4JI4M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 25
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ji4M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4ji4M02
4NXNM 2UXBM 3SAVA 3JR5A 4DR5M 4LF7M 3SBJA 4NRVA 2E5LM 2XZFA 4JI0M 4G4NA 3DOAA 4PDGA 4DV6M 1KFVA 3U6MA 4G4QA 1Q39A 1Z5BA 4PDIA 3VK7A 4CISA 4PCZA 4JI8M 4X62M 2OPFA 4DV5M 2UXCM 5ITQA 1MX0A 3VK8A 4LFAM 3GQ3A 4PD2A 1PM5A 4JI1M 1K3XA 2F5QA 4NXMM 4LFBM 1PJJA 4B3TM 4JI5M 1R2YA 4DV3M 1N36M 1I94M 2UUCM 1PJIA 3U6CA 3GPYA 3C58A 5LMNM 4GKKM 1XMOM 4AQYM 2ZBKB 3GPXA 5LMUM 3TWLA 1XC8A 4G4OA 3GPUA 1J5EM 4DR1M 1IBLM 2F5NA 2EA0A 3GPPA 3A46A 3JR4A 1HNXM 3GQ5A 4LF9M 4X64M 3TWKA 5ITUA 4LFCM 1Q3BA 1R2ZA 1N33M 2HKJA 2F5SA 2F5PA 1TDZA 3GQ4A 4B3RM 3U6OA 4DR7M 3A42A 2VQFM 3A45A 1L1TA 4X65M 1HNZM 2VQEM 5ITRA 2UUBM 2HHHM 5ITXA 1Z59A 4JV5M 4YHHM 3J81S 5FLXS 4LF6M 2F4VM 4JYAM 4X66M 2UXDM 4DR2M 4LF8M 2ZM6M 4YY3M 1TDHA 4K0KM 1N34M 5BR8M 3U6PA 3TWMA 1HR0M 2XZUA 3SASA 5IWAM 1XMQM 2UU9M 4B3SM 4JI2M 1N32M 5ITYA 3J7AS 5A2QS 4DV1M 4ITQA 1FJGM 3U6LA 1Z5AA 1NNJA 4JI7M 4KHPM 4G4RA 5ITXE 3SARA 5IT9S 1MU5A 3OTOM 1L2DA 4B3MM 4DV4M 4DUZM 1EE8A 4DR3M 4JI3M 4LF5M 4DR4M 1L2BA 3SAWA 4DV7M 5ITTA 4NRWA 1IBMM 3U6QA 3J80S 2OQ4A 4JI4M 4DV2M 1L2CA 3U6DA 2F5OA 1XNQM 4MB7A 1Q3CA 3GP1A 4OX9M 4JI6M 4GKJM 4DV0M 4DR6M 3SATA 3GO8A 4LF4M 1Z5CA 1K82A 3U6EA 3T1YM 3SAUA 2UUAM 3U6SA 3W0FA 1IBKM 3JAMS 1XNRM 4DUYM 3T1HM 2Q2EB 1K3WA 1L1ZA 1HNWM
chains in the Genus database with same CATH superfamily
2QBYB 3FTEA 3IG8A 3JR5A 3SAVA 1JQJC 2VF8A 3U60A 2E5LM 1YE9A 4LG2A 3HZJA 3Q8GA 4JI0M 2CV0A 1DV0A 5DYIA 1OIZA 2JUJA 1XWIA 4IBBA 4PDGA 3TQSA 3I01M 5KPZA 1KFVA 2L7IA 2O25A 4LZZA 4G4QA 4B7FA 1QUSA 4PDIA 2CHQA 2DAGA 2JNHA 5EP3A 3AV0A 4FW9A 4FVMA 4X62M 4DV5M 4NC6A 3GRRA 3K8ZA 4LFAM 3W0LB 4PD2A 1T3TA 5BPVA 1PM5A 2V1UA 2KNVA 2L7HA 2RGHA 4NXMM 1KYIA 3KFUG 4L15A 4R71A 1OKSA 5EXPA 3GLFB 4B3TM 1J09A 2R4JA 4F2LA 1Q02A 2VDBB 1D0LA 2YR0A 4RF1A 1R2YA 4JI5M 1G4AE 1V33A 1E9SA 3U6CA 2CP8A 3VDPA 5LMNM 1OAOC 3LMMA 4REZA 2LXEA 1W5TA 4AQYM 3SHFA 3TWLA 2LVAA 2DXIA 1IN5A 1XXHE 4KO8A 3HHZA 1J5EM 4DR1M 1IBLM 2EA0A 3KP0E 3FRHA 3A98B 2X8AA 3JR4A 1OTRA 2R18A 3LCVB 2R62A 2R45A 5C18A 1HQCA 3K9PA 1NJFA 2XFTA 3K9OA 2RRUA 2DAMA 4LFCM 1R2ZA 4HL4A 2HKJA 1OFHA 3HJSA 1VEGA 3LW5F 4GC9A 3H4MA 3WHLA 5JI3E 4XGIA 3L25A 3SHGB 1MJGM 3BBZA 3KOZE 2Y21A 1GLNA 2C5RA 1DO0A 1SXJB 1D2NA 3ILKA 2CV2A 1GABA 2Z4RA 4L16A 4OVZA 3RE8A 2VQEM 2K0BX 3M0EA 1HJPA 4FCVA 3CF0A 2HHHM 2J7NA 2FS1A 1QZMA 1Z59A 2XFSA 4IBIA 2KNAA 2DAKA 5FLXS 3U5ZB 4LF6M 3LQRA 2F4VM 4TUWA 2WSEF 3DA1A 4LJ5A 4DR2M 4LF8M 3K2LA 4YY3M 3FYDA 3J7BA 4LGYA 4G6ZA 4DV1M 3QYEA 1WR1B 5DYGA 1NNUC 2K47A 3FUVA 4Z8XA 4Z6YA 4JI7M 3SYLA 1FJGM 1RU3A 2DAIA 2QQ8A 4GC5A 3W68A 2ZTDA 2MROB 2J5YA 3SC3A 2LVQD 4I4LA 2B3TA 2FNAA 1L2BA 3HJ8A 4DV7M 1I4WA 3KOXE 2G5GX 2R46A 3J80S 3GLFE 4DV2M 3KS4A 3QWLA 4RNAA 1EIJA 2F5OA 2HCBA 3GP1A 1T43A 1G71A 4CJ6A 4JI6M 3CF2A 3PNVA 1ZV1A 3SATA 1IY2A 4LJ6A 1PJQA 1HT1E 2KA6B 1NHWC 3KSXA 4LCBA 3HJQA 4NOOB 3KS8A 1WIVA 3FTDA 1QVRA 4Y28F 2KXEA 5JI2E 2V6ZM 2YFQA 5KPRA 4CGYB 4MGHA 3CTWB 3I51A 5FTLA 2UXBM 4DR5M 4M0WA 4LF7M 2X49A 1PRBA 3KW6A 4NRVA 2XZFA 3FE3A 3DOAA 3LCUA 4B08A 4DV6M 1NY6A 4B7GA 4LJ7A 4QNRA 4OW0A 1OQYA 2LVPC 4MGIE 3ZC7B 4PCZA 3HU1A 4RF0A 1GVNA 2N35A 2KDLA 4P16A 2OPFA 2UXCM 1MX0A 1OAIA 2YNMD 4BB9A 2R0IA 1K3XA 1C7YA 4MGKE 2F5QA 3J2PB 1PGYA 1AIPC 1SXJE 4LFBM 3VKGA 1PJJA 3IG5A 2XF3A 3VLFB 3I4VA 1OJLA 3FUUA 3V76A 1IN4A 4W5WA 1I94M 1PJIA 3GLHB 3I4YA 4GKKM 4FD2A 3GLGB 3HU2A 2ZBKB 4AI6A 1XB2B 2CHGA 4QNMA 1QAQA 1UM8A 4AKIA 1WJ7A 1Y8GA 1TGUA 3T38A 1GKIA 3GPPA 4GIPA 4L8RC 3A46A 3KDSE 1EFUB 4IBFA 1JR3A 3GRUA 3HHYA 5C1BA 4UN2B 1E32A 7CATA 1IQPA 2ZAOA 1VEKA 4L6V6 2WSCF 4X64M 1C1KA 4G3OA 2MH8A 1Q3BA 4II7A 2L4FA 1N33M 3HX3A 3BXWA 1UFZA 2DHYA 2ERCA 2KZSA 2K9DA 2ZTCA 2MR9A 3B74A 1IN8A 2XH9A 2DZNB 2R44A 2Y0QA 3THGA 3U6OA 3U60B 4FCTA 3PVSA 3RGSA 1L8QA 2VQFM 2C9OA 2I7PA 1VEJA 4X65M 4D82A 2BJVA 5ITXA 2QHOB 2L4EA 4LRSA 1T6OA 5FTJA 3KVWA 4JV5M 4YHHM 3R9XB 4JYAM 1QZEA 5EXTA 2V1CA 2JY8A 1QDTA 2BWBA 4AKHA 1TDHA 5BR8M 3CGWA 2JA2A 4HEOA 1HT2E 2C98A 5FSWA 2LTUA 3R8FA 3SASA 3U61A 1R6BX 5IWAM 4NSOB 1ZMUA 1XMQM 5ITYA 1QYRA 3TPZA 4LRTA 4EIWA 3RGPA 3GLIA 4IJFA 4I81A 4FWHA 1N75A 3VKHA 3HGIA 1JR3D 3QAUA 4ANRA 2QCUA 3C9PA 4IBGA 2RGOA 2WSFF 4DR4M 2GQFA 3UJNA 2C96A 5ITTA 2BWEA 5E6JA 3U6QA 2XEPA 3IECA 2GNOA 1MN3A 2DHRA 5KQDA 1XHBA 2KEBA 3B7NA 1QAOA 2OQ4A 2EKKA 2JXNA 3B7ZA 3U6DA 1L2CA 1Q3CA 2LHCA 3T6PA 1VQ1A 1V92A 4QOZC 3GLHE 5EP4A 2L09A 2VIIA 1PJTA 4B7HA 2Z7JA 2JP7A 3CF6E 3U6EA 3GLGE 3T1YM 2EUCA 4GMQA 2D7GA 2XSZA 4HLQA 4IBCA 1NSFA 4LY6A 4AG6A 3GLIB 2Q2EB 4RKUF 4CIZA 4DUYM 2QZ4A 1HNWM 1IXSA 2QNJA 5DNYA 2FE8A 3FKEA 4NXNM 2KRKA 4NL4H 2EKFA 2MJ5B 4S12A 5L8RF 3EIEA 3Q8XA 1LTMA 4G4NA 4AKGA 4IBJA 4OVZB 1SXJC 1W5SA 1Q39A 1GL6A 2OO9A 4LJ8A 3FUXA 1S3SA 3B7QA 3VK7A 3DFZA 4CISA 1DGFA 4GHAA 3NBIA 1ZMVA 2ZAMA 5ITQA 2OOAA 1XXHA 1LV7A 2D7EA 2Y0TA 3D8LA 4CHTB 1ZQ9A 2KNZA 4IBEA 4KLNA 4M0DA 1P3QQ 3LQQA 3SYKA 4OU7A 3B9PA 5KQ8A 2G8LA 2R4EA 3EIHA 2MGWA 3KXEC 2APLA 5IZ7D 2EJSA 2JY5A 3C58A 2FH0A 2RKOA 2R6FA 3I04M 4F1IA 4P17A 1XMOM 1IFYA 5EP1A 3GPXA 2JY7A 1TF0B 3E9SA 1GL7A 2XGNA 4G4OA 1XC8A 1IY0A 2C99A 2OOBA 2DZLA 2QPAA 3L29A 5FTKA 8CATA 2LWXA 4AZFA 1QANA 1NHGC 4I5SA 1E94E 2FFJA 4GITA 2XSZD 3FTFA 3GQ5A 4LF9M 3H4JA 1XXHB 3KOWE 1G3IA 1R4GA 3RFWA 3TWKA 4M9XA 4LJ4A 2QP9X 1ZAEA 3GRVA 5FTNA 1N78A 3KOYE 2F5SA 4GRIA 4JN6A 1DGBA 1YLAA 1YUBA 3K1JA 3TL4X 2QBYA 4GHLA 2CFOA 2AHMA 1TDZA 3GQ4A 3KP1E 4GH9A 4B3RM 4DR7M 1VDDA 2NQ8C 3A42A 3T1HM 3HWSA 3VDUA 3E21A 1YSYA 5EP2A 2EO2A 1L1TA 1QDRA 1OIPA 1HNZM 3HU3A 1ZMWA 1QQWA 2CV1A 1GJTA 1NY5A 3MJ5A 1IXZA 3J81S 4X66M 2UXDM 1IN7A 3T15A 3L26A 3PXGA 3E4RA 1N34M 1PJSA 4XK8F 1HR0M 2XZUA 3FUWA 1VDLA 3L27A 1X37A 3FTCA 3WHKA 3GLFA 4B3SM 2Z3XA 5A2QS 2DWZB 3AOEC 3J27B 4ITQA 3MHVC 3L2AA 1Z5AA 1NNJA 4IJEA 3UGJA 1VG5A 2LVNC 1IN6A 3HY5A 4FWGA 3GRYA 2LH0A 1EE8A 3C3DA 3QYBA 4DR3M 2DWMA 2M5ZA 3AL0C 2LVOC 3KSJA 4LF5M 3SAWA 1NV8A 1Z6TA 3M6AA 4JXJA 4LJAA 1IBMM 3ZQJA 4FCWA 1SG9A 2A5YB 3FD9A 2Z8YM 2H5XA 5H37D 3HHXA 1G59A 2P5TA 1WHCA 3ZCBB 3MK6A 2DVWB 4MM3B 4GKJM 4D80A 4DV0M 4DR6M 3E46A 5E26A 5IREB 1CUKA 3SAUA 5GKNA 3W0FA 3LVWA 3JAMS 1IXRC 3F92A 4I8OA 4DV4M 1K3WA 1L1ZA 3ZH9B 4AW4A 2Z4SA 4WURA 1IY1A 3SBJA 1SXJA 3FRIA 2XLJA 1OFIA 4R3DA 3FYCA 2JZ1A 3FUTA 4M9ZA 1FNNA 3U6MA 1D0MA 1NVMA 4Q7JA 2CRUA 4R7GA 2QENA 3B89A 1Z5BA 3UK6A 5KO3A 2DKLA 3U5ZA 4QHSA 2LBCA 4JI8M 2L6OA 3SMSA 3IHPA 2R65A 4A3VB 3VK8A 3GQ3A 4JI1M 2LHGA 2LNHC 5F3WA 1DGHA 2DENA 3NWLA 3U61B 1DGGA 4LJ9A 3W67A 3HHWA 3DZDA 4IBKA 4DBGB 3LVVA 1A5TA 4DV3M 1N36M 2UUCM 2D7HA 2WZJA 3GPYA 2L2DA 4L4UA 1V34A 4IBDA 2HAKA 2C9CA 1GO5A 5DFLA 4MGZE 1H6UA 5LMUM 1ORYB 1NO1A 5EJCA 3GPUA 4WP2A 1NV9A 3AFHA 3L28A 2F5NA 5EXXA 1JB0F 4ZPXA 2CUZA 4XBOA 1HNXM 1TTEA 3HKPA 2QSFX 3AOGA 4D81A 1WGNA 4JI4M 1DGHB 4LGMA 1WXQA 4MGYE 1GJSA 1IM2A 3PFIA 5ITUA 1SXJD 3PNYA 3MMPA 3NBXX 1NJGA 2O5RA 4KT0F 2YQZA 2F5PA 1TH2A 2K6BA 1KSFX 1IXSB 3D8BA 1N77A 4WW0A 4BLCA 1BVSA 4LZJA 1JR3E 2CWBA 3C3EA 4NSRA 3A45A 3K92A 2DWLA 2DZOB 2BJWA 2CHVA 5ITRA 2UUBM 2Y20A 2CE7A 4KODA 2O01F 2W82A 2HL7A 3AJIB 3UZUA 4BBAA 4QOSA 3TE6A 4QHTA 3BOSA 2ZM6M 3AOEA 4K0KM 3AKZA 2JWSA 3U6PA 2I7NA 2CEAA 3TWMA 4FWDA 2UU9M 1N32M 4JI2M 5KPTA 1TR8A 3J7AS 4M9SA 1TH4A 2G3QA 1DO2A 3U6LA 2X4AA 2BNKA 2VF7A 4KHPM 3M7GA 4G4RA 5ITXE 2DWNA 3GLHA 3SARA 5IT9S 1MU5A 3OTOM 1L2DA 3SMPA 1WGLA 2DI0A 4B3MM 3GLGA 4DUZM 4JI3M 1G8PA 2DNAA 4PT5A 3VFDA 1AUAA 4GEWA 2J7OA 4NRWA 2M60A 2HWJA 2KHHA 2JY6B 3UMMA 4AG5A 4IIWA 5EQTA 2KZUA 3GLIE 1XNQM 1HQYE 4MB7A 2DAEA 2H1RA 2KRUA 5EXSA 4L78A 4OX9M 1G41A 1TH3A 2ZANA 3GO8A 1Z5CA 2JZ0A 3SFZA 1K82A 4LF4M 1F4IA 1R5LA 1QAMA 2UUAM 1D0KA 1R7RA 2FOIC 2KW0A 3U6SA 1IBKM 1XNRM 4MH0E 1QUTA 1E9RA 1J7KA 5FTMA
chains in the Genus database with same CATH topology
2QBYB 3FTEA 3IG8A 3JR5A 3SAVA 1JQJC 3U60A 2E5LM 1YE9A 4LG2A 4JI0M 2CV0A 5DYIA 1XWIA 4IBBA 4PDGA 3TQSA 5KPZA 1KFVA 2L7IA 4LZZA 4G4QA 4B7FA 4PDIA 2CHQA 5EP3A 3AV0A 4FW9A 4FVMA 4X62M 4DV5M 3GRRA 3K8ZA 4LFAM 3W0LB 4PD2A 1T3TA 5BPVA 1PM5A 2V1UA 2RGHA 2L7HA 4NXMM 3KFUG 1KYIA 4L15A 5EXPA 3GLFB 4B3TM 1J09A 2R4JA 4RF1A 2YR0A 1R2YA 4JI5M 1G4AE 1E9SA 3U6CA 3VDPA 5LMNM 3LMMA 4REZA 2LXEA 1W5TA 4AQYM 3SHFA 3TWLA 2DXIA 1IN5A 4KO8A 3HHZA 1J5EM 4DR1M 1IBLM 2EA0A 3KP0E 3A98B 2X8AA 3JR4A 2R18A 2R62A 2R45A 5C18A 1HQCA 1NJFA 2XFTA 4LFCM 1R2ZA 4HL4A 2HKJA 1OFHA 3HJSA 3WHLA 4GC9A 3H4MA 5JI3E 4XGIA 3L25A 3SHGB 3KOZE 2Y21A 1GLNA 2C5RA 1DO0A 1SXJB 1D2NA 3ILKA 2CV2A 2Z4RA 4L16A 4OVZA 3RE8A 2VQEM 3M0EA 2HHHM 4FCVA 3CF0A 2J7NA 1QZMA 1Z59A 2XFSA 4IBIA 4LF6M 5FLXS 3U5ZB 2F4VM 4TUWA 3LQRA 3DA1A 4LJ5A 4DR2M 4LF8M 3K2LA 4YY3M 3FYDA 3J7BA 4LGYA 4G6ZA 4DV1M 5DYGA 1NNUC 2K47A 3FUVA 4Z8XA 4Z6YA 4JI7M 3SYLA 1FJGM 4GC5A 3SC3A 4I4LA 2FNAA 1L2BA 3HJ8A 4DV7M 1I4WA 3KOXE 2G5GX 2R46A 3J80S 4DV2M 3KS4A 3QWLA 4RNAA 2F5OA 2HCBA 3GP1A 4JI6M 3CF2A 3PNVA 3SATA 1IY2A 4LJ6A 2KA6B 1HT1E 1NHWC 3KSXA 4LCBA 3HJQA 4NOOB 3KS8A 3FTDA 1QVRA 2KXEA 5JI2E 2V6ZM 2YFQA 5KPRA 4CGYB 4MGHA 3CTWB 3I51A 5FTLA 2UXBM 4DR5M 4M0WA 4LF7M 2X49A 3KW6A 4NRVA 2XZFA 3DOAA 4B08A 4DV6M 1NY6A 4B7GA 4LJ7A 4QNRA 4OW0A 4MGIE 3ZC7B 4PCZA 3HU1A 4RF0A 1GVNA 4P16A 2OPFA 2UXCM 1MX0A 4BB9A 2YNMD 1K3XA 4MGKE 2F5QA 3J2PB 4LFBM 1SXJE 3VKGA 1PJJA 3IG5A 2XF3A 3VLFB 3I4VA 1OJLA 3FUUA 1IN4A 4W5WA 1I94M 1PJIA 3GLHB 3I4YA 4GKKM 4FD2A 3GLGB 3HU2A 2ZBKB 4AI6A 2CHGA 4QNMA 1QAQA 1UM8A 4AKIA 3T38A 1TGUA 1GKIA 3GPPA 4GIPA 4L8RC 3A46A 3KDSE 4IBFA 3HHYA 1JR3A 3GRUA 5C1BA 1E32A 7CATA 1IQPA 2ZAOA 4X64M 1C1KA 1Q3BA 4II7A 1N33M 2ERCA 2KZSA 1IN8A 2XH9A 2DZNB 2Y0QA 3THGA 3U6OA 3U60B 4FCTA 3PVSA 3RGSA 1L8QA 2VQFM 2C9OA 2I7PA 4X65M 4D82A 2BJVA 5ITXA 4LRSA 5FTJA 3KVWA 4JV5M 4YHHM 3R9XB 4JYAM 5EXTA 2V1CA 4AKHA 1TDHA 5BR8M 2JA2A 1HT2E 2C98A 5FSWA 3R8FA 3SASA 3U61A 1R6BX 5IWAM 4NSOB 1XMQM 5ITYA 1QYRA 3TPZA 4LRTA 4EIWA 3RGPA 3GLIA 4IJFA 4I81A 4FWHA 1N75A 3VKHA 3HGIA 1JR3D 3QAUA 2QCUA 4IBGA 2RGOA 4DR4M 3UJNA 2C96A 5ITTA 5E6JA 3U6QA 2XEPA 5KQDA 2OQ4A 5F3WA 2DHRA 4JI4M 1XHBA 2KEBA 1L2CA 1QAOA 3U6DA 1Q3CA 4QOZC 5EP4A 2L09A 2VIIA 4B7HA 2Z7JA 3CF6E 3U6EA 3T1YM 2EUCA 4GMQA 2D7GA 2XSZA 4HLQA 4IBCA 1NSFA 4LY6A 4AG6A 3GLIB 2Q2EB 4DUYM 1HNWM 2QZ4A 5DNYA 2FE8A 3FKEA 4NXNM 2KRKA 4NL4H 4S12A 3EIEA 3Q8XA 4G4NA 4AKGA 4IBJA 4OVZB 1SXJC 1W5SA 1Q39A 1GL6A 4LJ8A 3FUXA 1S3SA 3VK7A 4CISA 3DFZA 1DGFA 4GHAA 3NBIA 2ZAMA 5ITQA 1XXHA 1LV7A 2D7EA 2Y0TA 3D8LA 4CHTB 1ZQ9A 4IBEA 4KLNA 4M0DA 3LQQA 3SYKA 4OU7A 3B9PA 5KQ8A 2G8LA 2R4EA 3EIHA 3KXEC 5IZ7D 3C58A 2RKOA 1XMOM 5EP1A 3GPXA 1XC8A 3E9SA 1GL7A 2XGNA 4G4OA 1IY0A 2C99A 2QPAA 3L29A 5FTKA 8CATA 2LWXA 4AZFA 1QANA 1NHGC 4I5SA 1E94E 2FFJA 4GITA 2XSZD 3FTFA 3GQ5A 4LF9M 3KOWE 1XXHB 1G3IA 3RFWA 3TWKA 4M9XA 4LJ4A 2QP9X 1ZAEA 3GRVA 5FTNA 1N78A 3KOYE 2F5SA 4GRIA 4JN6A 1DGBA 1YUBA 3K1JA 3TL4X 2QBYA 4GHLA 2CFOA 2AHMA 1TDZA 3GQ4A 3KP1E 4GH9A 4B3RM 4DR7M 1VDDA 2NQ8C 3A42A 3T1HM 3HWSA 3VDUA 1YSYA 5EP2A 2EO2A 1L1TA 1HNZM 3HU3A 1QQWA 2CV1A 1NY5A 3MJ5A 3J81S 1IXZA 2UXDM 4X66M 1IN7A 3T15A 3L26A 3PXGA 3E4RA 1N34M 1HR0M 2XZUA 3FUWA 3WHKA 3L27A 1X37A 3FTCA 3GLFA 4B3SM 2Z3XA 5A2QS 2DWZB 3AOEC 3J27B 4ITQA 3MHVC 3L2AA 1Z5AA 1NNJA 4IJEA 3UGJA 1IN6A 4FWGA 3GRYA 2LH0A 1EE8A 4DR3M 2DWMA 2M5ZA 3AL0C 4LF5M 3KSJA 3SAWA 3M6AA 1Z6TA 4JXJA 4LJAA 1IBMM 4FCWA 2A5YB 3FD9A 5H37D 1G59A 3HHXA 2P5TA 3ZCBB 3MK6A 2DVWB 4MM3B 4GKJM 4D80A 4DV0M 4DR6M 5E26A 5IREB 3SAUA 5GKNA 3W0FA 3LVWA 3JAMS 1IXRC 4I8OA 4DV4M 1K3WA 1L1ZA 3ZH9B 4AW4A 2Z4SA 4WURA 1IY1A 3SBJA 1SXJA 2XLJA 1OFIA 4R3DA 3FYCA 3FUTA 4M9ZA 1FNNA 3U6MA 1NVMA 4R7GA 3UK6A 2QENA 1Z5BA 5KO3A 3U5ZA 4QHSA 4JI8M 2L6OA 3SMSA 2R65A 4A3VB 3VK8A 3GQ3A 4JI1M 2LNHC 1DGHA 3NWLA 3U61B 1DGGA 4LJ9A 3HHWA 3DZDA 4IBKA 3LVVA 4DV3M 1N36M 2UUCM 2D7HA 3GPYA 4L4UA 4IBDA 2C9CA 4MGZE 1H6UA 5LMUM 1ORYB 5EJCA 3GPUA 3AFHA 3L28A 2F5NA 5EXXA 4ZPXA 2CUZA 4XBOA 1HNXM 3HKPA 3AOGA 4D81A 1DGHB 4LGMA 1WXQA 4MGYE 1IM2A 3PFIA 5ITUA 1SXJD 3PNYA 1NJGA 2O5RA 2YQZA 2F5PA 1TH2A 1KSFX 1IXSB 3D8BA 1N77A 4WW0A 4BLCA 4LZJA 4NSRA 3A45A 3K92A 2DWLA 2DZOB 2BJWA 2CHVA 5ITRA 2UUBM 2Y20A 2CE7A 4KODA 2W82A 2HL7A 3AJIB 3UZUA 4BBAA 4QOSA 3TE6A 4QHTA 3BOSA 2ZM6M 3AOEA 4K0KM 3AKZA 3U6PA 2I7NA 2CEAA 3TWMA 4FWDA 2UU9M 1N32M 4JI2M 5KPTA 3J7AS 4M9SA 1TH4A 1DO2A 3U6LA 2X4AA 2BNKA 4KHPM 3M7GA 4G4RA 5ITXE 2DWNA 3GLHA 3SARA 5IT9S 1MU5A 3OTOM 1L2DA 3SMPA 4B3MM 3GLGA 4DUZM 4JI3M 1G8PA 4PT5A 3VFDA 4NRWA 2J7OA 2M60A 3UMMA 4AG5A 4IIWA 5EQTA 2KZUA 1XNQM 1HQYE 4MB7A 2H1RA 2KRUA 5EXSA 4OX9M 4L78A 1G41A 1TH3A 2ZANA 3GO8A 1Z5CA 3SFZA 1K82A 4LF4M 1QAMA 2UUAM 2FOIC 1R7RA 2KW0A 3U6SA 1IBKM 1XNRM 4MH0E 1E9RA 1J7KA 5FTMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXN M;  2UXB M;  3SAV A;  3JR5 A;  4DR5 M;  4LF7 M;  3SBJ A;  4NRV A;  2E5L M;  2XZF A;  4JI0 M;  4G4N A;  3DOA A;  4PDG A;  4DV6 M;  1KFV A;  3U6M A;  4G4Q A;  1Q39 A;  1Z5B A;  4PDI A;  3VK7 A;  4CIS A;  4PCZ A;  4JI8 M;  4X62 M;  2OPF A;  4DV5 M;  2UXC M;  5ITQ A;  1MX0 A;  3VK8 A;  4LFA M;  3GQ3 A;  4PD2 A;  1PM5 A;  4JI1 M;  1K3X A;  2F5Q A;  4NXM M;  4LFB M;  1PJJ A;  4B3T M;  4JI5 M;  1R2Y A;  4DV3 M;  1N36 M;  1I94 M;  2UUC M;  1PJI A;  3U6C A;  3GPY A;  3C58 A;  5LMN M;  4GKK M;  1XMO M;  4AQY M;  2ZBK B;  3GPX A;  5LMU M;  3TWL A;  1XC8 A;  4G4O A;  3GPU A;  1J5E M;  4DR1 M;  1IBL M;  2F5N A;  2EA0 A;  3GPP A;  3A46 A;  3JR4 A;  1HNX M;  3GQ5 A;  4LF9 M;  4X64 M;  3TWK A;  5ITU A;  4LFC M;  1Q3B A;  1R2Z A;  1N33 M;  2HKJ A;  2F5S A;  2F5P A;  1TDZ A;  3GQ4 A;  4B3R M;  3U6O A;  4DR7 M;  3A42 A;  2VQF M;  3A45 A;  1L1T A;  4X65 M;  1HNZ M;  2VQE M;  5ITR A;  2UUB M;  2HHH M;  5ITX A;  1Z59 A;  4JV5 M;  4YHH M;  3J81 S;  5FLX S;  4LF6 M;  2F4V M;  4JYA M;  4X66 M;  2UXD M;  4DR2 M;  4LF8 M;  2ZM6 M;  4YY3 M;  1TDH A;  4K0K M;  1N34 M;  5BR8 M;  3U6P A;  3TWM A;  1HR0 M;  2XZU A;  3SAS A;  5IWA M;  1XMQ M;  2UU9 M;  4B3S M;  4JI2 M;  1N32 M;  5ITY A;  3J7A S;  5A2Q S;  4DV1 M;  4ITQ A;  1FJG M;  3U6L A;  1Z5A A;  1NNJ A;  4JI7 M;  4KHP M;  4G4R A;  5ITX E;  3SAR A;  5IT9 S;  1MU5 A;  3OTO M;  1L2D A;  4B3M M;  4DV4 M;  4DUZ M;  1EE8 A;  4DR3 M;  4JI3 M;  4LF5 M;  4DR4 M;  1L2B A;  3SAW A;  4DV7 M;  5ITT A;  4NRW A;  1IBM M;  3U6Q A;  3J80 S;  2OQ4 A;  4JI4 M;  4DV2 M;  1L2C A;  3U6D A;  2F5O A;  1XNQ M;  4MB7 A;  1Q3C A;  3GP1 A;  4OX9 M;  4JI6 M;  4GKJ M;  4DV0 M;  4DR6 M;  3SAT A;  3GO8 A;  4LF4 M;  1Z5C A;  1K82 A;  3U6E A;  3T1Y M;  3SAU A;  2UUA M;  3U6S A;  3W0F A;  1IBK M;  3JAM S;  1XNR M;  4DUY M;  3T1H M;  2Q2E B;  1K3W A;  1L1Z A;  1HNW M; 
#chains in the Genus database with same CATH topology
 2QBY B;  3FTE A;  3IG8 A;  3JR5 A;  3SAV A;  1JQJ C;  2VF8 A;  3U60 A;  2E5L M;  1YE9 A;  4LG2 A;  3HZJ A;  3Q8G A;  4JI0 M;  2CV0 A;  1DV0 A;  5DYI A;  1OIZ A;  2JUJ A;  1XWI A;  4IBB A;  4PDG A;  3TQS A;  3I01 M;  5KPZ A;  1KFV A;  2L7I A;  2O25 A;  4LZZ A;  4G4Q A;  4B7F A;  1QUS A;  4PDI A;  2CHQ A;  2DAG A;  2JNH A;  5EP3 A;  3AV0 A;  4FW9 A;  4FVM A;  4X62 M;  4DV5 M;  4NC6 A;  3GRR A;  3K8Z A;  4LFA M;  3W0L B;  4PD2 A;  1T3T A;  5BPV A;  1PM5 A;  2V1U A;  2KNV A;  2L7H A;  2RGH A;  4NXM M;  1KYI A;  3KFU G;  4L15 A;  4R71 A;  1OKS A;  5EXP A;  3GLF B;  4B3T M;  1J09 A;  2R4J A;  4F2L A;  1Q02 A;  2VDB B;  1D0L A;  2YR0 A;  4RF1 A;  1R2Y A;  4JI5 M;  1G4A E;  1V33 A;  1E9S A;  3U6C A;  2CP8 A;  3VDP A;  5LMN M;  1OAO C;  3LMM A;  4REZ A;  2LXE A;  1W5T A;  4AQY M;  3SHF A;  3TWL A;  2LVA A;  2DXI A;  1IN5 A;  1XXH E;  4KO8 A;  3HHZ A;  1J5E M;  4DR1 M;  1IBL M;  2EA0 A;  3KP0 E;  3FRH A;  3A98 B;  2X8A A;  3JR4 A;  1OTR A;  2R18 A;  3LCV B;  2R62 A;  2R45 A;  5C18 A;  1HQC A;  3K9P A;  1NJF A;  2XFT A;  3K9O A;  2RRU A;  2DAM A;  4LFC M;  1R2Z A;  4HL4 A;  2HKJ A;  1OFH A;  3HJS A;  1VEG A;  3LW5 F;  4GC9 A;  3H4M A;  3WHL A;  5JI3 E;  4XGI A;  3L25 A;  3SHG B;  1MJG M;  3BBZ A;  3KOZ E;  2Y21 A;  1GLN A;  2C5R A;  1DO0 A;  1SXJ B;  1D2N A;  3ILK A;  2CV2 A;  1GAB A;  2Z4R A;  4L16 A;  4OVZ A;  3RE8 A;  2VQE M;  2K0B X;  3M0E A;  1HJP A;  4FCV A;  3CF0 A;  2HHH M;  2J7N A;  2FS1 A;  1QZM A;  1Z59 A;  2XFS A;  4IBI A;  2KNA A;  2DAK A;  5FLX S;  3U5Z B;  4LF6 M;  3LQR A;  2F4V M;  4TUW A;  2WSE F;  3DA1 A;  4LJ5 A;  4DR2 M;  4LF8 M;  3K2L A;  4YY3 M;  3FYD A;  3J7B A;  4LGY A;  4G6Z A;  4DV1 M;  3QYE A;  1WR1 B;  5DYG A;  1NNU C;  2K47 A;  3FUV A;  4Z8X A;  4Z6Y A;  4JI7 M;  3SYL A;  1FJG M;  1RU3 A;  2DAI A;  2QQ8 A;  4GC5 A;  3W68 A;  2ZTD A;  2MRO B;  2J5Y A;  3SC3 A;  2LVQ D;  4I4L A;  2B3T A;  2FNA A;  1L2B A;  3HJ8 A;  4DV7 M;  1I4W A;  3KOX E;  2G5G X;  2R46 A;  3J80 S;  3GLF E;  4DV2 M;  3KS4 A;  3QWL A;  4RNA A;  1EIJ A;  2F5O A;  2HCB A;  3GP1 A;  1T43 A;  1G71 A;  4CJ6 A;  4JI6 M;  3CF2 A;  3PNV A;  1ZV1 A;  3SAT A;  1IY2 A;  4LJ6 A;  1PJQ A;  1HT1 E;  2KA6 B;  1NHW C;  3KSX A;  4LCB A;  3HJQ A;  4NOO B;  3KS8 A;  1WIV A;  3FTD A;  1QVR A;  4Y28 F;  2KXE A;  5JI2 E;  2V6Z M;  2YFQ A;  5KPR A;  4CGY B;  4MGH A;  3CTW B;  3I51 A;  5FTL A;  2UXB M;  4DR5 M;  4M0W A;  4LF7 M;  2X49 A;  1PRB A;  3KW6 A;  4NRV A;  2XZF A;  3FE3 A;  3DOA A;  3LCU A;  4B08 A;  4DV6 M;  1NY6 A;  4B7G A;  4LJ7 A;  4QNR A;  4OW0 A;  1OQY A;  2LVP C;  4MGI E;  3ZC7 B;  4PCZ A;  3HU1 A;  4RF0 A;  1GVN A;  2N35 A;  2KDL A;  4P16 A;  2OPF A;  2UXC M;  1MX0 A;  1OAI A;  2YNM D;  4BB9 A;  2R0I A;  1K3X A;  1C7Y A;  4MGK E;  2F5Q A;  3J2P B;  1PGY A;  1AIP C;  1SXJ E;  4LFB M;  3VKG A;  1PJJ A;  3IG5 A;  2XF3 A;  3VLF B;  3I4V A;  1OJL A;  3FUU A;  3V76 A;  1IN4 A;  4W5W A;  1I94 M;  1PJI A;  3GLH B;  3I4Y A;  4GKK M;  4FD2 A;  3GLG B;  3HU2 A;  2ZBK B;  4AI6 A;  1XB2 B;  2CHG A;  4QNM A;  1QAQ A;  1UM8 A;  4AKI A;  1WJ7 A;  1Y8G A;  1TGU A;  3T38 A;  1GKI A;  3GPP A;  4GIP A;  4L8R C;  3A46 A;  3KDS E;  1EFU B;  4IBF A;  1JR3 A;  3GRU A;  3HHY A;  5C1B A;  4UN2 B;  1E32 A;  7CAT A;  1IQP A;  2ZAO A;  1VEK A;  4L6V 6;  2WSC F;  4X64 M;  1C1K A;  4G3O A;  2MH8 A;  1Q3B A;  4II7 A;  2L4F A;  1N33 M;  3HX3 A;  3BXW A;  1UFZ A;  2DHY A;  2ERC A;  2KZS A;  2K9D A;  2ZTC A;  2MR9 A;  3B74 A;  1IN8 A;  2XH9 A;  2DZN B;  2R44 A;  2Y0Q A;  3THG A;  3U6O A;  3U60 B;  4FCT A;  3PVS A;  3RGS A;  1L8Q A;  2VQF M;  2C9O A;  2I7P A;  1VEJ A;  4X65 M;  4D82 A;  2BJV A;  5ITX A;  2QHO B;  2L4E A;  4LRS A;  1T6O A;  5FTJ A;  3KVW A;  4JV5 M;  4YHH M;  3R9X B;  4JYA M;  1QZE A;  5EXT A;  2V1C A;  2JY8 A;  1QDT A;  2BWB A;  4AKH A;  1TDH A;  5BR8 M;  3CGW A;  2JA2 A;  4HEO A;  1HT2 E;  2C98 A;  5FSW A;  2LTU A;  3R8F A;  3SAS A;  3U61 A;  1R6B X;  5IWA M;  4NSO B;  1ZMU A;  1XMQ M;  5ITY A;  1QYR A;  3TPZ A;  4LRT A;  4EIW A;  3RGP A;  3GLI A;  4IJF A;  4I81 A;  4FWH A;  1N75 A;  3VKH A;  3HGI A;  1JR3 D;  3QAU A;  4ANR A;  2QCU A;  3C9P A;  4IBG A;  2RGO A;  2WSF F;  4DR4 M;  2GQF A;  3UJN A;  2C96 A;  5ITT A;  2BWE A;  5E6J A;  3U6Q A;  2XEP A;  3IEC A;  2GNO A;  1MN3 A;  2DHR A;  5KQD A;  1XHB A;  2KEB A;  3B7N A;  1QAO A;  2OQ4 A;  2EKK A;  2JXN A;  3B7Z A;  3U6D A;  1L2C A;  1Q3C A;  2LHC A;  3T6P A;  1VQ1 A;  1V92 A;  4QOZ C;  3GLH E;  5EP4 A;  2L09 A;  2VII A;  1PJT A;  4B7H A;  2Z7J A;  2JP7 A;  3CF6 E;  3U6E A;  3GLG E;  3T1Y M;  2EUC A;  4GMQ A;  2D7G A;  2XSZ A;  4HLQ A;  4IBC A;  1NSF A;  4LY6 A;  4AG6 A;  3GLI B;  2Q2E B;  4RKU F;  4CIZ A;  4DUY M;  2QZ4 A;  1HNW M;  1IXS A;  2QNJ A;  5DNY A;  2FE8 A;  3FKE A;  4NXN M;  2KRK A;  4NL4 H;  2EKF A;  2MJ5 B;  4S12 A;  5L8R F;  3EIE A;  3Q8X A;  1LTM A;  4G4N A;  4AKG A;  4IBJ A;  4OVZ B;  1SXJ C;  1W5S A;  1Q39 A;  1GL6 A;  2OO9 A;  4LJ8 A;  3FUX A;  1S3S A;  3B7Q A;  3VK7 A;  3DFZ A;  4CIS A;  1DGF A;  4GHA A;  3NBI A;  1ZMV A;  2ZAM A;  5ITQ A;  2OOA A;  1XXH A;  1LV7 A;  2D7E A;  2Y0T A;  3D8L A;  4CHT B;  1ZQ9 A;  2KNZ A;  4IBE A;  4KLN A;  4M0D A;  1P3Q Q;  3LQQ A;  3SYK A;  4OU7 A;  3B9P A;  5KQ8 A;  2G8L A;  2R4E A;  3EIH A;  2MGW A;  3KXE C;  2APL A;  5IZ7 D;  2EJS A;  2JY5 A;  3C58 A;  2FH0 A;  2RKO A;  2R6F A;  3I04 M;  4F1I A;  4P17 A;  1XMO M;  1IFY A;  5EP1 A;  3GPX A;  2JY7 A;  1TF0 B;  3E9S A;  1GL7 A;  2XGN A;  4G4O A;  1XC8 A;  1IY0 A;  2C99 A;  2OOB A;  2DZL A;  2QPA A;  3L29 A;  5FTK A;  8CAT A;  2LWX A;  4AZF A;  1QAN A;  1NHG C;  4I5S A;  1E94 E;  2FFJ A;  4GIT A;  2XSZ D;  3FTF A;  3GQ5 A;  4LF9 M;  3H4J A;  1XXH B;  3KOW E;  1G3I A;  1R4G A;  3RFW A;  3TWK A;  4M9X A;  4LJ4 A;  2QP9 X;  1ZAE A;  3GRV A;  5FTN A;  1N78 A;  3KOY E;  2F5S A;  4GRI A;  4JN6 A;  1DGB A;  1YLA A;  1YUB A;  3K1J A;  3TL4 X;  2QBY A;  4GHL A;  2CFO A;  2AHM A;  1TDZ A;  3GQ4 A;  3KP1 E;  4GH9 A;  4B3R M;  4DR7 M;  1VDD A;  2NQ8 C;  3A42 A;  3T1H M;  3HWS A;  3VDU A;  3E21 A;  1YSY A;  5EP2 A;  2EO2 A;  1L1T A;  1QDR A;  1OIP A;  1HNZ M;  3HU3 A;  1ZMW A;  1QQW A;  2CV1 A;  1GJT A;  1NY5 A;  3MJ5 A;  1IXZ A;  3J81 S;  4X66 M;  2UXD M;  1IN7 A;  3T15 A;  3L26 A;  3PXG A;  3E4R A;  1N34 M;  1PJS A;  4XK8 F;  1HR0 M;  2XZU A;  3FUW A;  1VDL A;  3L27 A;  1X37 A;  3FTC A;  3WHK A;  3GLF A;  4B3S M;  2Z3X A;  5A2Q S;  2DWZ B;  3AOE C;  3J27 B;  4ITQ A;  3MHV C;  3L2A A;  1Z5A A;  1NNJ A;  4IJE A;  3UGJ A;  1VG5 A;  2LVN C;  1IN6 A;  3HY5 A;  4FWG A;  3GRY A;  2LH0 A;  1EE8 A;  3C3D A;  3QYB A;  4DR3 M;  2DWM A;  2M5Z A;  3AL0 C;  2LVO C;  3KSJ A;  4LF5 M;  3SAW A;  1NV8 A;  1Z6T A;  3M6A A;  4JXJ A;  4LJA A;  1IBM M;  3ZQJ A;  4FCW A;  1SG9 A;  2A5Y B;  3FD9 A;  2Z8Y M;  2H5X A;  5H37 D;  3HHX A;  1G59 A;  2P5T A;  1WHC A;  3ZCB B;  3MK6 A;  2DVW B;  4MM3 B;  4GKJ M;  4D80 A;  4DV0 M;  4DR6 M;  3E46 A;  5E26 A;  5IRE B;  1CUK A;  3SAU A;  5GKN A;  3W0F A;  3LVW A;  3JAM S;  1IXR C;  3F92 A;  4I8O A;  4DV4 M;  1K3W A;  1L1Z A;  3ZH9 B;  4AW4 A;  2Z4S A;  4WUR A;  1IY1 A;  3SBJ A;  1SXJ A;  3FRI A;  2XLJ A;  1OFI A;  4R3D A;  3FYC A;  2JZ1 A;  3FUT A;  4M9Z A;  1FNN A;  3U6M A;  1D0M A;  1NVM A;  4Q7J A;  2CRU A;  4R7G A;  2QEN A;  3B89 A;  1Z5B A;  3UK6 A;  5KO3 A;  2DKL A;  3U5Z A;  4QHS A;  2LBC A;  4JI8 M;  2L6O A;  3SMS A;  3IHP A;  2R65 A;  4A3V B;  3VK8 A;  3GQ3 A;  4JI1 M;  2LHG A;  2LNH C;  5F3W A;  1DGH A;  2DEN A;  3NWL A;  3U61 B;  1DGG A;  4LJ9 A;  3W67 A;  3HHW A;  3DZD A;  4IBK A;  4DBG B;  3LVV A;  1A5T A;  4DV3 M;  1N36 M;  2UUC M;  2D7H A;  2WZJ A;  3GPY A;  2L2D A;  4L4U A;  1V34 A;  4IBD A;  2HAK A;  2C9C A;  1GO5 A;  5DFL A;  4MGZ E;  1H6U A;  5LMU M;  1ORY B;  1NO1 A;  5EJC A;  3GPU A;  4WP2 A;  1NV9 A;  3AFH A;  3L28 A;  2F5N A;  5EXX A;  1JB0 F;  4ZPX A;  2CUZ A;  4XBO A;  1HNX M;  1TTE A;  3HKP A;  2QSF X;  3AOG A;  4D81 A;  1WGN A;  4JI4 M;  1DGH B;  4LGM A;  1WXQ A;  4MGY E;  1GJS A;  1IM2 A;  3PFI A;  5ITU A;  1SXJ D;  3PNY A;  3MMP A;  3NBX X;  1NJG A;  2O5R A;  4KT0 F;  2YQZ A;  2F5P A;  1TH2 A;  2K6B A;  1KSF X;  1IXS B;  3D8B A;  1N77 A;  4WW0 A;  4BLC A;  1BVS A;  4LZJ A;  1JR3 E;  2CWB A;  3C3E A;  4NSR A;  3A45 A;  3K92 A;  2DWL A;  2DZO B;  2BJW A;  2CHV A;  5ITR A;  2UUB M;  2Y20 A;  2CE7 A;  4KOD A;  2O01 F;  2W82 A;  2HL7 A;  3AJI B;  3UZU A;  4BBA A;  4QOS A;  3TE6 A;  4QHT A;  3BOS A;  2ZM6 M;  3AOE A;  4K0K M;  3AKZ A;  2JWS A;  3U6P A;  2I7N A;  2CEA A;  3TWM A;  4FWD A;  2UU9 M;  1N32 M;  4JI2 M;  5KPT A;  1TR8 A;  3J7A S;  4M9S A;  1TH4 A;  2G3Q A;  1DO2 A;  3U6L A;  2X4A A;  2BNK A;  2VF7 A;  4KHP M;  3M7G A;  4G4R A;  5ITX E;  2DWN A;  3GLH A;  3SAR A;  5IT9 S;  1MU5 A;  3OTO M;  1L2D A;  3SMP A;  1WGL A;  2DI0 A;  4B3M M;  3GLG A;  4DUZ M;  4JI3 M;  1G8P A;  2DNA A;  4PT5 A;  3VFD A;  1AUA A;  4GEW A;  2J7O A;  4NRW A;  2M60 A;  2HWJ A;  2KHH A;  2JY6 B;  3UMM A;  4AG5 A;  4IIW A;  5EQT A;  2KZU A;  3GLI E;  1XNQ M;  1HQY E;  4MB7 A;  2DAE A;  2H1R A;  2KRU A;  5EXS A;  4L78 A;  4OX9 M;  1G41 A;  1TH3 A;  2ZAN A;  3GO8 A;  1Z5C A;  2JZ0 A;  3SFZ A;  1K82 A;  4LF4 M;  1F4I A;  1R5L A;  1QAM A;  2UUA M;  1D0K A;  1R7R A;  2FOI C;  2KW0 A;  3U6S A;  1IBK M;  1XNR M;  4MH0 E;  1QUT A;  1E9R A;  1J7K A;  5FTM A; 
#chains in the Genus database with same CATH homology
 2QBY B;  3FTE A;  3IG8 A;  3JR5 A;  3SAV A;  1JQJ C;  3U60 A;  2E5L M;  1YE9 A;  4LG2 A;  4JI0 M;  2CV0 A;  5DYI A;  1XWI A;  4IBB A;  4PDG A;  3TQS A;  5KPZ A;  1KFV A;  2L7I A;  4LZZ A;  4G4Q A;  4B7F A;  4PDI A;  2CHQ A;  5EP3 A;  3AV0 A;  4FW9 A;  4FVM A;  4X62 M;  4DV5 M;  3GRR A;  3K8Z A;  4LFA M;  3W0L B;  4PD2 A;  1T3T A;  5BPV A;  1PM5 A;  2V1U A;  2RGH A;  2L7H A;  4NXM M;  3KFU G;  1KYI A;  4L15 A;  5EXP A;  3GLF B;  4B3T M;  1J09 A;  2R4J A;  4RF1 A;  2YR0 A;  1R2Y A;  4JI5 M;  1G4A E;  1E9S A;  3U6C A;  3VDP A;  5LMN M;  3LMM A;  4REZ A;  2LXE A;  1W5T A;  4AQY M;  3SHF A;  3TWL A;  2DXI A;  1IN5 A;  4KO8 A;  3HHZ A;  1J5E M;  4DR1 M;  1IBL M;  2EA0 A;  3KP0 E;  3A98 B;  2X8A A;  3JR4 A;  2R18 A;  2R62 A;  2R45 A;  5C18 A;  1HQC A;  1NJF A;  2XFT A;  4LFC M;  1R2Z A;  4HL4 A;  2HKJ A;  1OFH A;  3HJS A;  3WHL A;  4GC9 A;  3H4M A;  5JI3 E;  4XGI A;  3L25 A;  3SHG B;  3KOZ E;  2Y21 A;  1GLN A;  2C5R A;  1DO0 A;  1SXJ B;  1D2N A;  3ILK A;  2CV2 A;  2Z4R A;  4L16 A;  4OVZ A;  3RE8 A;  2VQE M;  3M0E A;  2HHH M;  4FCV A;  3CF0 A;  2J7N A;  1QZM A;  1Z59 A;  2XFS A;  4IBI A;  4LF6 M;  5FLX S;  3U5Z B;  2F4V M;  4TUW A;  3LQR A;  3DA1 A;  4LJ5 A;  4DR2 M;  4LF8 M;  3K2L A;  4YY3 M;  3FYD A;  3J7B A;  4LGY A;  4G6Z A;  4DV1 M;  5DYG A;  1NNU C;  2K47 A;  3FUV A;  4Z8X A;  4Z6Y A;  4JI7 M;  3SYL A;  1FJG M;  4GC5 A;  3SC3 A;  4I4L A;  2FNA A;  1L2B A;  3HJ8 A;  4DV7 M;  1I4W A;  3KOX E;  2G5G X;  2R46 A;  3J80 S;  4DV2 M;  3KS4 A;  3QWL A;  4RNA A;  2F5O A;  2HCB A;  3GP1 A;  4JI6 M;  3CF2 A;  3PNV A;  3SAT A;  1IY2 A;  4LJ6 A;  2KA6 B;  1HT1 E;  1NHW C;  3KSX A;  4LCB A;  3HJQ A;  4NOO B;  3KS8 A;  3FTD A;  1QVR A;  2KXE A;  5JI2 E;  2V6Z M;  2YFQ A;  5KPR A;  4CGY B;  4MGH A;  3CTW B;  3I51 A;  5FTL A;  2UXB M;  4DR5 M;  4M0W A;  4LF7 M;  2X49 A;  3KW6 A;  4NRV A;  2XZF A;  3DOA A;  4B08 A;  4DV6 M;  1NY6 A;  4B7G A;  4LJ7 A;  4QNR A;  4OW0 A;  4MGI E;  3ZC7 B;  4PCZ A;  3HU1 A;  4RF0 A;  1GVN A;  4P16 A;  2OPF A;  2UXC M;  1MX0 A;  4BB9 A;  2YNM D;  1K3X A;  4MGK E;  2F5Q A;  3J2P B;  4LFB M;  1SXJ E;  3VKG A;  1PJJ A;  3IG5 A;  2XF3 A;  3VLF B;  3I4V A;  1OJL A;  3FUU A;  1IN4 A;  4W5W A;  1I94 M;  1PJI A;  3GLH B;  3I4Y A;  4GKK M;  4FD2 A;  3GLG B;  3HU2 A;  2ZBK B;  4AI6 A;  2CHG A;  4QNM A;  1QAQ A;  1UM8 A;  4AKI A;  3T38 A;  1TGU A;  1GKI A;  3GPP A;  4GIP A;  4L8R C;  3A46 A;  3KDS E;  4IBF A;  3HHY A;  1JR3 A;  3GRU A;  5C1B A;  1E32 A;  7CAT A;  1IQP A;  2ZAO A;  4X64 M;  1C1K A;  1Q3B A;  4II7 A;  1N33 M;  2ERC A;  2KZS A;  1IN8 A;  2XH9 A;  2DZN B;  2Y0Q A;  3THG A;  3U6O A;  3U60 B;  4FCT A;  3PVS A;  3RGS A;  1L8Q A;  2VQF M;  2C9O A;  2I7P A;  4X65 M;  4D82 A;  2BJV A;  5ITX A;  4LRS A;  5FTJ A;  3KVW A;  4JV5 M;  4YHH M;  3R9X B;  4JYA M;  5EXT A;  2V1C A;  4AKH A;  1TDH A;  5BR8 M;  2JA2 A;  1HT2 E;  2C98 A;  5FSW A;  3R8F A;  3SAS A;  3U61 A;  1R6B X;  5IWA M;  4NSO B;  1XMQ M;  5ITY A;  1QYR A;  3TPZ A;  4LRT A;  4EIW A;  3RGP A;  3GLI A;  4IJF A;  4I81 A;  4FWH A;  1N75 A;  3VKH A;  3HGI A;  1JR3 D;  3QAU A;  2QCU A;  4IBG A;  2RGO A;  4DR4 M;  3UJN A;  2C96 A;  5ITT A;  5E6J A;  3U6Q A;  2XEP A;  5KQD A;  2OQ4 A;  5F3W A;  2DHR A;  4JI4 M;  1XHB A;  2KEB A;  1L2C A;  1QAO A;  3U6D A;  1Q3C A;  4QOZ C;  5EP4 A;  2L09 A;  2VII A;  4B7H A;  2Z7J A;  3CF6 E;  3U6E A;  3T1Y M;  2EUC A;  4GMQ A;  2D7G A;  2XSZ A;  4HLQ A;  4IBC A;  1NSF A;  4LY6 A;  4AG6 A;  3GLI B;  2Q2E B;  4DUY M;  1HNW M;  2QZ4 A;  5DNY A;  2FE8 A;  3FKE A;  4NXN M;  2KRK A;  4NL4 H;  4S12 A;  3EIE A;  3Q8X A;  4G4N A;  4AKG A;  4IBJ A;  4OVZ B;  1SXJ C;  1W5S A;  1Q39 A;  1GL6 A;  4LJ8 A;  3FUX A;  1S3S A;  3VK7 A;  4CIS A;  3DFZ A;  1DGF A;  4GHA A;  3NBI A;  2ZAM A;  5ITQ A;  1XXH A;  1LV7 A;  2D7E A;  2Y0T A;  3D8L A;  4CHT B;  1ZQ9 A;  4IBE A;  4KLN A;  4M0D A;  3LQQ A;  3SYK A;  4OU7 A;  3B9P A;  5KQ8 A;  2G8L A;  2R4E A;  3EIH A;  3KXE C;  5IZ7 D;  3C58 A;  2RKO A;  1XMO M;  5EP1 A;  3GPX A;  1XC8 A;  3E9S A;  1GL7 A;  2XGN A;  4G4O A;  1IY0 A;  2C99 A;  2QPA A;  3L29 A;  5FTK A;  8CAT A;  2LWX A;  4AZF A;  1QAN A;  1NHG C;  4I5S A;  1E94 E;  2FFJ A;  4GIT A;  2XSZ D;  3FTF A;  3GQ5 A;  4LF9 M;  3KOW E;  1XXH B;  1G3I A;  3RFW A;  3TWK A;  4M9X A;  4LJ4 A;  2QP9 X;  1ZAE A;  3GRV A;  5FTN A;  1N78 A;  3KOY E;  2F5S A;  4GRI A;  4JN6 A;  1DGB A;  1YUB A;  3K1J A;  3TL4 X;  2QBY A;  4GHL A;  2CFO A;  2AHM A;  1TDZ A;  3GQ4 A;  3KP1 E;  4GH9 A;  4B3R M;  4DR7 M;  1VDD A;  2NQ8 C;  3A42 A;  3T1H M;  3HWS A;  3VDU A;  1YSY A;  5EP2 A;  2EO2 A;  1L1T A;  1HNZ M;  3HU3 A;  1QQW A;  2CV1 A;  1NY5 A;  3MJ5 A;  3J81 S;  1IXZ A;  2UXD M;  4X66 M;  1IN7 A;  3T15 A;  3L26 A;  3PXG A;  3E4R A;  1N34 M;  1HR0 M;  2XZU A;  3FUW A;  3WHK A;  3L27 A;  1X37 A;  3FTC A;  3GLF A;  4B3S M;  2Z3X A;  5A2Q S;  2DWZ B;  3AOE C;  3J27 B;  4ITQ A;  3MHV C;  3L2A A;  1Z5A A;  1NNJ A;  4IJE A;  3UGJ A;  1IN6 A;  4FWG A;  3GRY A;  2LH0 A;  1EE8 A;  4DR3 M;  2DWM A;  2M5Z A;  3AL0 C;  4LF5 M;  3KSJ A;  3SAW A;  3M6A A;  1Z6T A;  4JXJ A;  4LJA A;  1IBM M;  4FCW A;  2A5Y B;  3FD9 A;  5H37 D;  1G59 A;  3HHX A;  2P5T A;  3ZCB B;  3MK6 A;  2DVW B;  4MM3 B;  4GKJ M;  4D80 A;  4DV0 M;  4DR6 M;  5E26 A;  5IRE B;  3SAU A;  5GKN A;  3W0F A;  3LVW A;  3JAM S;  1IXR C;  4I8O A;  4DV4 M;  1K3W A;  1L1Z A;  3ZH9 B;  4AW4 A;  2Z4S A;  4WUR A;  1IY1 A;  3SBJ A;  1SXJ A;  2XLJ A;  1OFI A;  4R3D A;  3FYC A;  3FUT A;  4M9Z A;  1FNN A;  3U6M A;  1NVM A;  4R7G A;  3UK6 A;  2QEN A;  1Z5B A;  5KO3 A;  3U5Z A;  4QHS A;  4JI8 M;  2L6O A;  3SMS A;  2R65 A;  4A3V B;  3VK8 A;  3GQ3 A;  4JI1 M;  2LNH C;  1DGH A;  3NWL A;  3U61 B;  1DGG A;  4LJ9 A;  3HHW A;  3DZD A;  4IBK A;  3LVV A;  4DV3 M;  1N36 M;  2UUC M;  2D7H A;  3GPY A;  4L4U A;  4IBD A;  2C9C A;  4MGZ E;  1H6U A;  5LMU M;  1ORY B;  5EJC A;  3GPU A;  3AFH A;  3L28 A;  2F5N A;  5EXX A;  4ZPX A;  2CUZ A;  4XBO A;  1HNX M;  3HKP A;  3AOG A;  4D81 A;  1DGH B;  4LGM A;  1WXQ A;  4MGY E;  1IM2 A;  3PFI A;  5ITU A;  1SXJ D;  3PNY A;  1NJG A;  2O5R A;  2YQZ A;  2F5P A;  1TH2 A;  1KSF X;  1IXS B;  3D8B A;  1N77 A;  4WW0 A;  4BLC A;  4LZJ A;  4NSR A;  3A45 A;  3K92 A;  2DWL A;  2DZO B;  2BJW A;  2CHV A;  5ITR A;  2UUB M;  2Y20 A;  2CE7 A;  4KOD A;  2W82 A;  2HL7 A;  3AJI B;  3UZU A;  4BBA A;  4QOS A;  3TE6 A;  4QHT A;  3BOS A;  2ZM6 M;  3AOE A;  4K0K M;  3AKZ A;  3U6P A;  2I7N A;  2CEA A;  3TWM A;  4FWD A;  2UU9 M;  1N32 M;  4JI2 M;  5KPT A;  3J7A S;  4M9S A;  1TH4 A;  1DO2 A;  3U6L A;  2X4A A;  2BNK A;  4KHP M;  3M7G A;  4G4R A;  5ITX E;  2DWN A;  3GLH A;  3SAR A;  5IT9 S;  1MU5 A;  3OTO M;  1L2D A;  3SMP A;  4B3M M;  3GLG A;  4DUZ M;  4JI3 M;  1G8P A;  4PT5 A;  3VFD A;  4NRW A;  2J7O A;  2M60 A;  3UMM A;  4AG5 A;  4IIW A;  5EQT A;  2KZU A;  1XNQ M;  1HQY E;  4MB7 A;  2H1R A;  2KRU A;  5EXS A;  4OX9 M;  4L78 A;  1G41 A;  1TH3 A;  2ZAN A;  3GO8 A;  1Z5C A;  3SFZ A;  1K82 A;  4LF4 M;  1QAM A;  2UUA M;  2FOI C;  1R7R A;  2KW0 A;  3U6S A;  1IBK M;  1XNR M;  4MH0 E;  1E9R A;  1J7K A;  5FTM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...