4JI4M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 25
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ji4M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4ji4M02
3A42A 1HNXM 1L1TA 5ITUA 3GQ5A 4NXNM 4AQYM 4B3MM 4JV5M 3SAWA 1N33M 4G4QA 2F5QA 3SARA 3U6CA 4KHPM 3A46A 1I94M 3GP1A 3U6OA 1L2CA 4NXMM 4JI6M 4DR2M 5ITTA 5A2QS 1N36M 4X62M 1MX0A 4JI5M 2OPFA 1XMOM 3SASA 5FLXS 3U6PA 4YHHM 4B3SM 4DV1M 3TWMA 5BR8M 3W0FA 1KFVA 4DV0M 1HR0M 2HHHM 4JYAM 4DR6M 1Z5CA 1NNJA 4JI3M 1Q3CA 4NRVA 4LFCM 2UUBM 4G4NA 5ITQA 3GQ4A 3T1YM 4LFBM 3SAUA 2F4VM 5ITXA 3T1HM 1PJIA 3SATA 4LFAM 1IBMM 3SBJA 3A45A 2ZBKB 3VK8A 4DV2M 2HKJA 2XZFA 1K3XA 1R2ZA 3GPUA 1L2DA 4DR1M 3U6QA 4LF5M 1XC8A 4DV3M 4PD2A 1Q39A 3GQ3A 4DR5M 1HNWM 3TWKA 2UXCM 4JI4M 2VQFM 4DUYM 3JR4A 3GO8A 1L1ZA 4DV5M 3U6LA 1XNQM 3VK7A 4LF6M 2F5SA 2F5PA 2Q2EB 5IWAM 4OX9M 4MB7A 1MU5A 1PM5A 4DUZM 4JI2M 4LF4M 4G4RA 5ITYA 1J5EM 4B3RM 3U6DA 4JI7M 4PDGA 2EA0A 5ITXE 1Z5BA 4JI8M 3U6SA 3JAMS 1TDZA 3J80S 4X64M 3JR5A 3U6MA 2UU9M 3U6EA 4NRWA 4JI0M 1XNRM 5LMNM 1TDHA 1Z5AA 4DV4M 1IBKM 1HNZM 2OQ4A 4JI1M 3DOAA 2UXDM 4G4OA 2UUCM 2E5LM 2F5OA 4DR7M 1N32M 1FJGM 1PJJA 1IBLM 1EE8A 2F5NA 2VQEM 3TWLA 4DV7M 4DV6M 4LF8M 3J81S 4K0KM 3C58A 1R2YA 1Z59A 5ITRA 1XMQM 1K3WA 5LMUM 2XZUA 4DR4M 3GPPA 4PDIA 4X65M 4B3TM 4GKKM 2UXBM 2ZM6M 4LF7M 1L2BA 5IT9S 3OTOM 4DR3M 4GKJM 1Q3BA 3GPXA 2UUAM 4X66M 4PCZA 3GPYA 3SAVA 4CISA 1K82A 4ITQA 4LF9M 1N34M 4YY3M 3J7AS
chains in the Genus database with same CATH superfamily
2XLJA 4Y28F 1HNXM 2ZTCA 1DO2A 1R6BX 1L1TA 4B3MM 3SAWA 3CF2A 1N33M 2N35A 1TGUA 4LRSA 4KT0F 5EP1A 1GJSA 1I94M 4LZJA 3GP1A 4NXMM 2YQZA 1VQ1A 2KW0A 3A98B 4S12A 2CV1A 1NY5A 2H5XA 1IXSA 1W5SA 2FH0A 4GH9A 5A2QS 1N36M 4X62M 3E21A 3CTWB 3TPZA 2AHMA 3SASA 2FFJA 3M0EA 1D0KA 5FLXS 2WSFF 5BR8M 1JB0F 3W68A 3QAUA 2KXEA 1QDRA 1OFHA 1Z5CA 4QHTA 5EXSA 4AKHA 1QAQA 2DWLA 4JXJA 5FTLA 2JZ1A 4QOZC 2KA6B 4IBKA 2JXNA 2BWEA 4FW9A 2KRKA 2RKOA 1QDTA 1IM2A 3V76A 1IY1A 4L8RC 1XXHB 5ITXA 1PGYA 1FNNA 1IBMM 3W0LB 2LVQD 1QQWA 5C1BA 3VK8A 3L26A 3FUTA 4LJ6A 1GJTA 1VEJA 4QNMA 5KQ8A 3UGJA 4DR1M 4AZFA 2LVPC 2R65A 4I81A 5DNYA 3QYBA 4LJ9A 4DV3M 1Q39A 4DR5M 3GLIB 1HNWM 4TUWA 3TWKA 3L29A 4D80A 1NO1A 4I8OA 1VDDA 4MM3B 2QENA 4F1IA 1XNQM 2EKKA 1CUKA 3SYKA 2F5SA 2Q2EB 2R4JA 3HJ8A 2EO2A 1R5LA 4MB7A 4KLNA 2XEPA 3THGA 4OX9M 1MU5A 1IY2A 5DYGA 3KSXA 4RF0A 1PM5A 2QCUA 2FNAA 3HGIA 3VDUA 4ANRA 1TH4A 3HJSA 5ITYA 4B3RM 4JI7M 1DGHB 1G4AE 2JY6B 5ITXE 1YE9A 3VKHA 4G6ZA 4QNRA 3ZCBB 4JI8M 3H4JA 3PVSA 1QAOA 4HL4A 1VEGA 1UFZA 1JR3D 1ZAEA 4X64M 4IBGA 3JR5A 3U6MA 3U6EA 2QHOB 2GQFA 3FYCA 1C1KA 1XWIA 2WSEF 4NC6A 4JI0M 3UJNA 1TTEA 4L4UA 1E9RA 1IQPA 1IBKM 1IN8A 2OQ4A 2R45A 3HU2A 5E6JA 2LHCA 2R46A 2UUCM 2E5LM 2UXDM 4LCBA 1QVRA 1N32M 1LTMA 1QZEA 2J5YA 1V34A 3FRHA 2P5TA 3D8LA 3GRYA 1TH2A 2DAIA 5EJCA 3TWLA 4AW4A 4IBDA 4K0KM 2RGHA 3NBXX 2MGWA 1Z59A 2D7GA 2KZUA 2LWXA 1IFYA 1K3WA 1NV9A 2W82A 4G3OA 1IY0A 2R44A 4AG6A 4CIZA 2XZUA 4DR4M 4X65M 5BPVA 1ZMVA 3RE8A 2H1RA 5DFLA 4LG2A 4GKJM 3R9XB 2DZNB 1KYIA 3IHPA 1A5TA 2WZJA 4PCZA 1VDLA 3GLHB 2XFSA 3GLHA 4RNAA 2L6OA 4CISA 4AKGA 4NOOB 4BLCA 1IN7A 4YY3M 2EUCA 3J7AS 4BB9A 3FUVA 3AL0C 1PJTA 3KDSE 4JV5M 1IN4A 2QZ4A 5DYIA 1IN5A 3KSJA 4FWDA 2I7PA 4LJ8A 4REZA 4KHPM 2HAKA 5GKNA 3U6OA 5ITTA 5EXTA 1HQYE 1E9SA 1XB2B 4CJ6A 1SXJC 3AOEA 4MGKE 1J09A 2ZAOA 1HT2E 4JI5M 2OPFA 1XMOM 2JY5A 5IZ7D 2Z3XA 2EJSA 4B3SM 1ZMWA 4LZZA 2M5ZA 2DAGA 3K9PA 3BBZA 5KPTA 2RRUA 3BOSA 2HHHM 2HWJA 3B7ZA 4W5WA 1Q3CA 3W67A 1QUSA 3KS8A 2CV2A 4AI6A 3FTFA 1SXJB 2X8AA 2YFQA 3KP0E 4D81A 2O25A 2DXIA 2XSZD 2BJWA 4LFCM 1NJFA 2LVOC 3B9PA 3T15A 2ZTDA 2C96A 4XBOA 3VFDA 2JY8A 2QNJA 3MJ5A 2JP7A 5EXPA 2GNOA 3PXGA 1TH3A 3U61B 2KEBA 1PJIA 3HHZA 3SBJA 4B7GA 3L25A 4FWGA 2ZAMA 1ZQ9A 4F2LA 1BVSA 2LVAA 3AJIB 1R2ZA 4M9SA 2LNHC 2JZ0A 3FD9A 2VDBB 3RGSA 3GPUA 3GLGE 4IBIA 5KQDA 3U6QA 2CV0A 1WXQA 1E32A 2L4FA 3LW5F 4PD2A 5F3WA 1DO0A 3GLIE 3HHYA 1DV0A 3FTCA 3EIEA 5FTKA 2VQFM 4DUYM 1XXHE 3GO8A 2O5RA 1JR3E 4B7HA 3JR4A 1L1ZA 3L28A 3MK6A 3CF0A 5FTNA 2XFTA 3U60A 5IWAM 3J27B 2R0IA 2DENA 2Z8YM 2KDLA 3FRIA 2RGOA 4DUZM 2CE7A 3KFUG 1G41A 4LF4M 4AKIA 1TR8A 1RU3A 4II7A 3QYEA 1D0LA 2EA0A 4MGHA 3SMPA 4LRTA 3CF6E 4OU7A 3LQQA 5KPRA 2BNKA 4KODA 3LVVA 2UU9M 2YNMD 1WR1B 2DAEA 3GLGB 4NRWA 3MHVC 1V33A 3AOGA 3AV0A 1TDHA 1HT1E 4DV4M 5L8RF 3GLGA 2D7EA 4JI1M 3DOAA 2YR0A 3Q8XA 1VEKA 2BWBA 2F5OA 2QBYA 3I04M 3HHXA 4QHSA 4LJ7A 1IBLM 3DFZA 3IG8A 4M9ZA 1NSFA 2LTUA 3J81S 1N77A 4NSOB 4IBFA 2R18A 1G3IA 1PJSA 3T6PA 1GL7A 4FWHA 4LGMA 3L27A 3GPPA 2DAKA 4Z8XA 4GRIA 1L2BA 2V1UA 5IT9S 2DVWB 1NV8A 2OOAA 4DR3M 4JN6A 1Q3BA 3VLFB 2QPAA 3GPXA 1EFUB 5IREB 5JI3E 4RF1A 1K82A 4ITQA 1T3TA 1N34M 4XGIA 3FUWA 3A42A 5ITUA 3GQ5A 4NXNM 4A3VB 4Z6YA 2KNAA 1NHWC 3K2LA 3E9SA 2F5QA 3U6CA 3A46A 3K8ZA 4B08A 3SFZA 1JR3A 4JI6M 3GRVA 2DHYA 3LVWA 2M60A 1OQYA 2L09A 1WIVA 1MX0A 2K9DA 2VF7A 4BBAA 1ORYB 2DI0A 2Z7JA 1DGGA 3IG5A 4OW0A 1PJQA 4DV1M 3U6PA 2CHQA 2QP9X 4GHLA 1YUBA 1HQCA 2KNVA 3I01M 3W0FA 3KW6A 1P3QQ 1Y8GA 4D82A 3UZUA 4FCTA 4PDGA 4XK8F 4DR6M 4JI3M 2C5RA 1G59A 3KOYE 1YLAA 4M9XA 3J2PB 3SYLA 4FCWA 3C9PA 2LH0A 3B7QA 5EP2A 2J7NA 2EKFA 3KS4A 3LCUA 3NBIA 2FS1A 3GQ4A 2JWSA 2MR9A 3AFHA 2Y21A 1G71A 3T1HM 4M0WA 4LFAM 3SATA 2X4AA 3GLFA 2KHHA 3A45A 2L2DA 3EIHA 2ZBKB 2LXEA 4RKUF 4B7FA 1LV7A 2HKJA 2XZFA 1K3XA 4LJ4A 5KPZA 3U60B 1L2DA 2CEAA 1F4IA 4LF5M 2I7NA 5EP4A 1N78A 3GQ3A 1EIJA 3U5ZA 2APLA 2FOIC 2X49A 3B7NA 4IBJA 4MGYE 4JI4M 3H4MA 2ZANA 1QANA 4DV5M 4DBGB 2BJVA 3U6LA 1C7YA 3VK7A 2F5PA 4MGZE 1HJPA 2CRUA 3KXEC 2K47A 3SHFA 1I4WA 3K92A 4JI2M 2FE8A 3U5ZB 3AKZA 1Q02A 1J5EM 1L8QA 5KO3A 2L7HA 3U6DA 1V92A 1T43A 2CUZA 3FYDA 1MN3A 3C3DA 4GC5A 4L6V6 3TQSA 1Z5BA 3CGWA 2B3TA 4QOSA 3TL4X 3KVWA 3JAMS 2NQ8C 1WGNA 2HCBA 3LQRA 3HY5A 4P17A 3J80S 3T38A 1NVMA 1VG5A 2MH8A 1R4GA 3GRRA 3GLFB 2D7HA 2R62A 4NL4H 4R3DA 1XNRM 2DZOB 1IN6A 5EXXA 2WSCF 2A5YB 1HNZM 8CATA 2LVNC 1G8PA 3IECA 3ILKA 3Q8GA 2CFOA 4R7GA 1JQJC 4KO8A 5JI2E 1OKSA 2DHRA 4GEWA 1SXJD 1EE8A 2VQEM 1GVNA 1AIPC 4DV6M 3I4VA 3E4RA 3RGPA 4L15A 5ITRA 4L78A 1OJLA 5LMUM 2L4EA 2J7OA 2QQ8A 3WHLA 4FVMA 3GRUA 4B3TM 3SC3A 4IBEA 2UXBM 4LJAA 4LF7M 2V6ZM 3I4YA 4EIWA 3HKPA 3HJQA 1WJ7A 3TE6A 2UUAM 3FE3A 2CHGA 3GPYA 3SAVA 2CP8A 2MJ5B 3VDPA 4LF9M 3FUUA 2MROB 1E94E 3BXWA 3PNVA 5EQTA 4AQYM 3PNYA 4MGIE 5C18A 4PT5A 1OIPA 4LGYA 3GLFE 4G4QA 3SARA 2DNAA 4LJ5A 5H37D 3GLHE 1SXJA 3AOEC 1ZMUA 1L2CA 3B89A 1XXHA 4I4LA 4DR2M 2K6BA 3HWSA 2VIIA 1NY6A 2L7IA 2VF8A 3C3EA 3FTDA 2Y0QA 2QSFX 4YHHM 3TWMA 2C9OA 3J7BA 2OO9A 1KFVA 1DGBA 4GC9A 4DV0M 3KOXE 3HU1A 2DAMA 1HR0M 4JYAM 4GIPA 1NNJA 4IBCA 5EP3A 2LHGA 1QYRA 3UMMA 2QBYB 3WHKA 3LMMA 4NRVA 5FTMA 1GKIA 3FKEA 1W5TA 1OAIA 1QZMA 2G8LA 5FSWA 2UUBM 2XH9A 1QUTA 1IXSB 4G4NA 2ERCA 5ITQA 3T1YM 2DWNA 3FTEA 2DWZB 4ZPXA 2C99A 2DWMA 4CHTB 4LFBM 3SAUA 2F4VM 1SXJE 1NJGA 4I5SA 1QAMA 7CATA 2XSZA 3M6AA 1IXRC 4DV2M 2Y0TA 3I51A 2V1CA 2R6FA 2DKLA 4MH0E 3HZJA 1GABA 2O01F 4UN2B 3LCVB 1XC8A 4HLQA 3L2AA 2UXCM 4IJFA 3RFWA 4HEOA 4GITA 4R71A 4IJEA 2OOBA 1J7KA 1KSFX 1TF0B 3DA1A 3ZQJA 2DZLA 2Y20A 1OIZA 4LF6M 4OVZA 4FCVA 1GO5A 1SG9A 2KRUA 1PRBA 3K9OA 1WHCA 3K1JA 2C98A 4CGYB 2XGNA 4LY6A 1YSYA 3NWLA 1OFIA 2XF3A 4G4RA 4GHAA 2R4EA 4WP2A 1GL6A 1MJGM 3SMSA 2C9CA 1AUAA 3QWLA 1D2NA 4GMQA 3U6SA 1TDZA 3E46A 3KOWE 1WGLA 3M7GA 3D8BA 3ZH9B 3KP1E 4FD2A 3U61A 2KNZA 5LMNM 1DGHA 1UM8A 4WW0A 3SHGB 1Z5AA 1X37A 4M0DA 1H6UA 2KZSA 4Q7JA 3HX3A 4G4OA 4DR7M 4NSRA 4WURA 5E26A 1NHGC 1T6OA 2Z4RA 4IBBA 1FJGM 3KOZE 1PJJA 1IXZA 2G3QA 2G5GX 2JUJA 2Z4SA 2F5NA 1R7RA 1ZV1A 2K0BX 3VKGA 4DV7M 4LF8M 1OTRA 2HL7A 2JA2A 2JY7A 3DZDA 4IIWA 3C58A 3PFIA 1R2YA 2JNHA 3B74A 1XMQM 3GLIA 3HHWA 2CHVA 3ZC7B 4OVZB 4GKKM 1Z6TA 4PDIA 1N75A 4L16A 1XHBA 3FUXA 3UK6A 2ZM6M 2LBCA 3OTOM 5FTJA 1GLNA 1OAOC 1S3SA 3MMPA 1D0MA 3F92A 4X66M 3HU3A 3R8FA 4P16A 1NNUC 2CWBA 1DGFA 4AG5A
chains in the Genus database with same CATH topology
2XLJA 1HNXM 1DO2A 1R6BX 1L1TA 4B3MM 3SAWA 3CF2A 1N33M 4LRSA 1TGUA 5EP1A 1I94M 4LZJA 3GP1A 4NXMM 2YQZA 2KW0A 3A98B 4S12A 2CV1A 1NY5A 4GH9A 1W5SA 5A2QS 1N36M 4X62M 3CTWB 3TPZA 2AHMA 3SASA 2FFJA 3M0EA 5FLXS 5BR8M 3QAUA 2KXEA 1Z5CA 1OFHA 5EXSA 4QHTA 4AKHA 1QAQA 2DWLA 4JXJA 5FTLA 4QOZC 2KA6B 4IBKA 4FW9A 2KRKA 2RKOA 1IM2A 1IY1A 4L8RC 1XXHB 5ITXA 1FNNA 1IBMM 3W0LB 5C1BA 1QQWA 3VK8A 3L26A 3FUTA 4LJ6A 5KQ8A 4QNMA 3UGJA 4DR1M 4AZFA 5DNYA 2R65A 4I81A 4LJ9A 4DV3M 1Q39A 4DR5M 3GLIB 1HNWM 4TUWA 3TWKA 3L29A 4D80A 4I8OA 1VDDA 4MM3B 2QENA 1XNQM 3SYKA 2F5SA 2Q2EB 2R4JA 3HJ8A 2EO2A 4MB7A 3THGA 4KLNA 2XEPA 4OX9M 1MU5A 1IY2A 5DYGA 3KSXA 4RF0A 1PM5A 2QCUA 2FNAA 3HGIA 3VDUA 1TH4A 3HJSA 5ITYA 4B3RM 4JI7M 1DGHB 1G4AE 5ITXE 3VKHA 1YE9A 4G6ZA 4QNRA 3ZCBB 4JI8M 3PVSA 1QAOA 4HL4A 4X64M 1JR3D 1ZAEA 3JR5A 4IBGA 3U6MA 3U6EA 3FYCA 1C1KA 1XWIA 4JI0M 3UJNA 4L4UA 1E9RA 1IQPA 1IBKM 1IN8A 2OQ4A 2R45A 3HU2A 5E6JA 2UUCM 2R46A 2UXDM 2E5LM 4LCBA 1QVRA 1N32M 2P5TA 3D8LA 3GRYA 1TH2A 5EJCA 3TWLA 4AW4A 4IBDA 4K0KM 2RGHA 1Z59A 2D7GA 2KZUA 2LWXA 1K3WA 2W82A 1IY0A 4AG6A 2XZUA 4DR4M 4X65M 5BPVA 3RE8A 2H1RA 4LG2A 4GKJM 3R9XB 2DZNB 1KYIA 4PCZA 4CISA 3GLHB 2XFSA 3GLHA 4RNAA 2L6OA 4AKGA 4NOOB 4BLCA 1IN7A 4YY3M 2EUCA 3J7AS 4BB9A 3FUVA 3AL0C 3KDSE 4JV5M 1IN4A 2QZ4A 5DYIA 1IN5A 3KSJA 4FWDA 2I7PA 4LJ8A 4REZA 4KHPM 5GKNA 3U6OA 5ITTA 5EXTA 1DGFA 1HQYE 1E9SA 1SXJC 3AOEA 4MGKE 1J09A 2ZAOA 1HT2E 4JI5M 2OPFA 1XMOM 5IZ7D 2Z3XA 4B3SM 4LZZA 2M5ZA 5KPTA 3BOSA 2HHHM 4W5WA 1Q3CA 4AI6A 3KS8A 2CV2A 3FTFA 1SXJB 2X8AA 2YFQA 3KP0E 4D81A 2DXIA 4LFCM 2XSZD 2BJWA 1NJFA 3B9PA 3T15A 2C96A 4XBOA 3VFDA 3MJ5A 5EXPA 3PXGA 1TH3A 3U61B 2KEBA 1PJIA 3HHZA 3SBJA 4B7GA 3L25A 4FWGA 2ZAMA 1ZQ9A 3AJIB 1R2ZA 4M9SA 2LNHC 3FD9A 3RGSA 3GPUA 4IBIA 5KQDA 3U6QA 2CV0A 1WXQA 1E32A 4PD2A 5F3WA 1DO0A 3HHYA 3FTCA 3EIEA 5FTKA 2VQFM 4DUYM 3JR4A 3GO8A 2O5RA 1L1ZA 4B7HA 3L28A 3MK6A 3CF0A 5FTNA 2XFTA 3U60A 5IWAM 3J27B 3KFUG 2RGOA 4DUZM 2CE7A 1G41A 4LF4M 4AKIA 4II7A 2EA0A 4MGHA 3SMPA 4LRTA 3CF6E 4OU7A 3LQQA 5KPRA 2BNKA 4KODA 3LVVA 2UU9M 2YNMD 3GLGB 4NRWA 3MHVC 3AOGA 3AV0A 1TDHA 1HT1E 4DV4M 3GLGA 2D7EA 4JI1M 3DOAA 2YR0A 3Q8XA 2F5OA 2QBYA 3HHXA 4QHSA 4LJ7A 1IBLM 3DFZA 3IG8A 4M9ZA 1NSFA 3J81S 1N77A 4NSOB 4IBFA 2R18A 1G3IA 1GL7A 4FWHA 4LGMA 3L27A 3GPPA 4Z8XA 4GRIA 1L2BA 2V1UA 5IT9S 2DVWB 4DR3M 4JN6A 1Q3BA 3VLFB 2QPAA 3GPXA 5IREB 5JI3E 4RF1A 1K82A 4ITQA 1T3TA 1N34M 4XGIA 3FUWA 3A42A 5ITUA 3GQ5A 4NXNM 4A3VB 4Z6YA 1NHWC 3K2LA 3E9SA 2F5QA 3U6CA 3A46A 3K8ZA 4B08A 3SFZA 1JR3A 4JI6M 3GRVA 3LVWA 2M60A 2L09A 1MX0A 4BBAA 1ORYB 4OW0A 2Z7JA 1DGGA 3IG5A 3U6PA 4DV1M 2CHQA 2QP9X 4GHLA 1YUBA 1HQCA 3W0FA 3KW6A 4D82A 3UZUA 4FCTA 4DR6M 4JI3M 2C5RA 1G59A 3KOYE 4M9XA 3J2PB 3SYLA 4FCWA 2LH0A 5EP2A 2J7NA 3KS4A 3NBIA 3GQ4A 3AFHA 2Y21A 3T1HM 4M0WA 4LFAM 3SATA 2X4AA 3GLFA 3A45A 3EIHA 2ZBKB 2LXEA 4B7FA 1LV7A 2HKJA 2XZFA 1K3XA 4LJ4A 5KPZA 3U60B 1L2DA 2CEAA 4LF5M 2I7NA 5EP4A 1N78A 3GQ3A 3U5ZA 2FOIC 2X49A 4IBJA 4JI4M 4MGYE 3H4MA 2ZANA 1QANA 4DV5M 3U6LA 2BJVA 3VK7A 2F5PA 4MGZE 3KXEC 2K47A 3SHFA 1I4WA 3K92A 4JI2M 2FE8A 3U5ZB 3AKZA 1J5EM 1L8QA 5KO3A 2L7HA 3U6DA 2CUZA 3FYDA 4PDGA 4GC5A 3TQSA 1Z5BA 4QOSA 3TL4X 3KVWA 3JAMS 2NQ8C 2HCBA 3LQRA 3J80S 3T38A 1NVMA 3GRRA 3GLFB 2D7HA 2R62A 4NL4H 4R3DA 1XNRM 2DZOB 1IN6A 5EXXA 2A5YB 1HNZM 8CATA 1G8PA 3ILKA 2CFOA 4R7GA 1JQJC 4KO8A 5JI2E 2DHRA 1SXJD 1EE8A 2VQEM 1GVNA 4DV6M 3I4VA 3E4RA 3RGPA 4L15A 5ITRA 4L78A 1OJLA 5LMUM 2J7OA 3WHLA 4FVMA 3GRUA 4B3TM 3SC3A 4IBEA 2UXBM 4LJAA 4LF7M 2V6ZM 3I4YA 4EIWA 3HKPA 3HJQA 3TE6A 2UUAM 2CHGA 3GPYA 3SAVA 3VDPA 4LF9M 3FUUA 1E94E 3PNVA 5EQTA 4AQYM 3PNYA 4MGIE 5C18A 4PT5A 4LGYA 4G4QA 3SARA 4LJ5A 5H37D 1SXJA 3AOEC 1L2CA 1XXHA 4I4LA 4DR2M 3HWSA 2VIIA 1NY6A 2L7IA 3FTDA 2Y0QA 4YHHM 3TWMA 2C9OA 3J7BA 1KFVA 1DGBA 4GC9A 4DV0M 3KOXE 3HU1A 1HR0M 4JYAM 4GIPA 1NNJA 4IBCA 5EP3A 1QYRA 3UMMA 2QBYB 3WHKA 3LMMA 4NRVA 5FTMA 1GKIA 3FKEA 1W5TA 1QZMA 2G8LA 5FSWA 2UUBM 2XH9A 1IXSB 4G4NA 2ERCA 5ITQA 3T1YM 2DWNA 3FTEA 2DWZB 4ZPXA 2C99A 2DWMA 4CHTB 4LFBM 3SAUA 2F4VM 1SXJE 1NJGA 4I5SA 1QAMA 7CATA 2XSZA 3M6AA 1IXRC 4DV2M 2Y0TA 3I51A 2V1CA 4MH0E 1XC8A 4HLQA 3L2AA 2UXCM 4IJFA 3RFWA 4GITA 4IJEA 1J7KA 1KSFX 3DA1A 2Y20A 4LF6M 4OVZA 4FCVA 2KRUA 3K1JA 2C98A 4CGYB 2XGNA 4LY6A 1YSYA 3NWLA 1OFIA 2XF3A 4G4RA 4GHAA 2R4EA 1GL6A 3SMSA 2C9CA 1D2NA 4GMQA 3U6SA 1TDZA 3KOWE 3M7GA 3D8BA 3ZH9B 3KP1E 4FD2A 3U61A 5LMNM 1DGHA 1UM8A 4WW0A 3SHGB 1Z5AA 1X37A 4M0DA 1H6UA 2KZSA 4G4OA 4DR7M 4NSRA 4WURA 5E26A 1NHGC 2Z4RA 1FJGM 4IBBA 3KOZE 1PJJA 1IXZA 2G5GX 2Z4SA 2F5NA 1R7RA 3VKGA 4DV7M 4LF8M 2HL7A 2JA2A 3DZDA 4IIWA 3C58A 1R2YA 3PFIA 1XMQM 3GLIA 3HHWA 2CHVA 3ZC7B 4OVZB 4GKKM 1Z6TA 4PDIA 1N75A 4L16A 1XHBA 3FUXA 3UK6A 2ZM6M 3OTOM 5FTJA 1GLNA 1S3SA 4X66M 3HU3A 3R8FA 4P16A 1NNUC 3QWLA 4AG5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A42 A;  1HNX M;  1L1T A;  5ITU A;  3GQ5 A;  4NXN M;  4AQY M;  4B3M M;  4JV5 M;  3SAW A;  1N33 M;  4G4Q A;  2F5Q A;  3SAR A;  3U6C A;  4KHP M;  3A46 A;  1I94 M;  3GP1 A;  3U6O A;  1L2C A;  4NXM M;  4JI6 M;  4DR2 M;  5ITT A;  5A2Q S;  1N36 M;  4X62 M;  1MX0 A;  4JI5 M;  2OPF A;  1XMO M;  3SAS A;  5FLX S;  3U6P A;  4YHH M;  4B3S M;  4DV1 M;  3TWM A;  5BR8 M;  3W0F A;  1KFV A;  4DV0 M;  1HR0 M;  2HHH M;  4JYA M;  4DR6 M;  1Z5C A;  1NNJ A;  4JI3 M;  1Q3C A;  4NRV A;  4LFC M;  2UUB M;  4G4N A;  5ITQ A;  3GQ4 A;  3T1Y M;  4LFB M;  3SAU A;  2F4V M;  5ITX A;  3T1H M;  1PJI A;  3SAT A;  4LFA M;  1IBM M;  3SBJ A;  3A45 A;  2ZBK B;  3VK8 A;  4DV2 M;  2HKJ A;  2XZF A;  1K3X A;  1R2Z A;  3GPU A;  1L2D A;  4DR1 M;  3U6Q A;  4LF5 M;  1XC8 A;  4DV3 M;  4PD2 A;  1Q39 A;  3GQ3 A;  4DR5 M;  1HNW M;  3TWK A;  2UXC M;  4JI4 M;  2VQF M;  4DUY M;  3JR4 A;  3GO8 A;  1L1Z A;  4DV5 M;  3U6L A;  1XNQ M;  3VK7 A;  4LF6 M;  2F5S A;  2F5P A;  2Q2E B;  5IWA M;  4OX9 M;  4MB7 A;  1MU5 A;  1PM5 A;  4DUZ M;  4JI2 M;  4LF4 M;  4G4R A;  5ITY A;  1J5E M;  4B3R M;  3U6D A;  4JI7 M;  4PDG A;  2EA0 A;  5ITX E;  1Z5B A;  4JI8 M;  3U6S A;  3JAM S;  1TDZ A;  3J80 S;  4X64 M;  3JR5 A;  3U6M A;  2UU9 M;  3U6E A;  4NRW A;  4JI0 M;  1XNR M;  5LMN M;  1TDH A;  1Z5A A;  4DV4 M;  1IBK M;  1HNZ M;  2OQ4 A;  4JI1 M;  3DOA A;  2UXD M;  4G4O A;  2UUC M;  2E5L M;  2F5O A;  4DR7 M;  1N32 M;  1FJG M;  1PJJ A;  1IBL M;  1EE8 A;  2F5N A;  2VQE M;  3TWL A;  4DV7 M;  4DV6 M;  4LF8 M;  3J81 S;  4K0K M;  3C58 A;  1R2Y A;  1Z59 A;  5ITR A;  1XMQ M;  1K3W A;  5LMU M;  2XZU A;  4DR4 M;  3GPP A;  4PDI A;  4X65 M;  4B3T M;  4GKK M;  2UXB M;  2ZM6 M;  4LF7 M;  1L2B A;  5IT9 S;  3OTO M;  4DR3 M;  4GKJ M;  1Q3B A;  3GPX A;  2UUA M;  4X66 M;  4PCZ A;  3GPY A;  3SAV A;  4CIS A;  1K82 A;  4ITQ A;  4LF9 M;  1N34 M;  4YY3 M;  3J7A S; 
#chains in the Genus database with same CATH topology
 2XLJ A;  4Y28 F;  1HNX M;  2ZTC A;  1DO2 A;  1R6B X;  1L1T A;  4B3M M;  3SAW A;  3CF2 A;  1N33 M;  2N35 A;  1TGU A;  4LRS A;  4KT0 F;  5EP1 A;  1GJS A;  1I94 M;  4LZJ A;  3GP1 A;  4NXM M;  2YQZ A;  1VQ1 A;  2KW0 A;  3A98 B;  4S12 A;  2CV1 A;  1NY5 A;  2H5X A;  1IXS A;  1W5S A;  2FH0 A;  4GH9 A;  5A2Q S;  1N36 M;  4X62 M;  3E21 A;  3CTW B;  3TPZ A;  2AHM A;  3SAS A;  2FFJ A;  3M0E A;  1D0K A;  5FLX S;  2WSF F;  5BR8 M;  1JB0 F;  3W68 A;  3QAU A;  2KXE A;  1QDR A;  1OFH A;  1Z5C A;  4QHT A;  5EXS A;  4AKH A;  1QAQ A;  2DWL A;  4JXJ A;  5FTL A;  2JZ1 A;  4QOZ C;  2KA6 B;  4IBK A;  2JXN A;  2BWE A;  4FW9 A;  2KRK A;  2RKO A;  1QDT A;  1IM2 A;  3V76 A;  1IY1 A;  4L8R C;  1XXH B;  5ITX A;  1PGY A;  1FNN A;  1IBM M;  3W0L B;  2LVQ D;  1QQW A;  5C1B A;  3VK8 A;  3L26 A;  3FUT A;  4LJ6 A;  1GJT A;  1VEJ A;  4QNM A;  5KQ8 A;  3UGJ A;  4DR1 M;  4AZF A;  2LVP C;  2R65 A;  4I81 A;  5DNY A;  3QYB A;  4LJ9 A;  4DV3 M;  1Q39 A;  4DR5 M;  3GLI B;  1HNW M;  4TUW A;  3TWK A;  3L29 A;  4D80 A;  1NO1 A;  4I8O A;  1VDD A;  4MM3 B;  2QEN A;  4F1I A;  1XNQ M;  2EKK A;  1CUK A;  3SYK A;  2F5S A;  2Q2E B;  2R4J A;  3HJ8 A;  2EO2 A;  1R5L A;  4MB7 A;  4KLN A;  2XEP A;  3THG A;  4OX9 M;  1MU5 A;  1IY2 A;  5DYG A;  3KSX A;  4RF0 A;  1PM5 A;  2QCU A;  2FNA A;  3HGI A;  3VDU A;  4ANR A;  1TH4 A;  3HJS A;  5ITY A;  4B3R M;  4JI7 M;  1DGH B;  1G4A E;  2JY6 B;  5ITX E;  1YE9 A;  3VKH A;  4G6Z A;  4QNR A;  3ZCB B;  4JI8 M;  3H4J A;  3PVS A;  1QAO A;  4HL4 A;  1VEG A;  1UFZ A;  1JR3 D;  1ZAE A;  4X64 M;  4IBG A;  3JR5 A;  3U6M A;  3U6E A;  2QHO B;  2GQF A;  3FYC A;  1C1K A;  1XWI A;  2WSE F;  4NC6 A;  4JI0 M;  3UJN A;  1TTE A;  4L4U A;  1E9R A;  1IQP A;  1IBK M;  1IN8 A;  2OQ4 A;  2R45 A;  3HU2 A;  5E6J A;  2LHC A;  2R46 A;  2UUC M;  2E5L M;  2UXD M;  4LCB A;  1QVR A;  1N32 M;  1LTM A;  1QZE A;  2J5Y A;  1V34 A;  3FRH A;  2P5T A;  3D8L A;  3GRY A;  1TH2 A;  2DAI A;  5EJC A;  3TWL A;  4AW4 A;  4IBD A;  4K0K M;  2RGH A;  3NBX X;  2MGW A;  1Z59 A;  2D7G A;  2KZU A;  2LWX A;  1IFY A;  1K3W A;  1NV9 A;  2W82 A;  4G3O A;  1IY0 A;  2R44 A;  4AG6 A;  4CIZ A;  2XZU A;  4DR4 M;  4X65 M;  5BPV A;  1ZMV A;  3RE8 A;  2H1R A;  5DFL A;  4LG2 A;  4GKJ M;  3R9X B;  2DZN B;  1KYI A;  3IHP A;  1A5T A;  2WZJ A;  4PCZ A;  1VDL A;  3GLH B;  2XFS A;  3GLH A;  4RNA A;  2L6O A;  4CIS A;  4AKG A;  4NOO B;  4BLC A;  1IN7 A;  4YY3 M;  2EUC A;  3J7A S;  4BB9 A;  3FUV A;  3AL0 C;  1PJT A;  3KDS E;  4JV5 M;  1IN4 A;  2QZ4 A;  5DYI A;  1IN5 A;  3KSJ A;  4FWD A;  2I7P A;  4LJ8 A;  4REZ A;  4KHP M;  2HAK A;  5GKN A;  3U6O A;  5ITT A;  5EXT A;  1HQY E;  1E9S A;  1XB2 B;  4CJ6 A;  1SXJ C;  3AOE A;  4MGK E;  1J09 A;  2ZAO A;  1HT2 E;  4JI5 M;  2OPF A;  1XMO M;  2JY5 A;  5IZ7 D;  2Z3X A;  2EJS A;  4B3S M;  1ZMW A;  4LZZ A;  2M5Z A;  2DAG A;  3K9P A;  3BBZ A;  5KPT A;  2RRU A;  3BOS A;  2HHH M;  2HWJ A;  3B7Z A;  4W5W A;  1Q3C A;  3W67 A;  1QUS A;  3KS8 A;  2CV2 A;  4AI6 A;  3FTF A;  1SXJ B;  2X8A A;  2YFQ A;  3KP0 E;  4D81 A;  2O25 A;  2DXI A;  2XSZ D;  2BJW A;  4LFC M;  1NJF A;  2LVO C;  3B9P A;  3T15 A;  2ZTD A;  2C96 A;  4XBO A;  3VFD A;  2JY8 A;  2QNJ A;  3MJ5 A;  2JP7 A;  5EXP A;  2GNO A;  3PXG A;  1TH3 A;  3U61 B;  2KEB A;  1PJI A;  3HHZ A;  3SBJ A;  4B7G A;  3L25 A;  4FWG A;  2ZAM A;  1ZQ9 A;  4F2L A;  1BVS A;  2LVA A;  3AJI B;  1R2Z A;  4M9S A;  2LNH C;  2JZ0 A;  3FD9 A;  2VDB B;  3RGS A;  3GPU A;  3GLG E;  4IBI A;  5KQD A;  3U6Q A;  2CV0 A;  1WXQ A;  1E32 A;  2L4F A;  3LW5 F;  4PD2 A;  5F3W A;  1DO0 A;  3GLI E;  3HHY A;  1DV0 A;  3FTC A;  3EIE A;  5FTK A;  2VQF M;  4DUY M;  1XXH E;  3GO8 A;  2O5R A;  1JR3 E;  4B7H A;  3JR4 A;  1L1Z A;  3L28 A;  3MK6 A;  3CF0 A;  5FTN A;  2XFT A;  3U60 A;  5IWA M;  3J27 B;  2R0I A;  2DEN A;  2Z8Y M;  2KDL A;  3FRI A;  2RGO A;  4DUZ M;  2CE7 A;  3KFU G;  1G41 A;  4LF4 M;  4AKI A;  1TR8 A;  1RU3 A;  4II7 A;  3QYE A;  1D0L A;  2EA0 A;  4MGH A;  3SMP A;  4LRT A;  3CF6 E;  4OU7 A;  3LQQ A;  5KPR A;  2BNK A;  4KOD A;  3LVV A;  2UU9 M;  2YNM D;  1WR1 B;  2DAE A;  3GLG B;  4NRW A;  3MHV C;  1V33 A;  3AOG A;  3AV0 A;  1TDH A;  1HT1 E;  4DV4 M;  5L8R F;  3GLG A;  2D7E A;  4JI1 M;  3DOA A;  2YR0 A;  3Q8X A;  1VEK A;  2BWB A;  2F5O A;  2QBY A;  3I04 M;  3HHX A;  4QHS A;  4LJ7 A;  1IBL M;  3DFZ A;  3IG8 A;  4M9Z A;  1NSF A;  2LTU A;  3J81 S;  1N77 A;  4NSO B;  4IBF A;  2R18 A;  1G3I A;  1PJS A;  3T6P A;  1GL7 A;  4FWH A;  4LGM A;  3L27 A;  3GPP A;  2DAK A;  4Z8X A;  4GRI A;  1L2B A;  2V1U A;  5IT9 S;  2DVW B;  1NV8 A;  2OOA A;  4DR3 M;  4JN6 A;  1Q3B A;  3VLF B;  2QPA A;  3GPX A;  1EFU B;  5IRE B;  5JI3 E;  4RF1 A;  1K82 A;  4ITQ A;  1T3T A;  1N34 M;  4XGI A;  3FUW A;  3A42 A;  5ITU A;  3GQ5 A;  4NXN M;  4A3V B;  4Z6Y A;  2KNA A;  1NHW C;  3K2L A;  3E9S A;  2F5Q A;  3U6C A;  3A46 A;  3K8Z A;  4B08 A;  3SFZ A;  1JR3 A;  4JI6 M;  3GRV A;  2DHY A;  3LVW A;  2M60 A;  1OQY A;  2L09 A;  1WIV A;  1MX0 A;  2K9D A;  2VF7 A;  4BBA A;  1ORY B;  2DI0 A;  2Z7J A;  1DGG A;  3IG5 A;  4OW0 A;  1PJQ A;  4DV1 M;  3U6P A;  2CHQ A;  2QP9 X;  4GHL A;  1YUB A;  1HQC A;  2KNV A;  3I01 M;  3W0F A;  3KW6 A;  1P3Q Q;  1Y8G A;  4D82 A;  3UZU A;  4FCT A;  4PDG A;  4XK8 F;  4DR6 M;  4JI3 M;  2C5R A;  1G59 A;  3KOY E;  1YLA A;  4M9X A;  3J2P B;  3SYL A;  4FCW A;  3C9P A;  2LH0 A;  3B7Q A;  5EP2 A;  2J7N A;  2EKF A;  3KS4 A;  3LCU A;  3NBI A;  2FS1 A;  3GQ4 A;  2JWS A;  2MR9 A;  3AFH A;  2Y21 A;  1G71 A;  3T1H M;  4M0W A;  4LFA M;  3SAT A;  2X4A A;  3GLF A;  2KHH A;  3A45 A;  2L2D A;  3EIH A;  2ZBK B;  2LXE A;  4RKU F;  4B7F A;  1LV7 A;  2HKJ A;  2XZF A;  1K3X A;  4LJ4 A;  5KPZ A;  3U60 B;  1L2D A;  2CEA A;  1F4I A;  4LF5 M;  2I7N A;  5EP4 A;  1N78 A;  3GQ3 A;  1EIJ A;  3U5Z A;  2APL A;  2FOI C;  2X49 A;  3B7N A;  4IBJ A;  4MGY E;  4JI4 M;  3H4M A;  2ZAN A;  1QAN A;  4DV5 M;  4DBG B;  2BJV A;  3U6L A;  1C7Y A;  3VK7 A;  2F5P A;  4MGZ E;  1HJP A;  2CRU A;  3KXE C;  2K47 A;  3SHF A;  1I4W A;  3K92 A;  4JI2 M;  2FE8 A;  3U5Z B;  3AKZ A;  1Q02 A;  1J5E M;  1L8Q A;  5KO3 A;  2L7H A;  3U6D A;  1V92 A;  1T43 A;  2CUZ A;  3FYD A;  1MN3 A;  3C3D A;  4GC5 A;  4L6V 6;  3TQS A;  1Z5B A;  3CGW A;  2B3T A;  4QOS A;  3TL4 X;  3KVW A;  3JAM S;  2NQ8 C;  1WGN A;  2HCB A;  3LQR A;  3HY5 A;  4P17 A;  3J80 S;  3T38 A;  1NVM A;  1VG5 A;  2MH8 A;  1R4G A;  3GRR A;  3GLF B;  2D7H A;  2R62 A;  4NL4 H;  4R3D A;  1XNR M;  2DZO B;  1IN6 A;  5EXX A;  2WSC F;  2A5Y B;  1HNZ M;  8CAT A;  2LVN C;  1G8P A;  3IEC A;  3ILK A;  3Q8G A;  2CFO A;  4R7G A;  1JQJ C;  4KO8 A;  5JI2 E;  1OKS A;  2DHR A;  4GEW A;  1SXJ D;  1EE8 A;  2VQE M;  1GVN A;  1AIP C;  4DV6 M;  3I4V A;  3E4R A;  3RGP A;  4L15 A;  5ITR A;  4L78 A;  1OJL A;  5LMU M;  2L4E A;  2J7O A;  2QQ8 A;  3WHL A;  4FVM A;  3GRU A;  4B3T M;  3SC3 A;  4IBE A;  2UXB M;  4LJA A;  4LF7 M;  2V6Z M;  3I4Y A;  4EIW A;  3HKP A;  3HJQ A;  1WJ7 A;  3TE6 A;  2UUA M;  3FE3 A;  2CHG A;  3GPY A;  3SAV A;  2CP8 A;  2MJ5 B;  3VDP A;  4LF9 M;  3FUU A;  2MRO B;  1E94 E;  3BXW A;  3PNV A;  5EQT A;  4AQY M;  3PNY A;  4MGI E;  5C18 A;  4PT5 A;  1OIP A;  4LGY A;  3GLF E;  4G4Q A;  3SAR A;  2DNA A;  4LJ5 A;  5H37 D;  3GLH E;  1SXJ A;  3AOE C;  1ZMU A;  1L2C A;  3B89 A;  1XXH A;  4I4L A;  4DR2 M;  2K6B A;  3HWS A;  2VII A;  1NY6 A;  2L7I A;  2VF8 A;  3C3E A;  3FTD A;  2Y0Q A;  2QSF X;  4YHH M;  3TWM A;  2C9O A;  3J7B A;  2OO9 A;  1KFV A;  1DGB A;  4GC9 A;  4DV0 M;  3KOX E;  3HU1 A;  2DAM A;  1HR0 M;  4JYA M;  4GIP A;  1NNJ A;  4IBC A;  5EP3 A;  2LHG A;  1QYR A;  3UMM A;  2QBY B;  3WHK A;  3LMM A;  4NRV A;  5FTM A;  1GKI A;  3FKE A;  1W5T A;  1OAI A;  1QZM A;  2G8L A;  5FSW A;  2UUB M;  2XH9 A;  1QUT A;  1IXS B;  4G4N A;  2ERC A;  5ITQ A;  3T1Y M;  2DWN A;  3FTE A;  2DWZ B;  4ZPX A;  2C99 A;  2DWM A;  4CHT B;  4LFB M;  3SAU A;  2F4V M;  1SXJ E;  1NJG A;  4I5S A;  1QAM A;  7CAT A;  2XSZ A;  3M6A A;  1IXR C;  4DV2 M;  2Y0T A;  3I51 A;  2V1C A;  2R6F A;  2DKL A;  4MH0 E;  3HZJ A;  1GAB A;  2O01 F;  4UN2 B;  3LCV B;  1XC8 A;  4HLQ A;  3L2A A;  2UXC M;  4IJF A;  3RFW A;  4HEO A;  4GIT A;  4R71 A;  4IJE A;  2OOB A;  1J7K A;  1KSF X;  1TF0 B;  3DA1 A;  3ZQJ A;  2DZL A;  2Y20 A;  1OIZ A;  4LF6 M;  4OVZ A;  4FCV A;  1GO5 A;  1SG9 A;  2KRU A;  1PRB A;  3K9O A;  1WHC A;  3K1J A;  2C98 A;  4CGY B;  2XGN A;  4LY6 A;  1YSY A;  3NWL A;  1OFI A;  2XF3 A;  4G4R A;  4GHA A;  2R4E A;  4WP2 A;  1GL6 A;  1MJG M;  3SMS A;  2C9C A;  1AUA A;  3QWL A;  1D2N A;  4GMQ A;  3U6S A;  1TDZ A;  3E46 A;  3KOW E;  1WGL A;  3M7G A;  3D8B A;  3ZH9 B;  3KP1 E;  4FD2 A;  3U61 A;  2KNZ A;  5LMN M;  1DGH A;  1UM8 A;  4WW0 A;  3SHG B;  1Z5A A;  1X37 A;  4M0D A;  1H6U A;  2KZS A;  4Q7J A;  3HX3 A;  4G4O A;  4DR7 M;  4NSR A;  4WUR A;  5E26 A;  1NHG C;  1T6O A;  2Z4R A;  4IBB A;  1FJG M;  3KOZ E;  1PJJ A;  1IXZ A;  2G3Q A;  2G5G X;  2JUJ A;  2Z4S A;  2F5N A;  1R7R A;  1ZV1 A;  2K0B X;  3VKG A;  4DV7 M;  4LF8 M;  1OTR A;  2HL7 A;  2JA2 A;  2JY7 A;  3DZD A;  4IIW A;  3C58 A;  3PFI A;  1R2Y A;  2JNH A;  3B74 A;  1XMQ M;  3GLI A;  3HHW A;  2CHV A;  3ZC7 B;  4OVZ B;  4GKK M;  1Z6T A;  4PDI A;  1N75 A;  4L16 A;  1XHB A;  3FUX A;  3UK6 A;  2ZM6 M;  2LBC A;  3OTO M;  5FTJ A;  1GLN A;  1OAO C;  1S3S A;  3MMP A;  1D0M A;  3F92 A;  4X66 M;  3HU3 A;  3R8F A;  4P16 A;  1NNU C;  2CWB A;  1DGF A;  4AG5 A; 
#chains in the Genus database with same CATH homology
 2XLJ A;  1HNX M;  1DO2 A;  1R6B X;  1L1T A;  4B3M M;  3SAW A;  3CF2 A;  1N33 M;  4LRS A;  1TGU A;  5EP1 A;  1I94 M;  4LZJ A;  3GP1 A;  4NXM M;  2YQZ A;  2KW0 A;  3A98 B;  4S12 A;  2CV1 A;  1NY5 A;  4GH9 A;  1W5S A;  5A2Q S;  1N36 M;  4X62 M;  3CTW B;  3TPZ A;  2AHM A;  3SAS A;  2FFJ A;  3M0E A;  5FLX S;  5BR8 M;  3QAU A;  2KXE A;  1Z5C A;  1OFH A;  5EXS A;  4QHT A;  4AKH A;  1QAQ A;  2DWL A;  4JXJ A;  5FTL A;  4QOZ C;  2KA6 B;  4IBK A;  4FW9 A;  2KRK A;  2RKO A;  1IM2 A;  1IY1 A;  4L8R C;  1XXH B;  5ITX A;  1FNN A;  1IBM M;  3W0L B;  5C1B A;  1QQW A;  3VK8 A;  3L26 A;  3FUT A;  4LJ6 A;  5KQ8 A;  4QNM A;  3UGJ A;  4DR1 M;  4AZF A;  5DNY A;  2R65 A;  4I81 A;  4LJ9 A;  4DV3 M;  1Q39 A;  4DR5 M;  3GLI B;  1HNW M;  4TUW A;  3TWK A;  3L29 A;  4D80 A;  4I8O A;  1VDD A;  4MM3 B;  2QEN A;  1XNQ M;  3SYK A;  2F5S A;  2Q2E B;  2R4J A;  3HJ8 A;  2EO2 A;  4MB7 A;  3THG A;  4KLN A;  2XEP A;  4OX9 M;  1MU5 A;  1IY2 A;  5DYG A;  3KSX A;  4RF0 A;  1PM5 A;  2QCU A;  2FNA A;  3HGI A;  3VDU A;  1TH4 A;  3HJS A;  5ITY A;  4B3R M;  4JI7 M;  1DGH B;  1G4A E;  5ITX E;  3VKH A;  1YE9 A;  4G6Z A;  4QNR A;  3ZCB B;  4JI8 M;  3PVS A;  1QAO A;  4HL4 A;  4X64 M;  1JR3 D;  1ZAE A;  3JR5 A;  4IBG A;  3U6M A;  3U6E A;  3FYC A;  1C1K A;  1XWI A;  4JI0 M;  3UJN A;  4L4U A;  1E9R A;  1IQP A;  1IBK M;  1IN8 A;  2OQ4 A;  2R45 A;  3HU2 A;  5E6J A;  2UUC M;  2R46 A;  2UXD M;  2E5L M;  4LCB A;  1QVR A;  1N32 M;  2P5T A;  3D8L A;  3GRY A;  1TH2 A;  5EJC A;  3TWL A;  4AW4 A;  4IBD A;  4K0K M;  2RGH A;  1Z59 A;  2D7G A;  2KZU A;  2LWX A;  1K3W A;  2W82 A;  1IY0 A;  4AG6 A;  2XZU A;  4DR4 M;  4X65 M;  5BPV A;  3RE8 A;  2H1R A;  4LG2 A;  4GKJ M;  3R9X B;  2DZN B;  1KYI A;  4PCZ A;  4CIS A;  3GLH B;  2XFS A;  3GLH A;  4RNA A;  2L6O A;  4AKG A;  4NOO B;  4BLC A;  1IN7 A;  4YY3 M;  2EUC A;  3J7A S;  4BB9 A;  3FUV A;  3AL0 C;  3KDS E;  4JV5 M;  1IN4 A;  2QZ4 A;  5DYI A;  1IN5 A;  3KSJ A;  4FWD A;  2I7P A;  4LJ8 A;  4REZ A;  4KHP M;  5GKN A;  3U6O A;  5ITT A;  5EXT A;  1DGF A;  1HQY E;  1E9S A;  1SXJ C;  3AOE A;  4MGK E;  1J09 A;  2ZAO A;  1HT2 E;  4JI5 M;  2OPF A;  1XMO M;  5IZ7 D;  2Z3X A;  4B3S M;  4LZZ A;  2M5Z A;  5KPT A;  3BOS A;  2HHH M;  4W5W A;  1Q3C A;  4AI6 A;  3KS8 A;  2CV2 A;  3FTF A;  1SXJ B;  2X8A A;  2YFQ A;  3KP0 E;  4D81 A;  2DXI A;  4LFC M;  2XSZ D;  2BJW A;  1NJF A;  3B9P A;  3T15 A;  2C96 A;  4XBO A;  3VFD A;  3MJ5 A;  5EXP A;  3PXG A;  1TH3 A;  3U61 B;  2KEB A;  1PJI A;  3HHZ A;  3SBJ A;  4B7G A;  3L25 A;  4FWG A;  2ZAM A;  1ZQ9 A;  3AJI B;  1R2Z A;  4M9S A;  2LNH C;  3FD9 A;  3RGS A;  3GPU A;  4IBI A;  5KQD A;  3U6Q A;  2CV0 A;  1WXQ A;  1E32 A;  4PD2 A;  5F3W A;  1DO0 A;  3HHY A;  3FTC A;  3EIE A;  5FTK A;  2VQF M;  4DUY M;  3JR4 A;  3GO8 A;  2O5R A;  1L1Z A;  4B7H A;  3L28 A;  3MK6 A;  3CF0 A;  5FTN A;  2XFT A;  3U60 A;  5IWA M;  3J27 B;  3KFU G;  2RGO A;  4DUZ M;  2CE7 A;  1G41 A;  4LF4 M;  4AKI A;  4II7 A;  2EA0 A;  4MGH A;  3SMP A;  4LRT A;  3CF6 E;  4OU7 A;  3LQQ A;  5KPR A;  2BNK A;  4KOD A;  3LVV A;  2UU9 M;  2YNM D;  3GLG B;  4NRW A;  3MHV C;  3AOG A;  3AV0 A;  1TDH A;  1HT1 E;  4DV4 M;  3GLG A;  2D7E A;  4JI1 M;  3DOA A;  2YR0 A;  3Q8X A;  2F5O A;  2QBY A;  3HHX A;  4QHS A;  4LJ7 A;  1IBL M;  3DFZ A;  3IG8 A;  4M9Z A;  1NSF A;  3J81 S;  1N77 A;  4NSO B;  4IBF A;  2R18 A;  1G3I A;  1GL7 A;  4FWH A;  4LGM A;  3L27 A;  3GPP A;  4Z8X A;  4GRI A;  1L2B A;  2V1U A;  5IT9 S;  2DVW B;  4DR3 M;  4JN6 A;  1Q3B A;  3VLF B;  2QPA A;  3GPX A;  5IRE B;  5JI3 E;  4RF1 A;  1K82 A;  4ITQ A;  1T3T A;  1N34 M;  4XGI A;  3FUW A;  3A42 A;  5ITU A;  3GQ5 A;  4NXN M;  4A3V B;  4Z6Y A;  1NHW C;  3K2L A;  3E9S A;  2F5Q A;  3U6C A;  3A46 A;  3K8Z A;  4B08 A;  3SFZ A;  1JR3 A;  4JI6 M;  3GRV A;  3LVW A;  2M60 A;  2L09 A;  1MX0 A;  4BBA A;  1ORY B;  4OW0 A;  2Z7J A;  1DGG A;  3IG5 A;  3U6P A;  4DV1 M;  2CHQ A;  2QP9 X;  4GHL A;  1YUB A;  1HQC A;  3W0F A;  3KW6 A;  4D82 A;  3UZU A;  4FCT A;  4DR6 M;  4JI3 M;  2C5R A;  1G59 A;  3KOY E;  4M9X A;  3J2P B;  3SYL A;  4FCW A;  2LH0 A;  5EP2 A;  2J7N A;  3KS4 A;  3NBI A;  3GQ4 A;  3AFH A;  2Y21 A;  3T1H M;  4M0W A;  4LFA M;  3SAT A;  2X4A A;  3GLF A;  3A45 A;  3EIH A;  2ZBK B;  2LXE A;  4B7F A;  1LV7 A;  2HKJ A;  2XZF A;  1K3X A;  4LJ4 A;  5KPZ A;  3U60 B;  1L2D A;  2CEA A;  4LF5 M;  2I7N A;  5EP4 A;  1N78 A;  3GQ3 A;  3U5Z A;  2FOI C;  2X49 A;  4IBJ A;  4JI4 M;  4MGY E;  3H4M A;  2ZAN A;  1QAN A;  4DV5 M;  3U6L A;  2BJV A;  3VK7 A;  2F5P A;  4MGZ E;  3KXE C;  2K47 A;  3SHF A;  1I4W A;  3K92 A;  4JI2 M;  2FE8 A;  3U5Z B;  3AKZ A;  1J5E M;  1L8Q A;  5KO3 A;  2L7H A;  3U6D A;  2CUZ A;  3FYD A;  4PDG A;  4GC5 A;  3TQS A;  1Z5B A;  4QOS A;  3TL4 X;  3KVW A;  3JAM S;  2NQ8 C;  2HCB A;  3LQR A;  3J80 S;  3T38 A;  1NVM A;  3GRR A;  3GLF B;  2D7H A;  2R62 A;  4NL4 H;  4R3D A;  1XNR M;  2DZO B;  1IN6 A;  5EXX A;  2A5Y B;  1HNZ M;  8CAT A;  1G8P A;  3ILK A;  2CFO A;  4R7G A;  1JQJ C;  4KO8 A;  5JI2 E;  2DHR A;  1SXJ D;  1EE8 A;  2VQE M;  1GVN A;  4DV6 M;  3I4V A;  3E4R A;  3RGP A;  4L15 A;  5ITR A;  4L78 A;  1OJL A;  5LMU M;  2J7O A;  3WHL A;  4FVM A;  3GRU A;  4B3T M;  3SC3 A;  4IBE A;  2UXB M;  4LJA A;  4LF7 M;  2V6Z M;  3I4Y A;  4EIW A;  3HKP A;  3HJQ A;  3TE6 A;  2UUA M;  2CHG A;  3GPY A;  3SAV A;  3VDP A;  4LF9 M;  3FUU A;  1E94 E;  3PNV A;  5EQT A;  4AQY M;  3PNY A;  4MGI E;  5C18 A;  4PT5 A;  4LGY A;  4G4Q A;  3SAR A;  4LJ5 A;  5H37 D;  1SXJ A;  3AOE C;  1L2C A;  1XXH A;  4I4L A;  4DR2 M;  3HWS A;  2VII A;  1NY6 A;  2L7I A;  3FTD A;  2Y0Q A;  4YHH M;  3TWM A;  2C9O A;  3J7B A;  1KFV A;  1DGB A;  4GC9 A;  4DV0 M;  3KOX E;  3HU1 A;  1HR0 M;  4JYA M;  4GIP A;  1NNJ A;  4IBC A;  5EP3 A;  1QYR A;  3UMM A;  2QBY B;  3WHK A;  3LMM A;  4NRV A;  5FTM A;  1GKI A;  3FKE A;  1W5T A;  1QZM A;  2G8L A;  5FSW A;  2UUB M;  2XH9 A;  1IXS B;  4G4N A;  2ERC A;  5ITQ A;  3T1Y M;  2DWN A;  3FTE A;  2DWZ B;  4ZPX A;  2C99 A;  2DWM A;  4CHT B;  4LFB M;  3SAU A;  2F4V M;  1SXJ E;  1NJG A;  4I5S A;  1QAM A;  7CAT A;  2XSZ A;  3M6A A;  1IXR C;  4DV2 M;  2Y0T A;  3I51 A;  2V1C A;  4MH0 E;  1XC8 A;  4HLQ A;  3L2A A;  2UXC M;  4IJF A;  3RFW A;  4GIT A;  4IJE A;  1J7K A;  1KSF X;  3DA1 A;  2Y20 A;  4LF6 M;  4OVZ A;  4FCV A;  2KRU A;  3K1J A;  2C98 A;  4CGY B;  2XGN A;  4LY6 A;  1YSY A;  3NWL A;  1OFI A;  2XF3 A;  4G4R A;  4GHA A;  2R4E A;  1GL6 A;  3SMS A;  2C9C A;  1D2N A;  4GMQ A;  3U6S A;  1TDZ A;  3KOW E;  3M7G A;  3D8B A;  3ZH9 B;  3KP1 E;  4FD2 A;  3U61 A;  5LMN M;  1DGH A;  1UM8 A;  4WW0 A;  3SHG B;  1Z5A A;  1X37 A;  4M0D A;  1H6U A;  2KZS A;  4G4O A;  4DR7 M;  4NSR A;  4WUR A;  5E26 A;  1NHG C;  2Z4R A;  1FJG M;  4IBB A;  3KOZ E;  1PJJ A;  1IXZ A;  2G5G X;  2Z4S A;  2F5N A;  1R7R A;  3VKG A;  4DV7 M;  4LF8 M;  2HL7 A;  2JA2 A;  3DZD A;  4IIW A;  3C58 A;  1R2Y A;  3PFI A;  1XMQ M;  3GLI A;  3HHW A;  2CHV A;  3ZC7 B;  4OVZ B;  4GKK M;  1Z6T A;  4PDI A;  1N75 A;  4L16 A;  1XHB A;  3FUX A;  3UK6 A;  2ZM6 M;  3OTO M;  5FTJ A;  1GLN A;  1S3S A;  4X66 M;  3HU3 A;  3R8F A;  4P16 A;  1NNU C;  3QWL A;  4AG5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...