4JI4M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 25
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ji4M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4ji4M02
4JI0M 2ZBKB 3GPXA 4DR1M 4DUYM 4G4OA 1NNJA 3A42A 3SAWA 5IWAM 4NXNM 3SAUA 2HHHM 1PM5A 1L1ZA 1EE8A 1L2BA 1K3XA 5ITRA 1N32M 3VK7A 4LFBM 4PD2A 4DV5M 3A46A 5FLXS 4PDGA 1PJIA 4DV4M 4NXMM 1IBKM 5ITYA 2UUAM 4LF8M 3GQ5A 1XC8A 4X62M 3U6PA 3U6QA 4G4NA 3DOAA 2VQFM 1XMQM 3SASA 4ITQA 5LMNM 1L2CA 4KHPM 4JYAM 5ITQA 4JV5M 4LFAM 2OPFA 3SARA 3U6MA 3U6CA 1Z5AA 4GKKM 4DR6M 4DV1M 1N36M 4DV0M 2F5SA 2UU9M 4CISA 4AQYM 4B3MM 2EA0A 4GKJM 3GQ4A 1R2YA 4LF6M 1Z59A 4JI8M 4DV7M 1K3WA 4B3TM 3TWKA 3A45A 3U6SA 3GPUA 1L1TA 1I94M 4LF7M 2UXCM 4X64M 3GPPA 3SAVA 1XNRM 1N33M 4LF5M 1R2ZA 1HNXM 3GP1A 4DV2M 4JI6M 4K0KM 2UUCM 3J80S 5BR8M 1IBMM 2F5OA 5ITXA 1FJGM 5IT9S 3T1YM 4JI2M 1PJJA 4G4QA 3VK8A 5ITUA 5ITXE 2F5QA 1N34M 4MB7A 1HR0M 2HKJA 4DR3M 3J7AS 4JI5M 4JI3M 1MU5A 1XNQM 3JR5A 3GQ3A 1KFVA 4X66M 5ITTA 1TDZA 2VQEM 4G4RA 4B3SM 3W0FA 2F5PA 2E5LM 1Z5BA 4YY3M 2UXDM 1HNZM 4JI1M 3U6LA 1J5EM 4LF9M 4DR2M 1XMOM 3U6OA 2XZFA 3OTOM 3JAMS 3U6EA 1Z5CA 1Q3BA 3TWLA 4PCZA 1HNWM 1Q39A 3T1HM 3TWMA 4DUZM 4LF4M 2UXBM 3SATA 4JI7M 3GPYA 5A2QS 4NRVA 2UUBM 4YHHM 4DV6M 3J81S 3C58A 3GO8A 1MX0A 4X65M 2Q2EB 5LMUM 4OX9M 2XZUA 1Q3CA 2OQ4A 4NRWA 1IBLM 2F5NA 4DV3M 3SBJA 4JI4M 1K82A 4B3RM 3JR4A 2F4VM 4DR5M 3U6DA 1L2DA 4LFCM 4DR4M 1TDHA 4DR7M 2ZM6M 4PDIA
chains in the Genus database with same CATH superfamily
5EXPA 1E9RA 1Y8GA 2ZBKB 3HX3A 5BPVA 2EKFA 3E21A 2XSZA 3E4RA 1LV7A 1IN6A 1GO5A 2KEBA 1NNJA 1SXJC 2QNJA 3W68A 5IREB 3WHKA 2HCBA 3K9PA 5DYGA 3ZCBB 2R18A 2QZ4A 3RFWA 2JA2A 5FSWA 3KP1E 2CFOA 1PM5A 3T6PA 1TF0B 2G8LA 5EQTA 3SHGB 3KW6A 3AOGA 2RRUA 4RKUF 4S12A 1D0MA 4LFBM 1H6UA 4PD2A 1SG9A 3A46A 1DGGA 4PDGA 4DV5M 1PJIA 4FD2A 1ZMWA 3M6AA 2CEAA 2DKLA 1XC8A 4X62M 4G4NA 4NC6A 2JP7A 2JXNA 5ITQA 5EJCA 3E46A 3Q8XA 2OPFA 1V33A 2VIIA 2D7HA 3GLIE 2VF8A 2DWLA 4DR6M 2UU9M 1F4IA 4B3MM 4LG2A 3L2AA 2EA0A 2CV1A 4AKHA 1R2YA 1S3SA 4W5WA 4LF6M 1JR3E 4JI8M 3M7GA 2DNAA 3TWKA 1QYRA 2WZJA 3GPUA 1L1TA 3FD9A 4BLCA 4FCVA 5GKNA 3GPPA 3AV0A 3M0EA 3SAVA 1XNRM 3HWSA 3QWLA 3DFZA 2Y20A 4M0WA 2O01F 2FS1A 3FYDA 3UMMA 4DV2M 1DGHA 1QUSA 5ITXA 1FJGM 2JY7A 3F92A 5IT9S 1EIJA 4LJ9A 2X49A 1OAOC 5C18A 2R46A 4M9SA 4TUWA 3E9SA 5DYIA 2RKOA 2F5QA 2KZSA 3TPZA 2HKJA 3AL0C 3J7AS 1AUAA 4JI3M 1MU5A 3T15A 3VLFB 3JR5A 3PXGA 3GLFB 2QBYA 1QAOA 1SXJD 1A5TA 3SMSA 2YNMD 4G4RA 2LBCA 1YLAA 3KS4A 1I4WA 3KVWA 3GRYA 1IY0A 1YUBA 1P3QQ 1NO1A 4HL4A 5FTNA 2R65A 2XGNA 5C1BA 3KP0E 3KXEC 4YY3M 5DFLA 2MR9A 2Z4RA 3PNYA 1ZAEA 2L4EA 1WR1B 1XHBA 2O25A 3FRHA 3V76A 3FUXA 4JI1M 3HHWA 4WP2A 3KFUG 4IBKA 1Z6TA 1IN5A 3J7BA 3ZH9B 3H4MA 3U6EA 2DHRA 2CWBA 1HNWM 1Q39A 3Q8GA 3SFZA 2Y0QA 1MJGM 1T6OA 4L8RC 2QCUA 4L78A 3U5ZA 3K2LA 4DUZM 4LF4M 2WSCF 2FOIC 3FTFA 3SYKA 3TL4X 3GPYA 1TH2A 1IN4A 3I51A 2K0BX 1QDRA 4EIWA 3RGPA 3LVVA 3FUVA 2CV2A 1NV9A 2C99A 1PJSA 2XZUA 2Z7JA 4GHLA 2OQ4A 1OIPA 3SBJA 3TQSA 1R7RA 1K82A 4JI4M 4B3RM 3CF0A 2F4VM 3SYLA 4F2LA 3R9XB 2V6ZM 1TDHA 2YQZA 3U61A 1YSYA 2P5TA 1OKSA 4RF0A 5JI3E 3UK6A 2DWMA 4NSRA 1DGHB 2ZTDA 4WW0A 4DUYM 4G4OA 4GRIA 4MH0E 3IHPA 4D82A 1QAQA 3SAWA 1SXJA 1N77A 4ZPXA 1HJPA 3W0LB 2Y0TA 3AJIB 2XH9A 3KDSE 3U60A 2LVQD 1L1ZA 4IBGA 4FVMA 3C3EA 1L2BA 2R62A 3AOEC 1GJTA 1NY5A 2DAKA 3BXWA 3GRUA 4HLQA 4IBIA 5E6JA 4QNRA 2QBYB 3K8ZA 3GLGA 2DZOB 1OJLA 1QDTA 5FTJA 3SMPA 1UFZA 2DHYA 4DV4M 2QENA 4I5SA 2XFSA 5ITYA 1HT1E 3HJQA 1G59A 4KODA 3FTCA 3DOAA 2VQFM 1PGYA 1N75A 3LVWA 4GMQA 1DO2A 2YR0A 4LJ5A 1IN7A 2L7IA 1NHGC 1Z5AA 2R45A 4GKKM 2H5XA 2R6FA 4DV0M 4CISA 2JWSA 4AQYM 1N78A 2XFTA 2O5RA 4D81A 4GKJM 4G3OA 1T43A 1VDLA 4Z8XA 1Z59A 1GKIA 2M5ZA 4DV7M 3HY5A 3PVSA 2C9CA 3B7ZA 1G3IA 3AKZA 4LF7M 1OQYA 1OFHA 3U5ZB 4MGYE 2BWEA 2EO2A 4LJ7A 2V1CA 2DAMA 2EJSA 4GITA 3MHVC 1WGLA 3GP1A 1NY6A 1G41A 1IXRC 4K0KM 3J80S 4Q7JA 5FTMA 3PNVA 3B74A 5BR8M 4P16A 3MMPA 1ZMUA 2K9DA 3CF2A 2R4JA 4IBBA 1PJJA 5KQDA 2CRUA 2R0IA 4JI2M 5ITXE 1PRBA 2DVWB 1DV0A 4DR3M 4LY6A 2VDBB 2HL7A 1JR3D 3HJSA 2XLJA 3NBIA 4LGYA 2QPAA 1ZQ9A 2JUJA 3U61B 3NBXX 3GQ3A 4QHSA 2Z8YM 1J09A 2YFQA 5FTLA 1D2NA 3H4JA 3GLHA 1PJQA 1E94E 1Z5BA 3AFHA 3I04M 4KO8A 1SXJB 4R7GA 3VKHA 2XF3A 1V92A 3BOSA 3LCVB 1XXHB 4CJ6A 4OVZB 2QQ8A 1GL6A 4LRTA 3U60B 2V1UA 3EIEA 2DZNB 4LF9M 2B3TA 3D8LA 2XZFA 3NWLA 3GLGB 3HHYA 1IM2A 2OO9A 4MGHA 3CGWA 4PCZA 3TWLA 3T1HM 5KPTA 2KNAA 2HWJA 3HHZA 2CHQA 1QAMA 2EUCA 1C7YA 3K9OA 1TR8A 3C3DA 2ZTCA 2UXBM 4XK8F 5A2QS 2QP9X 2JZ1A 4NRVA 2UUBM 2ZAMA 2BJVA 5JI2E 1QQWA 1MX0A 2K47A 4Y28F 4FWHA 4IIWA 4NRWA 3ILKA 2BJWA 3QYEA 1JQJC 4L6V6 4AZFA 3PFIA 2X4AA 1XWIA 3L25A 4DR4M 2KXEA 1QUTA 3U6DA 4GC5A 2DI0A 3HHXA 1R6BX 2ERCA 4NL4H 1BVSA 2R4EA 1C1KA 2GQFA 1JR3A 4DR1M 1GVNA 1IQPA 3FTDA 2N35A 3A42A 5IWAM 4NXNM 3UZUA 5KQ8A 3FYCA 2MH8A 5KPRA 2HHHM 1SXJE 4IBEA 1EE8A 4UN2B 1XXHE 3AOEA 5ITRA 3B7QA 1WIVA 4AKGA 4L15A 2LTUA 3HU1A 1NVMA 2LVPC 4AW4A 5EP4A 4QOSA 3GLGE 4CHTB 2UUAM 5EXSA 4LJ4A 1IXSA 4IBCA 3GQ5A 3GLHB 3SASA 4LF8M 3IECA 1XMQM 4ITQA 4JYAM 2J5YA 4KHPM 1IY2A 2H1RA 1E32A 3FUWA 4LFAM 3HKPA 3J2PB 3SARA 2C98A 3HJ8A 3GLFE 3U6MA 3U6CA 2D7EA 1JB0F 4B08A 3L27A 1N36M 2F5SA 5EXXA 1DGBA 4REZA 2XEPA 2FH0A 3KOYE 5EP2A 4LJ6A 1IN8A 4Z6YA 1NSFA 2CE7A 3A45A 5IZ7D 1E9SA 2WSEF 3K1JA 4LRSA 4X64M 1G8PA 3LQRA 4KLNA 2Z3XA 4LF5M 1HNXM 1GLNA 1YE9A 3FUTA 4QNMA 2RGHA 1ZMVA 1HQCA 1L8QA 7CATA 4MGZE 3BBZA 4LZJA 2UUCM 1WXQA 2F5OA 4AI6A 4I81A 3FE3A 1OIZA 3B7NA 1J7KA 2OOAA 1VEKA 5ITUA 3VK8A 1IXZA 2LHCA 1RU3A 2R44A 4MB7A 4I4LA 1HR0M 4G6ZA 1AIPC 4JI5M 1TH3A 4KT0F 1XNQM 1WGNA 2DAGA 1KFVA 3B9PA 2BNKA 4B3SM 4FWGA 4IJEA 2KW0A 3W0FA 4BBAA 3UGJA 4FCWA 4M9XA 4QOZC 3VKGA 2E5LM 3J27B 1CUKA 3VDUA 1HT2E 4FWDA 1QANA 3GLHE 4WURA 2UXDM 3ZQJA 4GC9A 4XGIA 4P17A 2A5YB 4PT5A 3L26A 1HNZM 5EP3A 4GIPA 1VG5A 3U6LA 2KRUA 4DR2M 1XMOM 4PDIA 3U6OA 2Z4SA 3OTOM 3JAMS 1Z5CA 3MK6A 4L4UA 4LJ8A 1IY1A 2C5RA 3HGIA 2JY6B 3TWMA 1IXSB 2VF7A 3KOZE 3EIHA 4JI7M 2JZ0A 2CHGA 4MM3B 3DZDA 4NOOB 4RF1A 1W5TA 4YHHM 4FW9A 4B7GA 1ZV1A 1D0KA 1T3TA 1G71A 4XBOA 1Q02A 4X65M 2CHVA 1LTMA 2Q2EB 1NNUC 5LMUM 3SC3A 2EKKA 1Q3CA 2J7NA 5FTKA 3VFDA 1IBLM 2F5NA 1TTEA 1FNNA 3JR4A 2LVOC 2HAKA 2DAEA 2DXIA 4LGMA 2QSFX 4GEWA 2JNHA 3HU2A 4JI0M 2KNVA 3HZJA 5EXTA 2LXEA 3GPXA 2KA6B 3L29A 1VEJA 2I7NA 3KOWE 3KS8A 3KSXA 1EFUB 1NHWC 1OFIA 2KDLA 3CF6E 3SAUA 3THGA 5F3WA 3R8FA 2DWZB 3GRVA 4B7FA 2G3QA 1R5LA 5DNYA 2BWBA 2J7OA 1K3XA 1N32M 3I4VA 3VK7A 4MGKE 5FLXS 3VDPA 2ZAOA 2FNAA 2L6OA 1GJSA 1VDDA 3CTWB 3L28A 1IBKM 2CV0A 4MGIE 4NXMM 3KSJA 3FTEA 2AHMA 3U6PA 3U6QA 4DBGB 1DGFA 3WHLA 2LWXA 8CATA 5LMNM 2G5GX 1UM8A 1L2CA 4JN6A 3GLIA 2LH0A 3FRIA 1NV8A 4AG6A 4JV5M 2L2DA 2QHOB 5L8RF 1WJ7A 1R4GA 1DO0A 3MJ5A 4DV1M 3LCUA 1ORYB 4AKIA 1WHCA 3GQ4A 4GHAA 4F1IA 1K3WA 4IBFA 4B3TM 2MGWA 2DENA 2MROB 1XB2B 3FKEA 3U6SA 1I94M 2UXCM 2KNZA 1QVRA 2CP8A 1N33M 2DZLA 3TE6A 1R2ZA 2RGOA 4R71A 4JI6M 2L7HA 2CUZA 1IBMM 1GABA 4GH9A 3T1YM 4FCTA 4IBDA 4RNAA 2X8AA 3T38A 4G4QA 4M9ZA 3FUUA 1OAIA 1GL7A 1N34M 1X37A 2W82A 2XSZD 1W5SA 4LZZA 2KRKA 2OOBA 3C9PA 1PJTA 1MN3A 4L16A 3ZC7B 4X66M 3K92A 5H37D 5ITTA 3LW5F 1TDZA 2VQEM 4IJFA 2LHGA 2F5PA 2NQ8C 1TGUA 4NSOB 3QYBA 2KHHA 4OU7A 3QAUA 3D8BA 2JY8A 3A98B 4I8OA 1V34A 3SHFA 1OTRA 2ZANA 2I7PA 2DAIA 3I01M 4IBJA 1HQYE 2M60A 2DWNA 2C9OA 4R3DA 4B7HA 5E26A 1J5EM 4JXJA 2JY5A 4LCBA 2GNOA 2L09A 3IG8A 4II7A 3LMMA 3RGSA 1Q3BA 2C96A 2FFJA 2FE8A 4QHTA 4AG5A 4CGYB 2LVAA 4ANRA 5KO3A 1VQ1A 3I4YA 1TH4A 3IG5A 3LQQA 3SATA 1NJGA 4BB9A 1XXHA 2MJ5B 2Y21A 3GLIB 1KYIA 3KOXE 4OVZA 1NJFA 4CIZA 5KPZA 2D7GA 1IFYA 3RE8A 4DV6M 3J81S 1QZEA 3C58A 3UJNA 3GO8A 3B89A 2APLA 4D80A 4OX9M 1QZMA 1KSFX 4DV3M 2LVNC 1D0LA 2K6BA 2KZUA 4HEOA 3HU3A 4LJAA 5EP1A 3GRRA 3W67A 4A3VB 4OW0A 4DR5M 4LFCM 1L2DA 4M0DA 3GLFA 4DR7M 2WSFF 3DA1A 2L4FA 1G4AE 2ZM6M 2LNHC 1VEGA
chains in the Genus database with same CATH topology
5EXPA 1E9RA 5BPVA 2ZBKB 2XSZA 3E4RA 1LV7A 1IN6A 2KEBA 1NNJA 1SXJC 3WHKA 5IREB 2HCBA 5DYGA 3ZCBB 2R18A 2QZ4A 3RFWA 2JA2A 5FSWA 3KP1E 2CFOA 1PM5A 2G8LA 5EQTA 3SHGB 3KW6A 3AOGA 4S12A 4LFBM 1H6UA 4PD2A 3A46A 4DV5M 1DGGA 4PDGA 1PJIA 4FD2A 3M6AA 2CEAA 1XC8A 4X62M 4G4NA 5ITQA 5EJCA 3Q8XA 2OPFA 2VIIA 2D7HA 2DWLA 4DR6M 2UU9M 4B3MM 4LG2A 3L2AA 2EA0A 2CV1A 4AKHA 1R2YA 1S3SA 4W5WA 4LF6M 4JI8M 3M7GA 3TWKA 1QYRA 3GPUA 1L1TA 3FD9A 4BLCA 4FCVA 5GKNA 3GPPA 3AV0A 3M0EA 3SAVA 1XNRM 3HWSA 3QWLA 3DFZA 2Y20A 4M0WA 3UMMA 3FYDA 4DV2M 1DGHA 5ITXA 1FJGM 5IT9S 4LJ9A 2X49A 5C18A 2R46A 4M9SA 4TUWA 3E9SA 5DYIA 2RKOA 2F5QA 2KZSA 3TPZA 2HKJA 3AL0C 3J7AS 4JI3M 1MU5A 3T15A 3VLFB 3JR5A 3PXGA 3GLFB 2QBYA 1QAOA 1SXJD 3SMSA 2YNMD 4G4RA 3KS4A 1I4WA 3KVWA 3GRYA 1IY0A 1YUBA 4HL4A 5FTNA 4BBAA 5C1BA 2R65A 2XGNA 3KP0E 3KXEC 4YY3M 2Z4RA 3PNYA 1ZAEA 1XHBA 4JI1M 3FUXA 3HHWA 3KFUG 4IBKA 1Z6TA 1IN5A 3J7BA 3ZH9B 3H4MA 3U6EA 2DHRA 1HNWM 1Q39A 3SFZA 2Y0QA 4L8RC 2QCUA 4L78A 3U5ZA 3K2LA 4DUZM 4LF4M 2FOIC 3FTFA 3SYKA 3TL4X 3GPYA 1TH2A 1IN4A 3I51A 4EIWA 3RGPA 3LVVA 3FUVA 2CV2A 2C99A 2XZUA 4GHLA 2OQ4A 3SBJA 3TQSA 1R7RA 1K82A 4JI4M 4B3RM 3CF0A 2F4VM 3SYLA 3R9XB 2V6ZM 1TDHA 2YQZA 3U61A 2P5TA 1YSYA 4RF0A 5JI3E 3UK6A 2DWMA 4NSRA 1DGHB 4WW0A 4DUYM 4G4OA 4GRIA 4MH0E 4D82A 1N77A 1QAQA 3SAWA 1SXJA 4ZPXA 3W0LB 2Y0TA 3AJIB 2XH9A 3KDSE 3U60A 1L1ZA 4IBGA 4FVMA 1L2BA 2R62A 3AOEC 3GRUA 1NY5A 4HLQA 4IBIA 5E6JA 4QNRA 2QBYB 3K8ZA 3GLGA 2DZOB 1OJLA 5FTJA 3SMPA 4DV4M 2QENA 4I5SA 2XFSA 5ITYA 1HT1E 3HJQA 1G59A 4KODA 3FTCA 3DOAA 2VQFM 3LVWA 1N75A 4GMQA 1DO2A 2YR0A 4LJ5A 1IN7A 2L7IA 1NHGC 1Z5AA 2R45A 4GKKM 4DV0M 4CISA 4AQYM 1N78A 2XFTA 2O5RA 4D81A 4GKJM 4Z8XA 1Z59A 1GKIA 2M5ZA 4DV7M 3PVSA 2C9CA 1G3IA 3AKZA 4LF7M 1OFHA 3U5ZB 4MGYE 2EO2A 4LJ7A 2V1CA 4GITA 3MHVC 3GP1A 1NY6A 1G41A 1IXRC 4K0KM 3J80S 5FTMA 5BR8M 3PNVA 4P16A 4IBBA 3CF2A 4JI2M 2R4JA 1PJJA 5KQDA 5ITXE 2DVWB 4DR3M 4LY6A 2HL7A 1JR3D 3HJSA 2XLJA 3NBIA 4LGYA 2QPAA 1ZQ9A 3U61B 3GQ3A 4QHSA 1J09A 2YFQA 5FTLA 1D2NA 3GLHA 3AFHA 1E94E 1Z5BA 4KO8A 1SXJB 4R7GA 3VKHA 2XF3A 3BOSA 1XXHB 4OVZB 3U60B 1GL6A 4LRTA 2V1UA 3EIEA 2DZNB 4LF9M 3D8LA 2XZFA 3NWLA 3GLGB 3HHYA 1IM2A 4MGHA 4PCZA 3TWLA 3T1HM 5KPTA 3HHZA 2CHQA 1QAMA 2EUCA 2UXBM 5A2QS 2QP9X 4NRVA 2UUBM 2ZAMA 2BJVA 5JI2E 1QQWA 1MX0A 2K47A 4FWHA 4IIWA 4NRWA 3ILKA 2BJWA 1JQJC 4AZFA 3PFIA 2X4AA 1XWIA 3L25A 4DR4M 2KXEA 3U6DA 4GC5A 3HHXA 1R6BX 2ERCA 4NL4H 2R4EA 1C1KA 1JR3A 4DR1M 1GVNA 1IQPA 3FTDA 3A42A 5IWAM 4NXNM 3UZUA 5KQ8A 3FYCA 5KPRA 2HHHM 1SXJE 4IBEA 1EE8A 3AOEA 5ITRA 4AKGA 4L15A 3HU1A 1NVMA 4AW4A 5EP4A 4QOSA 4CHTB 2UUAM 5EXSA 4LJ4A 4IBCA 3GQ5A 3SASA 3GLHB 4LF8M 1XMQM 4ITQA 4JYAM 4KHPM 1IY2A 2H1RA 1E32A 3FUWA 4LFAM 3HKPA 3J2PB 3SARA 2C98A 3HJ8A 3U6MA 3U6CA 2D7EA 4B08A 3L27A 1N36M 2F5SA 5EXXA 1DGBA 4REZA 2XEPA 3KOYE 5EP2A 4LJ6A 1IN8A 4Z6YA 1NSFA 2CE7A 3A45A 5IZ7D 1E9SA 3K1JA 4LRSA 4X64M 1G8PA 3LQRA 4KLNA 2Z3XA 4LF5M 1HNXM 1GLNA 1YE9A 3FUTA 4QNMA 2RGHA 1HQCA 1L8QA 7CATA 4MGZE 4LZJA 2UUCM 1WXQA 2F5OA 4AI6A 4I81A 1J7KA 3VK8A 5ITUA 1IXZA 4MB7A 4I4LA 1HR0M 4G6ZA 4JI5M 1TH3A 1XNQM 1KFVA 3B9PA 2BNKA 4B3SM 4FWGA 4IJEA 2KW0A 3W0FA 3UGJA 4FCWA 4M9XA 4QOZC 3VKGA 2E5LM 3J27B 3VDUA 1HT2E 4FWDA 1QANA 4WURA 2UXDM 4GC9A 4XGIA 2A5YB 4PT5A 3L26A 1HNZM 5EP3A 4GIPA 3U6LA 2KRUA 4DR2M 1XMOM 3U6OA 2Z4SA 3OTOM 3JAMS 1Z5CA 3MK6A 4L4UA 4LJ8A 1IY1A 2C5RA 3HGIA 3TWMA 1G4AE 1IXSB 3KOZE 3EIHA 4JI7M 2CHGA 4MM3B 3DZDA 4NOOB 4RF1A 1W5TA 4YHHM 4FW9A 4B7GA 1T3TA 4XBOA 4X65M 2CHVA 2Q2EB 1NNUC 5LMUM 3SC3A 1Q3CA 2J7NA 5FTKA 3VFDA 1IBLM 2F5NA 1FNNA 3JR4A 2DXIA 4LGMA 3HU2A 4JI0M 5EXTA 2LXEA 3GPXA 2KA6B 3L29A 3KOWE 2I7NA 3KS8A 3KSXA 3CF6E 1NHWC 1OFIA 3SAUA 3THGA 5F3WA 3R8FA 2DWZB 3GRVA 4B7FA 5DNYA 2J7OA 1K3XA 1N32M 3I4VA 3VK7A 4MGKE 5FLXS 3VDPA 2ZAOA 2FNAA 2L6OA 1VDDA 3CTWB 3L28A 1IBKM 2CV0A 4MGIE 4NXMM 3KSJA 3FTEA 2AHMA 3U6PA 3U6QA 1DGFA 3WHLA 2LWXA 8CATA 5LMNM 2G5GX 1UM8A 1L2CA 4JN6A 3GLIA 2LH0A 4JV5M 4AG6A 1DO0A 3MJ5A 4DV1M 1ORYB 4AKIA 3GQ4A 4GHAA 1K3WA 4IBFA 4B3TM 3U6SA 3FKEA 1I94M 2UXCM 1QVRA 1N33M 3TE6A 1R2ZA 2RGOA 4JI6M 2L7HA 2CUZA 1IBMM 4GH9A 3T1YM 4FCTA 4IBDA 4RNAA 2X8AA 3T38A 4G4QA 4M9ZA 3FUUA 1GL7A 1N34M 1X37A 2W82A 2XSZD 1W5SA 4LZZA 2KRKA 4L16A 3ZC7B 4X66M 3K92A 5H37D 5ITTA 1TDZA 2VQEM 4IJFA 2F5PA 2NQ8C 1TGUA 4NSOB 4OU7A 3QAUA 3D8BA 3A98B 4I8OA 3SHFA 2ZANA 2I7PA 4IBJA 1HQYE 2M60A 2DWNA 2C9OA 4R3DA 4B7HA 5E26A 1J5EM 4JXJA 4LCBA 2L09A 3IG8A 4II7A 3LMMA 3RGSA 1Q3BA 2C96A 2FFJA 2FE8A 4QHTA 4AG5A 4CGYB 5KO3A 3I4YA 1TH4A 3IG5A 3LQQA 3SATA 1NJGA 4BB9A 1XXHA 3GLIB 2Y21A 1KYIA 3KOXE 4OVZA 1NJFA 5KPZA 2D7GA 3RE8A 4DV6M 3J81S 3C58A 3UJNA 3GO8A 4D80A 4OX9M 1QZMA 1KSFX 4DV3M 2KZUA 3HU3A 4LJAA 5EP1A 3GRRA 4A3VB 4OW0A 4DR5M 4LFCM 1L2DA 4M0DA 3GLFA 4DR7M 3DA1A 2Z7JA 2ZM6M 2LNHC 4PDIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI0 M;  2ZBK B;  3GPX A;  4DR1 M;  4DUY M;  4G4O A;  1NNJ A;  3A42 A;  3SAW A;  5IWA M;  4NXN M;  3SAU A;  2HHH M;  1PM5 A;  1L1Z A;  1EE8 A;  1L2B A;  1K3X A;  5ITR A;  1N32 M;  3VK7 A;  4LFB M;  4PD2 A;  4DV5 M;  3A46 A;  5FLX S;  4PDG A;  1PJI A;  4DV4 M;  4NXM M;  1IBK M;  5ITY A;  2UUA M;  4LF8 M;  3GQ5 A;  1XC8 A;  4X62 M;  3U6P A;  3U6Q A;  4G4N A;  3DOA A;  2VQF M;  1XMQ M;  3SAS A;  4ITQ A;  5LMN M;  1L2C A;  4KHP M;  4JYA M;  5ITQ A;  4JV5 M;  4LFA M;  2OPF A;  3SAR A;  3U6M A;  3U6C A;  1Z5A A;  4GKK M;  4DR6 M;  4DV1 M;  1N36 M;  4DV0 M;  2F5S A;  2UU9 M;  4CIS A;  4AQY M;  4B3M M;  2EA0 A;  4GKJ M;  3GQ4 A;  1R2Y A;  4LF6 M;  1Z59 A;  4JI8 M;  4DV7 M;  1K3W A;  4B3T M;  3TWK A;  3A45 A;  3U6S A;  3GPU A;  1L1T A;  1I94 M;  4LF7 M;  2UXC M;  4X64 M;  3GPP A;  3SAV A;  1XNR M;  1N33 M;  4LF5 M;  1R2Z A;  1HNX M;  3GP1 A;  4DV2 M;  4JI6 M;  4K0K M;  2UUC M;  3J80 S;  5BR8 M;  1IBM M;  2F5O A;  5ITX A;  1FJG M;  5IT9 S;  3T1Y M;  4JI2 M;  1PJJ A;  4G4Q A;  3VK8 A;  5ITU A;  5ITX E;  2F5Q A;  1N34 M;  4MB7 A;  1HR0 M;  2HKJ A;  4DR3 M;  3J7A S;  4JI5 M;  4JI3 M;  1MU5 A;  1XNQ M;  3JR5 A;  3GQ3 A;  1KFV A;  4X66 M;  5ITT A;  1TDZ A;  2VQE M;  4G4R A;  4B3S M;  3W0F A;  2F5P A;  2E5L M;  1Z5B A;  4YY3 M;  2UXD M;  1HNZ M;  4JI1 M;  3U6L A;  1J5E M;  4LF9 M;  4DR2 M;  1XMO M;  3U6O A;  2XZF A;  3OTO M;  3JAM S;  3U6E A;  1Z5C A;  1Q3B A;  3TWL A;  4PCZ A;  1HNW M;  1Q39 A;  3T1H M;  3TWM A;  4DUZ M;  4LF4 M;  2UXB M;  3SAT A;  4JI7 M;  3GPY A;  5A2Q S;  4NRV A;  2UUB M;  4YHH M;  4DV6 M;  3J81 S;  3C58 A;  3GO8 A;  1MX0 A;  4X65 M;  2Q2E B;  5LMU M;  4OX9 M;  2XZU A;  1Q3C A;  2OQ4 A;  4NRW A;  1IBL M;  2F5N A;  4DV3 M;  3SBJ A;  4JI4 M;  1K82 A;  4B3R M;  3JR4 A;  2F4V M;  4DR5 M;  3U6D A;  1L2D A;  4LFC M;  4DR4 M;  1TDH A;  4DR7 M;  2ZM6 M;  4PDI A; 
#chains in the Genus database with same CATH topology
 5EXP A;  1E9R A;  1Y8G A;  2ZBK B;  3HX3 A;  5BPV A;  2EKF A;  3E21 A;  2XSZ A;  3E4R A;  1LV7 A;  1IN6 A;  1GO5 A;  2KEB A;  1NNJ A;  1SXJ C;  2QNJ A;  3W68 A;  5IRE B;  3WHK A;  2HCB A;  3K9P A;  5DYG A;  3ZCB B;  2R18 A;  2QZ4 A;  3RFW A;  2JA2 A;  5FSW A;  3KP1 E;  2CFO A;  1PM5 A;  3T6P A;  1TF0 B;  2G8L A;  5EQT A;  3SHG B;  3KW6 A;  3AOG A;  2RRU A;  4RKU F;  4S12 A;  1D0M A;  4LFB M;  1H6U A;  4PD2 A;  1SG9 A;  3A46 A;  1DGG A;  4PDG A;  4DV5 M;  1PJI A;  4FD2 A;  1ZMW A;  3M6A A;  2CEA A;  2DKL A;  1XC8 A;  4X62 M;  4G4N A;  4NC6 A;  2JP7 A;  2JXN A;  5ITQ A;  5EJC A;  3E46 A;  3Q8X A;  2OPF A;  1V33 A;  2VII A;  2D7H A;  3GLI E;  2VF8 A;  2DWL A;  4DR6 M;  2UU9 M;  1F4I A;  4B3M M;  4LG2 A;  3L2A A;  2EA0 A;  2CV1 A;  4AKH A;  1R2Y A;  1S3S A;  4W5W A;  4LF6 M;  1JR3 E;  4JI8 M;  3M7G A;  2DNA A;  3TWK A;  1QYR A;  2WZJ A;  3GPU A;  1L1T A;  3FD9 A;  4BLC A;  4FCV A;  5GKN A;  3GPP A;  3AV0 A;  3M0E A;  3SAV A;  1XNR M;  3HWS A;  3QWL A;  3DFZ A;  2Y20 A;  4M0W A;  2O01 F;  2FS1 A;  3FYD A;  3UMM A;  4DV2 M;  1DGH A;  1QUS A;  5ITX A;  1FJG M;  2JY7 A;  3F92 A;  5IT9 S;  1EIJ A;  4LJ9 A;  2X49 A;  1OAO C;  5C18 A;  2R46 A;  4M9S A;  4TUW A;  3E9S A;  5DYI A;  2RKO A;  2F5Q A;  2KZS A;  3TPZ A;  2HKJ A;  3AL0 C;  3J7A S;  1AUA A;  4JI3 M;  1MU5 A;  3T15 A;  3VLF B;  3JR5 A;  3PXG A;  3GLF B;  2QBY A;  1QAO A;  1SXJ D;  1A5T A;  3SMS A;  2YNM D;  4G4R A;  2LBC A;  1YLA A;  3KS4 A;  1I4W A;  3KVW A;  3GRY A;  1IY0 A;  1YUB A;  1P3Q Q;  1NO1 A;  4HL4 A;  5FTN A;  2R65 A;  2XGN A;  5C1B A;  3KP0 E;  3KXE C;  4YY3 M;  5DFL A;  2MR9 A;  2Z4R A;  3PNY A;  1ZAE A;  2L4E A;  1WR1 B;  1XHB A;  2O25 A;  3FRH A;  3V76 A;  3FUX A;  4JI1 M;  3HHW A;  4WP2 A;  3KFU G;  4IBK A;  1Z6T A;  1IN5 A;  3J7B A;  3ZH9 B;  3H4M A;  3U6E A;  2DHR A;  2CWB A;  1HNW M;  1Q39 A;  3Q8G A;  3SFZ A;  2Y0Q A;  1MJG M;  1T6O A;  4L8R C;  2QCU A;  4L78 A;  3U5Z A;  3K2L A;  4DUZ M;  4LF4 M;  2WSC F;  2FOI C;  3FTF A;  3SYK A;  3TL4 X;  3GPY A;  1TH2 A;  1IN4 A;  3I51 A;  2K0B X;  1QDR A;  4EIW A;  3RGP A;  3LVV A;  3FUV A;  2CV2 A;  1NV9 A;  2C99 A;  1PJS A;  2XZU A;  2Z7J A;  4GHL A;  2OQ4 A;  1OIP A;  3SBJ A;  3TQS A;  1R7R A;  1K82 A;  4JI4 M;  4B3R M;  3CF0 A;  2F4V M;  3SYL A;  4F2L A;  3R9X B;  2V6Z M;  1TDH A;  2YQZ A;  3U61 A;  1YSY A;  2P5T A;  1OKS A;  4RF0 A;  5JI3 E;  3UK6 A;  2DWM A;  4NSR A;  1DGH B;  2ZTD A;  4WW0 A;  4DUY M;  4G4O A;  4GRI A;  4MH0 E;  3IHP A;  4D82 A;  1QAQ A;  3SAW A;  1SXJ A;  1N77 A;  4ZPX A;  1HJP A;  3W0L B;  2Y0T A;  3AJI B;  2XH9 A;  3KDS E;  3U60 A;  2LVQ D;  1L1Z A;  4IBG A;  4FVM A;  3C3E A;  1L2B A;  2R62 A;  3AOE C;  1GJT A;  1NY5 A;  2DAK A;  3BXW A;  3GRU A;  4HLQ A;  4IBI A;  5E6J A;  4QNR A;  2QBY B;  3K8Z A;  3GLG A;  2DZO B;  1OJL A;  1QDT A;  5FTJ A;  3SMP A;  1UFZ A;  2DHY A;  4DV4 M;  2QEN A;  4I5S A;  2XFS A;  5ITY A;  1HT1 E;  3HJQ A;  1G59 A;  4KOD A;  3FTC A;  3DOA A;  2VQF M;  1PGY A;  1N75 A;  3LVW A;  4GMQ A;  1DO2 A;  2YR0 A;  4LJ5 A;  1IN7 A;  2L7I A;  1NHG C;  1Z5A A;  2R45 A;  4GKK M;  2H5X A;  2R6F A;  4DV0 M;  4CIS A;  2JWS A;  4AQY M;  1N78 A;  2XFT A;  2O5R A;  4D81 A;  4GKJ M;  4G3O A;  1T43 A;  1VDL A;  4Z8X A;  1Z59 A;  1GKI A;  2M5Z A;  4DV7 M;  3HY5 A;  3PVS A;  2C9C A;  3B7Z A;  1G3I A;  3AKZ A;  4LF7 M;  1OQY A;  1OFH A;  3U5Z B;  4MGY E;  2BWE A;  2EO2 A;  4LJ7 A;  2V1C A;  2DAM A;  2EJS A;  4GIT A;  3MHV C;  1WGL A;  3GP1 A;  1NY6 A;  1G41 A;  1IXR C;  4K0K M;  3J80 S;  4Q7J A;  5FTM A;  3PNV A;  3B74 A;  5BR8 M;  4P16 A;  3MMP A;  1ZMU A;  2K9D A;  3CF2 A;  2R4J A;  4IBB A;  1PJJ A;  5KQD A;  2CRU A;  2R0I A;  4JI2 M;  5ITX E;  1PRB A;  2DVW B;  1DV0 A;  4DR3 M;  4LY6 A;  2VDB B;  2HL7 A;  1JR3 D;  3HJS A;  2XLJ A;  3NBI A;  4LGY A;  2QPA A;  1ZQ9 A;  2JUJ A;  3U61 B;  3NBX X;  3GQ3 A;  4QHS A;  2Z8Y M;  1J09 A;  2YFQ A;  5FTL A;  1D2N A;  3H4J A;  3GLH A;  1PJQ A;  1E94 E;  1Z5B A;  3AFH A;  3I04 M;  4KO8 A;  1SXJ B;  4R7G A;  3VKH A;  2XF3 A;  1V92 A;  3BOS A;  3LCV B;  1XXH B;  4CJ6 A;  4OVZ B;  2QQ8 A;  1GL6 A;  4LRT A;  3U60 B;  2V1U A;  3EIE A;  2DZN B;  4LF9 M;  2B3T A;  3D8L A;  2XZF A;  3NWL A;  3GLG B;  3HHY A;  1IM2 A;  2OO9 A;  4MGH A;  3CGW A;  4PCZ A;  3TWL A;  3T1H M;  5KPT A;  2KNA A;  2HWJ A;  3HHZ A;  2CHQ A;  1QAM A;  2EUC A;  1C7Y A;  3K9O A;  1TR8 A;  3C3D A;  2ZTC A;  2UXB M;  4XK8 F;  5A2Q S;  2QP9 X;  2JZ1 A;  4NRV A;  2UUB M;  2ZAM A;  2BJV A;  5JI2 E;  1QQW A;  1MX0 A;  2K47 A;  4Y28 F;  4FWH A;  4IIW A;  4NRW A;  3ILK A;  2BJW A;  3QYE A;  1JQJ C;  4L6V 6;  4AZF A;  3PFI A;  2X4A A;  1XWI A;  3L25 A;  4DR4 M;  2KXE A;  1QUT A;  3U6D A;  4GC5 A;  2DI0 A;  3HHX A;  1R6B X;  2ERC A;  4NL4 H;  1BVS A;  2R4E A;  1C1K A;  2GQF A;  1JR3 A;  4DR1 M;  1GVN A;  1IQP A;  3FTD A;  2N35 A;  3A42 A;  5IWA M;  4NXN M;  3UZU A;  5KQ8 A;  3FYC A;  2MH8 A;  5KPR A;  2HHH M;  1SXJ E;  4IBE A;  1EE8 A;  4UN2 B;  1XXH E;  3AOE A;  5ITR A;  3B7Q A;  1WIV A;  4AKG A;  4L15 A;  2LTU A;  3HU1 A;  1NVM A;  2LVP C;  4AW4 A;  5EP4 A;  4QOS A;  3GLG E;  4CHT B;  2UUA M;  5EXS A;  4LJ4 A;  1IXS A;  4IBC A;  3GQ5 A;  3GLH B;  3SAS A;  4LF8 M;  3IEC A;  1XMQ M;  4ITQ A;  4JYA M;  2J5Y A;  4KHP M;  1IY2 A;  2H1R A;  1E32 A;  3FUW A;  4LFA M;  3HKP A;  3J2P B;  3SAR A;  2C98 A;  3HJ8 A;  3GLF E;  3U6M A;  3U6C A;  2D7E A;  1JB0 F;  4B08 A;  3L27 A;  1N36 M;  2F5S A;  5EXX A;  1DGB A;  4REZ A;  2XEP A;  2FH0 A;  3KOY E;  5EP2 A;  4LJ6 A;  1IN8 A;  4Z6Y A;  1NSF A;  2CE7 A;  3A45 A;  5IZ7 D;  1E9S A;  2WSE F;  3K1J A;  4LRS A;  4X64 M;  1G8P A;  3LQR A;  4KLN A;  2Z3X A;  4LF5 M;  1HNX M;  1GLN A;  1YE9 A;  3FUT A;  4QNM A;  2RGH A;  1ZMV A;  1HQC A;  1L8Q A;  7CAT A;  4MGZ E;  3BBZ A;  4LZJ A;  2UUC M;  1WXQ A;  2F5O A;  4AI6 A;  4I81 A;  3FE3 A;  1OIZ A;  3B7N A;  1J7K A;  2OOA A;  1VEK A;  5ITU A;  3VK8 A;  1IXZ A;  2LHC A;  1RU3 A;  2R44 A;  4MB7 A;  4I4L A;  1HR0 M;  4G6Z A;  1AIP C;  4JI5 M;  1TH3 A;  4KT0 F;  1XNQ M;  1WGN A;  2DAG A;  1KFV A;  3B9P A;  2BNK A;  4B3S M;  4FWG A;  4IJE A;  2KW0 A;  3W0F A;  4BBA A;  3UGJ A;  4FCW A;  4M9X A;  4QOZ C;  3VKG A;  2E5L M;  3J27 B;  1CUK A;  3VDU A;  1HT2 E;  4FWD A;  1QAN A;  3GLH E;  4WUR A;  2UXD M;  3ZQJ A;  4GC9 A;  4XGI A;  4P17 A;  2A5Y B;  4PT5 A;  3L26 A;  1HNZ M;  5EP3 A;  4GIP A;  1VG5 A;  3U6L A;  2KRU A;  4DR2 M;  1XMO M;  4PDI A;  3U6O A;  2Z4S A;  3OTO M;  3JAM S;  1Z5C A;  3MK6 A;  4L4U A;  4LJ8 A;  1IY1 A;  2C5R A;  3HGI A;  2JY6 B;  3TWM A;  1IXS B;  2VF7 A;  3KOZ E;  3EIH A;  4JI7 M;  2JZ0 A;  2CHG A;  4MM3 B;  3DZD A;  4NOO B;  4RF1 A;  1W5T A;  4YHH M;  4FW9 A;  4B7G A;  1ZV1 A;  1D0K A;  1T3T A;  1G71 A;  4XBO A;  1Q02 A;  4X65 M;  2CHV A;  1LTM A;  2Q2E B;  1NNU C;  5LMU M;  3SC3 A;  2EKK A;  1Q3C A;  2J7N A;  5FTK A;  3VFD A;  1IBL M;  2F5N A;  1TTE A;  1FNN A;  3JR4 A;  2LVO C;  2HAK A;  2DAE A;  2DXI A;  4LGM A;  2QSF X;  4GEW A;  2JNH A;  3HU2 A;  4JI0 M;  2KNV A;  3HZJ A;  5EXT A;  2LXE A;  3GPX A;  2KA6 B;  3L29 A;  1VEJ A;  2I7N A;  3KOW E;  3KS8 A;  3KSX A;  1EFU B;  1NHW C;  1OFI A;  2KDL A;  3CF6 E;  3SAU A;  3THG A;  5F3W A;  3R8F A;  2DWZ B;  3GRV A;  4B7F A;  2G3Q A;  1R5L A;  5DNY A;  2BWB A;  2J7O A;  1K3X A;  1N32 M;  3I4V A;  3VK7 A;  4MGK E;  5FLX S;  3VDP A;  2ZAO A;  2FNA A;  2L6O A;  1GJS A;  1VDD A;  3CTW B;  3L28 A;  1IBK M;  2CV0 A;  4MGI E;  4NXM M;  3KSJ A;  3FTE A;  2AHM A;  3U6P A;  3U6Q A;  4DBG B;  1DGF A;  3WHL A;  2LWX A;  8CAT A;  5LMN M;  2G5G X;  1UM8 A;  1L2C A;  4JN6 A;  3GLI A;  2LH0 A;  3FRI A;  1NV8 A;  4AG6 A;  4JV5 M;  2L2D A;  2QHO B;  5L8R F;  1WJ7 A;  1R4G A;  1DO0 A;  3MJ5 A;  4DV1 M;  3LCU A;  1ORY B;  4AKI A;  1WHC A;  3GQ4 A;  4GHA A;  4F1I A;  1K3W A;  4IBF A;  4B3T M;  2MGW A;  2DEN A;  2MRO B;  1XB2 B;  3FKE A;  3U6S A;  1I94 M;  2UXC M;  2KNZ A;  1QVR A;  2CP8 A;  1N33 M;  2DZL A;  3TE6 A;  1R2Z A;  2RGO A;  4R71 A;  4JI6 M;  2L7H A;  2CUZ A;  1IBM M;  1GAB A;  4GH9 A;  3T1Y M;  4FCT A;  4IBD A;  4RNA A;  2X8A A;  3T38 A;  4G4Q A;  4M9Z A;  3FUU A;  1OAI A;  1GL7 A;  1N34 M;  1X37 A;  2W82 A;  2XSZ D;  1W5S A;  4LZZ A;  2KRK A;  2OOB A;  3C9P A;  1PJT A;  1MN3 A;  4L16 A;  3ZC7 B;  4X66 M;  3K92 A;  5H37 D;  5ITT A;  3LW5 F;  1TDZ A;  2VQE M;  4IJF A;  2LHG A;  2F5P A;  2NQ8 C;  1TGU A;  4NSO B;  3QYB A;  2KHH A;  4OU7 A;  3QAU A;  3D8B A;  2JY8 A;  3A98 B;  4I8O A;  1V34 A;  3SHF A;  1OTR A;  2ZAN A;  2I7P A;  2DAI A;  3I01 M;  4IBJ A;  1HQY E;  2M60 A;  2DWN A;  2C9O A;  4R3D A;  4B7H A;  5E26 A;  1J5E M;  4JXJ A;  2JY5 A;  4LCB A;  2GNO A;  2L09 A;  3IG8 A;  4II7 A;  3LMM A;  3RGS A;  1Q3B A;  2C96 A;  2FFJ A;  2FE8 A;  4QHT A;  4AG5 A;  4CGY B;  2LVA A;  4ANR A;  5KO3 A;  1VQ1 A;  3I4Y A;  1TH4 A;  3IG5 A;  3LQQ A;  3SAT A;  1NJG A;  4BB9 A;  1XXH A;  2MJ5 B;  2Y21 A;  3GLI B;  1KYI A;  3KOX E;  4OVZ A;  1NJF A;  4CIZ A;  5KPZ A;  2D7G A;  1IFY A;  3RE8 A;  4DV6 M;  3J81 S;  1QZE A;  3C58 A;  3UJN A;  3GO8 A;  3B89 A;  2APL A;  4D80 A;  4OX9 M;  1QZM A;  1KSF X;  4DV3 M;  2LVN C;  1D0L A;  2K6B A;  2KZU A;  4HEO A;  3HU3 A;  4LJA A;  5EP1 A;  3GRR A;  3W67 A;  4A3V B;  4OW0 A;  4DR5 M;  4LFC M;  1L2D A;  4M0D A;  3GLF A;  4DR7 M;  2WSF F;  3DA1 A;  2L4F A;  1G4A E;  2ZM6 M;  2LNH C;  1VEG A; 
#chains in the Genus database with same CATH homology
 5EXP A;  1E9R A;  5BPV A;  2ZBK B;  2XSZ A;  3E4R A;  1LV7 A;  1IN6 A;  2KEB A;  1NNJ A;  1SXJ C;  3WHK A;  5IRE B;  2HCB A;  5DYG A;  3ZCB B;  2R18 A;  2QZ4 A;  3RFW A;  2JA2 A;  5FSW A;  3KP1 E;  2CFO A;  1PM5 A;  2G8L A;  5EQT A;  3SHG B;  3KW6 A;  3AOG A;  4S12 A;  4LFB M;  1H6U A;  4PD2 A;  3A46 A;  4DV5 M;  1DGG A;  4PDG A;  1PJI A;  4FD2 A;  3M6A A;  2CEA A;  1XC8 A;  4X62 M;  4G4N A;  5ITQ A;  5EJC A;  3Q8X A;  2OPF A;  2VII A;  2D7H A;  2DWL A;  4DR6 M;  2UU9 M;  4B3M M;  4LG2 A;  3L2A A;  2EA0 A;  2CV1 A;  4AKH A;  1R2Y A;  1S3S A;  4W5W A;  4LF6 M;  4JI8 M;  3M7G A;  3TWK A;  1QYR A;  3GPU A;  1L1T A;  3FD9 A;  4BLC A;  4FCV A;  5GKN A;  3GPP A;  3AV0 A;  3M0E A;  3SAV A;  1XNR M;  3HWS A;  3QWL A;  3DFZ A;  2Y20 A;  4M0W A;  3UMM A;  3FYD A;  4DV2 M;  1DGH A;  5ITX A;  1FJG M;  5IT9 S;  4LJ9 A;  2X49 A;  5C18 A;  2R46 A;  4M9S A;  4TUW A;  3E9S A;  5DYI A;  2RKO A;  2F5Q A;  2KZS A;  3TPZ A;  2HKJ A;  3AL0 C;  3J7A S;  4JI3 M;  1MU5 A;  3T15 A;  3VLF B;  3JR5 A;  3PXG A;  3GLF B;  2QBY A;  1QAO A;  1SXJ D;  3SMS A;  2YNM D;  4G4R A;  3KS4 A;  1I4W A;  3KVW A;  3GRY A;  1IY0 A;  1YUB A;  4HL4 A;  5FTN A;  4BBA A;  5C1B A;  2R65 A;  2XGN A;  3KP0 E;  3KXE C;  4YY3 M;  2Z4R A;  3PNY A;  1ZAE A;  1XHB A;  4JI1 M;  3FUX A;  3HHW A;  3KFU G;  4IBK A;  1Z6T A;  1IN5 A;  3J7B A;  3ZH9 B;  3H4M A;  3U6E A;  2DHR A;  1HNW M;  1Q39 A;  3SFZ A;  2Y0Q A;  4L8R C;  2QCU A;  4L78 A;  3U5Z A;  3K2L A;  4DUZ M;  4LF4 M;  2FOI C;  3FTF A;  3SYK A;  3TL4 X;  3GPY A;  1TH2 A;  1IN4 A;  3I51 A;  4EIW A;  3RGP A;  3LVV A;  3FUV A;  2CV2 A;  2C99 A;  2XZU A;  4GHL A;  2OQ4 A;  3SBJ A;  3TQS A;  1R7R A;  1K82 A;  4JI4 M;  4B3R M;  3CF0 A;  2F4V M;  3SYL A;  3R9X B;  2V6Z M;  1TDH A;  2YQZ A;  3U61 A;  2P5T A;  1YSY A;  4RF0 A;  5JI3 E;  3UK6 A;  2DWM A;  4NSR A;  1DGH B;  4WW0 A;  4DUY M;  4G4O A;  4GRI A;  4MH0 E;  4D82 A;  1N77 A;  1QAQ A;  3SAW A;  1SXJ A;  4ZPX A;  3W0L B;  2Y0T A;  3AJI B;  2XH9 A;  3KDS E;  3U60 A;  1L1Z A;  4IBG A;  4FVM A;  1L2B A;  2R62 A;  3AOE C;  3GRU A;  1NY5 A;  4HLQ A;  4IBI A;  5E6J A;  4QNR A;  2QBY B;  3K8Z A;  3GLG A;  2DZO B;  1OJL A;  5FTJ A;  3SMP A;  4DV4 M;  2QEN A;  4I5S A;  2XFS A;  5ITY A;  1HT1 E;  3HJQ A;  1G59 A;  4KOD A;  3FTC A;  3DOA A;  2VQF M;  3LVW A;  1N75 A;  4GMQ A;  1DO2 A;  2YR0 A;  4LJ5 A;  1IN7 A;  2L7I A;  1NHG C;  1Z5A A;  2R45 A;  4GKK M;  4DV0 M;  4CIS A;  4AQY M;  1N78 A;  2XFT A;  2O5R A;  4D81 A;  4GKJ M;  4Z8X A;  1Z59 A;  1GKI A;  2M5Z A;  4DV7 M;  3PVS A;  2C9C A;  1G3I A;  3AKZ A;  4LF7 M;  1OFH A;  3U5Z B;  4MGY E;  2EO2 A;  4LJ7 A;  2V1C A;  4GIT A;  3MHV C;  3GP1 A;  1NY6 A;  1G41 A;  1IXR C;  4K0K M;  3J80 S;  5FTM A;  5BR8 M;  3PNV A;  4P16 A;  4IBB A;  3CF2 A;  4JI2 M;  2R4J A;  1PJJ A;  5KQD A;  5ITX E;  2DVW B;  4DR3 M;  4LY6 A;  2HL7 A;  1JR3 D;  3HJS A;  2XLJ A;  3NBI A;  4LGY A;  2QPA A;  1ZQ9 A;  3U61 B;  3GQ3 A;  4QHS A;  1J09 A;  2YFQ A;  5FTL A;  1D2N A;  3GLH A;  3AFH A;  1E94 E;  1Z5B A;  4KO8 A;  1SXJ B;  4R7G A;  3VKH A;  2XF3 A;  3BOS A;  1XXH B;  4OVZ B;  3U60 B;  1GL6 A;  4LRT A;  2V1U A;  3EIE A;  2DZN B;  4LF9 M;  3D8L A;  2XZF A;  3NWL A;  3GLG B;  3HHY A;  1IM2 A;  4MGH A;  4PCZ A;  3TWL A;  3T1H M;  5KPT A;  3HHZ A;  2CHQ A;  1QAM A;  2EUC A;  2UXB M;  5A2Q S;  2QP9 X;  4NRV A;  2UUB M;  2ZAM A;  2BJV A;  5JI2 E;  1QQW A;  1MX0 A;  2K47 A;  4FWH A;  4IIW A;  4NRW A;  3ILK A;  2BJW A;  1JQJ C;  4AZF A;  3PFI A;  2X4A A;  1XWI A;  3L25 A;  4DR4 M;  2KXE A;  3U6D A;  4GC5 A;  3HHX A;  1R6B X;  2ERC A;  4NL4 H;  2R4E A;  1C1K A;  1JR3 A;  4DR1 M;  1GVN A;  1IQP A;  3FTD A;  3A42 A;  5IWA M;  4NXN M;  3UZU A;  5KQ8 A;  3FYC A;  5KPR A;  2HHH M;  1SXJ E;  4IBE A;  1EE8 A;  3AOE A;  5ITR A;  4AKG A;  4L15 A;  3HU1 A;  1NVM A;  4AW4 A;  5EP4 A;  4QOS A;  4CHT B;  2UUA M;  5EXS A;  4LJ4 A;  4IBC A;  3GQ5 A;  3SAS A;  3GLH B;  4LF8 M;  1XMQ M;  4ITQ A;  4JYA M;  4KHP M;  1IY2 A;  2H1R A;  1E32 A;  3FUW A;  4LFA M;  3HKP A;  3J2P B;  3SAR A;  2C98 A;  3HJ8 A;  3U6M A;  3U6C A;  2D7E A;  4B08 A;  3L27 A;  1N36 M;  2F5S A;  5EXX A;  1DGB A;  4REZ A;  2XEP A;  3KOY E;  5EP2 A;  4LJ6 A;  1IN8 A;  4Z6Y A;  1NSF A;  2CE7 A;  3A45 A;  5IZ7 D;  1E9S A;  3K1J A;  4LRS A;  4X64 M;  1G8P A;  3LQR A;  4KLN A;  2Z3X A;  4LF5 M;  1HNX M;  1GLN A;  1YE9 A;  3FUT A;  4QNM A;  2RGH A;  1HQC A;  1L8Q A;  7CAT A;  4MGZ E;  4LZJ A;  2UUC M;  1WXQ A;  2F5O A;  4AI6 A;  4I81 A;  1J7K A;  3VK8 A;  5ITU A;  1IXZ A;  4MB7 A;  4I4L A;  1HR0 M;  4G6Z A;  4JI5 M;  1TH3 A;  1XNQ M;  1KFV A;  3B9P A;  2BNK A;  4B3S M;  4FWG A;  4IJE A;  2KW0 A;  3W0F A;  3UGJ A;  4FCW A;  4M9X A;  4QOZ C;  3VKG A;  2E5L M;  3J27 B;  3VDU A;  1HT2 E;  4FWD A;  1QAN A;  4WUR A;  2UXD M;  4GC9 A;  4XGI A;  2A5Y B;  4PT5 A;  3L26 A;  1HNZ M;  5EP3 A;  4GIP A;  3U6L A;  2KRU A;  4DR2 M;  1XMO M;  3U6O A;  2Z4S A;  3OTO M;  3JAM S;  1Z5C A;  3MK6 A;  4L4U A;  4LJ8 A;  1IY1 A;  2C5R A;  3HGI A;  3TWM A;  1G4A E;  1IXS B;  3KOZ E;  3EIH A;  4JI7 M;  2CHG A;  4MM3 B;  3DZD A;  4NOO B;  4RF1 A;  1W5T A;  4YHH M;  4FW9 A;  4B7G A;  1T3T A;  4XBO A;  4X65 M;  2CHV A;  2Q2E B;  1NNU C;  5LMU M;  3SC3 A;  1Q3C A;  2J7N A;  5FTK A;  3VFD A;  1IBL M;  2F5N A;  1FNN A;  3JR4 A;  2DXI A;  4LGM A;  3HU2 A;  4JI0 M;  5EXT A;  2LXE A;  3GPX A;  2KA6 B;  3L29 A;  3KOW E;  2I7N A;  3KS8 A;  3KSX A;  3CF6 E;  1NHW C;  1OFI A;  3SAU A;  3THG A;  5F3W A;  3R8F A;  2DWZ B;  3GRV A;  4B7F A;  5DNY A;  2J7O A;  1K3X A;  1N32 M;  3I4V A;  3VK7 A;  4MGK E;  5FLX S;  3VDP A;  2ZAO A;  2FNA A;  2L6O A;  1VDD A;  3CTW B;  3L28 A;  1IBK M;  2CV0 A;  4MGI E;  4NXM M;  3KSJ A;  3FTE A;  2AHM A;  3U6P A;  3U6Q A;  1DGF A;  3WHL A;  2LWX A;  8CAT A;  5LMN M;  2G5G X;  1UM8 A;  1L2C A;  4JN6 A;  3GLI A;  2LH0 A;  4JV5 M;  4AG6 A;  1DO0 A;  3MJ5 A;  4DV1 M;  1ORY B;  4AKI A;  3GQ4 A;  4GHA A;  1K3W A;  4IBF A;  4B3T M;  3U6S A;  3FKE A;  1I94 M;  2UXC M;  1QVR A;  1N33 M;  3TE6 A;  1R2Z A;  2RGO A;  4JI6 M;  2L7H A;  2CUZ A;  1IBM M;  4GH9 A;  3T1Y M;  4FCT A;  4IBD A;  4RNA A;  2X8A A;  3T38 A;  4G4Q A;  4M9Z A;  3FUU A;  1GL7 A;  1N34 M;  1X37 A;  2W82 A;  2XSZ D;  1W5S A;  4LZZ A;  2KRK A;  4L16 A;  3ZC7 B;  4X66 M;  3K92 A;  5H37 D;  5ITT A;  1TDZ A;  2VQE M;  4IJF A;  2F5P A;  2NQ8 C;  1TGU A;  4NSO B;  4OU7 A;  3QAU A;  3D8B A;  3A98 B;  4I8O A;  3SHF A;  2ZAN A;  2I7P A;  4IBJ A;  1HQY E;  2M60 A;  2DWN A;  2C9O A;  4R3D A;  4B7H A;  5E26 A;  1J5E M;  4JXJ A;  4LCB A;  2L09 A;  3IG8 A;  4II7 A;  3LMM A;  3RGS A;  1Q3B A;  2C96 A;  2FFJ A;  2FE8 A;  4QHT A;  4AG5 A;  4CGY B;  5KO3 A;  3I4Y A;  1TH4 A;  3IG5 A;  3LQQ A;  3SAT A;  1NJG A;  4BB9 A;  1XXH A;  3GLI B;  2Y21 A;  1KYI A;  3KOX E;  4OVZ A;  1NJF A;  5KPZ A;  2D7G A;  3RE8 A;  4DV6 M;  3J81 S;  3C58 A;  3UJN A;  3GO8 A;  4D80 A;  4OX9 M;  1QZM A;  1KSF X;  4DV3 M;  2KZU A;  3HU3 A;  4LJA A;  5EP1 A;  3GRR A;  4A3V B;  4OW0 A;  4DR5 M;  4LFC M;  1L2D A;  4M0D A;  3GLF A;  4DR7 M;  3DA1 A;  2Z7J A;  2ZM6 M;  2LNH C;  4PDI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...