4JI4M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 25
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ji4M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4ji4M02
3GQ4A 1EE8A 2XZFA 1J5EM 2UU9M 4B3MM 4DR4M 4NXNM 2HHHM 4JYAM 5ITTA 2UXBM 4G4QA 4KHPM 4G4OA 2F5QA 2UXDM 1L1ZA 3JR4A 3GPPA 3U6EA 3SARA 4NRWA 3GPYA 4JI3M 4X65M 4DV4M 3JAMS 3U6MA 4PDIA 1PJIA 4LF9M 3GQ5A 4DR5M 4B3RM 4JI5M 4DR1M 4YY3M 3U6PA 4LF8M 4GKJM 3SAUA 1KFVA 3J81S 4NRVA 1FJGM 3OTOM 4MB7A 3T1YM 5LMNM 1HR0M 3W0FA 3VK8A 4PDGA 1L2CA 1L1TA 1Z5BA 3SATA 4DV0M 2F5OA 1Z59A 1K3XA 1Z5AA 3A45A 2F5NA 4B3TM 4DV1M 4GKKM 1Q3CA 4ITQA 1Q3BA 3GO8A 1L2BA 3U6SA 3VK7A 3SBJA 2OPFA 3U6OA 4DV5M 1IBLM 4LF5M 3SASA 4JI8M 4YHHM 2ZM6M 3U6LA 1XC8A 3GP1A 4DR7M 1R2ZA 1I94M 1TDHA 2F4VM 1IBKM 2F5SA 2EA0A 1TDZA 5ITYA 4DUYM 3DOAA 1IBMM 4JI1M 3TWKA 3U6CA 3SAVA 5IT9S 1HNZM 1HNWM 4LF4M 2F5PA 4JI6M 1R2YA 1NNJA 4DV7M 1XNRM 1PJJA 4JI2M 1Q39A 4OX9M 4K0KM 1K3WA 4DV2M 1L2DA 4JI4M 1N32M 4AQYM 2E5LM 4NXMM 5LMUM 2Q2EB 1K82A 5ITRA 4DUZM 2HKJA 1N36M 2XZUA 4LFAM 3SAWA 4JV5M 3U6DA 3T1HM 3GPXA 5ITQA 4G4NA 4PD2A 3TWLA 3C58A 4LF6M 5ITXE 3U6QA 5A2QS 3A46A 3J7AS 3A42A 2UXCM 3GQ3A 5BR8M 4B3SM 4DV3M 4LFBM 1XMOM 1N34M 2VQFM 5ITUA 1Z5CA 1MU5A 4DV6M 3JR5A 5FLXS 4X66M 4JI7M 2UUBM 4DR6M 4PCZA 4X64M 3TWMA 2UUAM 2VQEM 1XNQM 2OQ4A 1MX0A 5ITXA 4DR3M 1N33M 4CISA 1HNXM 4G4RA 3GPUA 4DR2M 4X62M 4LF7M 3J80S 1XMQM 1PM5A 4LFCM 2UUCM 5IWAM 2ZBKB 4JI0M
chains in the Genus database with same CATH superfamily
2JY6B 3RFWA 2XZFA 4GHAA 1QZMA 2V6ZM 1G41A 4IBKA 5ITTA 3KW6A 2DNAA 4G4QA 2HL7A 3HHYA 3B74A 2CUZA 2LTUA 2JZ1A 2EKFA 3GLGB 1QQWA 5EXSA 1DGHA 1C7YA 2BJVA 4I8OA 3SARA 4NRWA 4LJ4A 5FTJA 3GPYA 3D8BA 4DV4M 4L15A 4PDIA 3VFDA 1D2NA 2GQFA 4EIWA 2VF7A 3GLIA 3T15A 4B3RM 3U6PA 3HJSA 2XLJA 1V92A 1NHGC 1PJQA 4MGZE 1KFVA 3NWLA 4L6V6 3E46A 3J81S 2J5YA 2KNAA 3PFIA 3LW5F 5E6JA 5C1BA 5LMNM 1IQPA 2LHCA 1AIPC 2N35A 1PJSA 2FE8A 3C3EA 3VDUA 3VK8A 1EIJA 2HCBA 1PJTA 2QQ8A 3HU2A 2KZUA 1L1TA 1L2CA 1GLNA 2CV2A 3T38A 3EIEA 5DYIA 2F5OA 3AL0C 4Z8XA 1OIZA 3VDPA 2DZLA 2DWZB 2CP8A 4IJEA 2OOAA 4P17A 3IG8A 3D8LA 3DZDA 4Y28F 3GLFE 1L2BA 2Z4SA 3U6SA 3VK7A 3J27B 3PNVA 1TGUA 2LHGA 4DV5M 2DAIA 3FUUA 5IZ7D 2X8AA 2H1RA 2ZTDA 4M0WA 4R7GA 2DXIA 4DR7M 1P3QQ 1SXJB 1R2ZA 2QENA 3VLFB 2JY7A 3I4VA 5KPZA 2CHGA 1IY0A 4HLQA 3FTFA 3K92A 2I7NA 3I4YA 1TDZA 1OAOC 5ITYA 2KXEA 1NV9A 3M0EA 4JI1M 1XXHB 3U6CA 1DO0A 3SAVA 2XSZD 5IT9S 3KS8A 2FFJA 3KXEC 1G4AE 2L09A 2W82A 4JI6M 2KZSA 2YNMD 3FUVA 2KNZA 3L2AA 4XK8F 2G3QA 2NQ8C 2M60A 2Z4RA 3C9PA 4AQYM 2E5LM 4AKHA 2XGNA 1LTMA 3BOSA 4I4LA 3EIHA 3KSXA 1XXHE 4AKIA 3KOYE 4WURA 2MR9A 2C99A 3T1HM 4MM3B 4IBBA 2DHYA 1R6BX 1XWIA 1OKSA 3TWLA 2KNVA 3IG5A 5FTLA 2DAGA 3C58A 2DAEA 3I04M 4MGYE 1S3SA 4ANRA 5A2QS 1GL7A 1J09A 4GMQA 1J7KA 3IECA 3KSJA 3UK6A 1W5TA 2VQFM 1QUTA 2JA2A 3KOWE 5FLXS 4LF6M 3FKEA 1TH3A 5JI3E 2UUBM 3W67A 4JI7M 4PCZA 4X64M 3RGSA 2UUAM 1XNQM 3THGA 4M0DA 1NSFA 4NC6A 5ITXA 7CATA 1ZQ9A 1KYIA 1TR8A 4LF7M 2KDLA 1JQJC 2J7NA 2LNHC 1SXJD 2UUCM 2RRUA 3U6DA 1QVRA 4DBGB 1EE8A 1J5EM 2UU9M 1WIVA 1HT2E 4DR4M 4RF0A 2CHVA 4B7GA 1IN7A 1NO1A 1RU3A 1UM8A 2KRKA 3CF6E 1IN8A 4OU7A 3B9PA 1Y8GA 1ZMVA 4G3OA 3ZH9B 4F1IA 2UXDM 3FYDA 2EKKA 3VKGA 4D82A 3ILKA 3GPPA 3I01M 3IHPA 1G8PA 2VIIA 4NSOB 4KODA 5EXTA 3UMMA 1E94E 2EUCA 3HU1A 3SMSA 1DGBA 1PJIA 4LF9M 4AKGA 3HHWA 4LGYA 3GQ5A 4DR5M 2DZOB 3FRIA 3LQQA 4BBAA 4JI5M 1HQCA 4YY3M 1N75A 4FWGA 4GKJM 4GH9A 2K6BA 3DFZA 3GRRA 4LZJA 4NRVA 2XFSA 1W5SA 4MB7A 1WXQA 3FTEA 4L4UA 2MGWA 1EFUB 3U5ZA 2Y20A 2L7IA 1Z5BA 4FWHA 4LJAA 3SHGB 1ZAEA 4B08A 1Z59A 4CGYB 3F92A 2FS1A 3U5ZB 3A45A 3GLHE 1K3XA 3H4MA 3K9OA 3AOEA 4S12A 1Q3CA 3SC3A 4ITQA 3KOXE 3TPZA 1ORYB 3LVVA 3MHVC 3SBJA 2QZ4A 1NY5A 3SYKA 4AI6A 1QUSA 2LWXA 3MJ5A 4NL4H 2DAKA 2FNAA 2LVAA 3FYCA 3U6LA 3LQRA 1QAOA 2Z3XA 4FCTA 3ZC7B 2JZ0A 4GC5A 2F5SA 3I51A 2EA0A 1SXJC 2M5ZA 3DOAA 2ZTCA 1IBMM 3TWKA 1HNZM 3CTWB 2R18A 2JUJA 4LF4M 3AFHA 2R45A 4FVMA 1NNJA 4D81A 1Q02A 4FW9A 2CWBA 3FD9A 4DV7M 3FUXA 4QHSA 4OX9M 1OQYA 4LGMA 2DAMA 2RGHA 3SFZA 2DWMA 2KRUA 3TL4X 3UGJA 4OW0A 3GLIB 2R65A 1D0LA 3K1JA 3QYBA 4HEOA 1VG5A 5LMUM 2R0IA 5ITRA 3GLFA 4DUZM 2HKJA 1N36M 3AV0A 2EJSA 5EP2A 2AHMA 3K9PA 2BWEA 3LMMA 4G4NA 1JR3A 1YUBA 2BJWA 3U6QA 3L27A 4LRTA 4M9ZA 4GRIA 4IBIA 4IBDA 4GITA 4WW0A 1VEGA 5GKNA 1T43A 1IM2A 3ZQJA 1DV0A 4GC9A 2RGOA 3HGIA 4IBCA 3HWSA 2Z7JA 1R4GA 1NJFA 1VEJA 2QCUA 4KO8A 2J7OA 2DVWB 1QAMA 1IN4A 2MROB 3SMPA 3JR5A 3B7NA 2A5YB 3GLHA 3GLGA 2H5XA 4QNMA 3TWMA 3FRHA 1KSFX 2R44A 3AOGA 1GJSA 1N33M 2LXEA 5KQDA 4CISA 1HNXM 3Q8GA 1E9SA 4UN2B 4L78A 1NV8A 4X62M 3L26A 4B7FA 3FE3A 2CRUA 4LFCM 3R9XB 2ZANA 1IY2A 3HU3A 3QAUA 2KW0A 3GQ4A 1MJGM 4LJ9A 4AZFA 4B3MM 5DFLA 3NBXX 1XXHA 5FTMA 4JYAM 2Y0QA 2QPAA 2UXBM 5EP1A 4FCVA 3R8FA 2R4EA 4KHPM 1BVSA 3LCUA 3H4JA 3TE6A 1YE9A 3MK6A 5DNYA 3JR4A 3U6EA 1IN6A 2HWJA 2C5RA 1QANA 3CF0A 1V33A 3AJIB 4IBJA 2D7EA 2YR0A 3HKPA 3U6MA 1UFZA 2ZAMA 1ZMWA 2LVOC 4JXJA 5KPRA 1FNNA 4NSRA 2P5TA 4DR1M 3FTCA 3QWLA 4LJ6A 1YSYA 1G3IA 2JY5A 3E9SA 4KLNA 1E32A 3A98B 4IBGA 3B7QA 2DKLA 4FWDA 3KP1E 3L29A 4D80A 3M6AA 4I81A 3T1YM 2YFQA 3LVWA 1Z6TA 2C96A 3PXGA 2QNJA 1GKIA 1NJGA 1YLAA 3PVSA 4PDGA 2G5GX 1IY1A 4IIWA 2CHQA 1DGHB 3K2LA 4LCBA 1C1KA 4IBEA 4RNAA 3HX3A 5EP3A 4DV0M 1N78A 1WHCA 3V76A 2F5NA 2O25A 2QBYB 4B3TM 1XB2B 1GJTA 1R7RA 2JNHA 3L25A 1VQ1A 2G8LA 2O01F 3GLFB 2OPFA 4MGIE 2R6FA 2DZNB 2WZJA 4CIZA 1IBLM 4REZA 4LF5M 3SASA 1X37A 3RGPA 2LVNC 3CGWA 2ZM6M 1SXJE 5FSWA 1IXSA 1XC8A 2ZAOA 1NY6A 2JWSA 1MN3A 1IBKM 1IXSB 2X4AA 2XF3A 2LVPC 4XBOA 4QHTA 4DUYM 4NOOB 4G6ZA 3KOZE 4IJFA 2MH8A 1LV7A 3E4RA 1TH2A 4L8RC 2C9CA 2KA6B 2X49A 1G59A 3NBIA 2XSZA 3W0LB 1TH4A 1VEKA 2L6OA 4GEWA 4AG6A 1PJJA 1DGFA 4DV2M 3C3DA 5KO3A 4HL4A 2BWBA 4Q7JA 2K47A 4JI4M 2DI0A 4NXMM 2VF8A 3BBZA 2Q2EB 4IBFA 1JR3D 1SXJA 3J7BA 2Y21A 5F3WA 3SAWA 5IREB 3GRUA 4B7HA 4JV5M 3GPXA 1HQYE 4PD2A 2Z8YM 5H37D 3E21A 5ITXE 2APLA 5FTKA 4QOSA 1WR1B 1VDDA 2Y0TA 4RF1A 3A46A 1QAQA 2LVQD 3A42A 3UZUA 4BB9A 2K0BX 2MJ5B 4AW4A 5BR8M 3SYLA 4LG2A 3GRYA 4LFBM 1XMOM 4GIPA 1N34M 5ITUA 1JR3E 8CATA 2LBCA 1MU5A 3HJQA 2I7PA 3GRVA 2XEPA 4LY6A 1GL6A 4X66M 2DWLA 2CV1A 1AUAA 3RE8A 2KHHA 1E9RA 3M7GA 1CUKA 4II7A 4MGKE 2VQEM 3WHLA 2OQ4A 1MX0A 1VDLA 4LJ8A 4DR3M 2L7HA 4G4RA 2DWNA 1OTRA 4LRSA 2L2DA 4WP2A 3L28A 1F4IA 1XMQM 1L8QA 4MGHA 2CEAA 2K9DA 1XHBA 1WJ7A 2ZBKB 4JI0M 3HJ8A 1D0KA 1R5LA 4Z6YA 4NXNM 5EQTA 4CJ6A 3KVWA 2HHHM 3HHXA 1IXRC 1OFHA 2XFTA 2QBYA 2YQZA 4G4OA 2F5QA 3WHKA 1JB0F 1WGNA 1L1ZA 3KP0E 4TUWA 1V34A 1IFYA 2VDBB 3FTDA 2CV0A 1OIPA 4QOZC 4JI3M 4X65M 5FTNA 1QDTA 3W68A 3JAMS 3UJNA 1DGGA 4JN6A 1T6OA 4LF8M 4LJ7A 1GO5A 2ERCA 1ZMUA 2CFOA 4BLCA 4OVZB 2O5RA 3SAUA 2QP9X 1OJLA 4KT0F 3U61B 1FJGM 3OTOM 4OVZA 1HR0M 1OFIA 4M9SA 3W0FA 3B7ZA 1QYRA 1QZEA 2HAKA 4AG5A 2OO9A 3SHFA 1WGLA 3K8ZA 3AKZA 1OAIA 5KQ8A 3GLHB 3SATA 1TTEA 4FCWA 1G71A 1Z5AA 3GLGE 3CF2A 1DO2A 2FH0A 4DV1M 3LCVB 2JXNA 3T6PA 4GKKM 1HT1E 4PT5A 1Q3BA 3GO8A 3B89A 1TF0B 2V1UA 1SG9A 4QNRA 5E26A 2D7GA 3U6OA 4GHLA 1QDRA 1HJPA 2B3TA 2QSFX 1N77A 3DA1A 4JI8M 2DHRA 4YHHM 3Q8XA 1IN5A 3GP1A 2QHOB 2C98A 3BXWA 1I94M 1TDHA 3J2PB 2F4VM 4F2LA 1PRBA 3QYEA 1T3TA 2L4FA 2GNOA 2FOIC 2JY8A 3AOEC 2R46A 2LH0A 3HHZA 2R62A 2CE7A 4L16A 2EO2A 4R3DA 2WSEF 2BNKA 5EXPA 1HNWM 4R71A 2F5PA 3KDSE 1R2YA 2C9OA 1XNRM 4JI2M 1Q39A 3PNYA 1PGYA 4K0KM 1K3WA 1L2DA 1N32M 5EXXA 4FD2A 1H6UA 1K82A 3KS4A 4LJ5A 3HY5A 2XZUA 2OOBA 4LFAM 4P16A 3MMPA 5ITQA 3VKHA 5L8RF 2XH9A 3FUWA 4M9XA 5KPTA 1NNUC 4CHTB 2L4EA 3J7AS 4LZZA 4XGIA 3GQ3A 1ZV1A 1IXZA 2UXCM 4B3SM 2DENA 4DV3M 3FUTA 4MH0E 1Z5CA 2R4JA 3HZJA 1A5TA 3TQSA 4DV6M 3U60A 4A3VB 5DYGA 4W5WA 4DR6M 2KEBA 3U60B 1GVNA 2WSCF 2D7HA 2V1CA 2JP7A 1GABA 5JI2E 5BPVA 2RKOA 3GLIE 4RKUF 4ZPXA 3GPUA 4DR2M 3J80S 3ZCBB 1PM5A 5EJCA 4I5SA 1NHWC 2WSFF 1I4WA 5EP4A 3U61A 1D0MA 3KFUG 5IWAM 1NVMA 5C18A
chains in the Genus database with same CATH topology
3RFWA 2XZFA 4GHAA 1QZMA 2V6ZM 1G41A 4IBKA 5ITTA 3KW6A 4G4QA 2HL7A 3HHYA 2CUZA 3GLGB 1QQWA 5EXSA 1DGHA 2BJVA 4I8OA 3SARA 4NRWA 4LJ4A 5FTJA 3GPYA 3D8BA 4DV4M 4L15A 4PDIA 3VFDA 1D2NA 4EIWA 3GLIA 3T15A 4B3RM 3U6PA 3HJSA 2XLJA 1NHGC 4MGZE 1KFVA 3NWLA 3J81S 3PFIA 5E6JA 5C1BA 5LMNM 1IQPA 3VDUA 2FE8A 3VK8A 2HCBA 3HU2A 1L2CA 1L1TA 2KZUA 1GLNA 2CV2A 3T38A 3EIEA 5DYIA 2F5OA 3AL0C 4Z8XA 3VDPA 2DWZB 4IJEA 3IG8A 3D8LA 3DZDA 1L2BA 2Z4SA 3U6SA 3VK7A 3J27B 3PNVA 1TGUA 4DV5M 3FUUA 5IZ7D 2X8AA 2H1RA 4M0WA 4R7GA 2DXIA 4DR7M 1SXJB 1R2ZA 2QENA 3VLFB 3I4VA 5KPZA 3FTFA 2CHGA 1IY0A 4HLQA 3K92A 2I7NA 3I4YA 1TDZA 5ITYA 2KXEA 3M0EA 4JI1M 1XXHB 3U6CA 1DO0A 3SAVA 2XSZD 5IT9S 3KS8A 2FFJA 3KXEC 1G4AE 2L09A 2W82A 4JI6M 2KZSA 2YNMD 3FUVA 3L2AA 2NQ8C 2M60A 2Z4RA 4AQYM 2E5LM 4AKHA 2XGNA 3BOSA 4I4LA 3EIHA 3KSXA 4AKIA 3KOYE 4WURA 2C99A 3T1HM 4MM3B 4IBBA 1R6BX 1XWIA 3TWLA 3IG5A 5FTLA 3C58A 4LF6M 4MGYE 5A2QS 1S3SA 1GL7A 1J09A 4GMQA 1J7KA 3KSJA 3UK6A 1W5TA 2VQFM 3KOWE 2JA2A 5FLXS 3FKEA 1TH3A 5JI3E 2UUBM 4JI7M 4PCZA 4X64M 3RGSA 2UUAM 1XNQM 3THGA 4M0DA 1NSFA 5ITXA 7CATA 1ZQ9A 1KYIA 4LF7M 1JQJC 2J7NA 2LNHC 1SXJD 2UUCM 3U6DA 1QVRA 1EE8A 1J5EM 2UU9M 1HT2E 4DR4M 4RF0A 2CHVA 4B7GA 1IN7A 1UM8A 2KRKA 3CF6E 1IN8A 4OU7A 3B9PA 3ZH9B 2UXDM 3FYDA 3VKGA 4D82A 3ILKA 3GPPA 1G8PA 2VIIA 4NSOB 4KODA 5EXTA 3UMMA 1E94E 2EUCA 3HU1A 3SMSA 1DGBA 1PJIA 4LF9M 4AKGA 3HHWA 4LGYA 3GQ5A 4DR5M 2DZOB 3LQQA 4BBAA 4JI5M 1HQCA 4YY3M 1N75A 4FWGA 4GKJM 4GH9A 3DFZA 3GRRA 4LZJA 4NRVA 2XFSA 1W5SA 4MB7A 1WXQA 3FTEA 4L4UA 3U5ZA 2Y20A 2L7IA 1Z5BA 4FWHA 4LJAA 3SHGB 1ZAEA 4B08A 1Z59A 4CGYB 3U5ZB 1K3XA 3A45A 3H4MA 3AOEA 4S12A 1Q3CA 3SC3A 4ITQA 3KOXE 3TPZA 1ORYB 3LVVA 3MHVC 3SBJA 2QZ4A 1NY5A 3SYKA 4AI6A 3MJ5A 2LWXA 4NL4H 2FNAA 3FYCA 3U6LA 3LQRA 1QAOA 2Z3XA 4FCTA 3ZC7B 4GC5A 2F5SA 3I51A 2EA0A 1SXJC 2M5ZA 3DOAA 1IBMM 3TWKA 1HNZM 3CTWB 2R18A 4LF4M 3AFHA 2R45A 4FVMA 1NNJA 4D81A 4DV7M 4FW9A 3FD9A 3FUXA 4QHSA 4OX9M 4LGMA 2RGHA 3SFZA 2DWMA 2KRUA 3TL4X 3UGJA 4OW0A 3GLIB 2R65A 3K1JA 5LMUM 5ITRA 3GLFA 4DUZM 2HKJA 1N36M 3AV0A 5EP2A 2AHMA 3LMMA 4G4NA 1JR3A 1YUBA 2BJWA 3U6QA 3L27A 4LRTA 4M9ZA 4GRIA 4IBIA 4IBDA 4GITA 4WW0A 5GKNA 1IM2A 4GC9A 2RGOA 3HGIA 4IBCA 3HWSA 2Z7JA 1NJFA 2QCUA 4KO8A 2J7OA 2DVWB 1QAMA 1IN4A 3SMPA 3JR5A 3GLHA 2A5YB 3GLGA 4QNMA 3TWMA 1KSFX 3AOGA 1N33M 2LXEA 5KQDA 4CISA 1HNXM 1E9SA 4L78A 4X62M 3L26A 4B7FA 4LFCM 3R9XB 2ZANA 1IY2A 3QAUA 3HU3A 2KW0A 3GQ4A 4LJ9A 4AZFA 4B3MM 1XXHA 5FTMA 4JYAM 2Y0QA 2QPAA 2UXBM 5EP1A 4FCVA 3R8FA 2R4EA 4KHPM 3TE6A 1YE9A 3MK6A 5DNYA 3JR4A 3U6EA 1IN6A 2C5RA 1QANA 3CF0A 3AJIB 4IBJA 2D7EA 2YR0A 3HKPA 3U6MA 2ZAMA 4JXJA 5KPRA 1FNNA 4NSRA 2P5TA 4DR1M 3FTCA 3QWLA 4LJ6A 1YSYA 1G3IA 4KLNA 3E9SA 1E32A 3A98B 4IBGA 4FWDA 3KP1E 3L29A 4D80A 3M6AA 4I81A 3T1YM 2YFQA 3LVWA 1Z6TA 2C96A 3PXGA 1GKIA 1NJGA 3PVSA 4PDGA 2G5GX 1IY1A 4IIWA 2CHQA 1DGHB 3K2LA 4LCBA 1C1KA 4IBEA 4RNAA 2QBYB 5EP3A 4DV0M 1N78A 2F5NA 4B3TM 1R7RA 3L25A 2G8LA 3GLFB 2OPFA 4MGIE 2DZNB 1IBLM 4REZA 4LF5M 3SASA 1X37A 3RGPA 2ZM6M 1XC8A 1SXJE 5FSWA 2ZAOA 1NY6A 1IBKM 1IXSB 2X4AA 2XF3A 4XBOA 4QHTA 4DUYM 4NOOB 4G6ZA 3KOZE 4IJFA 1LV7A 3E4RA 1TH2A 4L8RC 2C9CA 2KA6B 2X49A 1G59A 3NBIA 2XSZA 3W0LB 1TH4A 2L6OA 1PJJA 4AG6A 1DGFA 4DV2M 5KO3A 4HL4A 4JI4M 2K47A 4NXMM 2Q2EB 4IBFA 1JR3D 1SXJA 3J7BA 2Y21A 5F3WA 3SAWA 5IREB 3GRUA 4B7HA 4JV5M 3GPXA 1HQYE 4PD2A 5H37D 5ITXE 5FTKA 4QOSA 1VDDA 2Y0TA 4RF1A 3A46A 1QAQA 3A42A 3UZUA 4BB9A 4LG2A 4AW4A 5BR8M 3SYLA 3GRYA 4LFBM 1XMOM 4GIPA 1N34M 5ITUA 8CATA 1MU5A 3HJQA 2I7PA 3GRVA 2XEPA 4LY6A 1GL6A 4X66M 2DWLA 2CV1A 3RE8A 1E9RA 3M7GA 4MGKE 4II7A 2VQEM 3WHLA 2OQ4A 1MX0A 4LJ8A 4DR3M 2L7HA 4G4RA 2DWNA 4LRSA 3L28A 1XMQM 1L8QA 4MGHA 2CEAA 2ZBKB 1XHBA 4JI0M 3HJ8A 4Z6YA 4NXNM 5EQTA 3KVWA 2HHHM 3HHXA 1IXRC 1OFHA 2XFTA 2QBYA 2YQZA 4G4OA 2F5QA 3WHKA 1L1ZA 3KP0E 4TUWA 2CV0A 3FTDA 4QOZC 4JI3M 4X65M 5FTNA 3JAMS 3UJNA 1DGGA 4JN6A 4LF8M 4LJ7A 2ERCA 4BLCA 2CFOA 4OVZB 2O5RA 3SAUA 2QP9X 1OJLA 3U61B 1FJGM 3OTOM 4OVZA 1HR0M 1OFIA 4M9SA 3W0FA 1QYRA 4AG5A 3SHFA 3K8ZA 3AKZA 5KQ8A 3GLHB 3SATA 4FCWA 1Z5AA 3CF2A 1DO2A 4DV1M 4GKKM 1HT1E 4PT5A 1Q3BA 3GO8A 2V1UA 4QNRA 5E26A 2D7GA 3U6OA 4GHLA 1N77A 3DA1A 4JI8M 2DHRA 4YHHM 3Q8XA 1IN5A 3GP1A 2C98A 1I94M 1TDHA 3J2PB 2F4VM 1T3TA 2FOIC 3AOEC 2R46A 2LH0A 3HHZA 2R62A 2CE7A 4L16A 2EO2A 4R3DA 2BNKA 5EXPA 1HNWM 2F5PA 3KDSE 1R2YA 2C9OA 1XNRM 4JI2M 1Q39A 3PNYA 4K0KM 1K3WA 1L2DA 1N32M 5EXXA 4FD2A 1H6UA 1K82A 3KS4A 4LJ5A 2XZUA 4LFAM 4P16A 5ITQA 3VKHA 2XH9A 3FUWA 4M9XA 5KPTA 1NNUC 4CHTB 3J7AS 4LZZA 4XGIA 3GQ3A 2UXCM 1IXZA 4B3SM 4DV3M 3FUTA 4MH0E 1Z5CA 2R4JA 3TQSA 3U60A 4DV6M 4A3VB 5DYGA 4W5WA 4DR6M 2KEBA 3U60B 1GVNA 2D7HA 2V1CA 5JI2E 5BPVA 2RKOA 4ZPXA 3GPUA 4DR2M 3J80S 3ZCBB 1PM5A 5EJCA 4I5SA 1NHWC 5EP4A 1I4WA 3U61A 3KFUG 5IWAM 1NVMA 5C18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GQ4 A;  1EE8 A;  2XZF A;  1J5E M;  2UU9 M;  4B3M M;  4DR4 M;  4NXN M;  2HHH M;  4JYA M;  5ITT A;  2UXB M;  4G4Q A;  4KHP M;  4G4O A;  2F5Q A;  2UXD M;  1L1Z A;  3JR4 A;  3GPP A;  3U6E A;  3SAR A;  4NRW A;  3GPY A;  4JI3 M;  4X65 M;  4DV4 M;  3JAM S;  3U6M A;  4PDI A;  1PJI A;  4LF9 M;  3GQ5 A;  4DR5 M;  4B3R M;  4JI5 M;  4DR1 M;  4YY3 M;  3U6P A;  4LF8 M;  4GKJ M;  3SAU A;  1KFV A;  3J81 S;  4NRV A;  1FJG M;  3OTO M;  4MB7 A;  3T1Y M;  5LMN M;  1HR0 M;  3W0F A;  3VK8 A;  4PDG A;  1L2C A;  1L1T A;  1Z5B A;  3SAT A;  4DV0 M;  2F5O A;  1Z59 A;  1K3X A;  1Z5A A;  3A45 A;  2F5N A;  4B3T M;  4DV1 M;  4GKK M;  1Q3C A;  4ITQ A;  1Q3B A;  3GO8 A;  1L2B A;  3U6S A;  3VK7 A;  3SBJ A;  2OPF A;  3U6O A;  4DV5 M;  1IBL M;  4LF5 M;  3SAS A;  4JI8 M;  4YHH M;  2ZM6 M;  3U6L A;  1XC8 A;  3GP1 A;  4DR7 M;  1R2Z A;  1I94 M;  1TDH A;  2F4V M;  1IBK M;  2F5S A;  2EA0 A;  1TDZ A;  5ITY A;  4DUY M;  3DOA A;  1IBM M;  4JI1 M;  3TWK A;  3U6C A;  3SAV A;  5IT9 S;  1HNZ M;  1HNW M;  4LF4 M;  2F5P A;  4JI6 M;  1R2Y A;  1NNJ A;  4DV7 M;  1XNR M;  1PJJ A;  4JI2 M;  1Q39 A;  4OX9 M;  4K0K M;  1K3W A;  4DV2 M;  1L2D A;  4JI4 M;  1N32 M;  4AQY M;  2E5L M;  4NXM M;  5LMU M;  2Q2E B;  1K82 A;  5ITR A;  4DUZ M;  2HKJ A;  1N36 M;  2XZU A;  4LFA M;  3SAW A;  4JV5 M;  3U6D A;  3T1H M;  3GPX A;  5ITQ A;  4G4N A;  4PD2 A;  3TWL A;  3C58 A;  4LF6 M;  5ITX E;  3U6Q A;  5A2Q S;  3A46 A;  3J7A S;  3A42 A;  2UXC M;  3GQ3 A;  5BR8 M;  4B3S M;  4DV3 M;  4LFB M;  1XMO M;  1N34 M;  2VQF M;  5ITU A;  1Z5C A;  1MU5 A;  4DV6 M;  3JR5 A;  5FLX S;  4X66 M;  4JI7 M;  2UUB M;  4DR6 M;  4PCZ A;  4X64 M;  3TWM A;  2UUA M;  2VQE M;  1XNQ M;  2OQ4 A;  1MX0 A;  5ITX A;  4DR3 M;  1N33 M;  4CIS A;  1HNX M;  4G4R A;  3GPU A;  4DR2 M;  4X62 M;  4LF7 M;  3J80 S;  1XMQ M;  1PM5 A;  4LFC M;  2UUC M;  5IWA M;  2ZBK B;  4JI0 M; 
#chains in the Genus database with same CATH topology
 2JY6 B;  3RFW A;  2XZF A;  4GHA A;  1QZM A;  2V6Z M;  1G41 A;  4IBK A;  5ITT A;  3KW6 A;  2DNA A;  4G4Q A;  2HL7 A;  3HHY A;  3B74 A;  2CUZ A;  2LTU A;  2JZ1 A;  2EKF A;  3GLG B;  1QQW A;  5EXS A;  1DGH A;  1C7Y A;  2BJV A;  4I8O A;  3SAR A;  4NRW A;  4LJ4 A;  5FTJ A;  3GPY A;  3D8B A;  4DV4 M;  4L15 A;  4PDI A;  3VFD A;  1D2N A;  2GQF A;  4EIW A;  2VF7 A;  3GLI A;  3T15 A;  4B3R M;  3U6P A;  3HJS A;  2XLJ A;  1V92 A;  1NHG C;  1PJQ A;  4MGZ E;  1KFV A;  3NWL A;  4L6V 6;  3E46 A;  3J81 S;  2J5Y A;  2KNA A;  3PFI A;  3LW5 F;  5E6J A;  5C1B A;  5LMN M;  1IQP A;  2LHC A;  1AIP C;  2N35 A;  1PJS A;  2FE8 A;  3C3E A;  3VDU A;  3VK8 A;  1EIJ A;  2HCB A;  1PJT A;  2QQ8 A;  3HU2 A;  2KZU A;  1L1T A;  1L2C A;  1GLN A;  2CV2 A;  3T38 A;  3EIE A;  5DYI A;  2F5O A;  3AL0 C;  4Z8X A;  1OIZ A;  3VDP A;  2DZL A;  2DWZ B;  2CP8 A;  4IJE A;  2OOA A;  4P17 A;  3IG8 A;  3D8L A;  3DZD A;  4Y28 F;  3GLF E;  1L2B A;  2Z4S A;  3U6S A;  3VK7 A;  3J27 B;  3PNV A;  1TGU A;  2LHG A;  4DV5 M;  2DAI A;  3FUU A;  5IZ7 D;  2X8A A;  2H1R A;  2ZTD A;  4M0W A;  4R7G A;  2DXI A;  4DR7 M;  1P3Q Q;  1SXJ B;  1R2Z A;  2QEN A;  3VLF B;  2JY7 A;  3I4V A;  5KPZ A;  2CHG A;  1IY0 A;  4HLQ A;  3FTF A;  3K92 A;  2I7N A;  3I4Y A;  1TDZ A;  1OAO C;  5ITY A;  2KXE A;  1NV9 A;  3M0E A;  4JI1 M;  1XXH B;  3U6C A;  1DO0 A;  3SAV A;  2XSZ D;  5IT9 S;  3KS8 A;  2FFJ A;  3KXE C;  1G4A E;  2L09 A;  2W82 A;  4JI6 M;  2KZS A;  2YNM D;  3FUV A;  2KNZ A;  3L2A A;  4XK8 F;  2G3Q A;  2NQ8 C;  2M60 A;  2Z4R A;  3C9P A;  4AQY M;  2E5L M;  4AKH A;  2XGN A;  1LTM A;  3BOS A;  4I4L A;  3EIH A;  3KSX A;  1XXH E;  4AKI A;  3KOY E;  4WUR A;  2MR9 A;  2C99 A;  3T1H M;  4MM3 B;  4IBB A;  2DHY A;  1R6B X;  1XWI A;  1OKS A;  3TWL A;  2KNV A;  3IG5 A;  5FTL A;  2DAG A;  3C58 A;  2DAE A;  3I04 M;  4MGY E;  1S3S A;  4ANR A;  5A2Q S;  1GL7 A;  1J09 A;  4GMQ A;  1J7K A;  3IEC A;  3KSJ A;  3UK6 A;  1W5T A;  2VQF M;  1QUT A;  2JA2 A;  3KOW E;  5FLX S;  4LF6 M;  3FKE A;  1TH3 A;  5JI3 E;  2UUB M;  3W67 A;  4JI7 M;  4PCZ A;  4X64 M;  3RGS A;  2UUA M;  1XNQ M;  3THG A;  4M0D A;  1NSF A;  4NC6 A;  5ITX A;  7CAT A;  1ZQ9 A;  1KYI A;  1TR8 A;  4LF7 M;  2KDL A;  1JQJ C;  2J7N A;  2LNH C;  1SXJ D;  2UUC M;  2RRU A;  3U6D A;  1QVR A;  4DBG B;  1EE8 A;  1J5E M;  2UU9 M;  1WIV A;  1HT2 E;  4DR4 M;  4RF0 A;  2CHV A;  4B7G A;  1IN7 A;  1NO1 A;  1RU3 A;  1UM8 A;  2KRK A;  3CF6 E;  1IN8 A;  4OU7 A;  3B9P A;  1Y8G A;  1ZMV A;  4G3O A;  3ZH9 B;  4F1I A;  2UXD M;  3FYD A;  2EKK A;  3VKG A;  4D82 A;  3ILK A;  3GPP A;  3I01 M;  3IHP A;  1G8P A;  2VII A;  4NSO B;  4KOD A;  5EXT A;  3UMM A;  1E94 E;  2EUC A;  3HU1 A;  3SMS A;  1DGB A;  1PJI A;  4LF9 M;  4AKG A;  3HHW A;  4LGY A;  3GQ5 A;  4DR5 M;  2DZO B;  3FRI A;  3LQQ A;  4BBA A;  4JI5 M;  1HQC A;  4YY3 M;  1N75 A;  4FWG A;  4GKJ M;  4GH9 A;  2K6B A;  3DFZ A;  3GRR A;  4LZJ A;  4NRV A;  2XFS A;  1W5S A;  4MB7 A;  1WXQ A;  3FTE A;  4L4U A;  2MGW A;  1EFU B;  3U5Z A;  2Y20 A;  2L7I A;  1Z5B A;  4FWH A;  4LJA A;  3SHG B;  1ZAE A;  4B08 A;  1Z59 A;  4CGY B;  3F92 A;  2FS1 A;  3U5Z B;  3A45 A;  3GLH E;  1K3X A;  3H4M A;  3K9O A;  3AOE A;  4S12 A;  1Q3C A;  3SC3 A;  4ITQ A;  3KOX E;  3TPZ A;  1ORY B;  3LVV A;  3MHV C;  3SBJ A;  2QZ4 A;  1NY5 A;  3SYK A;  4AI6 A;  1QUS A;  2LWX A;  3MJ5 A;  4NL4 H;  2DAK A;  2FNA A;  2LVA A;  3FYC A;  3U6L A;  3LQR A;  1QAO A;  2Z3X A;  4FCT A;  3ZC7 B;  2JZ0 A;  4GC5 A;  2F5S A;  3I51 A;  2EA0 A;  1SXJ C;  2M5Z A;  3DOA A;  2ZTC A;  1IBM M;  3TWK A;  1HNZ M;  3CTW B;  2R18 A;  2JUJ A;  4LF4 M;  3AFH A;  2R45 A;  4FVM A;  1NNJ A;  4D81 A;  1Q02 A;  4FW9 A;  2CWB A;  3FD9 A;  4DV7 M;  3FUX A;  4QHS A;  4OX9 M;  1OQY A;  4LGM A;  2DAM A;  2RGH A;  3SFZ A;  2DWM A;  2KRU A;  3TL4 X;  3UGJ A;  4OW0 A;  3GLI B;  2R65 A;  1D0L A;  3K1J A;  3QYB A;  4HEO A;  1VG5 A;  5LMU M;  2R0I A;  5ITR A;  3GLF A;  4DUZ M;  2HKJ A;  1N36 M;  3AV0 A;  2EJS A;  5EP2 A;  2AHM A;  3K9P A;  2BWE A;  3LMM A;  4G4N A;  1JR3 A;  1YUB A;  2BJW A;  3U6Q A;  3L27 A;  4LRT A;  4M9Z A;  4GRI A;  4IBI A;  4IBD A;  4GIT A;  4WW0 A;  1VEG A;  5GKN A;  1T43 A;  1IM2 A;  3ZQJ A;  1DV0 A;  4GC9 A;  2RGO A;  3HGI A;  4IBC A;  3HWS A;  2Z7J A;  1R4G A;  1NJF A;  1VEJ A;  2QCU A;  4KO8 A;  2J7O A;  2DVW B;  1QAM A;  1IN4 A;  2MRO B;  3SMP A;  3JR5 A;  3B7N A;  2A5Y B;  3GLH A;  3GLG A;  2H5X A;  4QNM A;  3TWM A;  3FRH A;  1KSF X;  2R44 A;  3AOG A;  1GJS A;  1N33 M;  2LXE A;  5KQD A;  4CIS A;  1HNX M;  3Q8G A;  1E9S A;  4UN2 B;  4L78 A;  1NV8 A;  4X62 M;  3L26 A;  4B7F A;  3FE3 A;  2CRU A;  4LFC M;  3R9X B;  2ZAN A;  1IY2 A;  3HU3 A;  3QAU A;  2KW0 A;  3GQ4 A;  1MJG M;  4LJ9 A;  4AZF A;  4B3M M;  5DFL A;  3NBX X;  1XXH A;  5FTM A;  4JYA M;  2Y0Q A;  2QPA A;  2UXB M;  5EP1 A;  4FCV A;  3R8F A;  2R4E A;  4KHP M;  1BVS A;  3LCU A;  3H4J A;  3TE6 A;  1YE9 A;  3MK6 A;  5DNY A;  3JR4 A;  3U6E A;  1IN6 A;  2HWJ A;  2C5R A;  1QAN A;  3CF0 A;  1V33 A;  3AJI B;  4IBJ A;  2D7E A;  2YR0 A;  3HKP A;  3U6M A;  1UFZ A;  2ZAM A;  1ZMW A;  2LVO C;  4JXJ A;  5KPR A;  1FNN A;  4NSR A;  2P5T A;  4DR1 M;  3FTC A;  3QWL A;  4LJ6 A;  1YSY A;  1G3I A;  2JY5 A;  3E9S A;  4KLN A;  1E32 A;  3A98 B;  4IBG A;  3B7Q A;  2DKL A;  4FWD A;  3KP1 E;  3L29 A;  4D80 A;  3M6A A;  4I81 A;  3T1Y M;  2YFQ A;  3LVW A;  1Z6T A;  2C96 A;  3PXG A;  2QNJ A;  1GKI A;  1NJG A;  1YLA A;  3PVS A;  4PDG A;  2G5G X;  1IY1 A;  4IIW A;  2CHQ A;  1DGH B;  3K2L A;  4LCB A;  1C1K A;  4IBE A;  4RNA A;  3HX3 A;  5EP3 A;  4DV0 M;  1N78 A;  1WHC A;  3V76 A;  2F5N A;  2O25 A;  2QBY B;  4B3T M;  1XB2 B;  1GJT A;  1R7R A;  2JNH A;  3L25 A;  1VQ1 A;  2G8L A;  2O01 F;  3GLF B;  2OPF A;  4MGI E;  2R6F A;  2DZN B;  2WZJ A;  4CIZ A;  1IBL M;  4REZ A;  4LF5 M;  3SAS A;  1X37 A;  3RGP A;  2LVN C;  3CGW A;  2ZM6 M;  1SXJ E;  5FSW A;  1IXS A;  1XC8 A;  2ZAO A;  1NY6 A;  2JWS A;  1MN3 A;  1IBK M;  1IXS B;  2X4A A;  2XF3 A;  2LVP C;  4XBO A;  4QHT A;  4DUY M;  4NOO B;  4G6Z A;  3KOZ E;  4IJF A;  2MH8 A;  1LV7 A;  3E4R A;  1TH2 A;  4L8R C;  2C9C A;  2KA6 B;  2X49 A;  1G59 A;  3NBI A;  2XSZ A;  3W0L B;  1TH4 A;  1VEK A;  2L6O A;  4GEW A;  4AG6 A;  1PJJ A;  1DGF A;  4DV2 M;  3C3D A;  5KO3 A;  4HL4 A;  2BWB A;  4Q7J A;  2K47 A;  4JI4 M;  2DI0 A;  4NXM M;  2VF8 A;  3BBZ A;  2Q2E B;  4IBF A;  1JR3 D;  1SXJ A;  3J7B A;  2Y21 A;  5F3W A;  3SAW A;  5IRE B;  3GRU A;  4B7H A;  4JV5 M;  3GPX A;  1HQY E;  4PD2 A;  2Z8Y M;  5H37 D;  3E21 A;  5ITX E;  2APL A;  5FTK A;  4QOS A;  1WR1 B;  1VDD A;  2Y0T A;  4RF1 A;  3A46 A;  1QAQ A;  2LVQ D;  3A42 A;  3UZU A;  4BB9 A;  2K0B X;  2MJ5 B;  4AW4 A;  5BR8 M;  3SYL A;  4LG2 A;  3GRY A;  4LFB M;  1XMO M;  4GIP A;  1N34 M;  5ITU A;  1JR3 E;  8CAT A;  2LBC A;  1MU5 A;  3HJQ A;  2I7P A;  3GRV A;  2XEP A;  4LY6 A;  1GL6 A;  4X66 M;  2DWL A;  2CV1 A;  1AUA A;  3RE8 A;  2KHH A;  1E9R A;  3M7G A;  1CUK A;  4II7 A;  4MGK E;  2VQE M;  3WHL A;  2OQ4 A;  1MX0 A;  1VDL A;  4LJ8 A;  4DR3 M;  2L7H A;  4G4R A;  2DWN A;  1OTR A;  4LRS A;  2L2D A;  4WP2 A;  3L28 A;  1F4I A;  1XMQ M;  1L8Q A;  4MGH A;  2CEA A;  2K9D A;  1XHB A;  1WJ7 A;  2ZBK B;  4JI0 M;  3HJ8 A;  1D0K A;  1R5L A;  4Z6Y A;  4NXN M;  5EQT A;  4CJ6 A;  3KVW A;  2HHH M;  3HHX A;  1IXR C;  1OFH A;  2XFT A;  2QBY A;  2YQZ A;  4G4O A;  2F5Q A;  3WHK A;  1JB0 F;  1WGN A;  1L1Z A;  3KP0 E;  4TUW A;  1V34 A;  1IFY A;  2VDB B;  3FTD A;  2CV0 A;  1OIP A;  4QOZ C;  4JI3 M;  4X65 M;  5FTN A;  1QDT A;  3W68 A;  3JAM S;  3UJN A;  1DGG A;  4JN6 A;  1T6O A;  4LF8 M;  4LJ7 A;  1GO5 A;  2ERC A;  1ZMU A;  2CFO A;  4BLC A;  4OVZ B;  2O5R A;  3SAU A;  2QP9 X;  1OJL A;  4KT0 F;  3U61 B;  1FJG M;  3OTO M;  4OVZ A;  1HR0 M;  1OFI A;  4M9S A;  3W0F A;  3B7Z A;  1QYR A;  1QZE A;  2HAK A;  4AG5 A;  2OO9 A;  3SHF A;  1WGL A;  3K8Z A;  3AKZ A;  1OAI A;  5KQ8 A;  3GLH B;  3SAT A;  1TTE A;  4FCW A;  1G71 A;  1Z5A A;  3GLG E;  3CF2 A;  1DO2 A;  2FH0 A;  4DV1 M;  3LCV B;  2JXN A;  3T6P A;  4GKK M;  1HT1 E;  4PT5 A;  1Q3B A;  3GO8 A;  3B89 A;  1TF0 B;  2V1U A;  1SG9 A;  4QNR A;  5E26 A;  2D7G A;  3U6O A;  4GHL A;  1QDR A;  1HJP A;  2B3T A;  2QSF X;  1N77 A;  3DA1 A;  4JI8 M;  2DHR A;  4YHH M;  3Q8X A;  1IN5 A;  3GP1 A;  2QHO B;  2C98 A;  3BXW A;  1I94 M;  1TDH A;  3J2P B;  2F4V M;  4F2L A;  1PRB A;  3QYE A;  1T3T A;  2L4F A;  2GNO A;  2FOI C;  2JY8 A;  3AOE C;  2R46 A;  2LH0 A;  3HHZ A;  2R62 A;  2CE7 A;  4L16 A;  2EO2 A;  4R3D A;  2WSE F;  2BNK A;  5EXP A;  1HNW M;  4R71 A;  2F5P A;  3KDS E;  1R2Y A;  2C9O A;  1XNR M;  4JI2 M;  1Q39 A;  3PNY A;  1PGY A;  4K0K M;  1K3W A;  1L2D A;  1N32 M;  5EXX A;  4FD2 A;  1H6U A;  1K82 A;  3KS4 A;  4LJ5 A;  3HY5 A;  2XZU A;  2OOB A;  4LFA M;  4P16 A;  3MMP A;  5ITQ A;  3VKH A;  5L8R F;  2XH9 A;  3FUW A;  4M9X A;  5KPT A;  1NNU C;  4CHT B;  2L4E A;  3J7A S;  4LZZ A;  4XGI A;  3GQ3 A;  1ZV1 A;  1IXZ A;  2UXC M;  4B3S M;  2DEN A;  4DV3 M;  3FUT A;  4MH0 E;  1Z5C A;  2R4J A;  3HZJ A;  1A5T A;  3TQS A;  4DV6 M;  3U60 A;  4A3V B;  5DYG A;  4W5W A;  4DR6 M;  2KEB A;  3U60 B;  1GVN A;  2WSC F;  2D7H A;  2V1C A;  2JP7 A;  1GAB A;  5JI2 E;  5BPV A;  2RKO A;  3GLI E;  4RKU F;  4ZPX A;  3GPU A;  4DR2 M;  3J80 S;  3ZCB B;  1PM5 A;  5EJC A;  4I5S A;  1NHW C;  2WSF F;  1I4W A;  5EP4 A;  3U61 A;  1D0M A;  3KFU G;  5IWA M;  1NVM A;  5C18 A; 
#chains in the Genus database with same CATH homology
 3RFW A;  2XZF A;  4GHA A;  1QZM A;  2V6Z M;  1G41 A;  4IBK A;  5ITT A;  3KW6 A;  4G4Q A;  2HL7 A;  3HHY A;  2CUZ A;  3GLG B;  1QQW A;  5EXS A;  1DGH A;  2BJV A;  4I8O A;  3SAR A;  4NRW A;  4LJ4 A;  5FTJ A;  3GPY A;  3D8B A;  4DV4 M;  4L15 A;  4PDI A;  3VFD A;  1D2N A;  4EIW A;  3GLI A;  3T15 A;  4B3R M;  3U6P A;  3HJS A;  2XLJ A;  1NHG C;  4MGZ E;  1KFV A;  3NWL A;  3J81 S;  3PFI A;  5E6J A;  5C1B A;  5LMN M;  1IQP A;  3VDU A;  2FE8 A;  3VK8 A;  2HCB A;  3HU2 A;  1L2C A;  1L1T A;  2KZU A;  1GLN A;  2CV2 A;  3T38 A;  3EIE A;  5DYI A;  2F5O A;  3AL0 C;  4Z8X A;  3VDP A;  2DWZ B;  4IJE A;  3IG8 A;  3D8L A;  3DZD A;  1L2B A;  2Z4S A;  3U6S A;  3VK7 A;  3J27 B;  3PNV A;  1TGU A;  4DV5 M;  3FUU A;  5IZ7 D;  2X8A A;  2H1R A;  4M0W A;  4R7G A;  2DXI A;  4DR7 M;  1SXJ B;  1R2Z A;  2QEN A;  3VLF B;  3I4V A;  5KPZ A;  3FTF A;  2CHG A;  1IY0 A;  4HLQ A;  3K92 A;  2I7N A;  3I4Y A;  1TDZ A;  5ITY A;  2KXE A;  3M0E A;  4JI1 M;  1XXH B;  3U6C A;  1DO0 A;  3SAV A;  2XSZ D;  5IT9 S;  3KS8 A;  2FFJ A;  3KXE C;  1G4A E;  2L09 A;  2W82 A;  4JI6 M;  2KZS A;  2YNM D;  3FUV A;  3L2A A;  2NQ8 C;  2M60 A;  2Z4R A;  4AQY M;  2E5L M;  4AKH A;  2XGN A;  3BOS A;  4I4L A;  3EIH A;  3KSX A;  4AKI A;  3KOY E;  4WUR A;  2C99 A;  3T1H M;  4MM3 B;  4IBB A;  1R6B X;  1XWI A;  3TWL A;  3IG5 A;  5FTL A;  3C58 A;  4LF6 M;  4MGY E;  5A2Q S;  1S3S A;  1GL7 A;  1J09 A;  4GMQ A;  1J7K A;  3KSJ A;  3UK6 A;  1W5T A;  2VQF M;  3KOW E;  2JA2 A;  5FLX S;  3FKE A;  1TH3 A;  5JI3 E;  2UUB M;  4JI7 M;  4PCZ A;  4X64 M;  3RGS A;  2UUA M;  1XNQ M;  3THG A;  4M0D A;  1NSF A;  5ITX A;  7CAT A;  1ZQ9 A;  1KYI A;  4LF7 M;  1JQJ C;  2J7N A;  2LNH C;  1SXJ D;  2UUC M;  3U6D A;  1QVR A;  1EE8 A;  1J5E M;  2UU9 M;  1HT2 E;  4DR4 M;  4RF0 A;  2CHV A;  4B7G A;  1IN7 A;  1UM8 A;  2KRK A;  3CF6 E;  1IN8 A;  4OU7 A;  3B9P A;  3ZH9 B;  2UXD M;  3FYD A;  3VKG A;  4D82 A;  3ILK A;  3GPP A;  1G8P A;  2VII A;  4NSO B;  4KOD A;  5EXT A;  3UMM A;  1E94 E;  2EUC A;  3HU1 A;  3SMS A;  1DGB A;  1PJI A;  4LF9 M;  4AKG A;  3HHW A;  4LGY A;  3GQ5 A;  4DR5 M;  2DZO B;  3LQQ A;  4BBA A;  4JI5 M;  1HQC A;  4YY3 M;  1N75 A;  4FWG A;  4GKJ M;  4GH9 A;  3DFZ A;  3GRR A;  4LZJ A;  4NRV A;  2XFS A;  1W5S A;  4MB7 A;  1WXQ A;  3FTE A;  4L4U A;  3U5Z A;  2Y20 A;  2L7I A;  1Z5B A;  4FWH A;  4LJA A;  3SHG B;  1ZAE A;  4B08 A;  1Z59 A;  4CGY B;  3U5Z B;  1K3X A;  3A45 A;  3H4M A;  3AOE A;  4S12 A;  1Q3C A;  3SC3 A;  4ITQ A;  3KOX E;  3TPZ A;  1ORY B;  3LVV A;  3MHV C;  3SBJ A;  2QZ4 A;  1NY5 A;  3SYK A;  4AI6 A;  3MJ5 A;  2LWX A;  4NL4 H;  2FNA A;  3FYC A;  3U6L A;  3LQR A;  1QAO A;  2Z3X A;  4FCT A;  3ZC7 B;  4GC5 A;  2F5S A;  3I51 A;  2EA0 A;  1SXJ C;  2M5Z A;  3DOA A;  1IBM M;  3TWK A;  1HNZ M;  3CTW B;  2R18 A;  4LF4 M;  3AFH A;  2R45 A;  4FVM A;  1NNJ A;  4D81 A;  4DV7 M;  4FW9 A;  3FD9 A;  3FUX A;  4QHS A;  4OX9 M;  4LGM A;  2RGH A;  3SFZ A;  2DWM A;  2KRU A;  3TL4 X;  3UGJ A;  4OW0 A;  3GLI B;  2R65 A;  3K1J A;  5LMU M;  5ITR A;  3GLF A;  4DUZ M;  2HKJ A;  1N36 M;  3AV0 A;  5EP2 A;  2AHM A;  3LMM A;  4G4N A;  1JR3 A;  1YUB A;  2BJW A;  3U6Q A;  3L27 A;  4LRT A;  4M9Z A;  4GRI A;  4IBI A;  4IBD A;  4GIT A;  4WW0 A;  5GKN A;  1IM2 A;  4GC9 A;  2RGO A;  3HGI A;  4IBC A;  3HWS A;  2Z7J A;  1NJF A;  2QCU A;  4KO8 A;  2J7O A;  2DVW B;  1QAM A;  1IN4 A;  3SMP A;  3JR5 A;  3GLH A;  2A5Y B;  3GLG A;  4QNM A;  3TWM A;  1KSF X;  3AOG A;  1N33 M;  2LXE A;  5KQD A;  4CIS A;  1HNX M;  1E9S A;  4L78 A;  4X62 M;  3L26 A;  4B7F A;  4LFC M;  3R9X B;  2ZAN A;  1IY2 A;  3QAU A;  3HU3 A;  2KW0 A;  3GQ4 A;  4LJ9 A;  4AZF A;  4B3M M;  1XXH A;  5FTM A;  4JYA M;  2Y0Q A;  2QPA A;  2UXB M;  5EP1 A;  4FCV A;  3R8F A;  2R4E A;  4KHP M;  3TE6 A;  1YE9 A;  3MK6 A;  5DNY A;  3JR4 A;  3U6E A;  1IN6 A;  2C5R A;  1QAN A;  3CF0 A;  3AJI B;  4IBJ A;  2D7E A;  2YR0 A;  3HKP A;  3U6M A;  2ZAM A;  4JXJ A;  5KPR A;  1FNN A;  4NSR A;  2P5T A;  4DR1 M;  3FTC A;  3QWL A;  4LJ6 A;  1YSY A;  1G3I A;  4KLN A;  3E9S A;  1E32 A;  3A98 B;  4IBG A;  4FWD A;  3KP1 E;  3L29 A;  4D80 A;  3M6A A;  4I81 A;  3T1Y M;  2YFQ A;  3LVW A;  1Z6T A;  2C96 A;  3PXG A;  1GKI A;  1NJG A;  3PVS A;  4PDG A;  2G5G X;  1IY1 A;  4IIW A;  2CHQ A;  1DGH B;  3K2L A;  4LCB A;  1C1K A;  4IBE A;  4RNA A;  2QBY B;  5EP3 A;  4DV0 M;  1N78 A;  2F5N A;  4B3T M;  1R7R A;  3L25 A;  2G8L A;  3GLF B;  2OPF A;  4MGI E;  2DZN B;  1IBL M;  4REZ A;  4LF5 M;  3SAS A;  1X37 A;  3RGP A;  2ZM6 M;  1XC8 A;  1SXJ E;  5FSW A;  2ZAO A;  1NY6 A;  1IBK M;  1IXS B;  2X4A A;  2XF3 A;  4XBO A;  4QHT A;  4DUY M;  4NOO B;  4G6Z A;  3KOZ E;  4IJF A;  1LV7 A;  3E4R A;  1TH2 A;  4L8R C;  2C9C A;  2KA6 B;  2X49 A;  1G59 A;  3NBI A;  2XSZ A;  3W0L B;  1TH4 A;  2L6O A;  1PJJ A;  4AG6 A;  1DGF A;  4DV2 M;  5KO3 A;  4HL4 A;  4JI4 M;  2K47 A;  4NXM M;  2Q2E B;  4IBF A;  1JR3 D;  1SXJ A;  3J7B A;  2Y21 A;  5F3W A;  3SAW A;  5IRE B;  3GRU A;  4B7H A;  4JV5 M;  3GPX A;  1HQY E;  4PD2 A;  5H37 D;  5ITX E;  5FTK A;  4QOS A;  1VDD A;  2Y0T A;  4RF1 A;  3A46 A;  1QAQ A;  3A42 A;  3UZU A;  4BB9 A;  4LG2 A;  4AW4 A;  5BR8 M;  3SYL A;  3GRY A;  4LFB M;  1XMO M;  4GIP A;  1N34 M;  5ITU A;  8CAT A;  1MU5 A;  3HJQ A;  2I7P A;  3GRV A;  2XEP A;  4LY6 A;  1GL6 A;  4X66 M;  2DWL A;  2CV1 A;  3RE8 A;  1E9R A;  3M7G A;  4MGK E;  4II7 A;  2VQE M;  3WHL A;  2OQ4 A;  1MX0 A;  4LJ8 A;  4DR3 M;  2L7H A;  4G4R A;  2DWN A;  4LRS A;  3L28 A;  1XMQ M;  1L8Q A;  4MGH A;  2CEA A;  2ZBK B;  1XHB A;  4JI0 M;  3HJ8 A;  4Z6Y A;  4NXN M;  5EQT A;  3KVW A;  2HHH M;  3HHX A;  1IXR C;  1OFH A;  2XFT A;  2QBY A;  2YQZ A;  4G4O A;  2F5Q A;  3WHK A;  1L1Z A;  3KP0 E;  4TUW A;  2CV0 A;  3FTD A;  4QOZ C;  4JI3 M;  4X65 M;  5FTN A;  3JAM S;  3UJN A;  1DGG A;  4JN6 A;  4LF8 M;  4LJ7 A;  2ERC A;  4BLC A;  2CFO A;  4OVZ B;  2O5R A;  3SAU A;  2QP9 X;  1OJL A;  3U61 B;  1FJG M;  3OTO M;  4OVZ A;  1HR0 M;  1OFI A;  4M9S A;  3W0F A;  1QYR A;  4AG5 A;  3SHF A;  3K8Z A;  3AKZ A;  5KQ8 A;  3GLH B;  3SAT A;  4FCW A;  1Z5A A;  3CF2 A;  1DO2 A;  4DV1 M;  4GKK M;  1HT1 E;  4PT5 A;  1Q3B A;  3GO8 A;  2V1U A;  4QNR A;  5E26 A;  2D7G A;  3U6O A;  4GHL A;  1N77 A;  3DA1 A;  4JI8 M;  2DHR A;  4YHH M;  3Q8X A;  1IN5 A;  3GP1 A;  2C98 A;  1I94 M;  1TDH A;  3J2P B;  2F4V M;  1T3T A;  2FOI C;  3AOE C;  2R46 A;  2LH0 A;  3HHZ A;  2R62 A;  2CE7 A;  4L16 A;  2EO2 A;  4R3D A;  2BNK A;  5EXP A;  1HNW M;  2F5P A;  3KDS E;  1R2Y A;  2C9O A;  1XNR M;  4JI2 M;  1Q39 A;  3PNY A;  4K0K M;  1K3W A;  1L2D A;  1N32 M;  5EXX A;  4FD2 A;  1H6U A;  1K82 A;  3KS4 A;  4LJ5 A;  2XZU A;  4LFA M;  4P16 A;  5ITQ A;  3VKH A;  2XH9 A;  3FUW A;  4M9X A;  5KPT A;  1NNU C;  4CHT B;  3J7A S;  4LZZ A;  4XGI A;  3GQ3 A;  2UXC M;  1IXZ A;  4B3S M;  4DV3 M;  3FUT A;  4MH0 E;  1Z5C A;  2R4J A;  3TQS A;  3U60 A;  4DV6 M;  4A3V B;  5DYG A;  4W5W A;  4DR6 M;  2KEB A;  3U60 B;  1GVN A;  2D7H A;  2V1C A;  5JI2 E;  5BPV A;  2RKO A;  4ZPX A;  3GPU A;  4DR2 M;  3J80 S;  3ZCB B;  1PM5 A;  5EJC A;  4I5S A;  1NHW C;  5EP4 A;  1I4W A;  3U61 A;  3KFU G;  5IWA M;  1NVM A;  5C18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...