4JI4L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLLGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji4L00
4JI3L 1RL2A 5IYDG 1HR0W 1OXVA 1HZBA 2KHIA 2IHFA 3ER0A 2HT1A 2ATWA 1SE8A 4JI4L 4GKJQ 2K5HA 1VQBA 1C9OA 2VY3A 5GAHC 4DUZQ 5C3EH 4OO1G 1YEZA 1Q1EA 1XMQL 1LYLA 4A3LH 1TWFH 3FHWA 1M1KC 4DV5L 1TWHH 1X56A 5JEAJ 2OQKA 4YHHQ 4X65L 4JV5Q 2MO0A 3EN2A 5FLMH 1WFQA 1K73C 5IT9c 5JJKA 2RHSB 2VUMH 2YYZA 2WP8J 2MNAA 1IL2A 4JOIA 4LF5Q 4A3EH 2ID0A 1K3RA 2ZJRA 3J80i 5GADC 4C2MH 2IY5B 3F8TA 4JC0A 3JAMc 2PI2A 4YCUA 1FJGL 4QL5A 5IP7H 3AFPA 3J7A5 3S2DH 1AE3A 1CKMA 2LSSA 5C4XH 4A3CG 3A0JA 4PZ8A 2UU9L 5C44G 2JA7G 1V9PA 5EAYA 2UUAL 4GKKQ 1N32Q 4X66Q 2R93G 3CQZH 1PH9A 3D0FA 2NVQH 1YHBA 2YU9H 4OWWB 2WFWA 2IX1A 1EIFA 5IWAQ 1MIUA 3CC2A 4A3IH 2JQOA 5C3EG 3KOJA 3U58A 3NBHB 1HH2P 4P74A 1N36L 1KHIA 1OXTA 4LNQA 4DV1L 4BXXH 3KLWA 2N49A 4LF7Q 2R7FA 2EIFA 3F2DA 4DR5L 4P75A 2E8GA 2AKWB 3A74A 3DM3A 1NE3A 2K50A 4OXPA 3RZDH 3W5OA 3ULJA 4LFAL 2ASBA 3FP9A 1NY4A 2I5MX 4B3TL 1EQRA 4A76A 2HQLA 4TQUS 5IY0A 3AEVA 3HOUG 2UXDQ 4DV7Q 1CKOA 2ZJQA 3KF6B 1IBMQ 4QQBX 3CMEA 1NBWA 3S1RH 5C44H 1S40A 5LMNQ 4OWXB 1UWVA 3H0GH 2VQFQ 4HIKA 3M9BA 4L5TA 3M7NA 2K14A 3KF6A 3PGZA 3G71A 4IJHA 3VDYA 4P73A 1VQOA 2B63H 4DPGA 3GTLH 2JA8H 4R4IA 4IPHA 3K7UC 1MKHA 2K5NA 2K4KA 2E2IH 1I3QH 3KF8B 4DV6Q 4A93H 4XTCS 1Q8KA 1EIYB 2I5HA 1YVCA 1IBKQ 3ULLA 3GTQH 1V1QA 2JA9A 1E3PA 3RLFA 1XJVA 1PH7A 1KC8C 3S17H 4NXML 5FJ8G 2ZTDA 3PO2G 4L5SA 4AQYQ 2E5LQ 1OTCA 1LUZA 1GVPA 1G291 3IRBA 3CCQA 4A4IA 2LXKA 4JBWA 4A3DH 1IBLL 3CCRA 4DV0L 4PZ6A 1VQJA 1Z9FA 2N78A 4LWCA 5IYCG 3S14H 4BBRG 3T1HQ 3GO5A 2YTXA 5M3FG 3Q8DA 3CCMA 1VQCA 2NZOA 4GS3A 2JJQA 3T1HL 3RLNA 3U4VA 4DR2L 3H0GG 4JI7L 4DR7L 4JI2L 5IYDH 3HOVG 1PYSB 4B3TQ 3CD6A 2WB1E 4DV0Q 4LF7L 1EUJA 4DV2Q 2AWOA 3CPWA 1KIXA 1K8AC 4ME3A 4YHHL 1Y1WG 1JJ2A 1VQ6A 3KFUA 4RG1A 2Y0SE 3PO2H 4A3JG 3GTMH 1PVOA 1EWIA 4IPDA 4POGA 3A5ZB 1SN8A 2RF4A 4O0AA 4GLXA 1HR0Q 4BY7H 4GLVB 3TQYA 1U5KA 1VCIA 4GOPA 3NELA 3G48A 2R92G 4OWTB 2Z0SA 2K75A 4JI2Q 5LMUQ 3CMAA 3E9HA 2F4VQ 4QGUA 2UU9Q 1WCMH 2R7DA 3PIPA 2UXDL 4RMFA 4NPSA 1JJCB 3S2HH 4C3HH 1IBML 4AYBG 4OONA 3HOZG 3HOZH 2JA7H 2N8NA 4R1JA 4DV7L 1EYGA 3J81c 1IBLQ 1WCMG 4B3RQ 1JB7A 2A19A 1HNXQ 1NTGA 1BBWA 3I55A 1Y14B 2D0OA 1N34L 1XNQL 4Y52H 2MQHA 3CCUA 4BBSG 4A3EG 3CCVA 2HHHL 3H15A 3UDIA 5GAEC 1HJPA 3CW2C 2ZM6Q 3S16H 2PQAA 2ZTCA 5FLMG 4A3JH 1N36Q 2EQSA 3K0XA 4DV3L 1K0RA 4JYAQ 5GROA 4WJ3M 2WAQE 4NXNQ 1FL0A 3U50C 4K0KQ 1NMGA 1YBYA 4GNXA 3I4MG 5HY6A 3EBEA 4LUVA 1UE5A 3UDXA 1N33Q 4OO1I 5BR8Q 5H1SE 2R93H 1VQKA 4JBMA 4GNXB 2KCMA 1X55A 2Z6KA 1L1OA 5ELOA 1VQPA 1Q81C 1J5EQ 4LW1A 1HNZL 5K36G 3GTPH 1UE1A 3T1YQ 3HOXH 3KJOA 2AMCB 3J81i 1VQ4A 4LF5L 3TS2A 3PUVA 4DV4L 1ASYA 2OTLA 3BZCA 5IP7G 1Q7YC 1I6HH 1A63A 1AH9A 1UE6A 4LF8L 4GLAC 1CKNA 2HHHQ 2JE6I 2UUCL 4HIOA 2JA5H 2BH8A 4DAMA 4JG2A 2CFMA 3ZJYC 3HFZB 3CC7A 3HKZE 4DK3C 4DR1Q 1SROA 2VUMG 1M90C 4NXMQ 2A8VA 1YJNA 4KLKA 1PH4A 2I0QA 3OTOQ 5JJLA 4DV5Q 3UDGA 3UDFA 1VQ5A 2UUCQ 4GKJL 3K81C 2JA6G 5IWAL 3M85A 1HZAA 2DGYA 1YI2A 1NJIC 4A93G 2YTVA 3B6YA 1G51A 2UXBL 3J80c 4JI3Q 3OW2A 2XTIA 1XMOQ 1QUQA 1Z47A 1R9TH 2ES2A 4B3SL 2B63G 2PQAB 4GN5A 5IYBH 1E7ZA 1C0AA 3S1NH 2HIVA 4HJ9A 1JT8A 4JOIC 2VL6A 1TWAH 1HR0L 1BKBA 1X65A 3I56A 3CF5A 4IPGA 1N33L 1X3GA 3GDEA 3AQQA 4UP8A 1MJCA 4KHPL 4B3ML 1L1OB 1X54A 3G6EA 1QZHA 3CCLA 3DLLA 1N9WA 3KJPA 4JYAL 1JJGA 3JC66 1CSQA 5ELNA 3BJUA 4AYBE 4DR1L 2JA5G 4L5RC 2BA0A 5C0XI 3CAMA 1XTDA 2NZHA 1Y1VH 4IO9A 3MEFA 3PCOB 4YWLA 4EX5A 4P71A 1PH1A 4JI5Q 1XNRL 3D31A 2BA1A 4BXXG 3S1QH 1KXLA 1P8LA 1E22A 1X3EA 3S24A 4JI4Q 1CSPA 4DNIA 1QZGA 3ERSX 3T1YL 1XPRA 2YTYA 5M3FH 4DAYB 1W3SA 4IFDJ 1GO3E 4X64Q 3LGJA 5LMNW 3TS0A 5IYCH 4A3IG 1B70B 1VQ7A 2UXCQ 2Z6KC 1X9NA 1J6QA 4KHZA 5BR8L 5AJ3Q 3NEMA 2MFIA 5JJIA 3WWVA 3EIVA 5AJ3L 5LMUL 4JI1L 3CP0A 4YY3L 1CKNB 1VQAA 4NXNL 1S3OA 4AH6A 5C4XG 2UUBQ 3KYHC 1XPOA 3STBC 2D0PA 1UE7A 2VQEQ 2L15A 2VNUD 2IHEA 4C3JH 1VQ9A 3HKZG 2UXBQ 2GVAA 1SLJA 4BBSH 3PUWA 4B3SQ 3H3VI 1VQ8A 2GVBA 3I2ZA 2VQFL 1WOCA 1NMFA 1JE5A 3PUXA 4IPCA 4HJ5A 4LF8Q 4IJLA 1KRTA 3HOYH 4J15A 4LF6L 2CKZB 3K80C 4YCVA 3CC4A 2ZTEA 3G4SA 1OXUA 2NN6I 1E1OA 1PH2A 1I94Q 1BBUA 2MO1A 4B3MQ 2JK8A 1B7YB 2GN5A 3TRZA 2VS1A 1XPUA 4DR6Q 4X6AH 4DR2Q 1GKHA 4JI7Q 4R4QA 2QA4A 5FLXc 1ASZA 4BA2I 4A3MH 1I5FA 1KQSA 2F4VL 2OTJA 3L7ZC 1HZCA 3F2CA 1OXSC 4DR5Q 5GQOA 4JI8Q 2ZJPA 4JI6Q 2B3GA 4YWKA 3M4OH 1A62A 3M4PA 5DLQE 1PH8A 1L2FA 5IP9H 3HKSA 1L0WA 5M5XH 1HNZQ 2LXJA 1Q46A 1GD7A 4K0KL 5C0XG 3TREA 2D62A 4IFDI 2IX0A 2K52A 4L5QA 4DUYL 2CQOA 3RN2A 2OWOA 4FDBA 4LF9Q 3AYHB 3GTKH 3HOYG 3PO3H 1FVIA 3PIOA 3E0EA 1IYJB 2VZAA 1PHJA 4Y7NH 4PMWA 3KDFB 4B3RL 4DV2L 1LTLA 2PI2E 3CPFA 1C7YA 4DR7Q 2OCEA 4BA1I 1YZ6A 4BBRH 1PYBA 3MXNB 1N34Q 1XNQQ 3J81j 4DR3Q 3E9IA 1P16A 2N3SA 3W1BA 4BY7G 2WAQG 2B29A 2JA6H 1QVGA 1IZ6A 3KDFA 4A3KG 1J5EL 3S1MH 4A3BG 4MZ9A 2F52A 4AQYL 2YV5A 1I50H 4A3KH 3UE1A 1Q82C 3M3YH 1SMXA 2E5LL 5C0XJ 3H3VH 2JA8G 1SFOH 4DV6L 2RCNA 3NENA 1GM5A 3K7AH 1PH5A 4LUOA 1RIPA 1D8LA 2H5XA 3GTJH 4PZ7A 3TEHB 5JEAG 2HIXA 2VW9A 1PFSA 2ALYB 3HOVH 1AE2A 1H95A 4AIMA 4DKAC 4DUYQ 1VQLA 3K8AA 1PA6A 1WI5A 4O2DA 4HJ7A 4LFCL 1SR3A 4GN3B 4P72A 4JI8L 4JI6L 3RZOH 3GD7A 1HNWL 2IT1A 1N32L 4UP9A 1TWCH 2C35B 5LMNL 2E2HH 4GOPB 1QVFA 1I94L 4A3DG 2AHOB 1YHQA 4DR6L 3U4ZA 2CCZA 4X64L 4JCVE 1Q12A 4JI0Q 1JMCA 3HOWH 4GNXC 1WYDA 3PUZA 1X3FA 1N8RC 4A3FG 2BH2A 3UE0A 4OX9Q 2Y0SG 4DK6C 2EXDA 4A3MG 1A0IA 1O7IA 5GAGC 4PG3A 4BY1G 1TWGH 1KRSA 1WJJA 1D7QA 2R7ZH 5IYBG 4JV5L 3CCSA 1E1TA 1FGUA 1QVCA 1DGSA 2KHJA 2Q2IA 4GOPC 1YITA 4DV1Q 4UP7A 4QY7A 4QIWE 5IE8A 1T9HA 2NVXH 4LF9L 3I4NH 3I4NG 4UPAA 4IOCA 1MJEA 2KCTA 1IBKL 4JBKA 4KHPQ 4WJ4A 2QEXA 1VQFA 4A3CH 2Q2UA 3HOUH 4A3GG 2KBNA 3CCEA 1Q86C 3RNUA 3CXCA 4ALPA 1UEBA 1PH3A 2Q2TA 1PH6A 4IOAA 1G6PA 1A8VA 3F1ZA 5IP9G 4OX9L 4YWMA 4UY8C 1KAWA 3PUYA 1EFWA 1K8GA 4DR3L 5C4JH 3I4OA 1QUQB 4TVAB 1YIJA 2NVYH 2A1AA 1W2BA 1K83H 3RLOA 1HZ9A 4LUZA 4JI5L 1YHAA 3L2PA 3HOXG 4JI0L 2QGQA 5E7NA 1XNRQ 4LFBL 2RHQB 1U0LA 3OTOL 4KI0A 2CWAA 1BVSA 1S72A 4EQ5A 1SRUA 1VQGA 1Y1WH 2V1CC 3S15H 1B8AA 4R4CA 1K9MC 4A3LG 3SGIA 1X6OA 1YJWA 1Q1BA 3ULPA 4MTNA 4X65Q 2KENA 3JAMi 3BZKA 4HJAA 1E24A 3RR5A 3I4MH 2XGTA 4APVA 4MNOA 2JEAI 2AWNA 4R4OA 3RN5A 3PV0A 4DUZL 3AFQA 2UUAQ 4XIGS 1IXRA 1Y1VG 1VQDA 4LF4L 2VQEL 3STBD 1YJ9A 3A5UA 3ICEA 3BU2A 1XMOL 2WB1G 1KL9A 3PF5A 4YCWA 4JI1Q 1YNXA 4YY3Q 4A3GH 1VQMA 5FJ8H 4DR4L 1LM0A 2PNHA 4X66L 1PV4A 4GKKL 2Q2HA 4QJFA 4A3BH 1VS0A 1VQHA 5J3BA 2K5VA 3OYYA 4H02A 2UXCL 2PMZE 1KD1C 1OXXK 2ZM6L 4LF6Q 1VQEA 4LFAQ 2JEBI 3GTGH 2NN6G 3FKIG 3F2BA 3FKIH 3HOWG 2R7ZG 2E2JH 4HJ8A 3PSIA 2R92H 1EOVA 4C3IH 3CCJA 1XMQQ 4BY1H 2FXQA 3GTOH 4GN4B 1VQIA 4DV4Q 4A3FH 3PO3G 5M5WH 1VQNA 3L0OA 2F3IA 4A75A 1HNXL 5HGQA 3PF4A 2CWPA 5M3MG 2OQ0A 2I5LX 4JBJA 1EQQA 2NVTH 2R6GA 2UUBL 4HIDA 4LFBQ 1L1OC 4DR4Q 4NB3A 4X62Q 5M5YH 1TXYA 2DUDA 1CUKA 3I7FA 4IFDG 4R4TA 4X62L 1HNWQ 3M4QA 3W1GA 5M3MH 4POFA 4LFCQ 4HIMA 3J7ZC 4DV3Q 4LF4Q 1FJGQ 1V43A
chains in the Genus database with same CATH superfamily
4JI3L 5IGCA 2MUYA 3VYSA 2IHFA 4PMCA 4FP5D 4OO1G 4DUZQ 5C3EH 3GP7A 2TSSA 1PFMA 3CU7A 2EE1A 5EKIA 3U9OA 1D5XC 3DHQA 2DJFC 2DY8A 1EQVA 2KUMA 4ZQ3A 5JJKA 2RHSB 2VUMH 2XVSA 1IL2A 4LF5Q 4A3EH 2NZ1D 3D4WA 1DCZA 3F8TA 2RDGA 1K8OA 2PI2A 4YCUA 1FJGL 1S5BD 5IP7H 3AFPA 4DGZA 1V9PA 2IX1A 1HUMA 3CRKC 3H09A 3IKJA 5C3EG 3KOJA 2Q8TA 3U58A 2JSOA 4P74A 1O7YA 4DV1L 3GTJB 4LNQA 4OIKA 4B9WA 4BXXH 1QNUA 2IWHA 1JWSD 2CW0D 2AKWB 1SMYD 3A74A 1B3QA 1NE3A 3RZDH 4LFAL 2ASBA 3ULJA 4I7AA 1NY4A 2I5MX 3H6MA 4B3TL 3TP5A 2B2VC 1EQRA 4I7ZC 1NR2A 2HQLA 3AEVA 3NQTA 3HOUG 2UXDQ 1CKOA 2R93B 1NBWA 4DXFA 1I4PA 3QO2A 5LMNQ 4OWXB 3H0GH 1EZ6A 3TDQA 3M9BA 4RGOS 1ICFB 4ZCKA 5JAVA 4CDCC 5C6AA 3G71A 4H0LC 4IJHA 2B63H 2B2YC 3GTLH 1WTWA 3K7UC 1MKHA 1H9MA 1STNA 2E2IH 3KF8B 3C46A 2CVRA 1IBKQ 3ULLA 1PH7A 1XJVA 1PZID 1OTCA 1LUZA 4L63B 3NHHA 3IL8A 3CCRA 4RKLA 4LWCA 1RCVD 2YTXA 3P20A 4GZYC 2F4IA 2JJQA 3E5SA 4GS3A 3HOXB 3H0GG 2F0UA 5IYDH 3QWNA 3HOVG 1F2MA 1PYSB 4B3TQ 4F7XA 3ZYYX 2LMCB 1EUJA 5C4HA 1KIXA 4YHHL 1Y1WG 1JJ2A 3D4DA 4RG1A 1T5EA 2Y0SE 1BUVT 2KQ3A 3PO2H 1HXYD 2CW0C 2F1MA 1MD2D 1SN8A 4BY7H 1E0BA 1SJED 4GOPA 2R92G 2B2UA 5AFWA 1Q8IA 3E9HA 3C3LA 1BBXC 2UXDL 1IBML 1TR5A 1AW7A 3HOZG 1EY6A 2N8NA 2L0CA 4N9PA 1IBLQ 4WORA 1WCMG 1NTGA 3I55A 1Y14B 1B53A 2WINB 2B2YA 3MC0B 4DXGA 5EJWA 2K28A 1DD2A 4A3EG 2B2TA 4BY1B 5GAEC 1X3PA 2EQSA 4DV3L 5K5PA 1CQFA 2AQ2B 4K0KQ 3J80E 4LUVA 1UE5A 3UDXA 2DJGC 5A2QE 5I4DA 3KLSA 1GXDC 5ELOA 1VQPA 3HOWB 1A6XA 4QUCA 4LF5L 5LL6X 1ASYA 5IP7G 5KRUA 2ZXPA 1JWUD 4BBSB 2JE6I 2UUCL 2WACA 4HIOA 4DAMA 4JG2A 3SHLA 5KNBA 2MP1A 4C56C 2VUMG 4XT1B 5ELBA 1SYBA 5JJLA 4DV5Q 3FVQA 3CRLC 3K81C 5IWAL 2DGYA 2XNAC 4A93G 3NWTA 5KGUA 3J80c 3OW2A 1XMOQ 1R9TH 4JI3Q 4A3EB 2PQAB 5IYBH 1E7ZA 1JT8A 4A3MB 3OMGA 1R4PB 4N9TA 1HCZA 1TWAH 1WCMB 1X65A 3CF5A 2IX3A 3HRZC 4DF7A 2LS01 2VB3X 1N33L 4UP8A 3HOZB 4IURA 1BQQT 2K5QA 1L1OB 1X54A 1FYCA 3NUCA 3G6EA 3CCLA 3DLLA 1ZEQX 4HR7B 3BJUA 4ZRZA 1PTOF 1Z7TA 2B2TC 4ABNA 4RGTA 1Y1VH 3MEFA 2I07B 3G6JB 1PH1A 2SNMA 1PZKD 3D31A 1E22A 3L3OC 3NTKA 4DNIA 3OOCA 4BBRB 1G2SA 3T1YL 1XPRA 5M3FH 3RZDB 4G7ZC 4IUNA 4A3IG 3ONAB 1WD0A 2Z6KC 1X9NA 4O1NA 1RF2D 2Z9HA 1G2TA 3WWVA 1UUPA 3EIVA 1E2ZA 3VA7A 1CKNB 4ULLA 4NXNL 5C4XG 2D0PA 3H0GB 4KK7A 1PTOB 2JXMB 2GVAA 3MFYA 1CM9A 3DM1A 3PUWA 4ZLTF 3GTLB 3GTOB 1JCKB 4HCSA 2MGSA 3A54A 3PUXA 4IPCA 4LF8Q 1KRTA 4HSPA 5K36H 4J15A 1TWCB 4XDXA 1KABA 1KLUD 3K0YA 1I94Q 4B3MQ 2JK8A 1B7YB 3TRZA 4DR6Q 4JI7Q 1H9SA 4R4QA 2Z6BA 2QA4A 1HUNA 4BA2I 1KQSA 2F4VL 2C5CA 1HZCA 2H4OA 3F2CA 2QEJC 4JI6Q 2B3GA 3M4PA 1I4HA 1L2FA 4IFDH 2HD3A 5CV4A 2H1EA 5FO8B 1DXMA 2IX0A 2K52A 1ZYRC 3RN2A 1RD9D 3AYHB 2BE5D 3E0EA 1GUGA 4PMWA 3KDFB 4Y7NH 2PI2E 4HEDA 1SNCA 3CPFA 2L11A 4P2CB 4RFBA 5J22A 3MXNB 4C2MB 1EY9A 3E9IA 1P16A 1O78A 1YNND 1VMPA 5C4JB 1PTOC 2HCIA 1J5EL 5FLXL 4JK1C 1BF4A 3TBIB 1BR9A 1CHQD 3NQIA 1SFOH 1PRTC 1L0XB 2RDFA 2RCNA 3HKZB 1RIPA 5JEAG 2HIXA 1PFSA 5EBCA 1X32A 3MXPA 1AE2A 1H95A 5KIXA 4DUYQ 3K8AA 1DONA 1PA6A 1CA5A 4JI8L 4P72A 3H3VC 3GD7A 1DZ1A 4GOPB 1NCVA 1I94L 2F3WA 3NTHA 1CQVA 1EEFD 2EPBA 1JMCA 3HOWH 4DNTB 2QDBA 4GNXC 3PUZA 3J81L 2EJMA 4OX9Q 2Y0SG 1O7IA 5GAGC 4F87A 2JN4A 3BYYB 1BCPF 2PO4A 1KRSA 4I65A 2VXWA 3PIO3 4FF2A 2Q2IA 1YITA 4DV1Q 5IE8A 3BVMA 4R9WA 1RJTA 2FFKB 4LF9L 3GTKB 4UPAA 2KCTA 1IBKL 4WJ4A 2EY6A 2QEXA 3CCEA 5C0XH 3RNUA 1D2BA 1WD1A 1PH3A 5ELCA 2Q2TA 1A8VA 2F0EA 1HQMC 4OX9L 4YWMA 4UY8C 1AEXA 2XN9C 3I4OA 4TVAB 3SEBA 4LUZA 4JI5L 1YHAA 1XNRQ 3S1MB 4LFBL 5E7NA 1U0LA 4KI0A 1BVSA 1AFPA 1Q90A 4EQ5A 5F2DA 4X3TA 4A3LG 4HAEA 3SGIA 5E4XA 1Q1BA 3AU7A 3ULPA 3WOFA 4U68A 3BZKA 4HJAA 3I4MH 3GTMB 2F0TA 4K14A 3K59A 5BN5A 2NWGA 3PV0A 1CT1D 4DUZL 3VYRA 1LT6D 1J9OA 4ZUJA 1BXTA 4ZKBB 3K57A 1IHZA 4CGYB 3I70A 4JI1Q 1LM0A 3T13A 1VQHA 5J3BA 3V96A 4KN7C 4RWSC 4OELB 1Y8OB 2CH4A 2F0IA 3T4AC 2NN6G 4EGVA 3FKIG 2R7ZG 2E2JH 3PSIA 2Y0SB 1EOVA 1A2TA 3SE0A 4GN4B 4DV4Q 5M5WH 2A69D 1VQNA 1AZPA 5HGQA 5M3MG 2OQ0A 3MVVA 4JBJA 4EVOA 3HOYB 2NVTH 5FO9B 4HIDA 4X62Q 5M5YH 4IFDG 1HNWQ 2EXZA 3A8JE 3W1GA 3J7ZC 4DV3Q 1U4MA 2AQ3B 1RL2A 3IFTA 2NVYB 3ER0A 5L37A 4XQJA 2ATWA 2HT1A 2K5HA 2VY3A 5GAHC 4FF3A 3EA6A 1TWHH 1X56A 3OIQA 4JV5Q 2F0OA 1TT2A 2WKCA 2L1BA 1IW7C 4EQPA 3R2IA 2WKDA 4K5XA 2ZJRA 3J80i 4HN7A 4IUVA 1A3TA 3S2DH 4A3CG 2LSSA 4FXGC 5C44G 2JA7G 2UUAL 3VR4A 1PXUA 2D2CC 4C3HG 4X66Q 3J7YW 2NVQH 1N32Q 1WTPA 1EIFA 5EPKA 1MIUA 1PRTB 3CC2A 4A3IH 3KK7A 1HPCA 1SYFA 2DY7A 1II3A 1KHIA 1OXTA 1EWHA 1DOKA 3P75A 1I4RA 4K5WA 1SE2A 2R7FA 2DNCA 2E8GA 5IGGA 3W5OA 5LHY1 2DN8A 1KAAA 1GUNA 1SE3A 1KNAA 1BCPC 2ZJQA 2K05A 4QQBX 5M3MB 5C4ZA 1BOSA 5IGFA 4L5TA 3M7NA 3KF6A 3PGZA 2A5HA 3VDYA 1LACA 2J0TD 4DN4M 4DPGA 2JA8H 2I0QA 1CI3M 4XTCS 5KEEA 1EIYB 2I5HA 1YVCA 4K2LA 1BNZA 1YNJD 1V1QA 3SR1A 3QR8A 1TIID 1KC8C 3TN2A 4NXML 3M4YA 2E5LQ 3IRBA 3CCQA 1G291 2EY2A 2KCCA 4DV0L 2N78A 3T16A 4BBRG 5CR3A 5NUCA 5M3FG 3FPUB 3T1HL 3U4VA 4DR2L 2X69A 3BYTB 3E0JA 2J4XA 2WB1E 4DV0Q 2RDHA 4M1UB 4LF7L 3IAYA 2YU9B 2AWOA 1VQ6A 3V2TA 5DNFA 3MAQA 3I4MB 2A68C 4A3JG 3GTMH 3PO3B 1PVOA 5FKAC 1HR0Q 3ND9A 4GLVB 3TQYA 1VCIA 3NELA 4J8QA 2QF7A 4OWTB 4UHVA 2F4VQ 2UU9Q 1WCMH 3PIPA 1EYAA 5E1FA 4NPSA 4C3HH 4AYBG 3HOZH 3VR2A 4R1JA 4DV7L 2I46A 1U4RA 3D4RA 1STAA 1BBWA 2D0OA 1N34L 1XNQL 4Y52H 1UNSA 2MQHA 4BBSG 2A6EC 3CCVA 2XIWA 1LV9A 2HHHL 1V1PB 2E2IB 4RCNA 5M5WB 4OEMB 1PZJD 1K0RA 2WAQE 4NXNQ 2AUJD 1NMGA 1YBYA 2RVLA 5HY6A 2Q8IB 1S4ZA 3GV6A 5H1SE 1VQKA 4GNXB 2NYZD 5IIFA 1ILQA 1QCBD 1HNZL 1GHKA 1LTID 3GTPH 4G7OC 3HOXH 2ZXRA 5JPNC 2AMCB 2KOLA 2GA4B 1AH9A 3BZCA 3R8BA 3LX0A 4KMUC 4GLAC 1CKNA 1IL8A 2BH8A 3ZJYC 3EQLC 4RKBA 5IT9L 3HFZB 4DK3C 1M90C 4KY6A 3I4NB 5ISRA 3OMCA 2A6HC 4KLKA 3PO2B 3OTOQ 4CJ2C 1B50A 4GKJL 3M85A 2OXPA 2XTIA 3SK8A 1QUQA 1F9QA 1Z47A 1C0AA 4X6AH 2O2LD 1CFMA 2EYMA 3W3AA 4HJ9A 4Q5VA 4JOIC 2EDGA 2B39A 1I4XA 1BKBA 3GDEA 2K32A 1FNVA 1R4QB 1RODA 4KHPL 1Y1WB 3JC66 1CSQA 2N88A 3CAMA 1K8MA 1ZKOA 1NUCA 4EX5A 3BS1A 1CK1A 1GOZA 1D5MC 2PZUA 1CSPA 3S24A 3K5NA 1E2VA 4ZYSA 1GO3E 2UXCQ 5LMNW 3TS0A 1VQ7A 3BVGA 4KHZA 2Z4HA 2MFIA 1U9RA 2G9DA 4L8JA 4IN3A 2B2VA 3SK6A 5AJ3L 4A3KB 4JI1L 2UUBQ 3KYHC 1XPOA 1SFOB 4F8MA 2VNUD 2IHEA 2O4XA 3K7AB 4IZ8A 4B3SQ 3H3VI 1F9PA 3C1EA 5CC4A 1K28A 2R61A 3I2ZA 1RTOA 1WOCA 1NMFA 4IJLA 5CORA 3A7AB 2CKZB 2ZTEA 3G4SA 1TQOA 2PW7A 1BBUA 2PPBC 5CV9A 1XPUA 1GKHA 3JAML 5EQ0A 5FLXc 1D5ZC 2OTJA 1I5FA 4L6TB 1G8ZD 4K6DA 4KKTA 5IGDA 1OXSC 4DR5Q 4ME5A 2ZJPA 3M4OH 4YWKA 1A62A 1PH8A 3ND8A 4JW0A 2EY1A 2L55A 1HA6A 1Q46A 1GD7A 2F3VA 4K0KL 4K5VA 5C0XG 3TREA 2D62A 3RUZA 3TP8A 2CQOA 2E74C 3H91A 4FDBA 4WFN3 1F9RA 3PO3H 1FVIA 1IYJB 4B3RL 1F2YA 5KYIA 1F2LA 2VUMB 2M00A 1BCPD 1LTLA 5JEAH 1C7YA 5ELEA 4WRDA 4BA1I 1YZ6A 3P7JA 4BBRH 2NB0A 5JPMC 1SEBD 3VYTA 3R3OA 2B29A 2JA6H 4H44C 3KDFA 4A3KG 1WTRA 3OW7A 3DWQA 4MZ9A 1IKMA 2F52A 2YV5A 1I50H 1EYDA 2K5DA 5FOBB 3S9WA 3M3YH 5CV8A 1SMXA 5C0XJ 1B4OA 1TU2B 1PDQA 5T1GA 3I72A 3Q24A 1FR3A 1GM5A 1A2UA 1PH5A 5HURA 3GTJH 2VW9A 4PQXA 4AIMA 4DKAC 4CDFC 4CDDC 1WI5A 4O2DA 4LFCL 4GN3B 3NWSA 5I2YA 1IYVA 3RZOH 1TWCH 2C35B 5J39A 5LMNL 4F88A 2IPKD 2AHOB 1Q3LA 1YHQA 1CZGA 1H9KA 1M8AA 2CCZA 1Q12A 2F0MA 1N8RC 1WYDA 2CHBD 1X3FA 1W6JA 4DK6C 3MEHA 2XRQD 1A0IA 3A56A 4PG3A 4BY1G 4BS9A 3SK5A 1QOHA 3K6OA 2R92B 1E1TA 1DGSA 2MPMA 4UP7A 4A3FB 4QIWE 4PMBA 3I4NG 5EPLA 1TVXA 3TP6A 1IW7D 1MJEA 1CA6A 3R2TA 3I90A 2G9HD 3A8IE 2Q2UA 4A3DB 1Q86C 4MTKA 4ALPA 1GHJA 1KAWA 3PUYA 1K8GA 1EZ8A 1M4VA 1YIJA 3HOXG 4JI0L 2PZTA 2QGQA 4NMZA 1RTNA 1SNDA 2RCFA 2B2WA 3AMUA 5EKLA 2O5IC 4NP5A 1LTBD 1X6OA 1YJWA 3DWPA 1F9SA 2SEBD 5KNCA 3JAMi 1ET6A 4HSVA 5DAUA 3K5LA 2JEAI 3HOVB 3RN5A 4DU9A 3AFQA 1AZQA 4BY7B 1IXRA 3HZXA 4CKEA 1SNMA 4LF4L 3RD4A 3STBD 5G3LF 1SYEA 3BU2A 2OEOA 5FJ8H 2PNHA 3BDLA 3MFGA 2Q2HA 4A3BH 4GKKL 3FEWX 4LK1C 2K04A 1B1ZA 4C1NK 2K5VA 1WTXA 2IJ0A 2UXCL 5FK9C 1KD1C 2PNRC 1TWGB 3F2BA 2F0FA 3FKIH 1JQYD 1B9MA 5D3DA 4O42A 3HGBA 4FXKC 1Y69U 4BY1H 2FXQA 3S16B 3PO3G 3L0OA 3KUPA 1HNXL 2NVXB 2CWPA 3OSOA 2I5LX 4RAUC 1CHPD 3KBGA 2K01A 3HOUB 4DR4Q 2DUDA 5TSSA 3M4QA 4HIMA 2C9OA 4MN3A 1HFGA 1HZBA 2PMZB 3EFXD 2WV6D 1ZYRD 4CBVA 2F0VA 4U673 1VQBA 1C9OA 2JA8B 1YEZA 4MHEA 5E3FA 1LYLA 1XMQL 2E75C 3E3XA 4A3LH 2HDMA 1TWFH 2IW3A 1MBYA 4YHHQ 1XWEA 3FPPA 4X65L 3S17B 1K0SA 2PW5A 1EIGA 3EN2A 5FLMH 5IT9c 4DAYA 2WAQB 2YYZA 2HQEA 2MNAA 4JOIA 3X3MA 2ID0A 4C3JG 4Q0FA 4UDUC 1STEA 4JC0A 2P5ZX 3NSWA 4QL5A 2QILA 3A0JA 4PZ8A 4KHVA 4WJWA 5EAYA 4GKKQ 1UAPA 1YHBA 2YU9H 4OWWB 2WFWA 5IWAQ 1VF5C 2JQOA 5FLXE 3Q22A 3P1HA 4CJ0B 1HH2P 2E2JB 2ZT9C 4X3UA 3NBIA 1B3AA 2N49A 4NKLA 2EIFA 3F2DA 4DR5L 1EL0A 3NXWA 5CV7A 4OXPA 2HUGA 4XYQA 1LTTD 4A76A 4TQUS 4DV7Q 1OO9B 4C3HB 3KF6B 1IBMQ 2JA7B 3CMEA 3S1RH 1LABA 5EBDA 1EQTA 2ZXOA 5C44H 1S40A 3QOLA 2VQFQ 4HIKA 1VMCA 4P73A 1VQOA 2RQXA 5JVH3 1B2TA 1WVLA 2K1BA 1XTCD 1I3QH 1EU3A 1Q8KA 2L5TA 1SYCA 3GTQH 2Q8RE 5FJ8G 1D6EC 2ZTDA 3PO2G 4AQYQ 3V05A 2LXKA 4A4IA 4A3DH 1IBLL 1U4PA 1HTLD 3S14H 1Z9FA 1KLGD 1S5ED 2B8GA 3I73A 3T1HQ 3Q8DA 3CCMA 1VQCA 2NZOA 3RLNA 1VDZA 2K03A 1JC7A 1B9NA 2EYFA 1EEID 1C48A 1W6KA 4H13C 2JA5B 4G57A 4DV2Q 3CPWA 5IGBA 1LTRD 3KLSX 4ME3A 1LT4D 3PMFA 5ELFA 1FNWA 5EKKA 2F0DA 3K5OA 4TKOB 4Y7NB 4POGA 4IUTA 1ZXTA 2RF4A 4O0AA 5DEHA 5IGEA 3C2PA 4TSSA 3G48A 3W2DA 3S1NB 2Z0SA 4IQZA 4QMGA 3CMAA 1C4QA 5CV6A 4CDEC 4QGUA 2R7DA 1SNOA 3FDTA 4RMFA 4A3GB 1JJCB 3S2HH 4OONA 1EYGA 2XSCA 1J8IA 1JB7A 4IUQA 1LO5D 1EIHA 4RH6A 3CCUA 1A3VA 1EY5A 2A69C 3FKIB 4LMQD 3J7AF 2SOBA 3SDZA 4QCLA 3DUZA 3UDIA 5HGTA 1HJPA 2ZM6Q 3S16H 2ZTCA 5FLMG 4A3JH 3K0XA 4K8IA 5GROA 1FL0A 2F0PA 3U50C 4GNXA 2NBFA 3I4MG 3EBEA 4K8JA 1N33Q 4OO1I 1KDBA 4HMJA 2KCMA 2Z6KA 1Q81C 5IT9E 4LW1A 5K36G 1SMYC 3T1YQ 3KJOA 3J81i 1VQ4A 2JYOA 2XWJB 1A63A 2OTLA 4CKBA 1UE6A 2BE5C 2A68D 3GQBA 1O7LA 4ODGA 5E4WC 4Z9CB 2CFMA 3LNNA 2KCNA 3HKZE 2HCCA 3K58A 1YJNA 1PH4A 1YNNC 3UDGA 1VQ5A 2F0SA 2UUCQ 2JA6G 1YI2A 1HZAA 4G4KA 4H7BA 2YTVA 1G51A 2V4DA 2KA7A 4B3SL 1ILPA 2ES2A 3LWUA 3L9AX 4GN5A 2FJ2A 1LTAD 1HR0L 3I56A 3EROA 4IPGA 4KD3A 1X3GA 4B3ML 4V190 1QZHA 1N9WA 4ZAIA 1JJGA 1HTPA 5ELNA 4DR1L 4AYBE 2BA0A 5CYUA 4S3SA 5C0XI 1TS2A 1XTDA 4FVMA 4IO9A 1WTHA 2F0HA 4P71A 1TS3A 2CH4W 3S1QH 1DYQA 1X3EA 4JI4Q 4RCOA 1QZGA 1MI2A 2Z8LA 1XX8A 4HCEA 1W3SA 4IFDJ 4X64Q 3LGJA 1GUTA 5DM73 5IYCH 1B70B 4M8AA 1J6QA 5BR8L 5AJ3Q 4C1NI 5JJIA 1S5DD 3AB9A 3MZ5A 2G5DA 4K2KA 1VQAA 4R8NA 1S3OA 4AH6A 5C44B 4FO2A 3M3YB 1UE7A 2VQEQ 2L15A 4BWGB 5D3IB 1X3QA 3HKZG 2UXBQ 1SLJA 3CHBD 2WIIB 1PFBA 1EWCA 1VQ8A 5EPJA 1XXGA 1S5CD 2VQFL 3FRPB 4HJ5A 3WDNA 2EVBA 2Z4IA 4KKUA 3OWFA 3HOYH 4LF6L 3RZOB 4TRDA 4G7HC 3CC4A 2E2HB 2NN6I 4KY5A 1C8CA 3BZDB 1PH2A 1HHVA 4DR2Q 1TKWB 1EYCA 1ASZA 2KHSA 3MXUA 5IP9H 5M5XH 3HEJA 4HMIA 3DEOA 3QJYA 1NAPA 2KEEA 4IFDI 2M2LA 1TWHB 4LF9Q 1ENAA 2K6AA 3MTSA 3HP3A 3HOYG 2JP1A 2VZAA 3NTIA 1QJOA 4DV2L 2OCEA 3HG9A 4XQNA 1PYBA 1N34Q 5CBEE 3J81j 5T1IA 4DR3Q 1XNQQ 4EQOA 4LAAA 4BY7G 1SDFA 5C4XB 1PYWD 1PRTD 4A3KH 2B8FA 2ICEC 3UE1A 1PTOD 1Q82C 5D14A 4A3IB 1V1OA 3H3VH 1BDOA 5KYLA 4C3JB 3NENA 3K7AH 1WTQA 4LUOA 1D8LA 2H5XA 4QF4A 4PZ7A 2ALYB 3HOVH 2MHVA 4OIJA 1VQLA 4HJ7A 1EFID 1SR3A 1HNWL 2IT1A 1N32L 4UP9A 3LWEA 2OT2A 1KDCA 4A3DG 2KVMA 4DR6L 2AQ1B 4X64L 2FINB 4X3KA 4DA2A 1GJXA 4A3FG 5CBAE 2EXDA 4A3MG 4C3IG 1TWGH 4ID6A 1D7QA 2R7ZH 1RKNA 4DFAA 5IYBG 4JV5L 4GOPC 1FGUA 1QVCA 1H9RA 1GUSA 4A93B 1O7ZA 4QY7A 1CZWA 3IFDA 1T9HA 2NVXH 1ONLA 3J7AV 4IOCA 3Q0AA 1TY0A 1VQFA 3HOUH 2RSOA 2KBNA 3A55A 3PQIA 3CXCA 1PH6A 4IOAA 1G6PA 1ESRA 3F1ZA 2EJGC 1EFWA 1STHA 1SYGA 1QUQB 5G3LD 1MSGA 1W2BA 3RLOA 3L2PA 1HZ9A 3HOWG 3D6WA 2RHQB 1FD7D 2CWAA 3T51B 2F0JA 1VQGA 2V1CC 1K9MC 3R93A 1BO0A 1DOLA 4MTNA 5I6YA 1V8QA 3RR5A 2ENBA 5D65A 5CV5A 3S1QB 1F2ZA 4XIGS 4JVZA 1QG7A 1I4QA 4RHSA 1JOKA 1FNUA 3MXGA 3TMEA 2B2WC 1PRTF 2WB1G 5I9PA 3N6RA 3PF5A 4YCWA 1NSNS 4YY3Q 1VQMA 1F77A 1PV4A 1JICA 3T53B 2BDOA 3OYYA 1SAPA 2D5DA 2F0NA 1OXXK 2PMZE 1ET9A 3PIP3 1Y8PB 4LFAQ 3T56B 4JPBW 1H9JA 4HJ8A 2R92H 1QE6A 4C3IH 1XMQQ 3GTOH 2NTTA 2FHTA 4A3FH 2F3IA 4A75A 3SK4A 1HQRD 1RHPA 1LTGD 3N52A 4V0BA 4PNYA 2R6GA 4QIWB 4LFBQ 1JOOA 4NB3A 1STYA 2ICIA 2B2UC 3DEPA 4HTHA 3I7FA 4QB4A 3S1RB 1HA5A 3VR3A 4LFCQ 1O80A 1LT5D 1FJGQ 1V43A 2F0WA 2BOSA 4KKSA 5IYDG 2TMPA 1I6HB 1HR0W 2F03A 1OXVA 1K83B 2KHIA 4FNFA 1SE8A 4JI4L 4GKJQ 5M9OA 2EOTA 1Q1EA 1I4GA 2CQAA 1T5XD 3NPPA 3FHWA 1M1KC 3MHBA 4DV5L 1XYIA 5JEAJ 2OQKA 2Z1CA 2MO0A 5EGTA 1WFQA 1K73C 3KBXA 3BVZA 2MJ8A 2WP8J 5COYA 3A7LA 4MIUA 1K3RA 2X6LA 5GADC 4C2MH 2IY5B 3JAMc 3J7A5 1AE3A 1CKMA 5C4XH 5ELDA 2A6ED 3F2UA 1JE4A 1SBBB 3MXNA 2UU9L 3G7LA 5DM63 2R93G 1PMRA 3CQZH 3D0FA 1PH9A 3DXJC 2F0KA 3VR5A 2A73B 3GTGB 3NBHB 1N36L 1MHWC 3KLWA 4OGQC 1KTKA 4LF7Q 4KV6A 4P75A 3D6CA 3DM3A 2K50A 4XQQA 3I3CA 1UEAB 3FP9A 4DAPA 2KJXA 5IY0A 3VA5A 1HRJA 3M7GA 1UWVA 1PLFA 2WB1B 5C5MA 2K14A 5FO7B 3OWEB 2BCOA 4R8IA 5C3EB 4R4IA 4IPHA 2F0LA 2K5NA 2K4KA 3O13A 4DV6Q 4A93H 1TWFB 4KJNA 2JA9A 1E3PA 3RLFA 3A8KE 3S17H 3TZUA 3UI2A 2EYOA 4L5SA 1GVPA 5I2XA 4JBWA 4EQNA 4PZ6A 1VQJA 5IYCG 2X6GA 4KD4A 3GO5A 1MSHA 2M9VA 4JI7L 4DR7L 2NUCA 4JI2L 3M4OB 3D3RA 2K33A 1JOQA 3CD6A 3KLRA 3J81E 3NBHA 1H9SB 4N8FA 1K8AC 2KECA 2L12A 3KFUA 5IOCA 4FF4A 5C3XA 1EWIA 4IPDA 1STBA 2HDLA 3A5ZB 3QB3A 4GLXA 3DMUA 1EY4A 1U5KA 1EY8A 1TS4A 2LY7A 2K75A 2KEDA 4JI2Q 5LMUQ 3Q6SA 1QILA 4X3SA 2JA6B 1SNPA 4IUPA 4K6LA 3NP8A 2R93H 2JA7H 1I50B 3J81c 1V1PA 1DOMA 4B3RQ 2A19A 1HNXQ 4CHTB 1Y1VB 2EYPA 4ZK9B 3H15A 2QDLA 4C3IB 1GUOA 3C1FA 3CW2C 2SDFA 1JORA 2OF1A 2PQAA 1N36Q 1ENFA 4WJ3M 4JYAQ 5M3FB 2K7VA 2NVTB 1FGBD 2L4NA 1SYDA 5LL6S 5BN3A 2J7ZA 3VR6A 5BR8Q 3D8GA 5M5YB 3BDOA 4JBMA 3S14B 1X55A 1L1OA 1J5EQ 2PCFB 1UE1A 4NW2A 3PUVA 4DV4L 3TS2A 1ICWA 1I6HH 1EU4A 1Q7YC 4RGMA 4LF8L 4IUUA 2HHHQ 4J1MA 2EYLA 2JA5H 1LT3D 2FMCA 1G6ZA 5CMDA 3CC7A 4DR1Q 1SROA 2A8VA 4NXMQ 2RA4A 1STGA 3K5MA 5A2QL 3I91A 4DAVA 1JWMD 3UDFA 4CKCA 3DWAA 3EJIA 2UXBL 1DJRD 1NJIC 1QNKA 3B6YA 1I6VC 2B63G 3Q23A 1YNJC 2HIVA 2NN6H 3S1NH 2VL6A 3E6ZX 4OL7A 3S2DB 1SE4A 3SXHA 4RA8A 5M5XB 3TSSA 3S2HB 3OPOA 3AQQA 4AYBB 2EZVA 1MJCA 3CQZB 3KJPA 3S15B 4JYAL 3HS0C 3I8ZA 4L5RC 1L0YB 2JA5G 1A15A 3TP7A 1EOTA 1AP0A 2NZHA 2L9HA 3PCOB 4YWLA 4JI5Q 1XNRL 4XXEA 1KXLA 2BA1A 4BXXG 1TY2A 1P8LA 2E2DC 1B44D 4A3JB 5IODA 3ERSX 2YTYA 1RDPD 1ESFA 4DAYB 3EVQA 1D1KA 2EYJA 4QUFA 2NTSA 4E6IA 3NEMA 3QG1A 4B9XA 4A3BB 5LMUL 3URYA 3SVMA 4YY3L 3CP0A 3STBC 3RMHA 2F0QA 2IL8A 4C3JH 1VQ9A 4DNRB 3WOEA 4BBSH 4XYOA 4KJOA 3ERQA 2GVBA 1JE5A 4FYDA 3K80C 4YCVA 1OXUA 2N55A 1E1OA 2FMMA 2MO1A 2F0GA 1QB5D 2GN5A 3MA2B 2VS1A 1R9TB 1IYUA 4A3MH 3L7ZC 1AN8A 1TS5A 2VB2X 5GQOA 1TWAB 4JI8Q 1K3BC 5DLQE 1HNZQ 2R3ZA 3HKSA 1L0WA 2R7ZB 2LXJA 3OIPA 5JOBA 2LKVA 3NE5B 4DUYL 4L5QA 2EJFC 2OWOA 3GTKH 1Z6HA 4XT3B 4DK0A 3PIOA 1PHJA 4DK1A 1SXTA 4FF1A 1DM0B 1SNQA 1U4LA 2EYHA 3KF8A 4ZKCB 4DR7Q 5C5LA 1E2WA 2N3SA 3W1BA 2WAQG 4OHJA 1QVGA 1Y8NB 1IZ6A 4IALA 2AUKA 3S1MH 1LTSD 4A3BG 5J1ZA 5CGKA 4AQYL 5JVG3 1SJHD 2E5LL 3CKIB 2JA8G 4DV6L 1PTOH 4OO1H 1A3UA 2XWBB 2RKSA 3TEHB 3JAME 1IKLA 2EY5A 4KY7A 2PQEA 3H94A 3ITPA 4JI6L 3MWYW 2SNSA 2E2HH 1QVFA 4KTAA 3U4ZA 4JCVE 4JI0Q 3BDCA 3GTPB 2RBMA 2BH2A 3UE0A 2A6HD 1JR0D 1WJJA 2B63B 3CCSA 2KHJA 1KNEA 4CJ1B 1I3QB 4YIJA 3TZDA 3GTQB 2DNEA 2O5JC 3I4NH 1VF7A 2LFNA 4FXDA 4KHPQ 4RHRA 4JBKA 4LJZC 1QWYA 1S5FD 4A3CH 4A3GG 2E76C 2QCPX 2D9UA 1UEBA 4UAIA 2BDNA 2K5WA 4ZUIA 5IP9G 2XRSD 4DR3L 5C4JH 5BN4A 1D1IA 2NVYH 2A1AA 1K83H 1CTMA 2PZWA 3OTOL 1S72A 1Y1WH 1SRUA 3S15H 1B8AA 4R4CA 1SSOA 4RGNA 3U9SA 3QIAA 4X65Q 2KENA 1E24A 3GV3A 2XGTA 4APVA 4MNOA 1WTVA 3I4LA 2AWNA 4R4OA 1EY7A 2UUAQ 1Y1VG 1VQDA 1NNXA 5I6WA 4NDXA 1BCPB 4J6HA 2VQEL 1YJ9A 3A5UA 1GUWA 3ICEA 4PV1C 1HFNA 3QOJA 3OHXC 1XMOL 1KL9A 1G91A 4A3GH 1YNXA 3FMCA 4DR4L 4X66L 3X3NA 5JJZA 4KN4C 4QJFA 1VS0A 1LLRD 2NVQB 4H02A 4N8X1 4LF6Q 2ZM6L 1ENCA 2QW7A 1VQEA 3VYUA 2JEBI 2PYKA 3GTGH 3NK9A 1PFNA 4ILWA 1NR4A 3CCJA 1VQIA 2RSNA 5KNDA 3PF4A 5I9OA 1EQQA 3BG3A 3J80L 2UUBL 1EY0A 1L1OC 1WTOA 1JB3A 1TXYA 5C3WA 1CUKA 4R4TA 4X62L 4B08A 1KDAA 5A35A 2QKIC 5M3MH 2A74C 4POFA 4LF4Q 1ML0D 1MGSA
chains in the Genus database with same CATH topology
4JI3L 1RL2A 5IYDG 1HR0W 1OXVA 1HZBA 2KHIA 2IHFA 3ER0A 2HT1A 2ATWA 1SE8A 4JI4L 4GKJQ 2K5HA 1VQBA 1C9OA 2VY3A 5GAHC 4DUZQ 5C3EH 4OO1G 1YEZA 1Q1EA 1XMQL 1LYLA 4A3LH 1TWFH 3FHWA 1M1KC 4DV5L 1TWHH 1X56A 5JEAJ 2OQKA 4YHHQ 4X65L 4JV5Q 2MO0A 3EN2A 5FLMH 1WFQA 1K73C 5IT9c 5JJKA 2RHSB 2VUMH 2YYZA 2WP8J 2MNAA 1IL2A 4JOIA 4LF5Q 4A3EH 2ID0A 1K3RA 2ZJRA 3J80i 5GADC 4C2MH 2IY5B 3F8TA 4JC0A 3JAMc 2PI2A 4YCUA 1FJGL 4QL5A 5IP7H 3AFPA 3J7A5 3S2DH 1AE3A 1CKMA 2LSSA 5C4XH 4A3CG 3A0JA 4PZ8A 2UU9L 5C44G 2JA7G 1V9PA 5EAYA 2UUAL 4GKKQ 1N32Q 4X66Q 2R93G 3CQZH 1PH9A 3D0FA 2NVQH 1YHBA 2YU9H 4OWWB 2WFWA 2IX1A 1EIFA 5IWAQ 1MIUA 3CC2A 4A3IH 2JQOA 5C3EG 3KOJA 3U58A 3NBHB 1HH2P 4P74A 1N36L 1KHIA 1OXTA 4LNQA 4DV1L 4BXXH 3KLWA 2N49A 4LF7Q 2R7FA 2EIFA 3F2DA 4DR5L 4P75A 2E8GA 2AKWB 3A74A 3DM3A 1NE3A 2K50A 4OXPA 3RZDH 3W5OA 3ULJA 4LFAL 2ASBA 3FP9A 1NY4A 2I5MX 4B3TL 1EQRA 4A76A 2HQLA 4TQUS 5IY0A 3AEVA 3HOUG 2UXDQ 4DV7Q 1CKOA 2ZJQA 3KF6B 1IBMQ 4QQBX 3CMEA 1NBWA 3S1RH 5C44H 1S40A 5LMNQ 4OWXB 1UWVA 3H0GH 2VQFQ 4HIKA 3M9BA 4L5TA 3M7NA 2K14A 3KF6A 3PGZA 3G71A 4IJHA 3VDYA 4P73A 1VQOA 2B63H 4DPGA 3GTLH 2JA8H 4R4IA 4IPHA 3K7UC 1MKHA 2K5NA 2K4KA 2E2IH 1I3QH 3KF8B 4DV6Q 4A93H 4XTCS 1Q8KA 1EIYB 2I5HA 1YVCA 1IBKQ 3ULLA 3GTQH 1V1QA 2JA9A 1E3PA 3RLFA 1XJVA 1PH7A 1KC8C 3S17H 4NXML 5FJ8G 2ZTDA 3PO2G 4L5SA 4AQYQ 2E5LQ 1OTCA 1LUZA 1GVPA 1G291 3IRBA 3CCQA 4A4IA 2LXKA 4JBWA 4A3DH 1IBLL 3CCRA 4DV0L 4PZ6A 1VQJA 1Z9FA 2N78A 4LWCA 5IYCG 3S14H 4BBRG 3T1HQ 3GO5A 2YTXA 5M3FG 3Q8DA 3CCMA 1VQCA 2NZOA 4GS3A 2JJQA 3T1HL 3RLNA 3U4VA 4DR2L 3H0GG 4JI7L 4DR7L 4JI2L 5IYDH 3HOVG 1PYSB 4B3TQ 3CD6A 2WB1E 4DV0Q 4LF7L 1EUJA 4DV2Q 2AWOA 3CPWA 1KIXA 1K8AC 4ME3A 4YHHL 1Y1WG 1JJ2A 1VQ6A 3KFUA 4RG1A 2Y0SE 3PO2H 4A3JG 3GTMH 1PVOA 1EWIA 4IPDA 4POGA 3A5ZB 1SN8A 2RF4A 4O0AA 4GLXA 1HR0Q 4BY7H 4GLVB 3TQYA 1U5KA 1VCIA 4GOPA 3NELA 3G48A 2R92G 4OWTB 2Z0SA 2K75A 4JI2Q 5LMUQ 3CMAA 3E9HA 2F4VQ 4QGUA 2UU9Q 1WCMH 2R7DA 3PIPA 2UXDL 4RMFA 4NPSA 1JJCB 3S2HH 4C3HH 1IBML 4AYBG 4OONA 3HOZG 3HOZH 2JA7H 2N8NA 4R1JA 4DV7L 1EYGA 3J81c 1IBLQ 1WCMG 4B3RQ 1JB7A 2A19A 1HNXQ 1NTGA 1BBWA 3I55A 1Y14B 2D0OA 1N34L 1XNQL 4Y52H 2MQHA 3CCUA 4BBSG 4A3EG 3CCVA 2HHHL 3H15A 3UDIA 5GAEC 1HJPA 3CW2C 2ZM6Q 3S16H 2PQAA 2ZTCA 5FLMG 4A3JH 1N36Q 2EQSA 3K0XA 4DV3L 1K0RA 4JYAQ 5GROA 4WJ3M 2WAQE 4NXNQ 1FL0A 3U50C 4K0KQ 1NMGA 1YBYA 4GNXA 3I4MG 5HY6A 3EBEA 4LUVA 1UE5A 3UDXA 1N33Q 4OO1I 5BR8Q 5H1SE 2R93H 1VQKA 4JBMA 4GNXB 2KCMA 1X55A 2Z6KA 1L1OA 5ELOA 1VQPA 1Q81C 1J5EQ 4LW1A 1HNZL 5K36G 3GTPH 1UE1A 3T1YQ 3HOXH 3KJOA 2AMCB 3J81i 1VQ4A 4LF5L 3TS2A 3PUVA 4DV4L 1ASYA 2OTLA 3BZCA 5IP7G 1Q7YC 1I6HH 1A63A 1AH9A 1UE6A 4LF8L 4GLAC 1CKNA 2HHHQ 2JE6I 2UUCL 4HIOA 2JA5H 2BH8A 4DAMA 4JG2A 2CFMA 3ZJYC 3HFZB 3CC7A 3HKZE 4DK3C 4DR1Q 1SROA 2VUMG 1M90C 4NXMQ 2A8VA 1YJNA 4KLKA 1PH4A 2I0QA 3OTOQ 5JJLA 4DV5Q 3UDGA 3UDFA 1VQ5A 2UUCQ 4GKJL 3K81C 2JA6G 5IWAL 3M85A 1HZAA 2DGYA 1YI2A 1NJIC 4A93G 2YTVA 3B6YA 1G51A 2UXBL 3J80c 4JI3Q 3OW2A 2XTIA 1XMOQ 1QUQA 1Z47A 1R9TH 2ES2A 4B3SL 2B63G 2PQAB 4GN5A 5IYBH 1E7ZA 1C0AA 3S1NH 2HIVA 4HJ9A 1JT8A 4JOIC 2VL6A 1TWAH 1HR0L 1BKBA 1X65A 3I56A 3CF5A 4IPGA 1N33L 1X3GA 3GDEA 3AQQA 4UP8A 1MJCA 4KHPL 4B3ML 1L1OB 1X54A 3G6EA 1QZHA 3CCLA 3DLLA 1N9WA 3KJPA 4JYAL 1JJGA 3JC66 1CSQA 5ELNA 3BJUA 4AYBE 4DR1L 2JA5G 4L5RC 2BA0A 5C0XI 3CAMA 1XTDA 2NZHA 1Y1VH 4IO9A 3MEFA 3PCOB 4YWLA 4EX5A 4P71A 1PH1A 4JI5Q 1XNRL 3D31A 2BA1A 4BXXG 3S1QH 1KXLA 1P8LA 1E22A 1X3EA 3S24A 4JI4Q 1CSPA 4DNIA 1QZGA 3ERSX 3T1YL 1XPRA 2YTYA 5M3FH 4DAYB 1W3SA 4IFDJ 1GO3E 4X64Q 3LGJA 5LMNW 3TS0A 5IYCH 4A3IG 1B70B 1VQ7A 2UXCQ 2Z6KC 1X9NA 1J6QA 4KHZA 5BR8L 5AJ3Q 3NEMA 2MFIA 5JJIA 3WWVA 3EIVA 5AJ3L 5LMUL 4JI1L 3CP0A 4YY3L 1CKNB 1VQAA 4NXNL 1S3OA 4AH6A 5C4XG 2UUBQ 3KYHC 1XPOA 3STBC 2D0PA 1UE7A 2VQEQ 2L15A 2VNUD 2IHEA 4C3JH 1VQ9A 3HKZG 2UXBQ 2GVAA 1SLJA 4BBSH 3PUWA 4B3SQ 3H3VI 1VQ8A 2GVBA 3I2ZA 2VQFL 1WOCA 1NMFA 1JE5A 3PUXA 4IPCA 4HJ5A 4LF8Q 4IJLA 1KRTA 3HOYH 4J15A 4LF6L 2CKZB 3K80C 4YCVA 3CC4A 2ZTEA 3G4SA 1OXUA 2NN6I 1E1OA 1PH2A 1I94Q 1BBUA 2MO1A 4B3MQ 2JK8A 1B7YB 2GN5A 3TRZA 2VS1A 1XPUA 4DR6Q 4X6AH 4DR2Q 1GKHA 4JI7Q 4R4QA 2QA4A 5FLXc 1ASZA 4BA2I 4A3MH 1I5FA 1KQSA 2F4VL 2OTJA 3L7ZC 1HZCA 3F2CA 1OXSC 4DR5Q 5GQOA 4JI8Q 2ZJPA 4JI6Q 2B3GA 4YWKA 3M4OH 1A62A 3M4PA 5DLQE 1PH8A 1L2FA 5IP9H 3HKSA 1L0WA 5M5XH 1HNZQ 2LXJA 1Q46A 1GD7A 4K0KL 5C0XG 3TREA 2D62A 4IFDI 2IX0A 2K52A 4L5QA 4DUYL 2CQOA 3RN2A 2OWOA 4FDBA 4LF9Q 3AYHB 3GTKH 3HOYG 3PO3H 1FVIA 3PIOA 3E0EA 1IYJB 2VZAA 1PHJA 4Y7NH 4PMWA 3KDFB 4B3RL 4DV2L 1LTLA 2PI2E 3CPFA 1C7YA 4DR7Q 2OCEA 4BA1I 1YZ6A 4BBRH 1PYBA 3MXNB 1N34Q 1XNQQ 3J81j 4DR3Q 3E9IA 1P16A 2N3SA 3W1BA 4BY7G 2WAQG 2B29A 2JA6H 1QVGA 1IZ6A 3KDFA 4A3KG 1J5EL 3S1MH 4A3BG 4MZ9A 2F52A 4AQYL 2YV5A 1I50H 4A3KH 3UE1A 1Q82C 3M3YH 1SMXA 2E5LL 5C0XJ 3H3VH 2JA8G 1SFOH 4DV6L 2RCNA 3NENA 1GM5A 3K7AH 1PH5A 4LUOA 1RIPA 1D8LA 2H5XA 3GTJH 4PZ7A 3TEHB 5JEAG 2HIXA 2VW9A 1PFSA 2ALYB 3HOVH 1AE2A 1H95A 4AIMA 4DKAC 4DUYQ 1VQLA 3K8AA 1PA6A 1WI5A 4O2DA 4HJ7A 4LFCL 1SR3A 4GN3B 4P72A 4JI8L 4JI6L 3RZOH 3GD7A 1HNWL 2IT1A 1N32L 4UP9A 1TWCH 2C35B 5LMNL 2E2HH 4GOPB 1QVFA 1I94L 4A3DG 2AHOB 1YHQA 4DR6L 3U4ZA 2CCZA 4X64L 4JCVE 1Q12A 4JI0Q 1JMCA 3HOWH 4GNXC 1WYDA 3PUZA 1X3FA 1N8RC 4A3FG 2BH2A 3UE0A 4OX9Q 2Y0SG 4DK6C 2EXDA 4A3MG 1A0IA 1O7IA 5GAGC 4PG3A 4BY1G 1TWGH 1KRSA 1WJJA 1D7QA 2R7ZH 5IYBG 4JV5L 3CCSA 1E1TA 1FGUA 1QVCA 1DGSA 2KHJA 2Q2IA 4GOPC 1YITA 4DV1Q 4UP7A 4QY7A 4QIWE 5IE8A 1T9HA 2NVXH 4LF9L 3I4NH 3I4NG 4UPAA 4IOCA 1MJEA 2KCTA 1IBKL 4JBKA 4KHPQ 4WJ4A 2QEXA 1VQFA 4A3CH 2Q2UA 3HOUH 4A3GG 2KBNA 3CCEA 1Q86C 3RNUA 3CXCA 4ALPA 1UEBA 1PH3A 2Q2TA 1PH6A 4IOAA 1G6PA 1A8VA 3F1ZA 5IP9G 4OX9L 4YWMA 4UY8C 1KAWA 3PUYA 1EFWA 1K8GA 4DR3L 5C4JH 3I4OA 1QUQB 4TVAB 1YIJA 2NVYH 2A1AA 1W2BA 1K83H 3RLOA 1HZ9A 4LUZA 4JI5L 1YHAA 3L2PA 3HOXG 4JI0L 2QGQA 5E7NA 1XNRQ 4LFBL 2RHQB 1U0LA 3OTOL 4KI0A 2CWAA 1BVSA 1S72A 4EQ5A 1SRUA 1VQGA 1Y1WH 2V1CC 3S15H 1B8AA 4R4CA 1K9MC 4A3LG 3SGIA 1X6OA 1YJWA 1Q1BA 3ULPA 4MTNA 4X65Q 2KENA 3JAMi 3BZKA 4HJAA 1E24A 3RR5A 3I4MH 2XGTA 4APVA 4MNOA 2JEAI 2AWNA 4R4OA 3RN5A 3PV0A 4DUZL 3AFQA 2UUAQ 4XIGS 1IXRA 1Y1VG 1VQDA 4LF4L 2VQEL 3STBD 1YJ9A 3A5UA 3ICEA 3BU2A 1XMOL 2WB1G 1KL9A 3PF5A 4YCWA 4JI1Q 1YNXA 4YY3Q 4A3GH 1VQMA 5FJ8H 4DR4L 1LM0A 2PNHA 4X66L 1PV4A 4GKKL 2Q2HA 4QJFA 4A3BH 1VS0A 1VQHA 5J3BA 2K5VA 3OYYA 4H02A 2UXCL 2PMZE 1KD1C 1OXXK 2ZM6L 4LF6Q 1VQEA 4LFAQ 2JEBI 3GTGH 2NN6G 3FKIG 3F2BA 3FKIH 3HOWG 2R7ZG 2E2JH 4HJ8A 3PSIA 2R92H 1EOVA 4C3IH 3CCJA 1XMQQ 4BY1H 2FXQA 3GTOH 4GN4B 1VQIA 4DV4Q 4A3FH 3PO3G 5M5WH 1VQNA 3L0OA 2F3IA 4A75A 1HNXL 5HGQA 3PF4A 2CWPA 5M3MG 2OQ0A 2I5LX 4JBJA 1EQQA 2NVTH 2R6GA 2UUBL 4HIDA 4LFBQ 1L1OC 4DR4Q 4NB3A 4X62Q 5M5YH 1TXYA 2DUDA 1CUKA 3I7FA 4IFDG 4R4TA 4X62L 1HNWQ 3M4QA 3W1GA 5M3MH 4POFA 4LFCQ 4HIMA 3J7ZC 4DV3Q 4LF4Q 1FJGQ 1V43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI3 L;  1RL2 A;  5IYD G;  1HR0 W;  1OXV A;  1HZB A;  2KHI A;  2IHF A;  3ER0 A;  2HT1 A;  2ATW A;  1SE8 A;  4JI4 L;  4GKJ Q;  2K5H A;  1VQB A;  1C9O A;  2VY3 A;  5GAH C;  4DUZ Q;  5C3E H;  4OO1 G;  1YEZ A;  1Q1E A;  1XMQ L;  1LYL A;  4A3L H;  1TWF H;  3FHW A;  1M1K C;  4DV5 L;  1TWH H;  1X56 A;  5JEA J;  2OQK A;  4YHH Q;  4X65 L;  4JV5 Q;  2MO0 A;  3EN2 A;  5FLM H;  1WFQ A;  1K73 C;  5IT9 c;  5JJK A;  2RHS B;  2VUM H;  2YYZ A;  2WP8 J;  2MNA A;  1IL2 A;  4JOI A;  4LF5 Q;  4A3E H;  2ID0 A;  1K3R A;  2ZJR A;  3J80 i;  5GAD C;  4C2M H;  2IY5 B;  3F8T A;  4JC0 A;  3JAM c;  2PI2 A;  4YCU A;  1FJG L;  4QL5 A;  5IP7 H;  3AFP A;  3J7A 5;  3S2D H;  1AE3 A;  1CKM A;  2LSS A;  5C4X H;  4A3C G;  3A0J A;  4PZ8 A;  2UU9 L;  5C44 G;  2JA7 G;  1V9P A;  5EAY A;  2UUA L;  4GKK Q;  1N32 Q;  4X66 Q;  2R93 G;  3CQZ H;  1PH9 A;  3D0F A;  2NVQ H;  1YHB A;  2YU9 H;  4OWW B;  2WFW A;  2IX1 A;  1EIF A;  5IWA Q;  1MIU A;  3CC2 A;  4A3I H;  2JQO A;  5C3E G;  3KOJ A;  3U58 A;  3NBH B;  1HH2 P;  4P74 A;  1N36 L;  1KHI A;  1OXT A;  4LNQ A;  4DV1 L;  4BXX H;  3KLW A;  2N49 A;  4LF7 Q;  2R7F A;  2EIF A;  3F2D A;  4DR5 L;  4P75 A;  2E8G A;  2AKW B;  3A74 A;  3DM3 A;  1NE3 A;  2K50 A;  4OXP A;  3RZD H;  3W5O A;  3ULJ A;  4LFA L;  2ASB A;  3FP9 A;  1NY4 A;  2I5M X;  4B3T L;  1EQR A;  4A76 A;  2HQL A;  4TQU S;  5IY0 A;  3AEV A;  3HOU G;  2UXD Q;  4DV7 Q;  1CKO A;  2ZJQ A;  3KF6 B;  1IBM Q;  4QQB X;  3CME A;  1NBW A;  3S1R H;  5C44 H;  1S40 A;  5LMN Q;  4OWX B;  1UWV A;  3H0G H;  2VQF Q;  4HIK A;  3M9B A;  4L5T A;  3M7N A;  2K14 A;  3KF6 A;  3PGZ A;  3G71 A;  4IJH A;  3VDY A;  4P73 A;  1VQO A;  2B63 H;  4DPG A;  3GTL H;  2JA8 H;  4R4I A;  4IPH A;  3K7U C;  1MKH A;  2K5N A;  2K4K A;  2E2I H;  1I3Q H;  3KF8 B;  4DV6 Q;  4A93 H;  4XTC S;  1Q8K A;  1EIY B;  2I5H A;  1YVC A;  1IBK Q;  3ULL A;  3GTQ H;  1V1Q A;  2JA9 A;  1E3P A;  3RLF A;  1XJV A;  1PH7 A;  1KC8 C;  3S17 H;  4NXM L;  5FJ8 G;  2ZTD A;  3PO2 G;  4L5S A;  4AQY Q;  2E5L Q;  1OTC A;  1LUZ A;  1GVP A;  1G29 1;  3IRB A;  3CCQ A;  4A4I A;  2LXK A;  4JBW A;  4A3D H;  1IBL L;  3CCR A;  4DV0 L;  4PZ6 A;  1VQJ A;  1Z9F A;  2N78 A;  4LWC A;  5IYC G;  3S14 H;  4BBR G;  3T1H Q;  3GO5 A;  2YTX A;  5M3F G;  3Q8D A;  3CCM A;  1VQC A;  2NZO A;  4GS3 A;  2JJQ A;  3T1H L;  3RLN A;  3U4V A;  4DR2 L;  3H0G G;  4JI7 L;  4DR7 L;  4JI2 L;  5IYD H;  3HOV G;  1PYS B;  4B3T Q;  3CD6 A;  2WB1 E;  4DV0 Q;  4LF7 L;  1EUJ A;  4DV2 Q;  2AWO A;  3CPW A;  1KIX A;  1K8A C;  4ME3 A;  4YHH L;  1Y1W G;  1JJ2 A;  1VQ6 A;  3KFU A;  4RG1 A;  2Y0S E;  3PO2 H;  4A3J G;  3GTM H;  1PVO A;  1EWI A;  4IPD A;  4POG A;  3A5Z B;  1SN8 A;  2RF4 A;  4O0A A;  4GLX A;  1HR0 Q;  4BY7 H;  4GLV B;  3TQY A;  1U5K A;  1VCI A;  4GOP A;  3NEL A;  3G48 A;  2R92 G;  4OWT B;  2Z0S A;  2K75 A;  4JI2 Q;  5LMU Q;  3CMA A;  3E9H A;  2F4V Q;  4QGU A;  2UU9 Q;  1WCM H;  2R7D A;  3PIP A;  2UXD L;  4RMF A;  4NPS A;  1JJC B;  3S2H H;  4C3H H;  1IBM L;  4AYB G;  4OON A;  3HOZ G;  3HOZ H;  2JA7 H;  2N8N A;  4R1J A;  4DV7 L;  1EYG A;  3J81 c;  1IBL Q;  1WCM G;  4B3R Q;  1JB7 A;  2A19 A;  1HNX Q;  1NTG A;  1BBW A;  3I55 A;  1Y14 B;  2D0O A;  1N34 L;  1XNQ L;  4Y52 H;  2MQH A;  3CCU A;  4BBS G;  4A3E G;  3CCV A;  2HHH L;  3H15 A;  3UDI A;  5GAE C;  1HJP A;  3CW2 C;  2ZM6 Q;  3S16 H;  2PQA A;  2ZTC A;  5FLM G;  4A3J H;  1N36 Q;  2EQS A;  3K0X A;  4DV3 L;  1K0R A;  4JYA Q;  5GRO A;  4WJ3 M;  2WAQ E;  4NXN Q;  1FL0 A;  3U50 C;  4K0K Q;  1NMG A;  1YBY A;  4GNX A;  3I4M G;  5HY6 A;  3EBE A;  4LUV A;  1UE5 A;  3UDX A;  1N33 Q;  4OO1 I;  5BR8 Q;  5H1S E;  2R93 H;  1VQK A;  4JBM A;  4GNX B;  2KCM A;  1X55 A;  2Z6K A;  1L1O A;  5ELO A;  1VQP A;  1Q81 C;  1J5E Q;  4LW1 A;  1HNZ L;  5K36 G;  3GTP H;  1UE1 A;  3T1Y Q;  3HOX H;  3KJO A;  2AMC B;  3J81 i;  1VQ4 A;  4LF5 L;  3TS2 A;  3PUV A;  4DV4 L;  1ASY A;  2OTL A;  3BZC A;  5IP7 G;  1Q7Y C;  1I6H H;  1A63 A;  1AH9 A;  1UE6 A;  4LF8 L;  4GLA C;  1CKN A;  2HHH Q;  2JE6 I;  2UUC L;  4HIO A;  2JA5 H;  2BH8 A;  4DAM A;  4JG2 A;  2CFM A;  3ZJY C;  3HFZ B;  3CC7 A;  3HKZ E;  4DK3 C;  4DR1 Q;  1SRO A;  2VUM G;  1M90 C;  4NXM Q;  2A8V A;  1YJN A;  4KLK A;  1PH4 A;  2I0Q A;  3OTO Q;  5JJL A;  4DV5 Q;  3UDG A;  3UDF A;  1VQ5 A;  2UUC Q;  4GKJ L;  3K81 C;  2JA6 G;  5IWA L;  3M85 A;  1HZA A;  2DGY A;  1YI2 A;  1NJI C;  4A93 G;  2YTV A;  3B6Y A;  1G51 A;  2UXB L;  3J80 c;  4JI3 Q;  3OW2 A;  2XTI A;  1XMO Q;  1QUQ A;  1Z47 A;  1R9T H;  2ES2 A;  4B3S L;  2B63 G;  2PQA B;  4GN5 A;  5IYB H;  1E7Z A;  1C0A A;  3S1N H;  2HIV A;  4HJ9 A;  1JT8 A;  4JOI C;  2VL6 A;  1TWA H;  1HR0 L;  1BKB A;  1X65 A;  3I56 A;  3CF5 A;  4IPG A;  1N33 L;  1X3G A;  3GDE A;  3AQQ A;  4UP8 A;  1MJC A;  4KHP L;  4B3M L;  1L1O B;  1X54 A;  3G6E A;  1QZH A;  3CCL A;  3DLL A;  1N9W A;  3KJP A;  4JYA L;  1JJG A;  3JC6 6;  1CSQ A;  5ELN A;  3BJU A;  4AYB E;  4DR1 L;  2JA5 G;  4L5R C;  2BA0 A;  5C0X I;  3CAM A;  1XTD A;  2NZH A;  1Y1V H;  4IO9 A;  3MEF A;  3PCO B;  4YWL A;  4EX5 A;  4P71 A;  1PH1 A;  4JI5 Q;  1XNR L;  3D31 A;  2BA1 A;  4BXX G;  3S1Q H;  1KXL A;  1P8L A;  1E22 A;  1X3E A;  3S24 A;  4JI4 Q;  1CSP A;  4DNI A;  1QZG A;  3ERS X;  3T1Y L;  1XPR A;  2YTY A;  5M3F H;  4DAY B;  1W3S A;  4IFD J;  1GO3 E;  4X64 Q;  3LGJ A;  5LMN W;  3TS0 A;  5IYC H;  4A3I G;  1B70 B;  1VQ7 A;  2UXC Q;  2Z6K C;  1X9N A;  1J6Q A;  4KHZ A;  5BR8 L;  5AJ3 Q;  3NEM A;  2MFI A;  5JJI A;  3WWV A;  3EIV A;  5AJ3 L;  5LMU L;  4JI1 L;  3CP0 A;  4YY3 L;  1CKN B;  1VQA A;  4NXN L;  1S3O A;  4AH6 A;  5C4X G;  2UUB Q;  3KYH C;  1XPO A;  3STB C;  2D0P A;  1UE7 A;  2VQE Q;  2L15 A;  2VNU D;  2IHE A;  4C3J H;  1VQ9 A;  3HKZ G;  2UXB Q;  2GVA A;  1SLJ A;  4BBS H;  3PUW A;  4B3S Q;  3H3V I;  1VQ8 A;  2GVB A;  3I2Z A;  2VQF L;  1WOC A;  1NMF A;  1JE5 A;  3PUX A;  4IPC A;  4HJ5 A;  4LF8 Q;  4IJL A;  1KRT A;  3HOY H;  4J15 A;  4LF6 L;  2CKZ B;  3K80 C;  4YCV A;  3CC4 A;  2ZTE A;  3G4S A;  1OXU A;  2NN6 I;  1E1O A;  1PH2 A;  1I94 Q;  1BBU A;  2MO1 A;  4B3M Q;  2JK8 A;  1B7Y B;  2GN5 A;  3TRZ A;  2VS1 A;  1XPU A;  4DR6 Q;  4X6A H;  4DR2 Q;  1GKH A;  4JI7 Q;  4R4Q A;  2QA4 A;  5FLX c;  1ASZ A;  4BA2 I;  4A3M H;  1I5F A;  1KQS A;  2F4V L;  2OTJ A;  3L7Z C;  1HZC A;  3F2C A;  1OXS C;  4DR5 Q;  5GQO A;  4JI8 Q;  2ZJP A;  4JI6 Q;  2B3G A;  4YWK A;  3M4O H;  1A62 A;  3M4P A;  5DLQ E;  1PH8 A;  1L2F A;  5IP9 H;  3HKS A;  1L0W A;  5M5X H;  1HNZ Q;  2LXJ A;  1Q46 A;  1GD7 A;  4K0K L;  5C0X G;  3TRE A;  2D62 A;  4IFD I;  2IX0 A;  2K52 A;  4L5Q A;  4DUY L;  2CQO A;  3RN2 A;  2OWO A;  4FDB A;  4LF9 Q;  3AYH B;  3GTK H;  3HOY G;  3PO3 H;  1FVI A;  3PIO A;  3E0E A;  1IYJ B;  2VZA A;  1PHJ A;  4Y7N H;  4PMW A;  3KDF B;  4B3R L;  4DV2 L;  1LTL A;  2PI2 E;  3CPF A;  1C7Y A;  4DR7 Q;  2OCE A;  4BA1 I;  1YZ6 A;  4BBR H;  1PYB A;  3MXN B;  1N34 Q;  1XNQ Q;  3J81 j;  4DR3 Q;  3E9I A;  1P16 A;  2N3S A;  3W1B A;  4BY7 G;  2WAQ G;  2B29 A;  2JA6 H;  1QVG A;  1IZ6 A;  3KDF A;  4A3K G;  1J5E L;  3S1M H;  4A3B G;  4MZ9 A;  2F52 A;  4AQY L;  2YV5 A;  1I50 H;  4A3K H;  3UE1 A;  1Q82 C;  3M3Y H;  1SMX A;  2E5L L;  5C0X J;  3H3V H;  2JA8 G;  1SFO H;  4DV6 L;  2RCN A;  3NEN A;  1GM5 A;  3K7A H;  1PH5 A;  4LUO A;  1RIP A;  1D8L A;  2H5X A;  3GTJ H;  4PZ7 A;  3TEH B;  5JEA G;  2HIX A;  2VW9 A;  1PFS A;  2ALY B;  3HOV H;  1AE2 A;  1H95 A;  4AIM A;  4DKA C;  4DUY Q;  1VQL A;  3K8A A;  1PA6 A;  1WI5 A;  4O2D A;  4HJ7 A;  4LFC L;  1SR3 A;  4GN3 B;  4P72 A;  4JI8 L;  4JI6 L;  3RZO H;  3GD7 A;  1HNW L;  2IT1 A;  1N32 L;  4UP9 A;  1TWC H;  2C35 B;  5LMN L;  2E2H H;  4GOP B;  1QVF A;  1I94 L;  4A3D G;  2AHO B;  1YHQ A;  4DR6 L;  3U4Z A;  2CCZ A;  4X64 L;  4JCV E;  1Q12 A;  4JI0 Q;  1JMC A;  3HOW H;  4GNX C;  1WYD A;  3PUZ A;  1X3F A;  1N8R C;  4A3F G;  2BH2 A;  3UE0 A;  4OX9 Q;  2Y0S G;  4DK6 C;  2EXD A;  4A3M G;  1A0I A;  1O7I A;  5GAG C;  4PG3 A;  4BY1 G;  1TWG H;  1KRS A;  1WJJ A;  1D7Q A;  2R7Z H;  5IYB G;  4JV5 L;  3CCS A;  1E1T A;  1FGU A;  1QVC A;  1DGS A;  2KHJ A;  2Q2I A;  4GOP C;  1YIT A;  4DV1 Q;  4UP7 A;  4QY7 A;  4QIW E;  5IE8 A;  1T9H A;  2NVX H;  4LF9 L;  3I4N H;  3I4N G;  4UPA A;  4IOC A;  1MJE A;  2KCT A;  1IBK L;  4JBK A;  4KHP Q;  4WJ4 A;  2QEX A;  1VQF A;  4A3C H;  2Q2U A;  3HOU H;  4A3G G;  2KBN A;  3CCE A;  1Q86 C;  3RNU A;  3CXC A;  4ALP A;  1UEB A;  1PH3 A;  2Q2T A;  1PH6 A;  4IOA A;  1G6P A;  1A8V A;  3F1Z A;  5IP9 G;  4OX9 L;  4YWM A;  4UY8 C;  1KAW A;  3PUY A;  1EFW A;  1K8G A;  4DR3 L;  5C4J H;  3I4O A;  1QUQ B;  4TVA B;  1YIJ A;  2NVY H;  2A1A A;  1W2B A;  1K83 H;  3RLO A;  1HZ9 A;  4LUZ A;  4JI5 L;  1YHA A;  3L2P A;  3HOX G;  4JI0 L;  2QGQ A;  5E7N A;  1XNR Q;  4LFB L;  2RHQ B;  1U0L A;  3OTO L;  4KI0 A;  2CWA A;  1BVS A;  1S72 A;  4EQ5 A;  1SRU A;  1VQG A;  1Y1W H;  2V1C C;  3S15 H;  1B8A A;  4R4C A;  1K9M C;  4A3L G;  3SGI A;  1X6O A;  1YJW A;  1Q1B A;  3ULP A;  4MTN A;  4X65 Q;  2KEN A;  3JAM i;  3BZK A;  4HJA A;  1E24 A;  3RR5 A;  3I4M H;  2XGT A;  4APV A;  4MNO A;  2JEA I;  2AWN A;  4R4O A;  3RN5 A;  3PV0 A;  4DUZ L;  3AFQ A;  2UUA Q;  4XIG S;  1IXR A;  1Y1V G;  1VQD A;  4LF4 L;  2VQE L;  3STB D;  1YJ9 A;  3A5U A;  3ICE A;  3BU2 A;  1XMO L;  2WB1 G;  1KL9 A;  3PF5 A;  4YCW A;  4JI1 Q;  1YNX A;  4YY3 Q;  4A3G H;  1VQM A;  5FJ8 H;  4DR4 L;  1LM0 A;  2PNH A;  4X66 L;  1PV4 A;  4GKK L;  2Q2H A;  4QJF A;  4A3B H;  1VS0 A;  1VQH A;  5J3B A;  2K5V A;  3OYY A;  4H02 A;  2UXC L;  2PMZ E;  1KD1 C;  1OXX K;  2ZM6 L;  4LF6 Q;  1VQE A;  4LFA Q;  2JEB I;  3GTG H;  2NN6 G;  3FKI G;  3F2B A;  3FKI H;  3HOW G;  2R7Z G;  2E2J H;  4HJ8 A;  3PSI A;  2R92 H;  1EOV A;  4C3I H;  3CCJ A;  1XMQ Q;  4BY1 H;  2FXQ A;  3GTO H;  4GN4 B;  1VQI A;  4DV4 Q;  4A3F H;  3PO3 G;  5M5W H;  1VQN A;  3L0O A;  2F3I A;  4A75 A;  1HNX L;  5HGQ A;  3PF4 A;  2CWP A;  5M3M G;  2OQ0 A;  2I5L X;  4JBJ A;  1EQQ A;  2NVT H;  2R6G A;  2UUB L;  4HID A;  4LFB Q;  1L1O C;  4DR4 Q;  4NB3 A;  4X62 Q;  5M5Y H;  1TXY A;  2DUD A;  1CUK A;  3I7F A;  4IFD G;  4R4T A;  4X62 L;  1HNW Q;  3M4Q A;  3W1G A;  5M3M H;  4POF A;  4LFC Q;  4HIM A;  3J7Z C;  4DV3 Q;  4LF4 Q;  1FJG Q;  1V43 A; 
#chains in the Genus database with same CATH topology
 4JI3 L;  5IGC A;  2MUY A;  3VYS A;  2IHF A;  4PMC A;  4FP5 D;  4OO1 G;  4DUZ Q;  5C3E H;  3GP7 A;  2TSS A;  1PFM A;  3CU7 A;  2EE1 A;  5EKI A;  3U9O A;  1D5X C;  3DHQ A;  2DJF C;  2DY8 A;  1EQV A;  2KUM A;  4ZQ3 A;  5JJK A;  2RHS B;  2VUM H;  2XVS A;  1IL2 A;  4LF5 Q;  4A3E H;  2NZ1 D;  3D4W A;  1DCZ A;  3F8T A;  2RDG A;  1K8O A;  2PI2 A;  4YCU A;  1FJG L;  1S5B D;  5IP7 H;  3AFP A;  4DGZ A;  1V9P A;  2IX1 A;  1HUM A;  3CRK C;  3H09 A;  3IKJ A;  5C3E G;  3KOJ A;  2Q8T A;  3U58 A;  2JSO A;  4P74 A;  1O7Y A;  4DV1 L;  3GTJ B;  4LNQ A;  4OIK A;  4B9W A;  4BXX H;  1QNU A;  2IWH A;  1JWS D;  2CW0 D;  2AKW B;  1SMY D;  3A74 A;  1B3Q A;  1NE3 A;  3RZD H;  4LFA L;  2ASB A;  3ULJ A;  4I7A A;  1NY4 A;  2I5M X;  3H6M A;  4B3T L;  3TP5 A;  2B2V C;  1EQR A;  4I7Z C;  1NR2 A;  2HQL A;  3AEV A;  3NQT A;  3HOU G;  2UXD Q;  1CKO A;  2R93 B;  1NBW A;  4DXF A;  1I4P A;  3QO2 A;  5LMN Q;  4OWX B;  3H0G H;  1EZ6 A;  3TDQ A;  3M9B A;  4RGO S;  1ICF B;  4ZCK A;  5JAV A;  4CDC C;  5C6A A;  3G71 A;  4H0L C;  4IJH A;  2B63 H;  2B2Y C;  3GTL H;  1WTW A;  3K7U C;  1MKH A;  1H9M A;  1STN A;  2E2I H;  3KF8 B;  3C46 A;  2CVR A;  1IBK Q;  3ULL A;  1PH7 A;  1XJV A;  1PZI D;  1OTC A;  1LUZ A;  4L63 B;  3NHH A;  3IL8 A;  3CCR A;  4RKL A;  4LWC A;  1RCV D;  2YTX A;  3P20 A;  4GZY C;  2F4I A;  2JJQ A;  3E5S A;  4GS3 A;  3HOX B;  3H0G G;  2F0U A;  5IYD H;  3QWN A;  3HOV G;  1F2M A;  1PYS B;  4B3T Q;  4F7X A;  3ZYY X;  2LMC B;  1EUJ A;  5C4H A;  1KIX A;  4YHH L;  1Y1W G;  1JJ2 A;  3D4D A;  4RG1 A;  1T5E A;  2Y0S E;  1BUV T;  2KQ3 A;  3PO2 H;  1HXY D;  2CW0 C;  2F1M A;  1MD2 D;  1SN8 A;  4BY7 H;  1E0B A;  1SJE D;  4GOP A;  2R92 G;  2B2U A;  5AFW A;  1Q8I A;  3E9H A;  3C3L A;  1BBX C;  2UXD L;  1IBM L;  1TR5 A;  1AW7 A;  3HOZ G;  1EY6 A;  2N8N A;  2L0C A;  4N9P A;  1IBL Q;  4WOR A;  1WCM G;  1NTG A;  3I55 A;  1Y14 B;  1B53 A;  2WIN B;  2B2Y A;  3MC0 B;  4DXG A;  5EJW A;  2K28 A;  1DD2 A;  4A3E G;  2B2T A;  4BY1 B;  5GAE C;  1X3P A;  2EQS A;  4DV3 L;  5K5P A;  1CQF A;  2AQ2 B;  4K0K Q;  3J80 E;  4LUV A;  1UE5 A;  3UDX A;  2DJG C;  5A2Q E;  5I4D A;  3KLS A;  1GXD C;  5ELO A;  1VQP A;  3HOW B;  1A6X A;  4QUC A;  4LF5 L;  5LL6 X;  1ASY A;  5IP7 G;  5KRU A;  2ZXP A;  1JWU D;  4BBS B;  2JE6 I;  2UUC L;  2WAC A;  4HIO A;  4DAM A;  4JG2 A;  3SHL A;  5KNB A;  2MP1 A;  4C56 C;  2VUM G;  4XT1 B;  5ELB A;  1SYB A;  5JJL A;  4DV5 Q;  3FVQ A;  3CRL C;  3K81 C;  5IWA L;  2DGY A;  2XNA C;  4A93 G;  3NWT A;  5KGU A;  3J80 c;  3OW2 A;  1XMO Q;  1R9T H;  4JI3 Q;  4A3E B;  2PQA B;  5IYB H;  1E7Z A;  1JT8 A;  4A3M B;  3OMG A;  1R4P B;  4N9T A;  1HCZ A;  1TWA H;  1WCM B;  1X65 A;  3CF5 A;  2IX3 A;  3HRZ C;  4DF7 A;  2LS0 1;  2VB3 X;  1N33 L;  4UP8 A;  3HOZ B;  4IUR A;  1BQQ T;  2K5Q A;  1L1O B;  1X54 A;  1FYC A;  3NUC A;  3G6E A;  3CCL A;  3DLL A;  1ZEQ X;  4HR7 B;  3BJU A;  4ZRZ A;  1PTO F;  1Z7T A;  2B2T C;  4ABN A;  4RGT A;  1Y1V H;  3MEF A;  2I07 B;  3G6J B;  1PH1 A;  2SNM A;  1PZK D;  3D31 A;  1E22 A;  3L3O C;  3NTK A;  4DNI A;  3OOC A;  4BBR B;  1G2S A;  3T1Y L;  1XPR A;  5M3F H;  3RZD B;  4G7Z C;  4IUN A;  4A3I G;  3ONA B;  1WD0 A;  2Z6K C;  1X9N A;  4O1N A;  1RF2 D;  2Z9H A;  1G2T A;  3WWV A;  1UUP A;  3EIV A;  1E2Z A;  3VA7 A;  1CKN B;  4ULL A;  4NXN L;  5C4X G;  2D0P A;  3H0G B;  4KK7 A;  1PTO B;  2JXM B;  2GVA A;  3MFY A;  1CM9 A;  3DM1 A;  3PUW A;  4ZLT F;  3GTL B;  3GTO B;  1JCK B;  4HCS A;  2MGS A;  3A54 A;  3PUX A;  4IPC A;  4LF8 Q;  1KRT A;  4HSP A;  5K36 H;  4J15 A;  1TWC B;  4XDX A;  1KAB A;  1KLU D;  3K0Y A;  1I94 Q;  4B3M Q;  2JK8 A;  1B7Y B;  3TRZ A;  4DR6 Q;  4JI7 Q;  1H9S A;  4R4Q A;  2Z6B A;  2QA4 A;  1HUN A;  4BA2 I;  1KQS A;  2F4V L;  2C5C A;  1HZC A;  2H4O A;  3F2C A;  2QEJ C;  4JI6 Q;  2B3G A;  3M4P A;  1I4H A;  1L2F A;  4IFD H;  2HD3 A;  5CV4 A;  2H1E A;  5FO8 B;  1DXM A;  2IX0 A;  2K52 A;  1ZYR C;  3RN2 A;  1RD9 D;  3AYH B;  2BE5 D;  3E0E A;  1GUG A;  4PMW A;  3KDF B;  4Y7N H;  2PI2 E;  4HED A;  1SNC A;  3CPF A;  2L11 A;  4P2C B;  4RFB A;  5J22 A;  3MXN B;  4C2M B;  1EY9 A;  3E9I A;  1P16 A;  1O78 A;  1YNN D;  1VMP A;  5C4J B;  1PTO C;  2HCI A;  1J5E L;  5FLX L;  4JK1 C;  1BF4 A;  3TBI B;  1BR9 A;  1CHQ D;  3NQI A;  1SFO H;  1PRT C;  1L0X B;  2RDF A;  2RCN A;  3HKZ B;  1RIP A;  5JEA G;  2HIX A;  1PFS A;  5EBC A;  1X32 A;  3MXP A;  1AE2 A;  1H95 A;  5KIX A;  4DUY Q;  3K8A A;  1DON A;  1PA6 A;  1CA5 A;  4JI8 L;  4P72 A;  3H3V C;  3GD7 A;  1DZ1 A;  4GOP B;  1NCV A;  1I94 L;  2F3W A;  3NTH A;  1CQV A;  1EEF D;  2EPB A;  1JMC A;  3HOW H;  4DNT B;  2QDB A;  4GNX C;  3PUZ A;  3J81 L;  2EJM A;  4OX9 Q;  2Y0S G;  1O7I A;  5GAG C;  4F87 A;  2JN4 A;  3BYY B;  1BCP F;  2PO4 A;  1KRS A;  4I65 A;  2VXW A;  3PIO 3;  4FF2 A;  2Q2I A;  1YIT A;  4DV1 Q;  5IE8 A;  3BVM A;  4R9W A;  1RJT A;  2FFK B;  4LF9 L;  3GTK B;  4UPA A;  2KCT A;  1IBK L;  4WJ4 A;  2EY6 A;  2QEX A;  3CCE A;  5C0X H;  3RNU A;  1D2B A;  1WD1 A;  1PH3 A;  5ELC A;  2Q2T A;  1A8V A;  2F0E A;  1HQM C;  4OX9 L;  4YWM A;  4UY8 C;  1AEX A;  2XN9 C;  3I4O A;  4TVA B;  3SEB A;  4LUZ A;  4JI5 L;  1YHA A;  1XNR Q;  3S1M B;  4LFB L;  5E7N A;  1U0L A;  4KI0 A;  1BVS A;  1AFP A;  1Q90 A;  4EQ5 A;  5F2D A;  4X3T A;  4A3L G;  4HAE A;  3SGI A;  5E4X A;  1Q1B A;  3AU7 A;  3ULP A;  3WOF A;  4U68 A;  3BZK A;  4HJA A;  3I4M H;  3GTM B;  2F0T A;  4K14 A;  3K59 A;  5BN5 A;  2NWG A;  3PV0 A;  1CT1 D;  4DUZ L;  3VYR A;  1LT6 D;  1J9O A;  4ZUJ A;  1BXT A;  4ZKB B;  3K57 A;  1IHZ A;  4CGY B;  3I70 A;  4JI1 Q;  1LM0 A;  3T13 A;  1VQH A;  5J3B A;  3V96 A;  4KN7 C;  4RWS C;  4OEL B;  1Y8O B;  2CH4 A;  2F0I A;  3T4A C;  2NN6 G;  4EGV A;  3FKI G;  2R7Z G;  2E2J H;  3PSI A;  2Y0S B;  1EOV A;  1A2T A;  3SE0 A;  4GN4 B;  4DV4 Q;  5M5W H;  2A69 D;  1VQN A;  1AZP A;  5HGQ A;  5M3M G;  2OQ0 A;  3MVV A;  4JBJ A;  4EVO A;  3HOY B;  2NVT H;  5FO9 B;  4HID A;  4X62 Q;  5M5Y H;  4IFD G;  1HNW Q;  2EXZ A;  3A8J E;  3W1G A;  3J7Z C;  4DV3 Q;  1U4M A;  2AQ3 B;  1RL2 A;  3IFT A;  2NVY B;  3ER0 A;  5L37 A;  4XQJ A;  2ATW A;  2HT1 A;  2K5H A;  2VY3 A;  5GAH C;  4FF3 A;  3EA6 A;  1TWH H;  1X56 A;  3OIQ A;  4JV5 Q;  2F0O A;  1TT2 A;  2WKC A;  2L1B A;  1IW7 C;  4EQP A;  3R2I A;  2WKD A;  4K5X A;  2ZJR A;  3J80 i;  4HN7 A;  4IUV A;  1A3T A;  3S2D H;  4A3C G;  2LSS A;  4FXG C;  5C44 G;  2JA7 G;  2UUA L;  3VR4 A;  1PXU A;  2D2C C;  4C3H G;  4X66 Q;  3J7Y W;  2NVQ H;  1N32 Q;  1WTP A;  1EIF A;  5EPK A;  1MIU A;  1PRT B;  3CC2 A;  4A3I H;  3KK7 A;  1HPC A;  1SYF A;  2DY7 A;  1II3 A;  1KHI A;  1OXT A;  1EWH A;  1DOK A;  3P75 A;  1I4R A;  4K5W A;  1SE2 A;  2R7F A;  2DNC A;  2E8G A;  5IGG A;  3W5O A;  5LHY 1;  2DN8 A;  1KAA A;  1GUN A;  1SE3 A;  1KNA A;  1BCP C;  2ZJQ A;  2K05 A;  4QQB X;  5M3M B;  5C4Z A;  1BOS A;  5IGF A;  4L5T A;  3M7N A;  3KF6 A;  3PGZ A;  2A5H A;  3VDY A;  1LAC A;  2J0T D;  4DN4 M;  4DPG A;  2JA8 H;  2I0Q A;  1CI3 M;  4XTC S;  5KEE A;  1EIY B;  2I5H A;  1YVC A;  4K2L A;  1BNZ A;  1YNJ D;  1V1Q A;  3SR1 A;  3QR8 A;  1TII D;  1KC8 C;  3TN2 A;  4NXM L;  3M4Y A;  2E5L Q;  3IRB A;  3CCQ A;  1G29 1;  2EY2 A;  2KCC A;  4DV0 L;  2N78 A;  3T16 A;  4BBR G;  5CR3 A;  5NUC A;  5M3F G;  3FPU B;  3T1H L;  3U4V A;  4DR2 L;  2X69 A;  3BYT B;  3E0J A;  2J4X A;  2WB1 E;  4DV0 Q;  2RDH A;  4M1U B;  4LF7 L;  3IAY A;  2YU9 B;  2AWO A;  1VQ6 A;  3V2T A;  5DNF A;  3MAQ A;  3I4M B;  2A68 C;  4A3J G;  3GTM H;  3PO3 B;  1PVO A;  5FKA C;  1HR0 Q;  3ND9 A;  4GLV B;  3TQY A;  1VCI A;  3NEL A;  4J8Q A;  2QF7 A;  4OWT B;  4UHV A;  2F4V Q;  2UU9 Q;  1WCM H;  3PIP A;  1EYA A;  5E1F A;  4NPS A;  4C3H H;  4AYB G;  3HOZ H;  3VR2 A;  4R1J A;  4DV7 L;  2I46 A;  1U4R A;  3D4R A;  1STA A;  1BBW A;  2D0O A;  1N34 L;  1XNQ L;  4Y52 H;  1UNS A;  2MQH A;  4BBS G;  2A6E C;  3CCV A;  2XIW A;  1LV9 A;  2HHH L;  1V1P B;  2E2I B;  4RCN A;  5M5W B;  4OEM B;  1PZJ D;  1K0R A;  2WAQ E;  4NXN Q;  2AUJ D;  1NMG A;  1YBY A;  2RVL A;  5HY6 A;  2Q8I B;  1S4Z A;  3GV6 A;  5H1S E;  1VQK A;  4GNX B;  2NYZ D;  5IIF A;  1ILQ A;  1QCB D;  1HNZ L;  1GHK A;  1LTI D;  3GTP H;  4G7O C;  3HOX H;  2ZXR A;  5JPN C;  2AMC B;  2KOL A;  2GA4 B;  1AH9 A;  3BZC A;  3R8B A;  3LX0 A;  4KMU C;  4GLA C;  1CKN A;  1IL8 A;  2BH8 A;  3ZJY C;  3EQL C;  4RKB A;  5IT9 L;  3HFZ B;  4DK3 C;  1M90 C;  4KY6 A;  3I4N B;  5ISR A;  3OMC A;  2A6H C;  4KLK A;  3PO2 B;  3OTO Q;  4CJ2 C;  1B50 A;  4GKJ L;  3M85 A;  2OXP A;  2XTI A;  3SK8 A;  1QUQ A;  1F9Q A;  1Z47 A;  1C0A A;  4X6A H;  2O2L D;  1CFM A;  2EYM A;  3W3A A;  4HJ9 A;  4Q5V A;  4JOI C;  2EDG A;  2B39 A;  1I4X A;  1BKB A;  3GDE A;  2K32 A;  1FNV A;  1R4Q B;  1ROD A;  4KHP L;  1Y1W B;  3JC6 6;  1CSQ A;  2N88 A;  3CAM A;  1K8M A;  1ZKO A;  1NUC A;  4EX5 A;  3BS1 A;  1CK1 A;  1GOZ A;  1D5M C;  2PZU A;  1CSP A;  3S24 A;  3K5N A;  1E2V A;  4ZYS A;  1GO3 E;  2UXC Q;  5LMN W;  3TS0 A;  1VQ7 A;  3BVG A;  4KHZ A;  2Z4H A;  2MFI A;  1U9R A;  2G9D A;  4L8J A;  4IN3 A;  2B2V A;  3SK6 A;  5AJ3 L;  4A3K B;  4JI1 L;  2UUB Q;  3KYH C;  1XPO A;  1SFO B;  4F8M A;  2VNU D;  2IHE A;  2O4X A;  3K7A B;  4IZ8 A;  4B3S Q;  3H3V I;  1F9P A;  3C1E A;  5CC4 A;  1K28 A;  2R61 A;  3I2Z A;  1RTO A;  1WOC A;  1NMF A;  4IJL A;  5COR A;  3A7A B;  2CKZ B;  2ZTE A;  3G4S A;  1TQO A;  2PW7 A;  1BBU A;  2PPB C;  5CV9 A;  1XPU A;  1GKH A;  3JAM L;  5EQ0 A;  5FLX c;  1D5Z C;  2OTJ A;  1I5F A;  4L6T B;  1G8Z D;  4K6D A;  4KKT A;  5IGD A;  1OXS C;  4DR5 Q;  4ME5 A;  2ZJP A;  3M4O H;  4YWK A;  1A62 A;  1PH8 A;  3ND8 A;  4JW0 A;  2EY1 A;  2L55 A;  1HA6 A;  1Q46 A;  1GD7 A;  2F3V A;  4K0K L;  4K5V A;  5C0X G;  3TRE A;  2D62 A;  3RUZ A;  3TP8 A;  2CQO A;  2E74 C;  3H91 A;  4FDB A;  4WFN 3;  1F9R A;  3PO3 H;  1FVI A;  1IYJ B;  4B3R L;  1F2Y A;  5KYI A;  1F2L A;  2VUM B;  2M00 A;  1BCP D;  1LTL A;  5JEA H;  1C7Y A;  5ELE A;  4WRD A;  4BA1 I;  1YZ6 A;  3P7J A;  4BBR H;  2NB0 A;  5JPM C;  1SEB D;  3VYT A;  3R3O A;  2B29 A;  2JA6 H;  4H44 C;  3KDF A;  4A3K G;  1WTR A;  3OW7 A;  3DWQ A;  4MZ9 A;  1IKM A;  2F52 A;  2YV5 A;  1I50 H;  1EYD A;  2K5D A;  5FOB B;  3S9W A;  3M3Y H;  5CV8 A;  1SMX A;  5C0X J;  1B4O A;  1TU2 B;  1PDQ A;  5T1G A;  3I72 A;  3Q24 A;  1FR3 A;  1GM5 A;  1A2U A;  1PH5 A;  5HUR A;  3GTJ H;  2VW9 A;  4PQX A;  4AIM A;  4DKA C;  4CDF C;  4CDD C;  1WI5 A;  4O2D A;  4LFC L;  4GN3 B;  3NWS A;  5I2Y A;  1IYV A;  3RZO H;  1TWC H;  2C35 B;  5J39 A;  5LMN L;  4F88 A;  2IPK D;  2AHO B;  1Q3L A;  1YHQ A;  1CZG A;  1H9K A;  1M8A A;  2CCZ A;  1Q12 A;  2F0M A;  1N8R C;  1WYD A;  2CHB D;  1X3F A;  1W6J A;  4DK6 C;  3MEH A;  2XRQ D;  1A0I A;  3A56 A;  4PG3 A;  4BY1 G;  4BS9 A;  3SK5 A;  1QOH A;  3K6O A;  2R92 B;  1E1T A;  1DGS A;  2MPM A;  4UP7 A;  4A3F B;  4QIW E;  4PMB A;  3I4N G;  5EPL A;  1TVX A;  3TP6 A;  1IW7 D;  1MJE A;  1CA6 A;  3R2T A;  3I90 A;  2G9H D;  3A8I E;  2Q2U A;  4A3D B;  1Q86 C;  4MTK A;  4ALP A;  1GHJ A;  1KAW A;  3PUY A;  1K8G A;  1EZ8 A;  1M4V A;  1YIJ A;  3HOX G;  4JI0 L;  2PZT A;  2QGQ A;  4NMZ A;  1RTN A;  1SND A;  2RCF A;  2B2W A;  3AMU A;  5EKL A;  2O5I C;  4NP5 A;  1LTB D;  1X6O A;  1YJW A;  3DWP A;  1F9S A;  2SEB D;  5KNC A;  3JAM i;  1ET6 A;  4HSV A;  5DAU A;  3K5L A;  2JEA I;  3HOV B;  3RN5 A;  4DU9 A;  3AFQ A;  1AZQ A;  4BY7 B;  1IXR A;  3HZX A;  4CKE A;  1SNM A;  4LF4 L;  3RD4 A;  3STB D;  5G3L F;  1SYE A;  3BU2 A;  2OEO A;  5FJ8 H;  2PNH A;  3BDL A;  3MFG A;  2Q2H A;  4A3B H;  4GKK L;  3FEW X;  4LK1 C;  2K04 A;  1B1Z A;  4C1N K;  2K5V A;  1WTX A;  2IJ0 A;  2UXC L;  5FK9 C;  1KD1 C;  2PNR C;  1TWG B;  3F2B A;  2F0F A;  3FKI H;  1JQY D;  1B9M A;  5D3D A;  4O42 A;  3HGB A;  4FXK C;  1Y69 U;  4BY1 H;  2FXQ A;  3S16 B;  3PO3 G;  3L0O A;  3KUP A;  1HNX L;  2NVX B;  2CWP A;  3OSO A;  2I5L X;  4RAU C;  1CHP D;  3KBG A;  2K01 A;  3HOU B;  4DR4 Q;  2DUD A;  5TSS A;  3M4Q A;  4HIM A;  2C9O A;  4MN3 A;  1HFG A;  1HZB A;  2PMZ B;  3EFX D;  2WV6 D;  1ZYR D;  4CBV A;  2F0V A;  4U67 3;  1VQB A;  1C9O A;  2JA8 B;  1YEZ A;  4MHE A;  5E3F A;  1LYL A;  1XMQ L;  2E75 C;  3E3X A;  4A3L H;  2HDM A;  1TWF H;  2IW3 A;  1MBY A;  4YHH Q;  1XWE A;  3FPP A;  4X65 L;  3S17 B;  1K0S A;  2PW5 A;  1EIG A;  3EN2 A;  5FLM H;  5IT9 c;  4DAY A;  2WAQ B;  2YYZ A;  2HQE A;  2MNA A;  4JOI A;  3X3M A;  2ID0 A;  4C3J G;  4Q0F A;  4UDU C;  1STE A;  4JC0 A;  2P5Z X;  3NSW A;  4QL5 A;  2QIL A;  3A0J A;  4PZ8 A;  4KHV A;  4WJW A;  5EAY A;  4GKK Q;  1UAP A;  1YHB A;  2YU9 H;  4OWW B;  2WFW A;  5IWA Q;  1VF5 C;  2JQO A;  5FLX E;  3Q22 A;  3P1H A;  4CJ0 B;  1HH2 P;  2E2J B;  2ZT9 C;  4X3U A;  3NBI A;  1B3A A;  2N49 A;  4NKL A;  2EIF A;  3F2D A;  4DR5 L;  1EL0 A;  3NXW A;  5CV7 A;  4OXP A;  2HUG A;  4XYQ A;  1LTT D;  4A76 A;  4TQU S;  4DV7 Q;  1OO9 B;  4C3H B;  3KF6 B;  1IBM Q;  2JA7 B;  3CME A;  3S1R H;  1LAB A;  5EBD A;  1EQT A;  2ZXO A;  5C44 H;  1S40 A;  3QOL A;  2VQF Q;  4HIK A;  1VMC A;  4P73 A;  1VQO A;  2RQX A;  5JVH 3;  1B2T A;  1WVL A;  2K1B A;  1XTC D;  1I3Q H;  1EU3 A;  1Q8K A;  2L5T A;  1SYC A;  3GTQ H;  2Q8R E;  5FJ8 G;  1D6E C;  2ZTD A;  3PO2 G;  4AQY Q;  3V05 A;  2LXK A;  4A4I A;  4A3D H;  1IBL L;  1U4P A;  1HTL D;  3S14 H;  1Z9F A;  1KLG D;  1S5E D;  2B8G A;  3I73 A;  3T1H Q;  3Q8D A;  3CCM A;  1VQC A;  2NZO A;  3RLN A;  1VDZ A;  2K03 A;  1JC7 A;  1B9N A;  2EYF A;  1EEI D;  1C48 A;  1W6K A;  4H13 C;  2JA5 B;  4G57 A;  4DV2 Q;  3CPW A;  5IGB A;  1LTR D;  3KLS X;  4ME3 A;  1LT4 D;  3PMF A;  5ELF A;  1FNW A;  5EKK A;  2F0D A;  3K5O A;  4TKO B;  4Y7N B;  4POG A;  4IUT A;  1ZXT A;  2RF4 A;  4O0A A;  5DEH A;  5IGE A;  3C2P A;  4TSS A;  3G48 A;  3W2D A;  3S1N B;  2Z0S A;  4IQZ A;  4QMG A;  3CMA A;  1C4Q A;  5CV6 A;  4CDE C;  4QGU A;  2R7D A;  1SNO A;  3FDT A;  4RMF A;  4A3G B;  1JJC B;  3S2H H;  4OON A;  1EYG A;  2XSC A;  1J8I A;  1JB7 A;  4IUQ A;  1LO5 D;  1EIH A;  4RH6 A;  3CCU A;  1A3V A;  1EY5 A;  2A69 C;  3FKI B;  4LMQ D;  3J7A F;  2SOB A;  3SDZ A;  4QCL A;  3DUZ A;  3UDI A;  5HGT A;  1HJP A;  2ZM6 Q;  3S16 H;  2ZTC A;  5FLM G;  4A3J H;  3K0X A;  4K8I A;  5GRO A;  1FL0 A;  2F0P A;  3U50 C;  4GNX A;  2NBF A;  3I4M G;  3EBE A;  4K8J A;  1N33 Q;  4OO1 I;  1KDB A;  4HMJ A;  2KCM A;  2Z6K A;  1Q81 C;  5IT9 E;  4LW1 A;  5K36 G;  1SMY C;  3T1Y Q;  3KJO A;  3J81 i;  1VQ4 A;  2JYO A;  2XWJ B;  1A63 A;  2OTL A;  4CKB A;  1UE6 A;  2BE5 C;  2A68 D;  3GQB A;  1O7L A;  4ODG A;  5E4W C;  4Z9C B;  2CFM A;  3LNN A;  2KCN A;  3HKZ E;  2HCC A;  3K58 A;  1YJN A;  1PH4 A;  1YNN C;  3UDG A;  1VQ5 A;  2F0S A;  2UUC Q;  2JA6 G;  1YI2 A;  1HZA A;  4G4K A;  4H7B A;  2YTV A;  1G51 A;  2V4D A;  2KA7 A;  4B3S L;  1ILP A;  2ES2 A;  3LWU A;  3L9A X;  4GN5 A;  2FJ2 A;  1LTA D;  1HR0 L;  3I56 A;  3ERO A;  4IPG A;  4KD3 A;  1X3G A;  4B3M L;  4V19 0;  1QZH A;  1N9W A;  4ZAI A;  1JJG A;  1HTP A;  5ELN A;  4DR1 L;  4AYB E;  2BA0 A;  5CYU A;  4S3S A;  5C0X I;  1TS2 A;  1XTD A;  4FVM A;  4IO9 A;  1WTH A;  2F0H A;  4P71 A;  1TS3 A;  2CH4 W;  3S1Q H;  1DYQ A;  1X3E A;  4JI4 Q;  4RCO A;  1QZG A;  1MI2 A;  2Z8L A;  1XX8 A;  4HCE A;  1W3S A;  4IFD J;  4X64 Q;  3LGJ A;  1GUT A;  5DM7 3;  5IYC H;  1B70 B;  4M8A A;  1J6Q A;  5BR8 L;  5AJ3 Q;  4C1N I;  5JJI A;  1S5D D;  3AB9 A;  3MZ5 A;  2G5D A;  4K2K A;  1VQA A;  4R8N A;  1S3O A;  4AH6 A;  5C44 B;  4FO2 A;  3M3Y B;  1UE7 A;  2VQE Q;  2L15 A;  4BWG B;  5D3I B;  1X3Q A;  3HKZ G;  2UXB Q;  1SLJ A;  3CHB D;  2WII B;  1PFB A;  1EWC A;  1VQ8 A;  5EPJ A;  1XXG A;  1S5C D;  2VQF L;  3FRP B;  4HJ5 A;  3WDN A;  2EVB A;  2Z4I A;  4KKU A;  3OWF A;  3HOY H;  4LF6 L;  3RZO B;  4TRD A;  4G7H C;  3CC4 A;  2E2H B;  2NN6 I;  4KY5 A;  1C8C A;  3BZD B;  1PH2 A;  1HHV A;  4DR2 Q;  1TKW B;  1EYC A;  1ASZ A;  2KHS A;  3MXU A;  5IP9 H;  5M5X H;  3HEJ A;  4HMI A;  3DEO A;  3QJY A;  1NAP A;  2KEE A;  4IFD I;  2M2L A;  1TWH B;  4LF9 Q;  1ENA A;  2K6A A;  3MTS A;  3HP3 A;  3HOY G;  2JP1 A;  2VZA A;  3NTI A;  1QJO A;  4DV2 L;  2OCE A;  3HG9 A;  4XQN A;  1PYB A;  1N34 Q;  5CBE E;  3J81 j;  5T1I A;  4DR3 Q;  1XNQ Q;  4EQO A;  4LAA A;  4BY7 G;  1SDF A;  5C4X B;  1PYW D;  1PRT D;  4A3K H;  2B8F A;  2ICE C;  3UE1 A;  1PTO D;  1Q82 C;  5D14 A;  4A3I B;  1V1O A;  3H3V H;  1BDO A;  5KYL A;  4C3J B;  3NEN A;  3K7A H;  1WTQ A;  4LUO A;  1D8L A;  2H5X A;  4QF4 A;  4PZ7 A;  2ALY B;  3HOV H;  2MHV A;  4OIJ A;  1VQL A;  4HJ7 A;  1EFI D;  1SR3 A;  1HNW L;  2IT1 A;  1N32 L;  4UP9 A;  3LWE A;  2OT2 A;  1KDC A;  4A3D G;  2KVM A;  4DR6 L;  2AQ1 B;  4X64 L;  2FIN B;  4X3K A;  4DA2 A;  1GJX A;  4A3F G;  5CBA E;  2EXD A;  4A3M G;  4C3I G;  1TWG H;  4ID6 A;  1D7Q A;  2R7Z H;  1RKN A;  4DFA A;  5IYB G;  4JV5 L;  4GOP C;  1FGU A;  1QVC A;  1H9R A;  1GUS A;  4A93 B;  1O7Z A;  4QY7 A;  1CZW A;  3IFD A;  1T9H A;  2NVX H;  1ONL A;  3J7A V;  4IOC A;  3Q0A A;  1TY0 A;  1VQF A;  3HOU H;  2RSO A;  2KBN A;  3A55 A;  3PQI A;  3CXC A;  1PH6 A;  4IOA A;  1G6P A;  1ESR A;  3F1Z A;  2EJG C;  1EFW A;  1STH A;  1SYG A;  1QUQ B;  5G3L D;  1MSG A;  1W2B A;  3RLO A;  3L2P A;  1HZ9 A;  3HOW G;  3D6W A;  2RHQ B;  1FD7 D;  2CWA A;  3T51 B;  2F0J A;  1VQG A;  2V1C C;  1K9M C;  3R93 A;  1BO0 A;  1DOL A;  4MTN A;  5I6Y A;  1V8Q A;  3RR5 A;  2ENB A;  5D65 A;  5CV5 A;  3S1Q B;  1F2Z A;  4XIG S;  4JVZ A;  1QG7 A;  1I4Q A;  4RHS A;  1JOK A;  1FNU A;  3MXG A;  3TME A;  2B2W C;  1PRT F;  2WB1 G;  5I9P A;  3N6R A;  3PF5 A;  4YCW A;  1NSN S;  4YY3 Q;  1VQM A;  1F77 A;  1PV4 A;  1JIC A;  3T53 B;  2BDO A;  3OYY A;  1SAP A;  2D5D A;  2F0N A;  1OXX K;  2PMZ E;  1ET9 A;  3PIP 3;  1Y8P B;  4LFA Q;  3T56 B;  4JPB W;  1H9J A;  4HJ8 A;  2R92 H;  1QE6 A;  4C3I H;  1XMQ Q;  3GTO H;  2NTT A;  2FHT A;  4A3F H;  2F3I A;  4A75 A;  3SK4 A;  1HQR D;  1RHP A;  1LTG D;  3N52 A;  4V0B A;  4PNY A;  2R6G A;  4QIW B;  4LFB Q;  1JOO A;  4NB3 A;  1STY A;  2ICI A;  2B2U C;  3DEP A;  4HTH A;  3I7F A;  4QB4 A;  3S1R B;  1HA5 A;  3VR3 A;  4LFC Q;  1O80 A;  1LT5 D;  1FJG Q;  1V43 A;  2F0W A;  2BOS A;  4KKS A;  5IYD G;  2TMP A;  1I6H B;  1HR0 W;  2F03 A;  1OXV A;  1K83 B;  2KHI A;  4FNF A;  1SE8 A;  4JI4 L;  4GKJ Q;  5M9O A;  2EOT A;  1Q1E A;  1I4G A;  2CQA A;  1T5X D;  3NPP A;  3FHW A;  1M1K C;  3MHB A;  4DV5 L;  1XYI A;  5JEA J;  2OQK A;  2Z1C A;  2MO0 A;  5EGT A;  1WFQ A;  1K73 C;  3KBX A;  3BVZ A;  2MJ8 A;  2WP8 J;  5COY A;  3A7L A;  4MIU A;  1K3R A;  2X6L A;  5GAD C;  4C2M H;  2IY5 B;  3JAM c;  3J7A 5;  1AE3 A;  1CKM A;  5C4X H;  5ELD A;  2A6E D;  3F2U A;  1JE4 A;  1SBB B;  3MXN A;  2UU9 L;  3G7L A;  5DM6 3;  2R93 G;  1PMR A;  3CQZ H;  3D0F A;  1PH9 A;  3DXJ C;  2F0K A;  3VR5 A;  2A73 B;  3GTG B;  3NBH B;  1N36 L;  1MHW C;  3KLW A;  4OGQ C;  1KTK A;  4LF7 Q;  4KV6 A;  4P75 A;  3D6C A;  3DM3 A;  2K50 A;  4XQQ A;  3I3C A;  1UEA B;  3FP9 A;  4DAP A;  2KJX A;  5IY0 A;  3VA5 A;  1HRJ A;  3M7G A;  1UWV A;  1PLF A;  2WB1 B;  5C5M A;  2K14 A;  5FO7 B;  3OWE B;  2BCO A;  4R8I A;  5C3E B;  4R4I A;  4IPH A;  2F0L A;  2K5N A;  2K4K A;  3O13 A;  4DV6 Q;  4A93 H;  1TWF B;  4KJN A;  2JA9 A;  1E3P A;  3RLF A;  3A8K E;  3S17 H;  3TZU A;  3UI2 A;  2EYO A;  4L5S A;  1GVP A;  5I2X A;  4JBW A;  4EQN A;  4PZ6 A;  1VQJ A;  5IYC G;  2X6G A;  4KD4 A;  3GO5 A;  1MSH A;  2M9V A;  4JI7 L;  4DR7 L;  2NUC A;  4JI2 L;  3M4O B;  3D3R A;  2K33 A;  1JOQ A;  3CD6 A;  3KLR A;  3J81 E;  3NBH A;  1H9S B;  4N8F A;  1K8A C;  2KEC A;  2L12 A;  3KFU A;  5IOC A;  4FF4 A;  5C3X A;  1EWI A;  4IPD A;  1STB A;  2HDL A;  3A5Z B;  3QB3 A;  4GLX A;  3DMU A;  1EY4 A;  1U5K A;  1EY8 A;  1TS4 A;  2LY7 A;  2K75 A;  2KED A;  4JI2 Q;  5LMU Q;  3Q6S A;  1QIL A;  4X3S A;  2JA6 B;  1SNP A;  4IUP A;  4K6L A;  3NP8 A;  2R93 H;  2JA7 H;  1I50 B;  3J81 c;  1V1P A;  1DOM A;  4B3R Q;  2A19 A;  1HNX Q;  4CHT B;  1Y1V B;  2EYP A;  4ZK9 B;  3H15 A;  2QDL A;  4C3I B;  1GUO A;  3C1F A;  3CW2 C;  2SDF A;  1JOR A;  2OF1 A;  2PQA A;  1N36 Q;  1ENF A;  4WJ3 M;  4JYA Q;  5M3F B;  2K7V A;  2NVT B;  1FGB D;  2L4N A;  1SYD A;  5LL6 S;  5BN3 A;  2J7Z A;  3VR6 A;  5BR8 Q;  3D8G A;  5M5Y B;  3BDO A;  4JBM A;  3S14 B;  1X55 A;  1L1O A;  1J5E Q;  2PCF B;  1UE1 A;  4NW2 A;  3PUV A;  4DV4 L;  3TS2 A;  1ICW A;  1I6H H;  1EU4 A;  1Q7Y C;  4RGM A;  4LF8 L;  4IUU A;  2HHH Q;  4J1M A;  2EYL A;  2JA5 H;  1LT3 D;  2FMC A;  1G6Z A;  5CMD A;  3CC7 A;  4DR1 Q;  1SRO A;  2A8V A;  4NXM Q;  2RA4 A;  1STG A;  3K5M A;  5A2Q L;  3I91 A;  4DAV A;  1JWM D;  3UDF A;  4CKC A;  3DWA A;  3EJI A;  2UXB L;  1DJR D;  1NJI C;  1QNK A;  3B6Y A;  1I6V C;  2B63 G;  3Q23 A;  1YNJ C;  2HIV A;  2NN6 H;  3S1N H;  2VL6 A;  3E6Z X;  4OL7 A;  3S2D B;  1SE4 A;  3SXH A;  4RA8 A;  5M5X B;  3TSS A;  3S2H B;  3OPO A;  3AQQ A;  4AYB B;  2EZV A;  1MJC A;  3CQZ B;  3KJP A;  3S15 B;  4JYA L;  3HS0 C;  3I8Z A;  4L5R C;  1L0Y B;  2JA5 G;  1A15 A;  3TP7 A;  1EOT A;  1AP0 A;  2NZH A;  2L9H A;  3PCO B;  4YWL A;  4JI5 Q;  1XNR L;  4XXE A;  1KXL A;  2BA1 A;  4BXX G;  1TY2 A;  1P8L A;  2E2D C;  1B44 D;  4A3J B;  5IOD A;  3ERS X;  2YTY A;  1RDP D;  1ESF A;  4DAY B;  3EVQ A;  1D1K A;  2EYJ A;  4QUF A;  2NTS A;  4E6I A;  3NEM A;  3QG1 A;  4B9X A;  4A3B B;  5LMU L;  3URY A;  3SVM A;  4YY3 L;  3CP0 A;  3STB C;  3RMH A;  2F0Q A;  2IL8 A;  4C3J H;  1VQ9 A;  4DNR B;  3WOE A;  4BBS H;  4XYO A;  4KJO A;  3ERQ A;  2GVB A;  1JE5 A;  4FYD A;  3K80 C;  4YCV A;  1OXU A;  2N55 A;  1E1O A;  2FMM A;  2MO1 A;  2F0G A;  1QB5 D;  2GN5 A;  3MA2 B;  2VS1 A;  1R9T B;  1IYU A;  4A3M H;  3L7Z C;  1AN8 A;  1TS5 A;  2VB2 X;  5GQO A;  1TWA B;  4JI8 Q;  1K3B C;  5DLQ E;  1HNZ Q;  2R3Z A;  3HKS A;  1L0W A;  2R7Z B;  2LXJ A;  3OIP A;  5JOB A;  2LKV A;  3NE5 B;  4DUY L;  4L5Q A;  2EJF C;  2OWO A;  3GTK H;  1Z6H A;  4XT3 B;  4DK0 A;  3PIO A;  1PHJ A;  4DK1 A;  1SXT A;  4FF1 A;  1DM0 B;  1SNQ A;  1U4L A;  2EYH A;  3KF8 A;  4ZKC B;  4DR7 Q;  5C5L A;  1E2W A;  2N3S A;  3W1B A;  2WAQ G;  4OHJ A;  1QVG A;  1Y8N B;  1IZ6 A;  4IAL A;  2AUK A;  3S1M H;  1LTS D;  4A3B G;  5J1Z A;  5CGK A;  4AQY L;  5JVG 3;  1SJH D;  2E5L L;  3CKI B;  2JA8 G;  4DV6 L;  1PTO H;  4OO1 H;  1A3U A;  2XWB B;  2RKS A;  3TEH B;  3JAM E;  1IKL A;  2EY5 A;  4KY7 A;  2PQE A;  3H94 A;  3ITP A;  4JI6 L;  3MWY W;  2SNS A;  2E2H H;  1QVF A;  4KTA A;  3U4Z A;  4JCV E;  4JI0 Q;  3BDC A;  3GTP B;  2RBM A;  2BH2 A;  3UE0 A;  2A6H D;  1JR0 D;  1WJJ A;  2B63 B;  3CCS A;  2KHJ A;  1KNE A;  4CJ1 B;  1I3Q B;  4YIJ A;  3TZD A;  3GTQ B;  2DNE A;  2O5J C;  3I4N H;  1VF7 A;  2LFN A;  4FXD A;  4KHP Q;  4RHR A;  4JBK A;  4LJZ C;  1QWY A;  1S5F D;  4A3C H;  4A3G G;  2E76 C;  2QCP X;  2D9U A;  1UEB A;  4UAI A;  2BDN A;  2K5W A;  4ZUI A;  5IP9 G;  2XRS D;  4DR3 L;  5C4J H;  5BN4 A;  1D1I A;  2NVY H;  2A1A A;  1K83 H;  1CTM A;  2PZW A;  3OTO L;  1S72 A;  1Y1W H;  1SRU A;  3S15 H;  1B8A A;  4R4C A;  1SSO A;  4RGN A;  3U9S A;  3QIA A;  4X65 Q;  2KEN A;  1E24 A;  3GV3 A;  2XGT A;  4APV A;  4MNO A;  1WTV A;  3I4L A;  2AWN A;  4R4O A;  1EY7 A;  2UUA Q;  1Y1V G;  1VQD A;  1NNX A;  5I6W A;  4NDX A;  1BCP B;  4J6H A;  2VQE L;  1YJ9 A;  3A5U A;  1GUW A;  3ICE A;  4PV1 C;  1HFN A;  3QOJ A;  3OHX C;  1XMO L;  1KL9 A;  1G91 A;  4A3G H;  1YNX A;  3FMC A;  4DR4 L;  4X66 L;  3X3N A;  5JJZ A;  4KN4 C;  4QJF A;  1VS0 A;  1LLR D;  2NVQ B;  4H02 A;  4N8X 1;  4LF6 Q;  2ZM6 L;  1ENC A;  2QW7 A;  1VQE A;  3VYU A;  2JEB I;  2PYK A;  3GTG H;  3NK9 A;  1PFN A;  4ILW A;  1NR4 A;  3CCJ A;  1VQI A;  2RSN A;  5KND A;  3PF4 A;  5I9O A;  1EQQ A;  3BG3 A;  3J80 L;  2UUB L;  1EY0 A;  1L1O C;  1WTO A;  1JB3 A;  1TXY A;  5C3W A;  1CUK A;  4R4T A;  4X62 L;  4B08 A;  1KDA A;  5A35 A;  2QKI C;  5M3M H;  2A74 C;  4POF A;  4LF4 Q;  1ML0 D;  1MGS A; 
#chains in the Genus database with same CATH homology
 4JI3 L;  1RL2 A;  5IYD G;  1HR0 W;  1OXV A;  1HZB A;  2KHI A;  2IHF A;  3ER0 A;  2HT1 A;  2ATW A;  1SE8 A;  4JI4 L;  4GKJ Q;  2K5H A;  1VQB A;  1C9O A;  2VY3 A;  5GAH C;  4DUZ Q;  5C3E H;  4OO1 G;  1YEZ A;  1Q1E A;  1XMQ L;  1LYL A;  4A3L H;  1TWF H;  3FHW A;  1M1K C;  4DV5 L;  1TWH H;  1X56 A;  5JEA J;  2OQK A;  4YHH Q;  4X65 L;  4JV5 Q;  2MO0 A;  3EN2 A;  5FLM H;  1WFQ A;  1K73 C;  5IT9 c;  5JJK A;  2RHS B;  2VUM H;  2YYZ A;  2WP8 J;  2MNA A;  1IL2 A;  4JOI A;  4LF5 Q;  4A3E H;  2ID0 A;  1K3R A;  2ZJR A;  3J80 i;  5GAD C;  4C2M H;  2IY5 B;  3F8T A;  4JC0 A;  3JAM c;  2PI2 A;  4YCU A;  1FJG L;  4QL5 A;  5IP7 H;  3AFP A;  3J7A 5;  3S2D H;  1AE3 A;  1CKM A;  2LSS A;  5C4X H;  4A3C G;  3A0J A;  4PZ8 A;  2UU9 L;  5C44 G;  2JA7 G;  1V9P A;  5EAY A;  2UUA L;  4GKK Q;  1N32 Q;  4X66 Q;  2R93 G;  3CQZ H;  1PH9 A;  3D0F A;  2NVQ H;  1YHB A;  2YU9 H;  4OWW B;  2WFW A;  2IX1 A;  1EIF A;  5IWA Q;  1MIU A;  3CC2 A;  4A3I H;  2JQO A;  5C3E G;  3KOJ A;  3U58 A;  3NBH B;  1HH2 P;  4P74 A;  1N36 L;  1KHI A;  1OXT A;  4LNQ A;  4DV1 L;  4BXX H;  3KLW A;  2N49 A;  4LF7 Q;  2R7F A;  2EIF A;  3F2D A;  4DR5 L;  4P75 A;  2E8G A;  2AKW B;  3A74 A;  3DM3 A;  1NE3 A;  2K50 A;  4OXP A;  3RZD H;  3W5O A;  3ULJ A;  4LFA L;  2ASB A;  3FP9 A;  1NY4 A;  2I5M X;  4B3T L;  1EQR A;  4A76 A;  2HQL A;  4TQU S;  5IY0 A;  3AEV A;  3HOU G;  2UXD Q;  4DV7 Q;  1CKO A;  2ZJQ A;  3KF6 B;  1IBM Q;  4QQB X;  3CME A;  1NBW A;  3S1R H;  5C44 H;  1S40 A;  5LMN Q;  4OWX B;  1UWV A;  3H0G H;  2VQF Q;  4HIK A;  3M9B A;  4L5T A;  3M7N A;  2K14 A;  3KF6 A;  3PGZ A;  3G71 A;  4IJH A;  3VDY A;  4P73 A;  1VQO A;  2B63 H;  4DPG A;  3GTL H;  2JA8 H;  4R4I A;  4IPH A;  3K7U C;  1MKH A;  2K5N A;  2K4K A;  2E2I H;  1I3Q H;  3KF8 B;  4DV6 Q;  4A93 H;  4XTC S;  1Q8K A;  1EIY B;  2I5H A;  1YVC A;  1IBK Q;  3ULL A;  3GTQ H;  1V1Q A;  2JA9 A;  1E3P A;  3RLF A;  1XJV A;  1PH7 A;  1KC8 C;  3S17 H;  4NXM L;  5FJ8 G;  2ZTD A;  3PO2 G;  4L5S A;  4AQY Q;  2E5L Q;  1OTC A;  1LUZ A;  1GVP A;  1G29 1;  3IRB A;  3CCQ A;  4A4I A;  2LXK A;  4JBW A;  4A3D H;  1IBL L;  3CCR A;  4DV0 L;  4PZ6 A;  1VQJ A;  1Z9F A;  2N78 A;  4LWC A;  5IYC G;  3S14 H;  4BBR G;  3T1H Q;  3GO5 A;  2YTX A;  5M3F G;  3Q8D A;  3CCM A;  1VQC A;  2NZO A;  4GS3 A;  2JJQ A;  3T1H L;  3RLN A;  3U4V A;  4DR2 L;  3H0G G;  4JI7 L;  4DR7 L;  4JI2 L;  5IYD H;  3HOV G;  1PYS B;  4B3T Q;  3CD6 A;  2WB1 E;  4DV0 Q;  4LF7 L;  1EUJ A;  4DV2 Q;  2AWO A;  3CPW A;  1KIX A;  1K8A C;  4ME3 A;  4YHH L;  1Y1W G;  1JJ2 A;  1VQ6 A;  3KFU A;  4RG1 A;  2Y0S E;  3PO2 H;  4A3J G;  3GTM H;  1PVO A;  1EWI A;  4IPD A;  4POG A;  3A5Z B;  1SN8 A;  2RF4 A;  4O0A A;  4GLX A;  1HR0 Q;  4BY7 H;  4GLV B;  3TQY A;  1U5K A;  1VCI A;  4GOP A;  3NEL A;  3G48 A;  2R92 G;  4OWT B;  2Z0S A;  2K75 A;  4JI2 Q;  5LMU Q;  3CMA A;  3E9H A;  2F4V Q;  4QGU A;  2UU9 Q;  1WCM H;  2R7D A;  3PIP A;  2UXD L;  4RMF A;  4NPS A;  1JJC B;  3S2H H;  4C3H H;  1IBM L;  4AYB G;  4OON A;  3HOZ G;  3HOZ H;  2JA7 H;  2N8N A;  4R1J A;  4DV7 L;  1EYG A;  3J81 c;  1IBL Q;  1WCM G;  4B3R Q;  1JB7 A;  2A19 A;  1HNX Q;  1NTG A;  1BBW A;  3I55 A;  1Y14 B;  2D0O A;  1N34 L;  1XNQ L;  4Y52 H;  2MQH A;  3CCU A;  4BBS G;  4A3E G;  3CCV A;  2HHH L;  3H15 A;  3UDI A;  5GAE C;  1HJP A;  3CW2 C;  2ZM6 Q;  3S16 H;  2PQA A;  2ZTC A;  5FLM G;  4A3J H;  1N36 Q;  2EQS A;  3K0X A;  4DV3 L;  1K0R A;  4JYA Q;  5GRO A;  4WJ3 M;  2WAQ E;  4NXN Q;  1FL0 A;  3U50 C;  4K0K Q;  1NMG A;  1YBY A;  4GNX A;  3I4M G;  5HY6 A;  3EBE A;  4LUV A;  1UE5 A;  3UDX A;  1N33 Q;  4OO1 I;  5BR8 Q;  5H1S E;  2R93 H;  1VQK A;  4JBM A;  4GNX B;  2KCM A;  1X55 A;  2Z6K A;  1L1O A;  5ELO A;  1VQP A;  1Q81 C;  1J5E Q;  4LW1 A;  1HNZ L;  5K36 G;  3GTP H;  1UE1 A;  3T1Y Q;  3HOX H;  3KJO A;  2AMC B;  3J81 i;  1VQ4 A;  4LF5 L;  3TS2 A;  3PUV A;  4DV4 L;  1ASY A;  2OTL A;  3BZC A;  5IP7 G;  1Q7Y C;  1I6H H;  1A63 A;  1AH9 A;  1UE6 A;  4LF8 L;  4GLA C;  1CKN A;  2HHH Q;  2JE6 I;  2UUC L;  4HIO A;  2JA5 H;  2BH8 A;  4DAM A;  4JG2 A;  2CFM A;  3ZJY C;  3HFZ B;  3CC7 A;  3HKZ E;  4DK3 C;  4DR1 Q;  1SRO A;  2VUM G;  1M90 C;  4NXM Q;  2A8V A;  1YJN A;  4KLK A;  1PH4 A;  2I0Q A;  3OTO Q;  5JJL A;  4DV5 Q;  3UDG A;  3UDF A;  1VQ5 A;  2UUC Q;  4GKJ L;  3K81 C;  2JA6 G;  5IWA L;  3M85 A;  1HZA A;  2DGY A;  1YI2 A;  1NJI C;  4A93 G;  2YTV A;  3B6Y A;  1G51 A;  2UXB L;  3J80 c;  4JI3 Q;  3OW2 A;  2XTI A;  1XMO Q;  1QUQ A;  1Z47 A;  1R9T H;  2ES2 A;  4B3S L;  2B63 G;  2PQA B;  4GN5 A;  5IYB H;  1E7Z A;  1C0A A;  3S1N H;  2HIV A;  4HJ9 A;  1JT8 A;  4JOI C;  2VL6 A;  1TWA H;  1HR0 L;  1BKB A;  1X65 A;  3I56 A;  3CF5 A;  4IPG A;  1N33 L;  1X3G A;  3GDE A;  3AQQ A;  4UP8 A;  1MJC A;  4KHP L;  4B3M L;  1L1O B;  1X54 A;  3G6E A;  1QZH A;  3CCL A;  3DLL A;  1N9W A;  3KJP A;  4JYA L;  1JJG A;  3JC6 6;  1CSQ A;  5ELN A;  3BJU A;  4AYB E;  4DR1 L;  2JA5 G;  4L5R C;  2BA0 A;  5C0X I;  3CAM A;  1XTD A;  2NZH A;  1Y1V H;  4IO9 A;  3MEF A;  3PCO B;  4YWL A;  4EX5 A;  4P71 A;  1PH1 A;  4JI5 Q;  1XNR L;  3D31 A;  2BA1 A;  4BXX G;  3S1Q H;  1KXL A;  1P8L A;  1E22 A;  1X3E A;  3S24 A;  4JI4 Q;  1CSP A;  4DNI A;  1QZG A;  3ERS X;  3T1Y L;  1XPR A;  2YTY A;  5M3F H;  4DAY B;  1W3S A;  4IFD J;  1GO3 E;  4X64 Q;  3LGJ A;  5LMN W;  3TS0 A;  5IYC H;  4A3I G;  1B70 B;  1VQ7 A;  2UXC Q;  2Z6K C;  1X9N A;  1J6Q A;  4KHZ A;  5BR8 L;  5AJ3 Q;  3NEM A;  2MFI A;  5JJI A;  3WWV A;  3EIV A;  5AJ3 L;  5LMU L;  4JI1 L;  3CP0 A;  4YY3 L;  1CKN B;  1VQA A;  4NXN L;  1S3O A;  4AH6 A;  5C4X G;  2UUB Q;  3KYH C;  1XPO A;  3STB C;  2D0P A;  1UE7 A;  2VQE Q;  2L15 A;  2VNU D;  2IHE A;  4C3J H;  1VQ9 A;  3HKZ G;  2UXB Q;  2GVA A;  1SLJ A;  4BBS H;  3PUW A;  4B3S Q;  3H3V I;  1VQ8 A;  2GVB A;  3I2Z A;  2VQF L;  1WOC A;  1NMF A;  1JE5 A;  3PUX A;  4IPC A;  4HJ5 A;  4LF8 Q;  4IJL A;  1KRT A;  3HOY H;  4J15 A;  4LF6 L;  2CKZ B;  3K80 C;  4YCV A;  3CC4 A;  2ZTE A;  3G4S A;  1OXU A;  2NN6 I;  1E1O A;  1PH2 A;  1I94 Q;  1BBU A;  2MO1 A;  4B3M Q;  2JK8 A;  1B7Y B;  2GN5 A;  3TRZ A;  2VS1 A;  1XPU A;  4DR6 Q;  4X6A H;  4DR2 Q;  1GKH A;  4JI7 Q;  4R4Q A;  2QA4 A;  5FLX c;  1ASZ A;  4BA2 I;  4A3M H;  1I5F A;  1KQS A;  2F4V L;  2OTJ A;  3L7Z C;  1HZC A;  3F2C A;  1OXS C;  4DR5 Q;  5GQO A;  4JI8 Q;  2ZJP A;  4JI6 Q;  2B3G A;  4YWK A;  3M4O H;  1A62 A;  3M4P A;  5DLQ E;  1PH8 A;  1L2F A;  5IP9 H;  3HKS A;  1L0W A;  5M5X H;  1HNZ Q;  2LXJ A;  1Q46 A;  1GD7 A;  4K0K L;  5C0X G;  3TRE A;  2D62 A;  4IFD I;  2IX0 A;  2K52 A;  4L5Q A;  4DUY L;  2CQO A;  3RN2 A;  2OWO A;  4FDB A;  4LF9 Q;  3AYH B;  3GTK H;  3HOY G;  3PO3 H;  1FVI A;  3PIO A;  3E0E A;  1IYJ B;  2VZA A;  1PHJ A;  4Y7N H;  4PMW A;  3KDF B;  4B3R L;  4DV2 L;  1LTL A;  2PI2 E;  3CPF A;  1C7Y A;  4DR7 Q;  2OCE A;  4BA1 I;  1YZ6 A;  4BBR H;  1PYB A;  3MXN B;  1N34 Q;  1XNQ Q;  3J81 j;  4DR3 Q;  3E9I A;  1P16 A;  2N3S A;  3W1B A;  4BY7 G;  2WAQ G;  2B29 A;  2JA6 H;  1QVG A;  1IZ6 A;  3KDF A;  4A3K G;  1J5E L;  3S1M H;  4A3B G;  4MZ9 A;  2F52 A;  4AQY L;  2YV5 A;  1I50 H;  4A3K H;  3UE1 A;  1Q82 C;  3M3Y H;  1SMX A;  2E5L L;  5C0X J;  3H3V H;  2JA8 G;  1SFO H;  4DV6 L;  2RCN A;  3NEN A;  1GM5 A;  3K7A H;  1PH5 A;  4LUO A;  1RIP A;  1D8L A;  2H5X A;  3GTJ H;  4PZ7 A;  3TEH B;  5JEA G;  2HIX A;  2VW9 A;  1PFS A;  2ALY B;  3HOV H;  1AE2 A;  1H95 A;  4AIM A;  4DKA C;  4DUY Q;  1VQL A;  3K8A A;  1PA6 A;  1WI5 A;  4O2D A;  4HJ7 A;  4LFC L;  1SR3 A;  4GN3 B;  4P72 A;  4JI8 L;  4JI6 L;  3RZO H;  3GD7 A;  1HNW L;  2IT1 A;  1N32 L;  4UP9 A;  1TWC H;  2C35 B;  5LMN L;  2E2H H;  4GOP B;  1QVF A;  1I94 L;  4A3D G;  2AHO B;  1YHQ A;  4DR6 L;  3U4Z A;  2CCZ A;  4X64 L;  4JCV E;  1Q12 A;  4JI0 Q;  1JMC A;  3HOW H;  4GNX C;  1WYD A;  3PUZ A;  1X3F A;  1N8R C;  4A3F G;  2BH2 A;  3UE0 A;  4OX9 Q;  2Y0S G;  4DK6 C;  2EXD A;  4A3M G;  1A0I A;  1O7I A;  5GAG C;  4PG3 A;  4BY1 G;  1TWG H;  1KRS A;  1WJJ A;  1D7Q A;  2R7Z H;  5IYB G;  4JV5 L;  3CCS A;  1E1T A;  1FGU A;  1QVC A;  1DGS A;  2KHJ A;  2Q2I A;  4GOP C;  1YIT A;  4DV1 Q;  4UP7 A;  4QY7 A;  4QIW E;  5IE8 A;  1T9H A;  2NVX H;  4LF9 L;  3I4N H;  3I4N G;  4UPA A;  4IOC A;  1MJE A;  2KCT A;  1IBK L;  4JBK A;  4KHP Q;  4WJ4 A;  2QEX A;  1VQF A;  4A3C H;  2Q2U A;  3HOU H;  4A3G G;  2KBN A;  3CCE A;  1Q86 C;  3RNU A;  3CXC A;  4ALP A;  1UEB A;  1PH3 A;  2Q2T A;  1PH6 A;  4IOA A;  1G6P A;  1A8V A;  3F1Z A;  5IP9 G;  4OX9 L;  4YWM A;  4UY8 C;  1KAW A;  3PUY A;  1EFW A;  1K8G A;  4DR3 L;  5C4J H;  3I4O A;  1QUQ B;  4TVA B;  1YIJ A;  2NVY H;  2A1A A;  1W2B A;  1K83 H;  3RLO A;  1HZ9 A;  4LUZ A;  4JI5 L;  1YHA A;  3L2P A;  3HOX G;  4JI0 L;  2QGQ A;  5E7N A;  1XNR Q;  4LFB L;  2RHQ B;  1U0L A;  3OTO L;  4KI0 A;  2CWA A;  1BVS A;  1S72 A;  4EQ5 A;  1SRU A;  1VQG A;  1Y1W H;  2V1C C;  3S15 H;  1B8A A;  4R4C A;  1K9M C;  4A3L G;  3SGI A;  1X6O A;  1YJW A;  1Q1B A;  3ULP A;  4MTN A;  4X65 Q;  2KEN A;  3JAM i;  3BZK A;  4HJA A;  1E24 A;  3RR5 A;  3I4M H;  2XGT A;  4APV A;  4MNO A;  2JEA I;  2AWN A;  4R4O A;  3RN5 A;  3PV0 A;  4DUZ L;  3AFQ A;  2UUA Q;  4XIG S;  1IXR A;  1Y1V G;  1VQD A;  4LF4 L;  2VQE L;  3STB D;  1YJ9 A;  3A5U A;  3ICE A;  3BU2 A;  1XMO L;  2WB1 G;  1KL9 A;  3PF5 A;  4YCW A;  4JI1 Q;  1YNX A;  4YY3 Q;  4A3G H;  1VQM A;  5FJ8 H;  4DR4 L;  1LM0 A;  2PNH A;  4X66 L;  1PV4 A;  4GKK L;  2Q2H A;  4QJF A;  4A3B H;  1VS0 A;  1VQH A;  5J3B A;  2K5V A;  3OYY A;  4H02 A;  2UXC L;  2PMZ E;  1KD1 C;  1OXX K;  2ZM6 L;  4LF6 Q;  1VQE A;  4LFA Q;  2JEB I;  3GTG H;  2NN6 G;  3FKI G;  3F2B A;  3FKI H;  3HOW G;  2R7Z G;  2E2J H;  4HJ8 A;  3PSI A;  2R92 H;  1EOV A;  4C3I H;  3CCJ A;  1XMQ Q;  4BY1 H;  2FXQ A;  3GTO H;  4GN4 B;  1VQI A;  4DV4 Q;  4A3F H;  3PO3 G;  5M5W H;  1VQN A;  3L0O A;  2F3I A;  4A75 A;  1HNX L;  5HGQ A;  3PF4 A;  2CWP A;  5M3M G;  2OQ0 A;  2I5L X;  4JBJ A;  1EQQ A;  2NVT H;  2R6G A;  2UUB L;  4HID A;  4LFB Q;  1L1O C;  4DR4 Q;  4NB3 A;  4X62 Q;  5M5Y H;  1TXY A;  2DUD A;  1CUK A;  3I7F A;  4IFD G;  4R4T A;  4X62 L;  1HNW Q;  3M4Q A;  3W1G A;  5M3M H;  4POF A;  4LFC Q;  4HIM A;  3J7Z C;  4DV3 Q;  4LF4 Q;  1FJG Q;  1V43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...