 A;  1M1K C;  1Q1B A;  4A3K G;  4GN5 A;  4KHZ A;  4JBK A;  4DV6 Q;  1FVI A;  1HNZ Q;  1VQE A;  5IP9 G;  4BY7 H;  2UXC Q;  4K0K Q;  1E7Z A;  1P8L A;  4YCV A;  3CC7 A;  3STB C;  1PH8 A;  3ICE A;  2OWO A;  4DV6 L;  1K0R A;  2YU9 H;  5GAG C;  1EIF A;  4QIW E;  3CC2 A;  4JI2 L;  4AIM A;  1WFQ A;  4DPG A;  4DV0 Q;  4IOC A;  3H3V H;  4K0K L;  2UXC L;  3BZK A;  1CSP A;  1OTC A;  1JB7 A;  2KCM A;  3H3V I;  4HJ7 A;  3LGJ A;  3J80 i;  4A3F G;  4DR1 Q;  5M5Y H;  4DV0 L;  4HID A;  1ASY A;  3I56 A;  3A5U A;  5JEA J;  2K5N A;  5IWA L;  3Q8D A;  2CKZ B;  3CCE A;  1GD7 A;  1I5F A;  5LMN L;  2ES2 A;  4A3C G;  4HIO A;  1BKB A;  1SRU A;  3M7N A;  1EWI A;  1DGS A;  4DAM A;  4B3T Q;  1FJG Q;  4DR1 L;  4JV5 Q;  4TVA B;  1HR0 W;  4DV4 L;  2LXK A;  2K52 A;  1Y14 B;  4O0A A;  1VQP A;  3M3Y H;  1YIJ A;  4OO1 I;  1A62 A;  3IRB A;  4GOP A;  5BR8 Q;  3GTG H;  1E1O A;  2A8V A;  1FJG L;  4LFB L;  1A63 A;  2K4K A;  4X66 Q;  1VQL A;  3GTJ H;  4LF9 Q;  2LSS A;  2R7D A;  3A0J A;  4DV7 Q;  2N3S A;  4IJL A;  5BR8 L;  4GNX C;  1K3R A;  4PZ7 A;  4X66 L;  1YJN A;  4DR7 L;  2PI2 A;  5M3F G;  4LF9 L;  1XPU A;  3AEV A;  1VQO A;  3CD6 A;  4X64 L;  3PO3 H;  4DV7 L;  2OTJ A;  2GVB A;  1N36 Q;  3OW2 A;  3EBE A;  2UXD Q;  3U50 C;  4LFC Q;  1J6Q A;  3I4O A;  4DR5 L;  1HJP A;  5M5W H;  1KXL A;  2VUM G;  4UY8 C;  2VL6 A;  2OQ0 A;  2ZTC A;  1EIY B;  4A75 A;  2R7F A;  1MJC A;  4DV5 Q;  5C44 H;  2UXD L;  2IY5 B;  2EIF A;  1EUJ A;  4LFC L;  2R93 G;  3GD7 A;  1Q1E A;  3S1R H;  4JI4 Q;  4ALP A;  1HR0 Q;  4B3S Q;  4DV3 Q;  1E3P A;  4LF5 L;  2VW9 A;  1G29 1;  4A3K H;  1VQM A;  2E5L Q;  1TWH H;  2JA6 H;  4DR6 L;  1TWA H;  1CSQ A;  4JI4 L;  2BH2 A;  2MO0 A;  1QVG A;  4BXX H;  1XNQ Q;  3HOU G;  4GOP B;  4X62 Q;  2ZTE A;  1SLJ A;  4POG A;  3GTP H;  2WB1 E;  3I4M H;  3S17 H;  3NBH B;  1FL0 A;  5GAE C;  4HIM A;  3PF5 A;  2ZJP A;  3ULJ A;  4X62 L;  5K36 G;  1C0A A;  3K81 C;  4GS3 A;  3GO5 A;  3OTO Q;  1SFO H;  2UU9 Q;  4A3F H;  4BBS H;  4YHH Q;  1XTD A;  3H0G G;  4WJ4 A;  4Y7N H;  2OTL A;  4A3C H;  3FHW A;  1KHI A;  1S40 A;  2JE6 I;  1IYJ B;  3MXN B;  3OTO L;  1LM0 A;  1PH7 A;  4JBW A;  3HKZ E;  1S3O A;  4DV1 Q;  2RHQ B;  1HNX L;  4KHP Q;  4BA2 I;  1JJG A;  2WAQ G;  3E9H A;  3F2D A;  2NN6 G;  3HFZ B;  3UDX A;  4DV2 Q;  4DR2 Q;  3J7A 5;  4DV1 L;  4KHP L;  3PCO B;  2F52 A;  3GDE A;  5M5X H;  1XMO L;  2VQF Q;  3E0E A;  5JJK A;  2R6G A;  3L7Z C;  4DV2 L;  2PQA B;  4DR2 L;  3RN5 A;  1PV4 A;  1M90 C;  5M3F H;  2JK8 A;  3KF6 A;  3AFQ A;  3I4N G;  3I2Z A;  1S72 A;  5IT9 c;  1XNR Q;  4A3E H;  3U4Z A;  3KLW A;  1WJJ A;  1KRS A;  3KF8 B;  1XPO A;  1WOC A;  1X56 A;  3KYH C;  4NB3 A;  3D0F A;  3CCM A;  3FKI G;  1XNR L;  5M3M G;  4LFA Q;  4JI6 Q;  4QJF A;  2VQE L;  4JI7 Q;  1UE7 A;  2R93 H;  1EFW A;  3TRE A;  2NVQ H;  1J5E Q;  1X55 A;  5AJ3 Q;  1GM5 A;  4JYA L;  1GVP A;  2FXQ A;  5IYD G;  1IBK Q;  4JI0 L;  1PHJ A;  2K75 A;  3B6Y A;  3GTK H;  2CFM A;  1JT8 A;  2ZTD A;  4LFA L;  3PGZ A;  3A5Z B;  4B3R Q;  3RN2 A;  1VQ6 A;  3PSI A;  1L1O C;  2IHF A;  4JI5 L;  2HHH Q;  4EQ5 A;  1X65 A;  2QA4 A;  1J5E L;  3G48 A;  5GAH C;  1TXY A;  1V43 A;  1IBK L;  3HOU H;  1N33 L;  4JI8 L;  4IO9 A;  3CCU A;  3UE0 A;  4DUZ Q;  4DKA C;  4IPC A;  1AE2 A;  3KDF A;  5IP7 H;  3RLF A;  2RCN A;  4HJ8 A;  4KLK A;  3PUZ A;  4LUV A;  4YWM A;  5IYB G;  1RL2 A;  1E22 A;  1UE6 A;  3BJU A;  1PH2 A;  4NXN L;  1I94 Q;  4L5R C;  4IFD G;  3CCR A;  1OXT A;  3CW2 C;  4DUZ L;  3T1Y L;  2IT1 A;  3K7A H;  4JBJ A;  2I5H A;  1MJE A;  3KF6 B;  2VY3 A;  1I6H H;  1PH9 A;  1I94 L;  4R4I A;  3PUY A;  3CMA A;  3H0G H;  1HNZ L;  4A3G G;  3PIP A;  1IBM Q;  2N49 A;  3NEN A;  4GN3 B;  1NJI C;  4YWK A;  4A3B G;  1K73 C;  2RHS B;  2JA8 G;  1HZB A;  5ELN A;  2E2J H;  1N8R C;  4A93 G;  4C2M H;  1VS0 A;  4AH6 A;  1IBM L;  1B70 B;  2B63 H;  1YHQ A;  4GKJ Q;  1SMX A;  3A74 A;  3KJP A;  1YNX A;  3G6E A;  3PO2 G;  1QZG A;  1VCI A;  1WCM G;  1Q81 C;  3GTM H;  2NN6 I;  1LYL A;  1JJC B;  4A3J H;  3CXC A;  1VQ9 A;  2V1C C;  4DUY Q;  3PF4 A;  3UE1 A;  4GKJ L;  1PYS B;  2BH8 A;  3JC6 6;  3F1Z A;  5FJ8 G;  2YTV A;  3HOW G;  3KDF B;  1Q46 A;  1N9W A;  3GTL H;  4GOP C;  3HOV G;  1R9T H;  4A3M G;  4DUY L;  3I4N H;  1Y1W G;  4B3T L;  2F3I A;  4JV5 L;  2PI2 E;  2KHJ A;  1PH5 A;  1TWG H;  1Z47 A;  4A3I H;  1Q82 C;  2EXD A;  5JEA G;  3FKI H;  2WFW A;  4QL5 A;  3HOZ G;  3CCL A;  1EOV A;  2NZO A;  1MKH A;  1W3S A;  1OXV A;  2F4V Q;  1HNW Q;  1BBW A;  4LUO A;  2Q2U A;  3MEF A;  2ASB A;  3HOY H;  1U5K A;  2A1A A;  5IYD H;  2E2I H;  4PZ6 A;  5C3E H;  2YV5 A;  3ULP A;  3UDI A;  1AE3 A;  1WYD A;  4MTN A;  4R4T A;  4TQU S;  3SGI A;  1JMC A;  2AWN A;  4R1J A;  2UXB Q;  1U0L A;  1N36 L;  4JI3 Q;  3M4Q A;  2GN5 A;  2IX1 A;  2ID0 A;  3CCS A;  1CKM A;  1B8A A;  1NTG A;  5HGQ A;  5IYB H;  3TS0 A;  4LF6 Q;  2K50 A;  4DV5 L;  3T1H Q;  1X6O A;  4YY3 Q;  4GNX A;  4IPD A;  2PMZ E;  2I5L X;  1HZC A;  4MNO A;  5DLQ E;  1Q12 A;  3J81 c;  4O2D A;  1VQJ A;  1HR0 L;  4B3S L;  5IP9 H;  4DV3 L;  4IFD I;  1P16 A;  2E5L L;  2PQA A;  2WAQ E;  1GKH A;  2R7Z G;  1PVO A;  3BU2 A;  1VQH A;  1PFS A;  2Y0S G;  2ZM6 Q;  1XNQ L;  3S24 A;  2JA5 G;  4LWC A;  3K0X A;  4A93 H;  3RLO A;  2I5M X;  3PV0 A;  2ZM6 L;  2EQS A;  3PO2 H;  3CCV A;  1PH3 A;  1VQK A;  1WCM H;  1GO3 E;  3ER0 A;  1C7Y A;  1Q86 C;  2N8N A;  1X3F A;  1E1T A;  2MO1 A;  4L5S A;  1SE8 A;  4IPG A;  1VQ7 A;  2UU9 L;  3TQY A;  4JOI C;  1VQI A;  2ALY B;  4YHH L;  3G4S A;  1D7Q A;  5FJ8 H;  3NEL A;  3J81 j;  4HJ5 A;  3S1Q H;  3RR5 A;  2C35 B;  1VQ5 A;  4FDB A;  1E24 A;  3AFP A;  3GTQ H;  5ELO A;  2KCT A;  4GNX B;  2JEB I;  3S1M H;  1B7Y B;  1EQQ A;  2RF4 A;  1YHA A;  1IZ6 A;  3TEH B;  3PUV A;  4L5T A;  1VQ4 A;  4H02 A;  4GLA C;  1KL9 A;  3HOZ H;  1NE3 A;  4PZ8 A;  1YBY A;  2QGQ A;  3H15 A;  1Q8K A;  5C0X G;  1KIX A;  2VQF L;  1PA6 A;  4UP8 A;  2AWO A;  1ASZ A;  1BVS A;  2BA1 A;  4LF4 Q;  5IYC G;  3F2C A;  2YTX A;  2UUA Q;  2NVT H;  2VUM H;  3CQZ H;  1YZ6 A;  1NMF A;  2HIX A;  4NPS A;  4LNQ A;  4LF8 Q;  2MFI A;  3ERS X;  3AYH B;  4OWT B;  4ME3 A;  5C4X G;  4J15 A;  2HT1 A;  4R4Q A;  1OXX K;  1YEZ A;  2JQO A;  1Q7Y C;  3JAM i;  2ZJR A;  3PIO A;  2B3G A;  3M9B A;  1IXR A;  2Z6K C;  4JI6 L;  4JI7 L;  3U4V A;  4OWX B;  1D8L A;  5EAY A;  5AJ3 L;  1VQN A;  4AYB G;  4DR3 Q;  1K8A C;  1PH4 A;  4GN4 B;  3WWV A;  1VQ8 A;  4UPA A;  4Y52 H;  1AH9 A;  4B3R L;  3PUW A;  4LF7 Q;  4RG1 A;  3J81 i;  3D31 A;  2JA7 G;  4DR3 L;  2VS1 A;  2JA5 H;  4EX5 A;  3M4P A;  4JC0 A;  4YWL A;  2KBN A;  4DK6 C;  1TWF H;  2NVX H;  3S16 H;  2IX0 A;  3PUX A;  1VQD A;  5LMN W;  2ATW A;  1YJ9 A;  1XPR A;  4A3L G;  4R4O A;  3HKS A;  1YIT A;  2K5V A;  1YJW A;  2N78 A;  2A19 A;  4DR4 Q;  1L1O A;  1CUK A;  3EN2 A;  5E7N A;  3W5O A;  5C44 G;  1O7I A;  4GLX A;  2B29 A;  2UUB Q;  4DR4 L;  3G71 A;  2YTY A;  1UE5 A;  2WP8 J;  3I55 A;  1YHB A;  2CQO A;  1EQR A;  1V1Q A;  2D62 A;  2LXJ A;  3KJO A;  2UUB L;  2JA6 G;  2E8G A;  4C3H H;  1IL2 A;  5HY6 A;  4JI2 Q;  2HHH L;  3TRZ A;  1EYG A;  4BXX G;  3HOX G;  4P71 A;  1KRT A;  2R92 G;  3AQQ A;  5LMU Q;  3I4M G;  2Z0S A;  1XJV A;  1RIP A;  2OQK A;  1W2B A;  4UP9 A;  2I0Q A;  2XGT A;  3FP9 A;  5IYC H;  1PYB A;  4RMF A;  5C0X I;  5LMU L;  5IWA Q;  5LMN Q;  4QGU A;  4YCU A;  4JCV E;  1Y1V G;  1T9H A;  5M3M H;  3ZJY C;  1SR3 A;  1X3G A;  4BY1 G;  3S2D H;  1X3E A;  4BBS G;  4DV4 Q;  5C4X H;  2CWP A;  2L15 A;  1PH6 A;  1KC8 C;  4PG3 A;  1L0W A;  1L1O B;  1C9O A;  3CME A;  1L2F A;  3CAM A;  2E2H H;  1V9P A;  2NVY H;  4LFB Q;  3GTO H;  2Y0S E;  2CWA A;  1OXS C;  1K9M C;  4NXM Q;  3JAM c;  2F4V L;  3CP0 A;  4WJ3 M;  4JBM A;  2AMC B;  3VDY A;  5C4J H;  1KD1 C;  4MZ9 A;  4DNI A;  3E9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...