4JI4M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 25
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ji4M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4ji4M02
4DV5M 3U6OA 4DV3M 1HNZM 2Q2EB 1Q3CA 1IBMM 4LFAM 1EE8A 3U6CA 2UXCM 1Q39A 3VK8A 3GP1A 2UU9M 4AQYM 3J81S 2F4VM 4NRVA 1XNQM 4X64M 2E5LM 2F5OA 1XNRM 4B3SM 2ZM6M 1PJIA 3U6LA 3JAMS 2ZBKB 4MB7A 3U6SA 2EA0A 4ITQA 4DR5M 4JI7M 5ITXA 4DUZM 2HHHM 1MU5A 2VQEM 4JI5M 2UUAM 5ITRA 4YHHM 4G4RA 4X62M 3SAWA 1HNWM 1Z59A 4PD2A 4KHPM 2F5NA 4G4NA 1IBKM 2UUCM 2UUBM 3GPYA 3VK7A 4DR2M 4JI4M 4NXMM 1L1TA 4LF7M 4LF8M 2HKJA 3A46A 2OQ4A 3C58A 1TDZA 1N33M 4DV6M 1XC8A 4B3TM 4DUYM 5ITUA 4JI0M 2F5PA 4JI1M 5ITTA 3J7AS 3DOAA 3GO8A 3SBJA 3GPUA 4JI6M 5BR8M 1IBLM 4K0KM 4JYAM 3GPXA 3TWMA 1L2DA 4B3MM 4JI2M 3GQ5A 4DV0M 4G4QA 3U6QA 1HNXM 1Z5CA 1FJGM 3GPPA 4GKKM 3JR5A 1NNJA 4DR1M 2F5SA 4PDIA 4JI3M 3GQ4A 4GKJM 5IT9S 3OTOM 4DV4M 3SAUA 4CISA 4LFBM 4DV1M 2XZFA 1N32M 2VQFM 1TDHA 5ITYA 3T1HM 2UXBM 3A42A 4DR7M 3TWKA 1Z5AA 3U6MA 3U6DA 4LFCM 4NRWA 2XZUA 1PJJA 5A2QS 3JR4A 4B3RM 4G4OA 4NXNM 5ITQA 4OX9M 1R2ZA 1L1ZA 1Q3BA 5LMUM 1K3XA 1N34M 3T1YM 1R2YA 2OPFA 4LF4M 4DR4M 1HR0M 4DV7M 4DV2M 4LF9M 1PM5A 3W0FA 3U6EA 5IWAM 1J5EM 4PDGA 3SAVA 1KFVA 1I94M 3SASA 1Z5BA 1L2BA 4LF5M 4X65M 4X66M 1XMQM 1N36M 3TWLA 4JI8M 5LMNM 1K3WA 4LF6M 4JV5M 2F5QA 3SATA 3U6PA 4YY3M 3A45A 3GQ3A 1K82A 4DR6M 3J80S 5ITXE 4PCZA 1L2CA 5FLXS 2UXDM 1MX0A 4DR3M 3SARA 1XMOM
chains in the Genus database with same CATH superfamily
2FE8A 4DV5M 4AKHA 5C1BA 1HNZM 2CWBA 4I5SA 1ORYB 1ZMVA 3M6AA 4LJ9A 3CTWB 5FTMA 2C9CA 2UXCM 1Q39A 2KNVA 4G3OA 1NHWC 3I04M 2LVAA 2QENA 2R18A 3KS4A 4LZZA 4S12A 4F1IA 1XNQM 3GLHE 3D8LA 4CJ6A 1GLNA 1XNRM 3DA1A 5FTLA 2ZM6M 1G4AE 4QNRA 3AV0A 2ZBKB 4IBJA 3E21A 4MB7A 2LHCA 4QOZC 4KO8A 1JQJC 7CATA 4LRSA 4BB9A 1MU5A 2VQEM 2J5YA 4YHHM 3FUTA 3L28A 3FUWA 4FVMA 4GHLA 4KT0F 2DHRA 2HCBA 1BVSA 4R7GA 5GKNA 3UJNA 4AW4A 2YR0A 1XXHB 3GRUA 4DR2M 3L27A 1XB2B 4GIPA 4LF7M 3B89A 4GRIA 3BBZA 2DAKA 2Z4SA 1QDTA 4BBAA 5DYGA 3MJ5A 2L2DA 3RGPA 3GLIE 4ZPXA 2CV2A 3QYBA 1X37A 4IBIA 4LJ6A 1QYRA 5JI3E 5ITTA 3DOAA 1HQCA 4K0KM 1ZMUA 3B74A 2RGHA 4DBGB 3GPXA 3HHWA 1KYIA 4GMQA 3FRHA 2M5ZA 1D0KA 3TWMA 1VEJA 1MN3A 4IJEA 4G4QA 2VIIA 5E26A 1HNXM 4GC9A 1FJGM 2KRUA 4RNAA 4LJ8A 1IXZA 4JI3M 4GHAA 3UZUA 1CUKA 5IREB 4WP2A 3VFDA 3KSJA 4GKJM 5IT9S 2CP8A 3RFWA 2C5RA 1I4WA 3OTOM 2A5YB 3SAUA 2APLA 3EIEA 4CISA 2XZFA 2KRKA 2VF7A 4FCTA 2JA2A 2O5RA 1TDHA 2W82A 2O01F 3ZH9B 1DGBA 4IBEA 4IBFA 2QBYA 1XXHE 4AI6A 3B7QA 3I4VA 3IECA 2KDLA 2FS1A 3UMMA 2OOAA 5A2QS 2V1UA 1NHGC 4UN2B 2CV1A 3HU2A 3CF0A 5EJCA 2KZSA 2WSFF 4B7HA 4AZFA 5LMUM 1SXJA 2LHGA 2DAMA 2R44A 2XFSA 2RGOA 2ZTCA 3K1JA 5EQTA 3VLFB 3FTFA 1Z6TA 4M9SA 1TTEA 3KOZE 2CFOA 1OAIA 1N78A 2JP7A 3LQRA 1JR3D 4PDGA 2MGWA 3SASA 2OOBA 1IY1A 2VDBB 4Q7JA 1SXJB 4X66M 4X65M 2NQ8C 2H1RA 1K3WA 3T6PA 2QZ4A 1DO0A 2O25A 3B9PA 1T6OA 3U6PA 2MJ5B 1YLAA 1GKIA 2R62A 3DFZA 5FSWA 2D7HA 2J7OA 4ANRA 5KPZA 1LTMA 1PJSA 3QAUA 1NSFA 2FFJA 4FWGA 3AKZA 2UXDM 2DXIA 2JZ1A 5H37D 4FW9A 3LW5F 3U6OA 2L7IA 3R9XB 1SXJC 2CEAA 5EP2A 4HEOA 2DVWB 1QAQA 1QZMA 3L29A 2DZOB 3U6CA 1R7RA 1TH2A 3PNVA 3VK8A 3FYDA 1FNNA 2CUZA 2YQZA 3GRYA 4JN6A 4NRVA 1VG5A 4AQYM 2F4VM 3PXGA 4X64M 2XLJA 1G59A 1P3QQ 2JY7A 2FH0A 1PJIA 1HT1E 3U6LA 3LVWA 1G3IA 4GITA 3VDPA 3FTCA 3SHGB 2V6ZM 3WHKA 5ITXA 2L09A 4QNMA 2DWZB 4FWDA 3KW6A 4WW0A 2UUAM 2K6BA 3RE8A 2X4AA 4X62M 1HNWM 3FYCA 1EIJA 1Z59A 4PD2A 2UUCM 1DGHA 5DYIA 2XFTA 5E6JA 2UUBM 2QPAA 2JY8A 4JI4M 3M7GA 2HAKA 4MGYE 4KODA 4L15A 4F2LA 1D0LA 3IG8A 3HHXA 3A46A 4LJ5A 3C58A 5DNYA 2RKOA 4M0DA 3SYLA 1XC8A 3U60A 1JR3E 1HQYE 3U5ZA 2F5PA 1GO5A 3TL4X 3C3DA 2R45A 1QQWA 1C7YA 1XHBA 4IJFA 5EP3A 1VEKA 4Z6YA 4JYAM 4TUWA 1G8PA 2DAEA 1IXRC 3HX3A 1RU3A 4M0WA 2XF3A 2FOIC 3U5ZB 3U6QA 3LQQA 1PGYA 4GKKM 3GPPA 1PJTA 1V33A 5JI2E 1TGUA 2Y0TA 4M9XA 4FCWA 1OTRA 2F5SA 3F92A 4XGIA 3KP1E 2DZNB 3SHFA 1YSYA 2CRUA 1VDDA 3WHLA 4DV4M 2B3TA 3R8FA 5KPTA 3J2PB 4AG5A 2VQFM 5ITYA 3T1HM 2UXBM 3I51A 1W5SA 4DR7M 2KHHA 1R6BX 1TR8A 2G8LA 3A98B 1SG9A 4MH0E 3TWKA 1Q02A 2BWEA 3U6MA 2DWMA 1T43A 1TH3A 3BXWA 3GRRA 4B08A 1IM2A 2BWBA 4RKUF 3K8ZA 3LVVA 3T15A 2P5TA 3L25A 4MGIE 2XZUA 1PJJA 4RF1A 3JR4A 4B3RM 4G4OA 3IG5A 5ITQA 2GQFA 1NVMA 4Z8XA 3FE3A 3VDUA 1T3TA 1QUTA 2MR9A 1N34M 1EFUB 3T1YM 2EJSA 1IXSA 2OPFA 4LF4M 1OIZA 1HR0M 4DV2M 4LF9M 4IBGA 1G41A 3W67A 4OW0A 2L4FA 3W0FA 3KFUG 4GEWA 3RGSA 4Y28F 1DGFA 1Z5BA 3KOYE 4LF5M 2LH0A 1WHCA 1N36M 4JI8M 1KSFX 1NY5A 1GABA 1NJFA 2F5QA 2JUJA 3SATA 3GQ3A 1K82A 4DR6M 2EKFA 2ZTDA 1Y8GA 2EO2A 2ZAMA 2HL7A 3J7BA 2JWSA 3GLFA 3UK6A 4R3DA 3AOEC 5FLXS 1L2CA 1IQPA 4P17A 3FTDA 1MX0A 5EP4A 1SXJD 1S3SA 2K0BX 1VDLA 1XMOM 2QBYB 4L4UA 2QSFX 5EXPA 2Y20A 1IBMM 4CHTB 2R46A 4LGMA 2DWLA 2CHVA 3HKPA 3Q8GA 2VF8A 2BNKA 4LZJA 3SMSA 1IN5A 3HWSA 2F5OA 4B3SM 2LVOC 3NBIA 4OVZA 3VKHA 1XWIA 3JAMS 1DGGA 1WGNA 2JNHA 2EA0A 1QZEA 3K2LA 3E46A 4D81A 3Q8XA 1E32A 2G5GX 2JXNA 4JI5M 2LXEA 4LJAA 5EP1A 1V34A 4GH9A 3TE6A 3TPZA 3SAWA 1WIVA 3GLGA 2F5NA 3U61A 4IBCA 1WGLA 3H4MA 3GPYA 1NV9A 2I7NA 3W0LB 3VK7A 4NXMM 1QAOA 1GJTA 2BJWA 1OFHA 1IY0A 3NWLA 1GL6A 4BLCA 4B7GA 2OQ4A 1QVRA 1N33M 2CHQA 1D2NA 3GLHA 4MM3B 4MGKE 2WZJA 2WSEF 4JI0M 3M0EA 4QHTA 3TQSA 4JI1M 4M9ZA 2HWJA 3BOSA 4JI6M 1W5TA 1IN4A 3KOXE 1IBLM 4RF0A 3SC3A 1ZAEA 2R65A 1C1KA 1IN6A 1L2DA 2D7GA 1GL7A 3D8BA 3FUXA 2K9DA 3HU3A 1TH4A 8CATA 4B3MM 2D7EA 3GQ5A 4JI2M 2KNZA 4G6ZA 1OKSA 2C99A 3QWLA 2KXEA 3JR5A 5KO3A 1NNJA 5BPVA 1SXJE 2EKKA 1D0MA 2N35A 3B7ZA 1YUBA 1AIPC 4I8OA 1PJQA 3GLIA 1N32M 4MGZE 4D80A 4LGYA 1R5LA 4FD2A 1V92A 1DGHB 1NO1A 3PFIA 2QQ8A 3U6DA 2JZ0A 2C98A 4CGYB 4NRWA 2DAIA 2LNHC 3QYEA 1IFYA 3LCUA 2JY6B 2ERCA 2KW0A 4WURA 4XK8F 1NY6A 2QP9X 3L26A 3HY5A 3U60B 4L16A 3FRIA 1R2ZA 1L1ZA 1Q3BA 1L8QA 2XSZA 4NSOB 1K3XA 3KXEC 2X8AA 2MROB 5KQ8A 2LTUA 4DR4M 2CE7A 3ZQJA 4DV7M 3VKGA 3CF2A 2KA6B 1PM5A 4D82A 3W68A 3U6EA 5IWAM 2Z8YM 2Y21A 2Z7JA 3SAVA 1KFVA 3CGWA 4AG6A 1I94M 3AOGA 3DZDA 1E9SA 1OJLA 3T38A 1N77A 3C3EA 4LJ4A 1NV8A 4QOSA 5LMNM 2K47A 1XXHA 4JV5M 3K92A 1QDRA 3E4RA 3FUVA 3CF6E 5FTKA 2RRUA 2DHYA 3PVSA 5ITXE 4PCZA 1XMQM 1ZV1A 1HJPA 3AOEA 1LV7A 2DI0A 2Y0QA 4NOOB 4AKGA 2KEBA 2LVNC 4DR3M 2YFQA 5C18A 4EIWA 2DZLA 2J7NA 4LCBA 4REZA 3FUUA 1UFZA 3NBXX 3ZCBB 4L78A 4B7FA 4DV3M 2Q2EB 1Q3CA 2LWXA 4LFAM 3LMMA 1EE8A 2CV0A 2BJVA 1N75A 1J7KA 4PT5A 5KPRA 1ZMWA 3GP1A 2LVPC 2UU9M 3J81S 1WXQA 5EXSA 2R4EA 3AJIB 1G71A 2E5LM 1DO2A 1IXSB 2XEPA 2CHGA 2DWNA 3AL0C 3MK6A 4P16A 2YNMD 4QHSA 3U6SA 2Z4RA 2QHOB 4ITQA 1OIPA 4DR5M 4JI7M 3HU1A 2R6FA 1H6UA 5DFLA 4DUZM 2HHHM 2MH8A 1GVNA 3HHYA 4L8RC 5ITRA 4G4RA 4HL4A 2R0IA 1GJSA 3KDSE 4KHPM 2C9OA 2XGNA 4G4NA 1IBKM 3IHPA 4IIWA 2M60A 1QAMA 1L1TA 4AKIA 3PNYA 5IZ7D 4LF8M 3GLFB 2HKJA 1J09A 2DAGA 1TDZA 3SFZA 3AFHA 2DKLA 3ILKA 3KP0E 4DV6M 3E9SA 4B3TM 2GNOA 4IBKA 2ZAOA 4IBDA 5ITUA 4DUYM 3LCVB 5F3WA 1OFIA 2XH9A 4OU7A 4LG2A 1TF0B 1IY2A 4NSRA 1VEGA 3J7AS 3GO8A 3SBJA 2KNAA 1AUAA 2AHMA 3GRVA 5BR8M 1OQYA 3KOWE 1E9RA 3SYKA 3GPUA 3V76A 2LVQD 2DENA 5L8RF 3KSXA 1F4IA 2H5XA 1VQ1A 3FD9A 3C9PA 2KZUA 1NNUC 4DV0M 1Z5CA 3L2AA 4NC6A 2X49A 4OVZB 4DR1M 4I4LA 1HT2E 4GC5A 2R4JA 4PDIA 3GQ4A 3KS8A 3ZC7B 5EXTA 4I81A 3B7NA 4LJ7A 4NL4H 4LFBM 4DV1M 3FKEA 3UGJA 5EXXA 3GLGB 1DV0A 3K9OA 1JR3A 3U61B 3A42A 3THGA 2L7HA 4XBOA 1Z5AA 4FWHA 3I4YA 4R71A 4LFCM 2OO9A 1QANA 3HJ8A 4L6V6 3GLFE 4LRTA 3I01M 4KLNA 3GLHB 4NXNM 4OX9M 2C96A 1R4GA 2L4EA 1PRBA 2V1CA 1IN7A 1NJGA 1R2YA 4A3VB 3FTEA 5FTJA 4CIZA 4II7A 2L6OA 1J5EM 3MMPA 5FTNA 1A5TA 1MJGM 5KQDA 2FNAA 1L2BA 1E94E 3HJQA 2ZANA 1UM8A 3HZJA 3HJSA 3J27B 4LY6A 2DNAA 2EUCA 1WR1B 4JXJA 3TWLA 2I7PA 1YE9A 4IBBA 2Z3XA 3HHZA 4LF6M 2QNJA 1OAOC 1WJ7A 4YY3M 3A45A 3H4JA 2G3QA 3J80S 3HGIA 3GLIB 3K9PA 3MHVC 3EIHA 2LBCA 4FCVA 4MGHA 3SMPA 4HLQA 3KVWA 1QUSA 1JB0F 1IN8A 2QCUA 2XSZD 1ZQ9A 4W5WA 3GLGE 2JY5A 2WSCF 3SARA
chains in the Genus database with same CATH topology
2FE8A 4DV5M 4AKHA 5C1BA 1HNZM 4I5SA 1ORYB 3M6AA 5FTMA 4LJ9A 3CTWB 2C9CA 2UXCM 1Q39A 1NHWC 4LZZA 2QENA 2R18A 3KS4A 4S12A 1XNQM 3D8LA 1GLNA 1XNRM 3DA1A 5FTLA 2ZM6M 1G4AE 4QNRA 3AV0A 2ZBKB 4IBJA 4MB7A 4QOZC 4KO8A 1JQJC 7CATA 4LRSA 4BB9A 1MU5A 2VQEM 4YHHM 3FUTA 3L28A 3FUWA 4FVMA 4GHLA 2DHRA 2HCBA 5GKNA 4R7GA 3UJNA 4AW4A 2YR0A 1XXHB 3GRUA 4DR2M 3L27A 4GIPA 4LF7M 4GRIA 4BBAA 2Z4SA 5DYGA 3MJ5A 3RGPA 4ZPXA 2CV2A 1X37A 4IBIA 4LJ6A 1QYRA 5JI3E 5ITTA 3DOAA 1HQCA 4K0KM 2RGHA 3GPXA 3HHWA 1KYIA 4GMQA 2M5ZA 3TWMA 4IJEA 4G4QA 2VIIA 5E26A 1HNXM 4GC9A 1FJGM 2KRUA 4RNAA 4LJ8A 1IXZA 4JI3M 4GHAA 3UZUA 3VFDA 5IREB 4GKJM 3KSJA 5IT9S 2C5RA 3RFWA 1I4WA 3OTOM 2A5YB 3SAUA 3EIEA 4CISA 2XZFA 2KRKA 4FCTA 2JA2A 2O5RA 1TDHA 2W82A 3ZH9B 1DGBA 4IBEA 4IBFA 2QBYA 4AI6A 3I4VA 3UMMA 5A2QS 2V1UA 1NHGC 2CV1A 3HU2A 3CF0A 5EJCA 2KZSA 4B7HA 4AZFA 5LMUM 1SXJA 3K1JA 3FTFA 2XFSA 2RGOA 3VLFB 5EQTA 1Z6TA 4M9SA 3KOZE 2CFOA 1N78A 3LQRA 1JR3D 4PDGA 3SASA 1IY1A 1SXJB 4X66M 4X65M 2NQ8C 2H1RA 1K3WA 2QZ4A 1DO0A 3B9PA 3U6PA 1GKIA 2R62A 3DFZA 5FSWA 2D7HA 2J7OA 5KPZA 3QAUA 1NSFA 2FFJA 4FWGA 3AKZA 2UXDM 2DXIA 5H37D 4FW9A 3U6OA 2L7IA 3R9XB 1SXJC 2CEAA 5EP2A 2DVWB 1QAQA 1QZMA 3L29A 2DZOB 3U6CA 1R7RA 1TH2A 3PNVA 3VK8A 3FYDA 1FNNA 2CUZA 2YQZA 3GRYA 4JN6A 4NRVA 4AQYM 2F4VM 3PXGA 4X64M 2XLJA 1G59A 1PJIA 1HT1E 3U6LA 3LVWA 1G3IA 4GITA 3VDPA 3FTCA 3SHGB 2V6ZM 3WHKA 5ITXA 2L09A 4QNMA 2DWZB 4FWDA 3KW6A 4WW0A 2UUAM 3RE8A 2X4AA 4X62M 1HNWM 3FYCA 1Z59A 4PD2A 2UUCM 1DGHA 5DYIA 2XFTA 5E6JA 2UUBM 2QPAA 4JI4M 3M7GA 4MGYE 4KODA 4L15A 3IG8A 3HHXA 3A46A 4LJ5A 3C58A 5DNYA 2RKOA 4M0DA 3SYLA 1XC8A 3U60A 1HQYE 3U5ZA 2F5PA 3TL4X 2R45A 1QQWA 1XHBA 4IJFA 5EP3A 4Z6YA 4JYAM 4TUWA 1G8PA 1IXRC 4M0WA 2XF3A 2FOIC 3U5ZB 3U6QA 3LQQA 4GKKM 3GPPA 5JI2E 1TGUA 2Y0TA 4M9XA 4FCWA 2F5SA 4XGIA 3KP1E 2DZNB 3SHFA 1YSYA 3WHLA 1VDDA 4DV4M 3R8FA 5KPTA 3J2PB 4AG5A 2VQFM 5ITYA 3T1HM 2UXBM 3I51A 1W5SA 4DR7M 3A98B 1R6BX 2G8LA 3TWKA 4MH0E 3U6MA 2DWMA 1TH3A 3GRRA 4B08A 1IM2A 3T15A 3L25A 3K8ZA 3LVVA 2P5TA 4MGIE 2XZUA 1PJJA 4RF1A 3JR4A 4B3RM 4G4OA 3IG5A 5ITQA 1NVMA 4Z8XA 3VDUA 1T3TA 1N34M 3T1YM 2OPFA 4LF4M 1HR0M 4DV2M 4LF9M 4IBGA 1G41A 4OW0A 3W0FA 3KFUG 3RGSA 1DGFA 3KOYE 1Z5BA 4LF5M 2LH0A 1N36M 4JI8M 1KSFX 1NY5A 1NJFA 2F5QA 3SATA 3GQ3A 1K82A 4DR6M 2ZAMA 2EO2A 2HL7A 3J7BA 3GLFA 3UK6A 4R3DA 3AOEC 5FLXS 1L2CA 1IQPA 3FTDA 1MX0A 5EP4A 1SXJD 1S3SA 1XMOM 2QBYB 4L4UA 5EXPA 2Y20A 1IBMM 4CHTB 2R46A 4LGMA 2DWLA 2CHVA 3HKPA 2BNKA 4LZJA 3SMSA 1IN5A 3HWSA 2F5OA 4B3SM 3NBIA 4OVZA 3VKHA 1XWIA 3JAMS 1DGGA 2EA0A 3K2LA 4D81A 3Q8XA 1E32A 2G5GX 4JI5M 2LXEA 4LJAA 5EP1A 3TE6A 4GH9A 3SAWA 3TPZA 3GLGA 2F5NA 3U61A 4IBCA 3H4MA 3GPYA 2I7NA 3W0LB 3VK7A 4NXMM 1QAOA 2BJWA 1OFHA 1IY0A 3NWLA 1GL6A 4BLCA 4B7GA 2OQ4A 1QVRA 1N33M 2CHQA 1D2NA 3GLHA 4MM3B 4MGKE 4JI0M 3M0EA 4QHTA 3TQSA 4JI1M 4M9ZA 3BOSA 4JI6M 1W5TA 1IN4A 3KOXE 1IBLM 4RF0A 3SC3A 1ZAEA 2R65A 1C1KA 1IN6A 1L2DA 2D7GA 1GL7A 3D8BA 3FUXA 3HU3A 8CATA 1TH4A 4B3MM 4JI2M 2D7EA 3GQ5A 4G6ZA 2C99A 3QWLA 2KXEA 3JR5A 5KO3A 1NNJA 5BPVA 1SXJE 1YUBA 4I8OA 3GLIA 1N32M 4MGZE 4D80A 4LGYA 4FD2A 1DGHB 3PFIA 3U6DA 2C98A 4CGYB 4NRWA 2LNHC 2ERCA 2KW0A 4WURA 1NY6A 2QP9X 3L26A 3U60B 4L16A 1R2ZA 1L1ZA 1Q3BA 1L8QA 2XSZA 4NSOB 1K3XA 3KXEC 2X8AA 5KQ8A 4DR4M 2CE7A 4DV7M 3VKGA 3CF2A 2KA6B 1PM5A 4D82A 3U6EA 5IWAM 2Y21A 2Z7JA 3SAVA 1KFVA 4AG6A 1I94M 3AOGA 3DZDA 1E9SA 1OJLA 3T38A 1N77A 4LJ4A 4QOSA 5LMNM 2K47A 1XXHA 4JV5M 3K92A 3E4RA 3FUVA 3CF6E 5FTKA 3PVSA 5ITXE 4PCZA 3AOEA 1LV7A 2Y0QA 4NOOB 4AKGA 2KEBA 4DR3M 2YFQA 5C18A 4EIWA 2J7NA 4LCBA 4REZA 3FUUA 4B7FA 3ZCBB 4DV3M 4L78A 2Q2EB 1Q3CA 2LWXA 4LFAM 3LMMA 1EE8A 2CV0A 2BJVA 1N75A 1J7KA 4PT5A 5KPRA 3GP1A 2UU9M 3J81S 1WXQA 5EXSA 2R4EA 3AJIB 2E5LM 1DO2A 1IXSB 2XEPA 2CHGA 2DWNA 3AL0C 3MK6A 4P16A 2YNMD 4QHSA 3U6SA 2Z4RA 4ITQA 4DR5M 4JI7M 3HU1A 4DUZM 1H6UA 2HHHM 1GVNA 3HHYA 4L8RC 5ITRA 4G4RA 4HL4A 3KDSE 4KHPM 2C9OA 2XGNA 4G4NA 1IBKM 4IIWA 2M60A 1QAMA 1L1TA 4AKIA 3PNYA 5IZ7D 4LF8M 3GLFB 2HKJA 1J09A 1TDZA 3SFZA 3AFHA 3ILKA 3KP0E 4DV6M 3E9SA 4B3TM 4DUYM 4IBKA 2ZAOA 4IBDA 5ITUA 5F3WA 1OFIA 2XH9A 4OU7A 4LG2A 4NSRA 1IY2A 3J7AS 3GO8A 3SBJA 3GPUA 3GRVA 2AHMA 5BR8M 3KOWE 1E9RA 3SYKA 3KSXA 3FD9A 2KZUA 1NNUC 4DV0M 1Z5CA 3L2AA 2X49A 4OVZB 4DR1M 4I4LA 1HT2E 4GC5A 2R4JA 4PDIA 3GQ4A 3KS8A 3ZC7B 5EXTA 4I81A 4LJ7A 4NL4H 4LFBM 4DV1M 3FKEA 3UGJA 5EXXA 3GLGB 1JR3A 3U61B 3A42A 3THGA 2L7HA 4XBOA 1Z5AA 4FWHA 3I4YA 4LFCM 1QANA 3HJ8A 4LRTA 4KLNA 4NXNM 3GLHB 4OX9M 2C96A 2V1CA 1IN7A 1NJGA 1R2YA 4A3VB 3FTEA 5FTJA 4II7A 2L6OA 1J5EM 5FTNA 5KQDA 2FNAA 1L2BA 3J27B 1E94E 2ZANA 1UM8A 3HJQA 3HJSA 4LY6A 3TWLA 2EUCA 4JXJA 1XMQM 2I7PA 1YE9A 4IBBA 2Z3XA 3HHZA 4LF6M 4YY3M 3A45A 3J80S 3HGIA 3GLIB 3MHVC 3EIHA 4MGHA 4FCVA 3SMPA 4HLQA 3KVWA 2QCUA 2XSZD 1IN8A 4W5WA 1ZQ9A 3SARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV5 M;  3U6O A;  4DV3 M;  1HNZ M;  2Q2E B;  1Q3C A;  1IBM M;  4LFA M;  1EE8 A;  3U6C A;  2UXC M;  1Q39 A;  3VK8 A;  3GP1 A;  2UU9 M;  4AQY M;  3J81 S;  2F4V M;  4NRV A;  1XNQ M;  4X64 M;  2E5L M;  2F5O A;  1XNR M;  4B3S M;  2ZM6 M;  1PJI A;  3U6L A;  3JAM S;  2ZBK B;  4MB7 A;  3U6S A;  2EA0 A;  4ITQ A;  4DR5 M;  4JI7 M;  5ITX A;  4DUZ M;  2HHH M;  1MU5 A;  2VQE M;  4JI5 M;  2UUA M;  5ITR A;  4YHH M;  4G4R A;  4X62 M;  3SAW A;  1HNW M;  1Z59 A;  4PD2 A;  4KHP M;  2F5N A;  4G4N A;  1IBK M;  2UUC M;  2UUB M;  3GPY A;  3VK7 A;  4DR2 M;  4JI4 M;  4NXM M;  1L1T A;  4LF7 M;  4LF8 M;  2HKJ A;  3A46 A;  2OQ4 A;  3C58 A;  1TDZ A;  1N33 M;  4DV6 M;  1XC8 A;  4B3T M;  4DUY M;  5ITU A;  4JI0 M;  2F5P A;  4JI1 M;  5ITT A;  3J7A S;  3DOA A;  3GO8 A;  3SBJ A;  3GPU A;  4JI6 M;  5BR8 M;  1IBL M;  4K0K M;  4JYA M;  3GPX A;  3TWM A;  1L2D A;  4B3M M;  4JI2 M;  3GQ5 A;  4DV0 M;  4G4Q A;  3U6Q A;  1HNX M;  1Z5C A;  1FJG M;  3GPP A;  4GKK M;  3JR5 A;  1NNJ A;  4DR1 M;  2F5S A;  4PDI A;  4JI3 M;  3GQ4 A;  4GKJ M;  5IT9 S;  3OTO M;  4DV4 M;  3SAU A;  4CIS A;  4LFB M;  4DV1 M;  2XZF A;  1N32 M;  2VQF M;  1TDH A;  5ITY A;  3T1H M;  2UXB M;  3A42 A;  4DR7 M;  3TWK A;  1Z5A A;  3U6M A;  3U6D A;  4LFC M;  4NRW A;  2XZU A;  1PJJ A;  5A2Q S;  3JR4 A;  4B3R M;  4G4O A;  4NXN M;  5ITQ A;  4OX9 M;  1R2Z A;  1L1Z A;  1Q3B A;  5LMU M;  1K3X A;  1N34 M;  3T1Y M;  1R2Y A;  2OPF A;  4LF4 M;  4DR4 M;  1HR0 M;  4DV7 M;  4DV2 M;  4LF9 M;  1PM5 A;  3W0F A;  3U6E A;  5IWA M;  1J5E M;  4PDG A;  3SAV A;  1KFV A;  1I94 M;  3SAS A;  1Z5B A;  1L2B A;  4LF5 M;  4X65 M;  4X66 M;  1XMQ M;  1N36 M;  3TWL A;  4JI8 M;  5LMN M;  1K3W A;  4LF6 M;  4JV5 M;  2F5Q A;  3SAT A;  3U6P A;  4YY3 M;  3A45 A;  3GQ3 A;  1K82 A;  4DR6 M;  3J80 S;  5ITX E;  4PCZ A;  1L2C A;  5FLX S;  2UXD M;  1MX0 A;  4DR3 M;  3SAR A;  1XMO M; 
#chains in the Genus database with same CATH topology
 2FE8 A;  4DV5 M;  4AKH A;  5C1B A;  1HNZ M;  2CWB A;  4I5S A;  1ORY B;  1ZMV A;  3M6A A;  4LJ9 A;  3CTW B;  5FTM A;  2C9C A;  2UXC M;  1Q39 A;  2KNV A;  4G3O A;  1NHW C;  3I04 M;  2LVA A;  2QEN A;  2R18 A;  3KS4 A;  4LZZ A;  4S12 A;  4F1I A;  1XNQ M;  3GLH E;  3D8L A;  4CJ6 A;  1GLN A;  1XNR M;  3DA1 A;  5FTL A;  2ZM6 M;  1G4A E;  4QNR A;  3AV0 A;  2ZBK B;  4IBJ A;  3E21 A;  4MB7 A;  2LHC A;  4QOZ C;  4KO8 A;  1JQJ C;  7CAT A;  4LRS A;  4BB9 A;  1MU5 A;  2VQE M;  2J5Y A;  4YHH M;  3FUT A;  3L28 A;  3FUW A;  4FVM A;  4GHL A;  4KT0 F;  2DHR A;  2HCB A;  1BVS A;  4R7G A;  5GKN A;  3UJN A;  4AW4 A;  2YR0 A;  1XXH B;  3GRU A;  4DR2 M;  3L27 A;  1XB2 B;  4GIP A;  4LF7 M;  3B89 A;  4GRI A;  3BBZ A;  2DAK A;  2Z4S A;  1QDT A;  4BBA A;  5DYG A;  3MJ5 A;  2L2D A;  3RGP A;  3GLI E;  4ZPX A;  2CV2 A;  3QYB A;  1X37 A;  4IBI A;  4LJ6 A;  1QYR A;  5JI3 E;  5ITT A;  3DOA A;  1HQC A;  4K0K M;  1ZMU A;  3B74 A;  2RGH A;  4DBG B;  3GPX A;  3HHW A;  1KYI A;  4GMQ A;  3FRH A;  2M5Z A;  1D0K A;  3TWM A;  1VEJ A;  1MN3 A;  4IJE A;  4G4Q A;  2VII A;  5E26 A;  1HNX M;  4GC9 A;  1FJG M;  2KRU A;  4RNA A;  4LJ8 A;  1IXZ A;  4JI3 M;  4GHA A;  3UZU A;  1CUK A;  5IRE B;  4WP2 A;  3VFD A;  3KSJ A;  4GKJ M;  5IT9 S;  2CP8 A;  3RFW A;  2C5R A;  1I4W A;  3OTO M;  2A5Y B;  3SAU A;  2APL A;  3EIE A;  4CIS A;  2XZF A;  2KRK A;  2VF7 A;  4FCT A;  2JA2 A;  2O5R A;  1TDH A;  2W82 A;  2O01 F;  3ZH9 B;  1DGB A;  4IBE A;  4IBF A;  2QBY A;  1XXH E;  4AI6 A;  3B7Q A;  3I4V A;  3IEC A;  2KDL A;  2FS1 A;  3UMM A;  2OOA A;  5A2Q S;  2V1U A;  1NHG C;  4UN2 B;  2CV1 A;  3HU2 A;  3CF0 A;  5EJC A;  2KZS A;  2WSF F;  4B7H A;  4AZF A;  5LMU M;  1SXJ A;  2LHG A;  2DAM A;  2R44 A;  2XFS A;  2RGO A;  2ZTC A;  3K1J A;  5EQT A;  3VLF B;  3FTF A;  1Z6T A;  4M9S A;  1TTE A;  3KOZ E;  2CFO A;  1OAI A;  1N78 A;  2JP7 A;  3LQR A;  1JR3 D;  4PDG A;  2MGW A;  3SAS A;  2OOB A;  1IY1 A;  2VDB B;  4Q7J A;  1SXJ B;  4X66 M;  4X65 M;  2NQ8 C;  2H1R A;  1K3W A;  3T6P A;  2QZ4 A;  1DO0 A;  2O25 A;  3B9P A;  1T6O A;  3U6P A;  2MJ5 B;  1YLA A;  1GKI A;  2R62 A;  3DFZ A;  5FSW A;  2D7H A;  2J7O A;  4ANR A;  5KPZ A;  1LTM A;  1PJS A;  3QAU A;  1NSF A;  2FFJ A;  4FWG A;  3AKZ A;  2UXD M;  2DXI A;  2JZ1 A;  5H37 D;  4FW9 A;  3LW5 F;  3U6O A;  2L7I A;  3R9X B;  1SXJ C;  2CEA A;  5EP2 A;  4HEO A;  2DVW B;  1QAQ A;  1QZM A;  3L29 A;  2DZO B;  3U6C A;  1R7R A;  1TH2 A;  3PNV A;  3VK8 A;  3FYD A;  1FNN A;  2CUZ A;  2YQZ A;  3GRY A;  4JN6 A;  4NRV A;  1VG5 A;  4AQY M;  2F4V M;  3PXG A;  4X64 M;  2XLJ A;  1G59 A;  1P3Q Q;  2JY7 A;  2FH0 A;  1PJI A;  1HT1 E;  3U6L A;  3LVW A;  1G3I A;  4GIT A;  3VDP A;  3FTC A;  3SHG B;  2V6Z M;  3WHK A;  5ITX A;  2L09 A;  4QNM A;  2DWZ B;  4FWD A;  3KW6 A;  4WW0 A;  2UUA M;  2K6B A;  3RE8 A;  2X4A A;  4X62 M;  1HNW M;  3FYC A;  1EIJ A;  1Z59 A;  4PD2 A;  2UUC M;  1DGH A;  5DYI A;  2XFT A;  5E6J A;  2UUB M;  2QPA A;  2JY8 A;  4JI4 M;  3M7G A;  2HAK A;  4MGY E;  4KOD A;  4L15 A;  4F2L A;  1D0L A;  3IG8 A;  3HHX A;  3A46 A;  4LJ5 A;  3C58 A;  5DNY A;  2RKO A;  4M0D A;  3SYL A;  1XC8 A;  3U60 A;  1JR3 E;  1HQY E;  3U5Z A;  2F5P A;  1GO5 A;  3TL4 X;  3C3D A;  2R45 A;  1QQW A;  1C7Y A;  1XHB A;  4IJF A;  5EP3 A;  1VEK A;  4Z6Y A;  4JYA M;  4TUW A;  1G8P A;  2DAE A;  1IXR C;  3HX3 A;  1RU3 A;  4M0W A;  2XF3 A;  2FOI C;  3U5Z B;  3U6Q A;  3LQQ A;  1PGY A;  4GKK M;  3GPP A;  1PJT A;  1V33 A;  5JI2 E;  1TGU A;  2Y0T A;  4M9X A;  4FCW A;  1OTR A;  2F5S A;  3F92 A;  4XGI A;  3KP1 E;  2DZN B;  3SHF A;  1YSY A;  2CRU A;  1VDD A;  3WHL A;  4DV4 M;  2B3T A;  3R8F A;  5KPT A;  3J2P B;  4AG5 A;  2VQF M;  5ITY A;  3T1H M;  2UXB M;  3I51 A;  1W5S A;  4DR7 M;  2KHH A;  1R6B X;  1TR8 A;  2G8L A;  3A98 B;  1SG9 A;  4MH0 E;  3TWK A;  1Q02 A;  2BWE A;  3U6M A;  2DWM A;  1T43 A;  1TH3 A;  3BXW A;  3GRR A;  4B08 A;  1IM2 A;  2BWB A;  4RKU F;  3K8Z A;  3LVV A;  3T15 A;  2P5T A;  3L25 A;  4MGI E;  2XZU A;  1PJJ A;  4RF1 A;  3JR4 A;  4B3R M;  4G4O A;  3IG5 A;  5ITQ A;  2GQF A;  1NVM A;  4Z8X A;  3FE3 A;  3VDU A;  1T3T A;  1QUT A;  2MR9 A;  1N34 M;  1EFU B;  3T1Y M;  2EJS A;  1IXS A;  2OPF A;  4LF4 M;  1OIZ A;  1HR0 M;  4DV2 M;  4LF9 M;  4IBG A;  1G41 A;  3W67 A;  4OW0 A;  2L4F A;  3W0F A;  3KFU G;  4GEW A;  3RGS A;  4Y28 F;  1DGF A;  1Z5B A;  3KOY E;  4LF5 M;  2LH0 A;  1WHC A;  1N36 M;  4JI8 M;  1KSF X;  1NY5 A;  1GAB A;  1NJF A;  2F5Q A;  2JUJ A;  3SAT A;  3GQ3 A;  1K82 A;  4DR6 M;  2EKF A;  2ZTD A;  1Y8G A;  2EO2 A;  2ZAM A;  2HL7 A;  3J7B A;  2JWS A;  3GLF A;  3UK6 A;  4R3D A;  3AOE C;  5FLX S;  1L2C A;  1IQP A;  4P17 A;  3FTD A;  1MX0 A;  5EP4 A;  1SXJ D;  1S3S A;  2K0B X;  1VDL A;  1XMO M;  2QBY B;  4L4U A;  2QSF X;  5EXP A;  2Y20 A;  1IBM M;  4CHT B;  2R46 A;  4LGM A;  2DWL A;  2CHV A;  3HKP A;  3Q8G A;  2VF8 A;  2BNK A;  4LZJ A;  3SMS A;  1IN5 A;  3HWS A;  2F5O A;  4B3S M;  2LVO C;  3NBI A;  4OVZ A;  3VKH A;  1XWI A;  3JAM S;  1DGG A;  1WGN A;  2JNH A;  2EA0 A;  1QZE A;  3K2L A;  3E46 A;  4D81 A;  3Q8X A;  1E32 A;  2G5G X;  2JXN A;  4JI5 M;  2LXE A;  4LJA A;  5EP1 A;  1V34 A;  4GH9 A;  3TE6 A;  3TPZ A;  3SAW A;  1WIV A;  3GLG A;  2F5N A;  3U61 A;  4IBC A;  1WGL A;  3H4M A;  3GPY A;  1NV9 A;  2I7N A;  3W0L B;  3VK7 A;  4NXM M;  1QAO A;  1GJT A;  2BJW A;  1OFH A;  1IY0 A;  3NWL A;  1GL6 A;  4BLC A;  4B7G A;  2OQ4 A;  1QVR A;  1N33 M;  2CHQ A;  1D2N A;  3GLH A;  4MM3 B;  4MGK E;  2WZJ A;  2WSE F;  4JI0 M;  3M0E A;  4QHT A;  3TQS A;  4JI1 M;  4M9Z A;  2HWJ A;  3BOS A;  4JI6 M;  1W5T A;  1IN4 A;  3KOX E;  1IBL M;  4RF0 A;  3SC3 A;  1ZAE A;  2R65 A;  1C1K A;  1IN6 A;  1L2D A;  2D7G A;  1GL7 A;  3D8B A;  3FUX A;  2K9D A;  3HU3 A;  1TH4 A;  8CAT A;  4B3M M;  2D7E A;  3GQ5 A;  4JI2 M;  2KNZ A;  4G6Z A;  1OKS A;  2C99 A;  3QWL A;  2KXE A;  3JR5 A;  5KO3 A;  1NNJ A;  5BPV A;  1SXJ E;  2EKK A;  1D0M A;  2N35 A;  3B7Z A;  1YUB A;  1AIP C;  4I8O A;  1PJQ A;  3GLI A;  1N32 M;  4MGZ E;  4D80 A;  4LGY A;  1R5L A;  4FD2 A;  1V92 A;  1DGH B;  1NO1 A;  3PFI A;  2QQ8 A;  3U6D A;  2JZ0 A;  2C98 A;  4CGY B;  4NRW A;  2DAI A;  2LNH C;  3QYE A;  1IFY A;  3LCU A;  2JY6 B;  2ERC A;  2KW0 A;  4WUR A;  4XK8 F;  1NY6 A;  2QP9 X;  3L26 A;  3HY5 A;  3U60 B;  4L16 A;  3FRI A;  1R2Z A;  1L1Z A;  1Q3B A;  1L8Q A;  2XSZ A;  4NSO B;  1K3X A;  3KXE C;  2X8A A;  2MRO B;  5KQ8 A;  2LTU A;  4DR4 M;  2CE7 A;  3ZQJ A;  4DV7 M;  3VKG A;  3CF2 A;  2KA6 B;  1PM5 A;  4D82 A;  3W68 A;  3U6E A;  5IWA M;  2Z8Y M;  2Y21 A;  2Z7J A;  3SAV A;  1KFV A;  3CGW A;  4AG6 A;  1I94 M;  3AOG A;  3DZD A;  1E9S A;  1OJL A;  3T38 A;  1N77 A;  3C3E A;  4LJ4 A;  1NV8 A;  4QOS A;  5LMN M;  2K47 A;  1XXH A;  4JV5 M;  3K92 A;  1QDR A;  3E4R A;  3FUV A;  3CF6 E;  5FTK A;  2RRU A;  2DHY A;  3PVS A;  5ITX E;  4PCZ A;  1XMQ M;  1ZV1 A;  1HJP A;  3AOE A;  1LV7 A;  2DI0 A;  2Y0Q A;  4NOO B;  4AKG A;  2KEB A;  2LVN C;  4DR3 M;  2YFQ A;  5C18 A;  4EIW A;  2DZL A;  2J7N A;  4LCB A;  4REZ A;  3FUU A;  1UFZ A;  3NBX X;  3ZCB B;  4L78 A;  4B7F A;  4DV3 M;  2Q2E B;  1Q3C A;  2LWX A;  4LFA M;  3LMM A;  1EE8 A;  2CV0 A;  2BJV A;  1N75 A;  1J7K A;  4PT5 A;  5KPR A;  1ZMW A;  3GP1 A;  2LVP C;  2UU9 M;  3J81 S;  1WXQ A;  5EXS A;  2R4E A;  3AJI B;  1G71 A;  2E5L M;  1DO2 A;  1IXS B;  2XEP A;  2CHG A;  2DWN A;  3AL0 C;  3MK6 A;  4P16 A;  2YNM D;  4QHS A;  3U6S A;  2Z4R A;  2QHO B;  4ITQ A;  1OIP A;  4DR5 M;  4JI7 M;  3HU1 A;  2R6F A;  1H6U A;  5DFL A;  4DUZ M;  2HHH M;  2MH8 A;  1GVN A;  3HHY A;  4L8R C;  5ITR A;  4G4R A;  4HL4 A;  2R0I A;  1GJS A;  3KDS E;  4KHP M;  2C9O A;  2XGN A;  4G4N A;  1IBK M;  3IHP A;  4IIW A;  2M60 A;  1QAM A;  1L1T A;  4AKI A;  3PNY A;  5IZ7 D;  4LF8 M;  3GLF B;  2HKJ A;  1J09 A;  2DAG A;  1TDZ A;  3SFZ A;  3AFH A;  2DKL A;  3ILK A;  3KP0 E;  4DV6 M;  3E9S A;  4B3T M;  2GNO A;  4IBK A;  2ZAO A;  4IBD A;  5ITU A;  4DUY M;  3LCV B;  5F3W A;  1OFI A;  2XH9 A;  4OU7 A;  4LG2 A;  1TF0 B;  1IY2 A;  4NSR A;  1VEG A;  3J7A S;  3GO8 A;  3SBJ A;  2KNA A;  1AUA A;  2AHM A;  3GRV A;  5BR8 M;  1OQY A;  3KOW E;  1E9R A;  3SYK A;  3GPU A;  3V76 A;  2LVQ D;  2DEN A;  5L8R F;  3KSX A;  1F4I A;  2H5X A;  1VQ1 A;  3FD9 A;  3C9P A;  2KZU A;  1NNU C;  4DV0 M;  1Z5C A;  3L2A A;  4NC6 A;  2X49 A;  4OVZ B;  4DR1 M;  4I4L A;  1HT2 E;  4GC5 A;  2R4J A;  4PDI A;  3GQ4 A;  3KS8 A;  3ZC7 B;  5EXT A;  4I81 A;  3B7N A;  4LJ7 A;  4NL4 H;  4LFB M;  4DV1 M;  3FKE A;  3UGJ A;  5EXX A;  3GLG B;  1DV0 A;  3K9O A;  1JR3 A;  3U61 B;  3A42 A;  3THG A;  2L7H A;  4XBO A;  1Z5A A;  4FWH A;  3I4Y A;  4R71 A;  4LFC M;  2OO9 A;  1QAN A;  3HJ8 A;  4L6V 6;  3GLF E;  4LRT A;  3I01 M;  4KLN A;  3GLH B;  4NXN M;  4OX9 M;  2C96 A;  1R4G A;  2L4E A;  1PRB A;  2V1C A;  1IN7 A;  1NJG A;  1R2Y A;  4A3V B;  3FTE A;  5FTJ A;  4CIZ A;  4II7 A;  2L6O A;  1J5E M;  3MMP A;  5FTN A;  1A5T A;  1MJG M;  5KQD A;  2FNA A;  1L2B A;  1E94 E;  3HJQ A;  2ZAN A;  1UM8 A;  3HZJ A;  3HJS A;  3J27 B;  4LY6 A;  2DNA A;  2EUC A;  1WR1 B;  4JXJ A;  3TWL A;  2I7P A;  1YE9 A;  4IBB A;  2Z3X A;  3HHZ A;  4LF6 M;  2QNJ A;  1OAO C;  1WJ7 A;  4YY3 M;  3A45 A;  3H4J A;  2G3Q A;  3J80 S;  3HGI A;  3GLI B;  3K9P A;  3MHV C;  3EIH A;  2LBC A;  4FCV A;  4MGH A;  3SMP A;  4HLQ A;  3KVW A;  1QUS A;  1JB0 F;  1IN8 A;  2QCU A;  2XSZ D;  1ZQ9 A;  4W5W A;  3GLG E;  2JY5 A;  2WSC F;  3SAR A; 
#chains in the Genus database with same CATH homology
 2FE8 A;  4DV5 M;  4AKH A;  5C1B A;  1HNZ M;  4I5S A;  1ORY B;  3M6A A;  5FTM A;  4LJ9 A;  3CTW B;  2C9C A;  2UXC M;  1Q39 A;  1NHW C;  4LZZ A;  2QEN A;  2R18 A;  3KS4 A;  4S12 A;  1XNQ M;  3D8L A;  1GLN A;  1XNR M;  3DA1 A;  5FTL A;  2ZM6 M;  1G4A E;  4QNR A;  3AV0 A;  2ZBK B;  4IBJ A;  4MB7 A;  4QOZ C;  4KO8 A;  1JQJ C;  7CAT A;  4LRS A;  4BB9 A;  1MU5 A;  2VQE M;  4YHH M;  3FUT A;  3L28 A;  3FUW A;  4FVM A;  4GHL A;  2DHR A;  2HCB A;  5GKN A;  4R7G A;  3UJN A;  4AW4 A;  2YR0 A;  1XXH B;  3GRU A;  4DR2 M;  3L27 A;  4GIP A;  4LF7 M;  4GRI A;  4BBA A;  2Z4S A;  5DYG A;  3MJ5 A;  3RGP A;  4ZPX A;  2CV2 A;  1X37 A;  4IBI A;  4LJ6 A;  1QYR A;  5JI3 E;  5ITT A;  3DOA A;  1HQC A;  4K0K M;  2RGH A;  3GPX A;  3HHW A;  1KYI A;  4GMQ A;  2M5Z A;  3TWM A;  4IJE A;  4G4Q A;  2VII A;  5E26 A;  1HNX M;  4GC9 A;  1FJG M;  2KRU A;  4RNA A;  4LJ8 A;  1IXZ A;  4JI3 M;  4GHA A;  3UZU A;  3VFD A;  5IRE B;  4GKJ M;  3KSJ A;  5IT9 S;  2C5R A;  3RFW A;  1I4W A;  3OTO M;  2A5Y B;  3SAU A;  3EIE A;  4CIS A;  2XZF A;  2KRK A;  4FCT A;  2JA2 A;  2O5R A;  1TDH A;  2W82 A;  3ZH9 B;  1DGB A;  4IBE A;  4IBF A;  2QBY A;  4AI6 A;  3I4V A;  3UMM A;  5A2Q S;  2V1U A;  1NHG C;  2CV1 A;  3HU2 A;  3CF0 A;  5EJC A;  2KZS A;  4B7H A;  4AZF A;  5LMU M;  1SXJ A;  3K1J A;  3FTF A;  2XFS A;  2RGO A;  3VLF B;  5EQT A;  1Z6T A;  4M9S A;  3KOZ E;  2CFO A;  1N78 A;  3LQR A;  1JR3 D;  4PDG A;  3SAS A;  1IY1 A;  1SXJ B;  4X66 M;  4X65 M;  2NQ8 C;  2H1R A;  1K3W A;  2QZ4 A;  1DO0 A;  3B9P A;  3U6P A;  1GKI A;  2R62 A;  3DFZ A;  5FSW A;  2D7H A;  2J7O A;  5KPZ A;  3QAU A;  1NSF A;  2FFJ A;  4FWG A;  3AKZ A;  2UXD M;  2DXI A;  5H37 D;  4FW9 A;  3U6O A;  2L7I A;  3R9X B;  1SXJ C;  2CEA A;  5EP2 A;  2DVW B;  1QAQ A;  1QZM A;  3L29 A;  2DZO B;  3U6C A;  1R7R A;  1TH2 A;  3PNV A;  3VK8 A;  3FYD A;  1FNN A;  2CUZ A;  2YQZ A;  3GRY A;  4JN6 A;  4NRV A;  4AQY M;  2F4V M;  3PXG A;  4X64 M;  2XLJ A;  1G59 A;  1PJI A;  1HT1 E;  3U6L A;  3LVW A;  1G3I A;  4GIT A;  3VDP A;  3FTC A;  3SHG B;  2V6Z M;  3WHK A;  5ITX A;  2L09 A;  4QNM A;  2DWZ B;  4FWD A;  3KW6 A;  4WW0 A;  2UUA M;  3RE8 A;  2X4A A;  4X62 M;  1HNW M;  3FYC A;  1Z59 A;  4PD2 A;  2UUC M;  1DGH A;  5DYI A;  2XFT A;  5E6J A;  2UUB M;  2QPA A;  4JI4 M;  3M7G A;  4MGY E;  4KOD A;  4L15 A;  3IG8 A;  3HHX A;  3A46 A;  4LJ5 A;  3C58 A;  5DNY A;  2RKO A;  4M0D A;  3SYL A;  1XC8 A;  3U60 A;  1HQY E;  3U5Z A;  2F5P A;  3TL4 X;  2R45 A;  1QQW A;  1XHB A;  4IJF A;  5EP3 A;  4Z6Y A;  4JYA M;  4TUW A;  1G8P A;  1IXR C;  4M0W A;  2XF3 A;  2FOI C;  3U5Z B;  3U6Q A;  3LQQ A;  4GKK M;  3GPP A;  5JI2 E;  1TGU A;  2Y0T A;  4M9X A;  4FCW A;  2F5S A;  4XGI A;  3KP1 E;  2DZN B;  3SHF A;  1YSY A;  3WHL A;  1VDD A;  4DV4 M;  3R8F A;  5KPT A;  3J2P B;  4AG5 A;  2VQF M;  5ITY A;  3T1H M;  2UXB M;  3I51 A;  1W5S A;  4DR7 M;  3A98 B;  1R6B X;  2G8L A;  3TWK A;  4MH0 E;  3U6M A;  2DWM A;  1TH3 A;  3GRR A;  4B08 A;  1IM2 A;  3T15 A;  3L25 A;  3K8Z A;  3LVV A;  2P5T A;  4MGI E;  2XZU A;  1PJJ A;  4RF1 A;  3JR4 A;  4B3R M;  4G4O A;  3IG5 A;  5ITQ A;  1NVM A;  4Z8X A;  3VDU A;  1T3T A;  1N34 M;  3T1Y M;  2OPF A;  4LF4 M;  1HR0 M;  4DV2 M;  4LF9 M;  4IBG A;  1G41 A;  4OW0 A;  3W0F A;  3KFU G;  3RGS A;  1DGF A;  3KOY E;  1Z5B A;  4LF5 M;  2LH0 A;  1N36 M;  4JI8 M;  1KSF X;  1NY5 A;  1NJF A;  2F5Q A;  3SAT A;  3GQ3 A;  1K82 A;  4DR6 M;  2ZAM A;  2EO2 A;  2HL7 A;  3J7B A;  3GLF A;  3UK6 A;  4R3D A;  3AOE C;  5FLX S;  1L2C A;  1IQP A;  3FTD A;  1MX0 A;  5EP4 A;  1SXJ D;  1S3S A;  1XMO M;  2QBY B;  4L4U A;  5EXP A;  2Y20 A;  1IBM M;  4CHT B;  2R46 A;  4LGM A;  2DWL A;  2CHV A;  3HKP A;  2BNK A;  4LZJ A;  3SMS A;  1IN5 A;  3HWS A;  2F5O A;  4B3S M;  3NBI A;  4OVZ A;  3VKH A;  1XWI A;  3JAM S;  1DGG A;  2EA0 A;  3K2L A;  4D81 A;  3Q8X A;  1E32 A;  2G5G X;  4JI5 M;  2LXE A;  4LJA A;  5EP1 A;  3TE6 A;  4GH9 A;  3SAW A;  3TPZ A;  3GLG A;  2F5N A;  3U61 A;  4IBC A;  3H4M A;  3GPY A;  2I7N A;  3W0L B;  3VK7 A;  4NXM M;  1QAO A;  2BJW A;  1OFH A;  1IY0 A;  3NWL A;  1GL6 A;  4BLC A;  4B7G A;  2OQ4 A;  1QVR A;  1N33 M;  2CHQ A;  1D2N A;  3GLH A;  4MM3 B;  4MGK E;  4JI0 M;  3M0E A;  4QHT A;  3TQS A;  4JI1 M;  4M9Z A;  3BOS A;  4JI6 M;  1W5T A;  1IN4 A;  3KOX E;  1IBL M;  4RF0 A;  3SC3 A;  1ZAE A;  2R65 A;  1C1K A;  1IN6 A;  1L2D A;  2D7G A;  1GL7 A;  3D8B A;  3FUX A;  3HU3 A;  8CAT A;  1TH4 A;  4B3M M;  4JI2 M;  2D7E A;  3GQ5 A;  4G6Z A;  2C99 A;  3QWL A;  2KXE A;  3JR5 A;  5KO3 A;  1NNJ A;  5BPV A;  1SXJ E;  1YUB A;  4I8O A;  3GLI A;  1N32 M;  4MGZ E;  4D80 A;  4LGY A;  4FD2 A;  1DGH B;  3PFI A;  3U6D A;  2C98 A;  4CGY B;  4NRW A;  2LNH C;  2ERC A;  2KW0 A;  4WUR A;  1NY6 A;  2QP9 X;  3L26 A;  3U60 B;  4L16 A;  1R2Z A;  1L1Z A;  1Q3B A;  1L8Q A;  2XSZ A;  4NSO B;  1K3X A;  3KXE C;  2X8A A;  5KQ8 A;  4DR4 M;  2CE7 A;  4DV7 M;  3VKG A;  3CF2 A;  2KA6 B;  1PM5 A;  4D82 A;  3U6E A;  5IWA M;  2Y21 A;  2Z7J A;  3SAV A;  1KFV A;  4AG6 A;  1I94 M;  3AOG A;  3DZD A;  1E9S A;  1OJL A;  3T38 A;  1N77 A;  4LJ4 A;  4QOS A;  5LMN M;  2K47 A;  1XXH A;  4JV5 M;  3K92 A;  3E4R A;  3FUV A;  3CF6 E;  5FTK A;  3PVS A;  5ITX E;  4PCZ A;  3AOE A;  1LV7 A;  2Y0Q A;  4NOO B;  4AKG A;  2KEB A;  4DR3 M;  2YFQ A;  5C18 A;  4EIW A;  2J7N A;  4LCB A;  4REZ A;  3FUU A;  4B7F A;  3ZCB B;  4DV3 M;  4L78 A;  2Q2E B;  1Q3C A;  2LWX A;  4LFA M;  3LMM A;  1EE8 A;  2CV0 A;  2BJV A;  1N75 A;  1J7K A;  4PT5 A;  5KPR A;  3GP1 A;  2UU9 M;  3J81 S;  1WXQ A;  5EXS A;  2R4E A;  3AJI B;  2E5L M;  1DO2 A;  1IXS B;  2XEP A;  2CHG A;  2DWN A;  3AL0 C;  3MK6 A;  4P16 A;  2YNM D;  4QHS A;  3U6S A;  2Z4R A;  4ITQ A;  4DR5 M;  4JI7 M;  3HU1 A;  4DUZ M;  1H6U A;  2HHH M;  1GVN A;  3HHY A;  4L8R C;  5ITR A;  4G4R A;  4HL4 A;  3KDS E;  4KHP M;  2C9O A;  2XGN A;  4G4N A;  1IBK M;  4IIW A;  2M60 A;  1QAM A;  1L1T A;  4AKI A;  3PNY A;  5IZ7 D;  4LF8 M;  3GLF B;  2HKJ A;  1J09 A;  1TDZ A;  3SFZ A;  3AFH A;  3ILK A;  3KP0 E;  4DV6 M;  3E9S A;  4B3T M;  4DUY M;  4IBK A;  2ZAO A;  4IBD A;  5ITU A;  5F3W A;  1OFI A;  2XH9 A;  4OU7 A;  4LG2 A;  4NSR A;  1IY2 A;  3J7A S;  3GO8 A;  3SBJ A;  3GPU A;  3GRV A;  2AHM A;  5BR8 M;  3KOW E;  1E9R A;  3SYK A;  3KSX A;  3FD9 A;  2KZU A;  1NNU C;  4DV0 M;  1Z5C A;  3L2A A;  2X49 A;  4OVZ B;  4DR1 M;  4I4L A;  1HT2 E;  4GC5 A;  2R4J A;  4PDI A;  3GQ4 A;  3KS8 A;  3ZC7 B;  5EXT A;  4I81 A;  4LJ7 A;  4NL4 H;  4LFB M;  4DV1 M;  3FKE A;  3UGJ A;  5EXX A;  3GLG B;  1JR3 A;  3U61 B;  3A42 A;  3THG A;  2L7H A;  4XBO A;  1Z5A A;  4FWH A;  3I4Y A;  4LFC M;  1QAN A;  3HJ8 A;  4LRT A;  4KLN A;  4NXN M;  3GLH B;  4OX9 M;  2C96 A;  2V1C A;  1IN7 A;  1NJG A;  1R2Y A;  4A3V B;  3FTE A;  5FTJ A;  4II7 A;  2L6O A;  1J5E M;  5FTN A;  5KQD A;  2FNA A;  1L2B A;  3J27 B;  1E94 E;  2ZAN A;  1UM8 A;  3HJQ A;  3HJS A;  4LY6 A;  3TWL A;  2EUC A;  4JXJ A;  1XMQ M;  2I7P A;  1YE9 A;  4IBB A;  2Z3X A;  3HHZ A;  4LF6 M;  4YY3 M;  3A45 A;  3J80 S;  3HGI A;  3GLI B;  3MHV C;  3EIH A;  4MGH A;  4FCV A;  3SMP A;  4HLQ A;  3KVW A;  2QCU A;  2XSZ D;  1IN8 A;  4W5W A;  1ZQ9 A;  3SAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...