4JI4O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4ji4O00
4AQYO 5FLXN 1DK1A 1FYJA 2Z0AA 4JI6O 1HNZO 1N33O 3R66A 4DV0O 2AGAA 2FKXA 1HNXO 2ZM6O 1J5EO 2UUAO 4DV5O 5BY1A 4X65O 4DR3O 1R6TA 2UUCO 4B3MO 4DV2O 3OTOO 2N74A 3O65A 4OX9O 5IWAO 4LF4O 3T1YO 1IBMO 4OPHA 4DR7O 2UXBO 4YHHO 2F4VO 4NXMO 3JAMN 2UUBO 4X62O 2VQEO 5BXZA 4GKJO 1NS1A 4JI3O 1AB3A 4DUYO 3M8AA 1XMQO 1AILA 2UU9O 1N34O 1XEQA 4KHPO 4GKKO 4JI1O 4JI7O 4DV1O 1F7YA 4LF5O 1FKAO 1I94O 5IT9N 4DR1O 1R1BA 5LL6Y 1YZBA 1N32O 1HR0O 2ZKOA 1D2DA 4LFBO 2DJVA 4LFAO 3F5TA 2JRIA 2DOSA 1XNRO 5A2QN 4OPAA 4DV3O 3J81N 5LMNO 4LFCO 4JI8O 4JI0O 4DR6O 4DR5O 4B3SO 4K0KO 4LF8O 4LF7O 1XMOO 1IBKO 4JI2O 4DV4O 5LMUO 5H5NA 2VQFO 2UXCO 4JV5O 5BR8O 4JYAO 1IBLO 4YY3O 4B3RO 4X64O 4DR2O 1X59A 1KUQA 4LF9O 4LF6O 1G1XB 4X66O 2E5LO 1A32A 4DV7O 4DR4O 1XNQO 4DUZO 2UXDO 3RT3C 3SDLA 4A5UB 3T1HO 4JI5O 4NXNO 2LW7A 4B3TO 3J80N 4DV6O 4JI4O 1N36O 2HHHO 1HNWO 1FJGO 3J7AU
chains in the Genus database with same CATH superfamily
1P7BA 2EIMB 5CN0A 3MHHC 2KKWA 1YSCA 2AXTZ 3B8NA 4ABMA 4E2LA 2Q7GA 2BTQB 1OCCB 1RM1B 4FLWA 2QKSA 3LSQA 1GRJA 4IHJA 3ABTA 2N74A 4PDLA 2OTJV 4NKGB 2Y4UA 2P4VA 1GK9A 4GYCB 1NBMG 1VF6A 3E8HA 5IWAB 4MVQA 4DR1B 3K04A 4JYYA 3A0BZ 2QM4A 1RSOA 4DK1A 4IIJA 5J2TB 3RWRD 3SJCC 3AG1B 4O2BB 2ZE8A 2NLJC 4MTXA 4FFKA 2PI4A 1JOYA 2F4VB 4K0KB 1Q81W 3X2QB 2B1IA 1S77D 2IJKA 1SA0A 3F5TA 4JZ2A 4U3JA 2HVJC 1VQNV 4I5SA 5CBHA 4JI3B 2X0LA 5JVDA 3AG1C 4BW5A 2BCCH 3FAVA 3H1JH 2YICA 2P06A 4OGQB 3IAYA 1IBKO 4ZHQB 4JI4B 1MNGA 4O4LB 2EULA 2F66C 1MZEA 4UVCA 4PJ0Z 4QE7A 1KD1W 5B1AC 1PL0A 1M57B 3G6BA 5JJNB 3Q4HA 4CS4A 1LUWA 1AJQA 4I4TB 2UUCB 5KHGA 3JAKA 2M7WA 2XAJA 3RFRA 2HHHO 4RO2A 1JMKC 2B9ZA 3ETEA 4LF9B 4MW3A 5JCOA 5KLVH 4R50A 1ROPA 3N2GB 3QNEA 4MSWC 1YI2V 1PKXA 2CTRA 4UCRA 4B3RB 5FPOA 3H1HH 1N33B 2EINC 1W0JG 4FM0A 4X1KB 1YCIA 1HNXB 3OEEG 4GKJB 1SRYA 1ZX3A 5KUMA 4UB8Z 1LUVA 2F93B 2N05A 2ZR2A 4F6RB 3P3PA 1H2GA 3TK1A 1UFIA 4QPJA 2LFSA 1E1RG 4LFAB 4B3TB 3HPLC 4JAUA 1EFRG 3A2FA 2G38A 1CP9A 1YIJV 1SQFA 3OTFA 2ZE6A 2YI8A 4K8ZA 3OUSA 2L35A 2QJ1A 3N2GA 4PV1B 4QE9A 2QM8A 4GLXA 3VOUA 5CMUA 3ABMC 5H5NA 1XMOB 4YJ2B 3Q4HB 2CE4A 3JAWB 4B3RO 3E8FA 4J7KA 1R6KA 3AK3A 3CXHF 1FXKA 2YUAA 2DE0X 3EXAA 3APOA 3ZJZA 1FS0G 3RT3C 2WA4A 5K1XA 3FX7A 2DN9A 4J11A 5JJEB 2YIBD 1JPXA 4MTOA 4XDKA 4Q20A 3D3QA 1IZ3A 1H8HG 3WB1A 1SQBH 4MT8A 4BIZA 2WSSG 2YIBA 1BSMA 3IC9A 1M1KW 5LOVA 2PGGA 1J5EO 1CPYA 4DV5O 5EZYA 4CC6A 1NQTA 3G71V 3LSUA 1V55C 4LBEC 2RJZA 4YJ2A 5EBLC 4I0XB 1IBMO 1S76D 2UXDB 1M93A 2JEUA 4R7CA 3RYFB 1F51A 4YHHO 1BE3H 2IW5A 5JH7B 4U3FH 5KHJA 1M4UA 3JATA 2X7RB 3RVZA 3OM3B 1K92A 1AB3A 4U7OA 1FJGB 4IHJB 4DK0A 3QO8A 5JH7A 2OIGA 3AK2A 2EZOA 4I0XA 1SETA 1W0KG 3HKBA 2CGOA 1K73W 2BE3A 4LFBO 4IYHA 5KX5A 1YJ9V 1VIBA 5DECA 2GTSA 2DYRB 1F23A 3CPWU 1XNRO 3EHBB 5KMGB 1ZL8A 4ZOLA 3ZMSA 4RAIA 3K0DA 1JA8A 2LP7A 1J5EB 1OV9A 2WLNA 3SPHA 2BOBC 4DV4O 4RQFA 2WLIA 1ZLZA 3BCCH 5BR8O 4TV9B 3UO2A 1V54B 3F7YC 1XI1A 1GO3F 2E5LO 3JALA 2EJ7A 1K34A 1NTMH 1TUBA 3JYCA 1QU7A 5IJ9A 4QNHB 3E35A 4TUYA 3ZHUA 3J80N 2H8PC 5LMUB 1H2NA 1BZKA 2YIDA 1RP3B 1FYJA 1VF7A 3NXSA 2HEPA 4UV9A 2Q5ZA 4DV0B 4GX5A 2F95B 1ZWIC 1AP5A 3A0HZ 4BAYA 3CCSV 4CBCA 4TV8A 3SR2C 3T1YO 5B1OA 3VQYA 4LH7A 4TQDA 2XTAA 3L74H 3A8TA 1HR0B 3H9VA 4FLXA 2CK3G 1MSDA 2HJDA 5A9GA 4UV8A 3JCUZ 3CCJV 1P49A 3VQXA 5IYCO 4DR3B 1R1BA 4X1IB 3ZEDA 2AHZA 1V55B 1X4TA 4IIJB 5J2TA 1SS3A 1H2KA 2QM7A 2BTOA 1K5SA 3T1HB 4EFEA 2Y69B 4MVOA 4DR5O 4LR3A 4K0KO 4JI2B 2JDIG 4R6ZA 4FZ1A 5C8YA 4F6EA 2Y0PA 4UFZA 3RYCB 3CS5A 5DEDA 3ETDA 3JARA 2B1GA 4KHPB 1GTOA 2BOCC 5LOVB 2OWOA 5JWPA 1HNWB 4B3TO 4K35A 4DV6O 2ZINA 2DQ0A 2ITCC 3EFFK 3STLC 5IYDO 1YTFB 4ICGA 1WLEA 5LA6B 1N0JA 3C90A 3RBZA 3OE7G 1ORQC 3C3SA 4ZI7B 2ZM6O 2Q6AA 3BABA 4X65O 5EK0A 5K1PA 4U3JB 2A9HA 4W4KA 4NTWA 1LR1A 3ZHSA 1AJPA 1Y76B 1VQPV 2UXBO 1Y74A 1GKFA 2Q4PA 2O57A 2LFRA 4P2ZA 1XDCA 5BMVB 4J42A 5B5EZ 3CCQV 2V7QG 4MVUA 1S0VA 5B3SB 3G67A 4CH3A 4NVPA 1AI4A 3KZIZ 1DTOA 3WB2A 1F7YA 2GTAA 2C2AA 3K5LA 2EINB 4UCUA 4JPRA 4LFAO 3CE2A 4DV5B 3CMAV 2R70A 4EFBA 3AG4C 3M99B 1QBZA 4PA7A 3BVOA 5LMNO 4DR6O 3CCUV 2ZM6B 5H9CA 2ZNIA 4DYLA 2EIKC 1S5JA 1R3LC 2YSUB 2KB1A 4EB6B 2ATKC 2OIEA 3ZHTA 5KX5B 2QR4A 1G1XB 1JFFB 1QLEB 3LNNA 3SGIA 2UXBB 1SERA 4LFCB 4O4HB 3ABMB 1VF6C 4LCUC 1FXHA 2JS5A 4LF5B 3ABLB 3SPGA 2ZE5A 2VQFB 1EM1A 3RYHA 4H13B 3FD9A 4BR6A 2XAHA 1J95A 1GH6A 1EN5A 4N23A 1TAEA 1NR1A 1H8EG 3R66A 1HDJA 3CC4V 1AR5A 4GX2A 3B2EE 3CRMA 1KMIZ 4OX9B 3U11A 5JQGA 3W7WA 3OTOO 2Q69A 1BHAA 2GUZB 3O65A 3JD2A 3OTOB 2KSDA 4FFBA 1IX9A 4DUYB 5CBFA 4CZZA 5JJJB 1SF9A 1VP7A 1AJNA 2CAZC 1YXBA 3MHSC 3D36A 5LYJA 4NXMO 1F4MA 2LJ2A 2RCVA 3CC2V 1KC8W 3TGUH 1PL4A 1K7DA 4JI7O 4DV1O 1EZVH 4JI7B 4LF5O 3GVMA 4X20B 2XOKG 3CWBH 1Q6IA 4B3MB 1IXBA 4DV3B 4MW8A 5ITZA 1AI5A 2CH7A 2Z5UA 5B1BC 3K3WA 4I7ZB 3AG3B 3ASNC 3RYHB 2YXLA 3S3WA 2JGUA 5IJ0A 4JI0O 1YHQV 3MDSA 3N27A 3SYOA 2M6YA 1NR7A 2Q8VA 3B40A 3B09A 2A7WA 3ZS8C 1K3EA 3P30A 1FFXB 2RNBA 3K03A 3K06A 4FJCC 1Q6HA 3CC7V 4AILC 2UXCO 2DYRC 2GHYA 4DR2O 2Y48A 3ZMUA 4LF6O 1W2BU 3JSNA 4X1IA 1MOFA 4PDRA 1CEZA 4PD4F 3ASOC 4YHHB 4FMTA 2YEVB 2WLLB 2JEXA 4B7EA 1VQLV 2P6JA 2DYSB 4H0LB 1H2SB 5KMGA 5D5PA 2JK5C 2Z0AA 4GCZA 1EBOA 2BSKA 3RYIA 3FB8C 4DV0O 5LHHA 4FLTA 4X1KA 4YJ3A 3K0GA 2P90A 4K8XA 2OTLV 1H2LA 1M56C 2XAGA 3FKSG 4FVMA 1XNRB 4X66B 1AP6A 1B06A 3P3NA 1NT2B 3DXRB 2GSMB 3L73H 1W59A 1SQPH 1K33A 2A79B 1KB9F 4YXWG 2Y4TA 1JR9A 3JAMN 3OMNB 1NKDA 2EBOA 2K1EA 1QR9A 4PDVA 3CD6V 3N2KA 2CTWA 2LGWA 1ENVA 1COWG 2W0FC 2P4KA 3WB0A 3AG2C 1IXMA 1Y76A 2E3CA 4WBNB 4DR1O 3JASA 2UUAB 4MVMA 1HR0O 2ZKOA 2HJFC 1FPOA 1AR4A 2DMXA 5GW7A 2DQ3A 2R9AA 2ZE7A 1EN4A 2GDSA 3HB3B 4N21A 5LYJB 5CBGA 3CP1A 5KAFZ 4JAAA 2YS8A 1SC5B 1WPXA 3UO3A 4JI2O 3HKCB 5EIBC 5KA5A 1PP9H 5LA6A 2QKAA 3AG4B 4Z2WA 1WPBA 2IH3C 2Q7EA 2L6LA 2YEVA 2P7TC 3OR7C 2QKCA 4G2KA 3CJHA 1WN7A 2ZDIC 3OAAG 4OXSA 3CRAA 1HNZB 3SDLA 5KAIZ 1NTZH 1XBLA 2JVDA 1LNQA 1IVSA 3LDDA 4KUMA 1VQ9V 3X2QC 2JGDB 2X6CA 3J7AU 1DK1A 3RYCA 4JI6B 3K58A 4JI6O 4P30A 3BRCA 1P7GA 3AG7A 4NB5A 2ZQMA 4GX1A 2XAQA 1U97A 5CB4A 1KP3A 2QWQB 2AGAA 2OT5A 3BEHA 3ASOB 4J9YB 5H6RA 4LF8B 1NTKH 4FM1A 3OMAB 1JFFA 3ZHVA 3B77A 4WFGA 5IY5C 2A06H 4B7KA 1YITV 2E75B 2UU9B 3BAAA 3QG5A 3QO5A 4ZBMA 2E76B 1SKVA 3B8MA 3OD4A 4PA9A 1AR1B 4U7NA 3ZRVA 1PV0A 2W6IG 2ZCEA 3GWKC 1K9MW 1UPGA 2ZIMA 3VQVA 3ZN1A 4GKJO 4IYIA 5B1BB 4JI3O 2EIJB 1XEQA 1YEWA 3D8CA 2ZXWB 3SYQA 2YXHA 2XAFA 3DTUB 5LHGA 4GKKO 4WBNA 1IBKB 2IU3A 1BQZA 5KHIA 4Z1VA 3K5OA 5J9PC 3RVYA 5EIBD 1TVKA 1QVFU 1UJWB 2DOSA 2F43G 2V1DA 3W7SA 1O9HA 3I5DA 4WF9V 2LQTA 3LNMB 1IURA 4LNUB 4DR7B 4PA6A 4CH4A 4LF8O 4LWSB 4DW1A 1WA8A 2IH1C 3BA9A 2LW1A 3JALB 4YY3O 5JCOC 1ZSPA 4MS2A 4LF9O 3RN4A 3RGBA 4TV9A 1OCRC 2PZSA 4DV7O 4O4LA 1KP2A 2Z3YA 4ZI7A 4F4LA 2ZXWC 3WG7C 3ZMZA 1GM8A 2IJHA 1Q82W 1AVMA 4O4JA 2NR5A 5DM6V 4MVRA 2QGNA 3ABUA 5AG2A 3E22B 4WCEV 1WP7A 3D3IA 1P84F 4IT5A 1DGSA 1D5AA 4JYBA 1SZTA 2EIKB 4ZOLB 2EILB 3CSXA 5HFMA 3BPZA 4J10A 2YXYA 2IJIA 1PNKA 2HP8A 4LF4O 2JJ2G 2F23A 4FM2A 4QPKA 5GONB 2H3OA 2YDEA 1Z2GA 4WFEA 5CB4B 5L3EA 1Y6XA 1I5YA 5BZBA 1RPOA 4FLVA 3IJ4A 5BXZA 4RUEA 1F4NA 3MD0A 4B3SB 1P4RA 1SZXA 2UXXA 3E86A 3PJSK 5KUKA 5IT9N 1R3JC 1XHXA 1V54C 1M56B 1QCEA 3CCEV 3LUTB 4TQFA 5CA1A 2XT9A 5A2QN 4DV3O 1GMGA 4PI0A 3HKEB 4ZHQA 4X9QA 4CH5A 1OHHG 3DC5A 3FAVB 3K5MA 3KCYA 4FFBB 5CA3A 1VEWA 1YDXA 2VWKA 1SQGA 4D6TH 4LF6B 3L9DA 3ZRSA 4QIWF 1WA8B 2WWWA 3QF7A 2EX3A 2LW7A 1K97A 4JYCA 2F1MA 2Q0AA 1EN6A 2XASA 3JAWA 2ZR3A 2D3OW 1VQ5V 5E1AC 3QO7A 5LP6B 1OCRB 2GBOA 1B3QA 3W7UA 3SYPA 4PDMA 5IJ9B 5HFLA 1TUBB 4UUJC 3CXCU 4DR3O 4B3MO 2W0XA 4DV2O 5IYZA 5CA0B 3OR6C 5EYPA 1ZAUA 3ETGA 4JI0B 1G8MA 1Q6UA 2VQEB 4DRXB 5FNVB 4J41A 5CA0A 3I56V 3K5NA 2HR3A 1KYOF 4J9ZB 1NS1A 1VQKV 3E83A 2ILMA 3HKBB 3T2MA 5FNVA 4KHPO 2DWEC 3ML0A 1I94O 3W7XA 4TV8B 4DR2B 5LGNA 2Q7HA 1HW7A 2Q67A 3E2EA 1EZJA 3K9AA 4I50B 3JATB 3HKDB 3DC6A 4X1YA 1XHZA 2R9IA 4E4EA 3CB2A 3AK1A 1Y74B 1JVMA 3QTCA 4D7TA 3F7VC 3U0ZA 1TGOA 1URFA 4NTXA 5LMUO 5LP6A 4JYAO 4X64O 4JYAB 4DR4B 2WPDG 1BS3A 4K3AA 2NNUA 2PI5A 4TUYB 4FLYA 1K8AW 4WFAV 5EZYB 1I08A 1AI7A 1THZA 3THOA 4DR5B 3F5WC 5B1NA 3ZHQA 3K08A 3KKYA 4AQYB 4B08A 3ICXA 4JI4O 2EIMC 1HNWO 1Q3EA 4CH6A 5F2VO 3TCUA 1GM7A 1HNZO 1I94B 5FL7G 4DO2A 4O2AB 1FXVA 4DV4B 2HVKC 2UUAO 4NYKA 4O2BA 5CA1B 2QWNB 1XUQA 3JARB 5KA6A 5KHKA 3R65A 5IWAO 5TISZ 1PM9A 1JJ2U 1MSWD 2NN4A 5LMNB 2F4VO 2KG7A 3IFXA 3JD4A 2PTMA 4L8JA 4YIOA 1U96A 2QTSA 3JD1A 3BFRA 1YTFD 4O4IB 1WB7A 1S5HC 2PF4E 1N34O 2WLMA 4FK5C 3OGCC 4X88A 1Y66A 1Z5WA 1YZBA 1VQMV 3FB7C 3LSSA 2OCHA 2W6JG 1QLNA 4X89A 4HZ3A 4JGSA 3AG3C 3ASNB 3L71H 3IC7A 3J81N 3T1YB 1O9GA 5E79Z 2LGQA 1S72V 4O2AA 3VQWA 1AROP 2MK3A 4ASUG 3KCXA 1XL6A 3BY6A 1N32B 2VS0A 5IYZB 2OCCB 3ETQA 2XNDG 4LH6A 3JASB 3BA8A 4MVSA 1IBMB 2UXDO 1FD9A 3FB6C 3E8BA 4WFFA 1US6A 4LNUA 1MG1A 5B3SC 4TWKA 4HBNA 1N4CA 3KG2A 5FLXN 4AHCA 4UCTA 1N8RW 1JX9A 3OMIB 3C3TA 1IBLB 4UCVA 1GM9A 1MZFA 3JAKB 3UCSC 3SJQC 3I55V 2P5OA 3FFQA 1Q86W 1CXZB 1HNXO 3M7MX 4FIPC 5BY1A 1YJWV 1JQ0A 4Z1MG 4PA3A 1N36B 1L1FA 4OX9O 1PNMA 2QEXV 3VBBA 2OYQA 5J2UA 4JI5B 4JZGA 1MMMA 1R3IC 4DV6B 3G80A 3DGEA 4L87A 4YY3B 1FFTB 2Q0OC 4JF3A 5IY5B 5D5QA 1PPJH 2ZNJA 4DUYO 1Q7YW 1SA0B 1XMQO 1OZ0A 2ODMA 2QWOB 4DRXA 1V9PA 1ZTEA 1NI8A 4NXMB 3CRCA 2GV9A 3OEHG 3CX5F 5C93A 4J7ZA 4JASA 1K4DC 1WP8A 2ITDC 1WNSA 3ZHRA 4OPAA 1XREA 3CYOA 5C8YB 4LFCO 3FB5C 4JI8O 1VF5B 2D2CB 1XMOO 3ZRWB 5GONA 2AHYA 2WLHA 4MVZA 5H6QA 2VQFO 2X6BA 3UT5A 3RW0A 2ZDIA 5ITZB 3U10A 3K79A 2JGDA 1OCOB 4HNAA 3TJTA 5EBWC 2OCCC 2ARHA 4X66O 3OUFA 4KFMA 2QWPB 4X20A 1QQCA 4DUZO 1R3KC 4CC5A 4A5UB 1R6NA 2YI9A 3CRQA 2H94A 3ABLC 4RUFA 3ZBHA 4QGPA 5IDJA 3EVKA 1JJOA 5L3FA 1PD3A 3T4ZA 3GWOA 3CMEV 4WFHA 4FLZA 3LDEA 3H1KH 1NU1H 1VQ6V 3UM7A 3HKEA 5J2UB 1QNMA 3L75H 2RDCA 1BT8A 3NR7A 2E74B 4D7SA 1WJZA 2IJJA 2CTPA 1R6TA 1S5LZ 1BMFG 3E89A 4JI8B 2HG5C 4LF7B 1VQ4V 4OPHA 1HP8A 4KP4A 2P22C 3WU2Z 3OFNG 2K9PA 2R72A 4PHZA 3SJBC 3AEIA 1S3JA 3HKDA 1SQXH 4X1YB 2AZ2A 4H37A 4TSFG 4HYOA 3M8AA 1AILA 2CUGA 1QHTA 2Q73A 2QWRB 4O4HA 1TUEB 5GTHZ 3RYIB 3SYCA 1M90W 2Q68A 3LDCA 2DJVA 5BR8B 4PI2A 2FTKA 1BQ0A 1KU9A 1OJHA 2V4DA 3G6EV 2PY5A 2AZ0A 2WLJA 2BTQA 3JD3A 1XOUA 1BCCH 3A0RA 3B4SA 4I55B 1GN2A 2IU0A 4GX0A 1GN4A 2PUSA 2R9RB 4J80A 4NXNB 1KKCA 2A3QA 3TETA 1Y4MA 2EJRA 3ZMVA 3UT5B 2ZD9A 1NVPD 1FFXA 4DR4O 1N34B 1OCCC 3ZRWA 4EKWA 1B6QA 5FPRA 3FYEB 2YIAA 2WA3A 4C7UA 2EILC 1JCHA 3L70H 4HAMA 2CH7B 4AQYO 4JTCB 3ZN0A 1M57C 4LWSA 2EIJC 4X8AA 4I4TA 4GKKB 2HLDG 5IJ0B 1RM1C 1YVWA 3CJHB 5H2FZ 1KBHA 2UUCO 1GN6A 1NH2B 1MA1A 3ZRXA 1DF5A 4NR1A 2JIZG 1TVKB 4H33A 2XHBA 3CCLV 2WAMA 1SQVH 2E5LB 3MAQA 1MABG 2HHHB 2HKOA 4UB6Z 4XDLA 3QVNA 3S3XA 4CS2A 4DR7O 1T5EA 2LO1A 4AI8A 3OW2U 1M5IA 1R73A 3STZC 1XNQB 3D36C 1KQSU 5JVDB 1K4CC 4GUNA 1E1QG 1OCZB 2UU9O 3K9SA 3K59A 2ZIOA 4UVAA 5L3DA 1VARA 1DF4A 5DN6G 5LL6Y 2YC0A 4X64B 2UXNA 4I9WA 2GUZA 2Y0IA 2QSAA 4J7JA 4KL1A 2ADQB 2N04A 2DYSC 1K5QA 4BIOA 4IGGA 1B04A 1QVGU 1FAFA 2FYUH 3HR0A 4I9QA 1E79G 1XILA 5IE9A 2IBZH 3ABKB 4XBFA 1Z5VA 3UQ8A 4P9PA 3SPJA 1RFYA 1H38A 4I50A 4PELA 3H1LH 4PA4A 2EZPA 1XNQO 3WG7B 1Y67A 1PNLA 4DXWA 4DR6B 2QTOA 2BSKB 2JS3A 4F6RA 4X65B 2P67A 2XUMA 4G28B 3ZCCA 1L0NH 1NZ6A 1Q90D 3CEIA 2WLLA 1NVPB 1WB8A 3AG2B 1VQOV 2QDOA 1KECA 2AW9A 4DV7B 1N33O 5IYBO 1I7FA 3O9OA 2VRZA 2FKXA 5B66Z 2HFEC 3GB7C 3ZMTA 4DW0A 2CDYA 5LBQA 2WLKA 3ZX6A 4TT3G 5KHHA 1SQQH 4FZ0A 4XDJA 2KG7B 4QJFB 4WFBV 3RYFA 4DUZB 2Q9LA 1FXKC 1L8DA 3TXSA 2ADPA 3ZIAG 3N2KB 4X62O 3JCZA 4IL6Z 2RN9A 5L3BA 2FMLA 2QE7G 3IGAC 1H2MA 5LGUA 2JJ1G 2KQXA 4LF4B 4JI1O 1XMQB 4JI1B 1FKAO 4RQEA 3BHPA 1I0HA 1N32O 2IM9A 1BHBA 1D2DA 5B1AB 2FL4A 1KKDA 1D5NA 4UVBA 2PYJA 1Q5OA 1I5XA 2WLIB 4YJ3B 4FPPA 3CHXA 2MW2B 3SPIA 4UXNA 4B3SO 1L0LH 4LF7O 4NTYA 4RWUA 2PYLA 3H1IH 2UUBB 4DV1B 3CCRV 3UKMA 1IBLO 1X59A 3CRRA 2FB5A 2B5UA 4MTFA 5JQGB 1NJIW 5L3GA 4BW9A 3DSQA 4JTDB 3SJAC 3T4DA 4ZKIA 1VQ8V 4JI5O 2Y69C 1DLBA 4X62B 3JD0A 4HNAB 4O4IA 2DWDC 1RSOB 4TOIA 1N36O 1VQ7V 2QA4V 4P9OA 2ZT9B 1Q8IA 3OGIB 4GZRB 5LP6C 2CGNA 2X6AA 4GT1A 1VMGA 2RQ6A 1GN3A 4UCOA 1AI6A 4JV5B 4EB6A 1M9NA 3K57A 3SYAA 5L3CA 1WAZA 3HKCA 4LP8A 3PN1A 1G4YB 4I55A 3WFVA 4BIUA 3TXQA 5LGTA 2ETNA 2UUBO 3P32A 4LC1A 5EYPB 2VWJA 3E22A 4DV2B 2VQEO 5EBMC 5EC1C 4JAVA 3APQA 1N0NA 1QLEC 4KXRA 4O4JB 1OCZC 5GTIZ 1BL8A 3E8GA 1HWYA 3JSLA 4LFBB 1G6UA 1SESA 3ABKC 1FXKB 1IDSA 3T1CA 3CCMV 1OCOC 3CCVV 5LHIA 2JRIA 1RPRA 4EEQA 1Q43A 1XQ8A 4ZIBA 1ZUQA 5BMVA 1QR8A 4Q6GA 4CS3A 4MTGA 5LXTA 3FYIB 4W4LA 1BGYH 5LXTB 2UXCB 3L72H 1GAXA 2A0LA 2CTQA 3DXRA 4G27B 4H44B 4JV5O 1TA8A 5EC2C 2DW4A 1KUQA 3G4SV 2RMKB 1A32A 1YF2A 4UCSA 3SPCA 4R8CA 3T1HO 4YIPA 1XL4A 4BWAA 3H01A 4NXNO 1YJNV 3W7TA 1ZL8B 4FLUA 1NH2D 1FJGO 4JTAB 3OT7A
chains in the Genus database with same CATH topology
4AQYO 5FLXN 1DK1A 1FYJA 2Z0AA 4JI6O 1HNZO 1N33O 3R66A 4DV0O 2AGAA 2FKXA 1HNXO 2ZM6O 1J5EO 2UUAO 4DV5O 5BY1A 4X65O 4DR3O 1R6TA 2UUCO 4B3MO 4DV2O 3OTOO 2N74A 3O65A 4OX9O 5IWAO 4LF4O 3T1YO 1IBMO 4OPHA 4DR7O 2UXBO 4YHHO 2F4VO 4NXMO 3JAMN 2UUBO 4X62O 2VQEO 5BXZA 4GKJO 1NS1A 4JI3O 1AB3A 4DUYO 3M8AA 1XMQO 1AILA 2UU9O 1N34O 1XEQA 4KHPO 4GKKO 4JI1O 4JI7O 4DV1O 1F7YA 4LF5O 1FKAO 1I94O 5IT9N 4DR1O 1R1BA 5LL6Y 1YZBA 1N32O 1HR0O 2ZKOA 1D2DA 4LFBO 2DJVA 4LFAO 3F5TA 2JRIA 2DOSA 1XNRO 5A2QN 4OPAA 4DV3O 3J81N 5LMNO 4LFCO 4JI8O 4JI0O 4DR6O 4DR5O 4B3SO 4K0KO 4LF8O 4LF7O 1XMOO 1IBKO 4JI2O 4DV4O 5LMUO 5H5NA 2VQFO 2UXCO 4JV5O 5BR8O 4JYAO 1IBLO 4YY3O 4B3RO 4X64O 4DR2O 1X59A 1KUQA 4LF9O 4LF6O 1G1XB 4X66O 2E5LO 1A32A 4DV7O 4DR4O 1XNQO 4DUZO 2UXDO 3RT3C 3SDLA 4A5UB 3T1HO 4JI5O 4NXNO 2LW7A 4B3TO 3J80N 4DV6O 4JI4O 1N36O 2HHHO 1HNWO 1FJGO 3J7AU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AQY O;  5FLX N;  1DK1 A;  1FYJ A;  2Z0A A;  4JI6 O;  1HNZ O;  1N33 O;  3R66 A;  4DV0 O;  2AGA A;  2FKX A;  1HNX O;  2ZM6 O;  1J5E O;  2UUA O;  4DV5 O;  5BY1 A;  4X65 O;  4DR3 O;  1R6T A;  2UUC O;  4B3M O;  4DV2 O;  3OTO O;  2N74 A;  3O65 A;  4OX9 O;  5IWA O;  4LF4 O;  3T1Y O;  1IBM O;  4OPH A;  4DR7 O;  2UXB O;  4YHH O;  2F4V O;  4NXM O;  3JAM N;  2UUB O;  4X62 O;  2VQE O;  5BXZ A;  4GKJ O;  1NS1 A;  4JI3 O;  1AB3 A;  4DUY O;  3M8A A;  1XMQ O;  1AIL A;  2UU9 O;  1N34 O;  1XEQ A;  4KHP O;  4GKK O;  4JI1 O;  4JI7 O;  4DV1 O;  1F7Y A;  4LF5 O;  1FKA O;  1I94 O;  5IT9 N;  4DR1 O;  1R1B A;  5LL6 Y;  1YZB A;  1N32 O;  1HR0 O;  2ZKO A;  1D2D A;  4LFB O;  2DJV A;  4LFA O;  3F5T A;  2JRI A;  2DOS A;  1XNR O;  5A2Q N;  4OPA A;  4DV3 O;  3J81 N;  5LMN O;  4LFC O;  4JI8 O;  4JI0 O;  4DR6 O;  4DR5 O;  4B3S O;  4K0K O;  4LF8 O;  4LF7 O;  1XMO O;  1IBK O;  4JI2 O;  4DV4 O;  5LMU O;  5H5N A;  2VQF O;  2UXC O;  4JV5 O;  5BR8 O;  4JYA O;  1IBL O;  4YY3 O;  4B3R O;  4X64 O;  4DR2 O;  1X59 A;  1KUQ A;  4LF9 O;  4LF6 O;  1G1X B;  4X66 O;  2E5L O;  1A32 A;  4DV7 O;  4DR4 O;  1XNQ O;  4DUZ O;  2UXD O;  3RT3 C;  3SDL A;  4A5U B;  3T1H O;  4JI5 O;  4NXN O;  2LW7 A;  4B3T O;  3J80 N;  4DV6 O;  4JI4 O;  1N36 O;  2HHH O;  1HNW O;  1FJG O;  3J7A U; 
#chains in the Genus database with same CATH topology
 1P7B A;  2EIM B;  5CN0 A;  3MHH C;  2KKW A;  1YSC A;  2AXT Z;  3B8N A;  4ABM A;  4E2L A;  2Q7G A;  2BTQ B;  1OCC B;  1RM1 B;  4FLW A;  2QKS A;  3LSQ A;  1GRJ A;  4IHJ A;  3ABT A;  2N74 A;  4PDL A;  2OTJ V;  4NKG B;  2Y4U A;  2P4V A;  1GK9 A;  4GYC B;  1NBM G;  1VF6 A;  3E8H A;  5IWA B;  4MVQ A;  4DR1 B;  3K04 A;  4JYY A;  3A0B Z;  2QM4 A;  1RSO A;  4DK1 A;  4IIJ A;  5J2T B;  3RWR D;  3SJC C;  3AG1 B;  4O2B B;  2ZE8 A;  2NLJ C;  4MTX A;  4FFK A;  2PI4 A;  1JOY A;  2F4V B;  4K0K B;  1Q81 W;  3X2Q B;  2B1I A;  1S77 D;  2IJK A;  1SA0 A;  3F5T A;  4JZ2 A;  4U3J A;  2HVJ C;  1VQN V;  4I5S A;  5CBH A;  4JI3 B;  2X0L A;  5JVD A;  3AG1 C;  4BW5 A;  2BCC H;  3FAV A;  3H1J H;  2YIC A;  2P06 A;  4OGQ B;  3IAY A;  1IBK O;  4ZHQ B;  4JI4 B;  1MNG A;  4O4L B;  2EUL A;  2F66 C;  1MZE A;  4UVC A;  4PJ0 Z;  4QE7 A;  1KD1 W;  5B1A C;  1PL0 A;  1M57 B;  3G6B A;  5JJN B;  3Q4H A;  4CS4 A;  1LUW A;  1AJQ A;  4I4T B;  2UUC B;  5KHG A;  3JAK A;  2M7W A;  2XAJ A;  3RFR A;  2HHH O;  4RO2 A;  1JMK C;  2B9Z A;  3ETE A;  4LF9 B;  4MW3 A;  5JCO A;  5KLV H;  4R50 A;  1ROP A;  3N2G B;  3QNE A;  4MSW C;  1YI2 V;  1PKX A;  2CTR A;  4UCR A;  4B3R B;  5FPO A;  3H1H H;  1N33 B;  2EIN C;  1W0J G;  4FM0 A;  4X1K B;  1YCI A;  1HNX B;  3OEE G;  4GKJ B;  1SRY A;  1ZX3 A;  5KUM A;  4UB8 Z;  1LUV A;  2F93 B;  2N05 A;  2ZR2 A;  4F6R B;  3P3P A;  1H2G A;  3TK1 A;  1UFI A;  4QPJ A;  2LFS A;  1E1R G;  4LFA B;  4B3T B;  3HPL C;  4JAU A;  1EFR G;  3A2F A;  2G38 A;  1CP9 A;  1YIJ V;  1SQF A;  3OTF A;  2ZE6 A;  2YI8 A;  4K8Z A;  3OUS A;  2L35 A;  2QJ1 A;  3N2G A;  4PV1 B;  4QE9 A;  2QM8 A;  4GLX A;  3VOU A;  5CMU A;  3ABM C;  5H5N A;  1XMO B;  4YJ2 B;  3Q4H B;  2CE4 A;  3JAW B;  4B3R O;  3E8F A;  4J7K A;  1R6K A;  3AK3 A;  3CXH F;  1FXK A;  2YUA A;  2DE0 X;  3EXA A;  3APO A;  3ZJZ A;  1FS0 G;  3RT3 C;  2WA4 A;  5K1X A;  3FX7 A;  2DN9 A;  4J11 A;  5JJE B;  2YIB D;  1JPX A;  4MTO A;  4XDK A;  4Q20 A;  3D3Q A;  1IZ3 A;  1H8H G;  3WB1 A;  1SQB H;  4MT8 A;  4BIZ A;  2WSS G;  2YIB A;  1BSM A;  3IC9 A;  1M1K W;  5LOV A;  2PGG A;  1J5E O;  1CPY A;  4DV5 O;  5EZY A;  4CC6 A;  1NQT A;  3G71 V;  3LSU A;  1V55 C;  4LBE C;  2RJZ A;  4YJ2 A;  5EBL C;  4I0X B;  1IBM O;  1S76 D;  2UXD B;  1M93 A;  2JEU A;  4R7C A;  3RYF B;  1F51 A;  4YHH O;  1BE3 H;  2IW5 A;  5JH7 B;  4U3F H;  5KHJ A;  1M4U A;  3JAT A;  2X7R B;  3RVZ A;  3OM3 B;  1K92 A;  1AB3 A;  4U7O A;  1FJG B;  4IHJ B;  4DK0 A;  3QO8 A;  5JH7 A;  2OIG A;  3AK2 A;  2EZO A;  4I0X A;  1SET A;  1W0K G;  3HKB A;  2CGO A;  1K73 W;  2BE3 A;  4LFB O;  4IYH A;  5KX5 A;  1YJ9 V;  1VIB A;  5DEC A;  2GTS A;  2DYR B;  1F23 A;  3CPW U;  1XNR O;  3EHB B;  5KMG B;  1ZL8 A;  4ZOL A;  3ZMS A;  4RAI A;  3K0D A;  1JA8 A;  2LP7 A;  1J5E B;  1OV9 A;  2WLN A;  3SPH A;  2BOB C;  4DV4 O;  4RQF A;  2WLI A;  1ZLZ A;  3BCC H;  5BR8 O;  4TV9 B;  3UO2 A;  1V54 B;  3F7Y C;  1XI1 A;  1GO3 F;  2E5L O;  3JAL A;  2EJ7 A;  1K34 A;  1NTM H;  1TUB A;  3JYC A;  1QU7 A;  5IJ9 A;  4QNH B;  3E35 A;  4TUY A;  3ZHU A;  3J80 N;  2H8P C;  5LMU B;  1H2N A;  1BZK A;  2YID A;  1RP3 B;  1FYJ A;  1VF7 A;  3NXS A;  2HEP A;  4UV9 A;  2Q5Z A;  4DV0 B;  4GX5 A;  2F95 B;  1ZWI C;  1AP5 A;  3A0H Z;  4BAY A;  3CCS V;  4CBC A;  4TV8 A;  3SR2 C;  3T1Y O;  5B1O A;  3VQY A;  4LH7 A;  4TQD A;  2XTA A;  3L74 H;  3A8T A;  1HR0 B;  3H9V A;  4FLX A;  2CK3 G;  1MSD A;  2HJD A;  5A9G A;  4UV8 A;  3JCU Z;  3CCJ V;  1P49 A;  3VQX A;  5IYC O;  4DR3 B;  1R1B A;  4X1I B;  3ZED A;  2AHZ A;  1V55 B;  1X4T A;  4IIJ B;  5J2T A;  1SS3 A;  1H2K A;  2QM7 A;  2BTO A;  1K5S A;  3T1H B;  4EFE A;  2Y69 B;  4MVO A;  4DR5 O;  4LR3 A;  4K0K O;  4JI2 B;  2JDI G;  4R6Z A;  4FZ1 A;  5C8Y A;  4F6E A;  2Y0P A;  4UFZ A;  3RYC B;  3CS5 A;  5DED A;  3ETD A;  3JAR A;  2B1G A;  4KHP B;  1GTO A;  2BOC C;  5LOV B;  2OWO A;  5JWP A;  1HNW B;  4B3T O;  4K35 A;  4DV6 O;  2ZIN A;  2DQ0 A;  2ITC C;  3EFF K;  3STL C;  5IYD O;  1YTF B;  4ICG A;  1WLE A;  5LA6 B;  1N0J A;  3C90 A;  3RBZ A;  3OE7 G;  1ORQ C;  3C3S A;  4ZI7 B;  2ZM6 O;  2Q6A A;  3BAB A;  4X65 O;  5EK0 A;  5K1P A;  4U3J B;  2A9H A;  4W4K A;  4NTW A;  1LR1 A;  3ZHS A;  1AJP A;  1Y76 B;  1VQP V;  2UXB O;  1Y74 A;  1GKF A;  2Q4P A;  2O57 A;  2LFR A;  4P2Z A;  1XDC A;  5BMV B;  4J42 A;  5B5E Z;  3CCQ V;  2V7Q G;  4MVU A;  1S0V A;  5B3S B;  3G67 A;  4CH3 A;  4NVP A;  1AI4 A;  3KZI Z;  1DTO A;  3WB2 A;  1F7Y A;  2GTA A;  2C2A A;  3K5L A;  2EIN B;  4UCU A;  4JPR A;  4LFA O;  3CE2 A;  4DV5 B;  3CMA V;  2R70 A;  4EFB A;  3AG4 C;  3M99 B;  1QBZ A;  4PA7 A;  3BVO A;  5LMN O;  4DR6 O;  3CCU V;  2ZM6 B;  5H9C A;  2ZNI A;  4DYL A;  2EIK C;  1S5J A;  1R3L C;  2YSU B;  2KB1 A;  4EB6 B;  2ATK C;  2OIE A;  3ZHT A;  5KX5 B;  2QR4 A;  1G1X B;  1JFF B;  1QLE B;  3LNN A;  3SGI A;  2UXB B;  1SER A;  4LFC B;  4O4H B;  3ABM B;  1VF6 C;  4LCU C;  1FXH A;  2JS5 A;  4LF5 B;  3ABL B;  3SPG A;  2ZE5 A;  2VQF B;  1EM1 A;  3RYH A;  4H13 B;  3FD9 A;  4BR6 A;  2XAH A;  1J95 A;  1GH6 A;  1EN5 A;  4N23 A;  1TAE A;  1NR1 A;  1H8E G;  3R66 A;  1HDJ A;  3CC4 V;  1AR5 A;  4GX2 A;  3B2E E;  3CRM A;  1KMI Z;  4OX9 B;  3U11 A;  5JQG A;  3W7W A;  3OTO O;  2Q69 A;  1BHA A;  2GUZ B;  3O65 A;  3JD2 A;  3OTO B;  2KSD A;  4FFB A;  1IX9 A;  4DUY B;  5CBF A;  4CZZ A;  5JJJ B;  1SF9 A;  1VP7 A;  1AJN A;  2CAZ C;  1YXB A;  3MHS C;  3D36 A;  5LYJ A;  4NXM O;  1F4M A;  2LJ2 A;  2RCV A;  3CC2 V;  1KC8 W;  3TGU H;  1PL4 A;  1K7D A;  4JI7 O;  4DV1 O;  1EZV H;  4JI7 B;  4LF5 O;  3GVM A;  4X20 B;  2XOK G;  3CWB H;  1Q6I A;  4B3M B;  1IXB A;  4DV3 B;  4MW8 A;  5ITZ A;  1AI5 A;  2CH7 A;  2Z5U A;  5B1B C;  3K3W A;  4I7Z B;  3AG3 B;  3ASN C;  3RYH B;  2YXL A;  3S3W A;  2JGU A;  5IJ0 A;  4JI0 O;  1YHQ V;  3MDS A;  3N27 A;  3SYO A;  2M6Y A;  1NR7 A;  2Q8V A;  3B40 A;  3B09 A;  2A7W A;  3ZS8 C;  1K3E A;  3P30 A;  1FFX B;  2RNB A;  3K03 A;  3K06 A;  4FJC C;  1Q6H A;  3CC7 V;  4AIL C;  2UXC O;  2DYR C;  2GHY A;  4DR2 O;  2Y48 A;  3ZMU A;  4LF6 O;  1W2B U;  3JSN A;  4X1I A;  1MOF A;  4PDR A;  1CEZ A;  4PD4 F;  3ASO C;  4YHH B;  4FMT A;  2YEV B;  2WLL B;  2JEX A;  4B7E A;  1VQL V;  2P6J A;  2DYS B;  4H0L B;  1H2S B;  5KMG A;  5D5P A;  2JK5 C;  2Z0A A;  4GCZ A;  1EBO A;  2BSK A;  3RYI A;  3FB8 C;  4DV0 O;  5LHH A;  4FLT A;  4X1K A;  4YJ3 A;  3K0G A;  2P90 A;  4K8X A;  2OTL V;  1H2L A;  1M56 C;  2XAG A;  3FKS G;  4FVM A;  1XNR B;  4X66 B;  1AP6 A;  1B06 A;  3P3N A;  1NT2 B;  3DXR B;  2GSM B;  3L73 H;  1W59 A;  1SQP H;  1K33 A;  2A79 B;  1KB9 F;  4YXW G;  2Y4T A;  1JR9 A;  3JAM N;  3OMN B;  1NKD A;  2EBO A;  2K1E A;  1QR9 A;  4PDV A;  3CD6 V;  3N2K A;  2CTW A;  2LGW A;  1ENV A;  1COW G;  2W0F C;  2P4K A;  3WB0 A;  3AG2 C;  1IXM A;  1Y76 A;  2E3C A;  4WBN B;  4DR1 O;  3JAS A;  2UUA B;  4MVM A;  1HR0 O;  2ZKO A;  2HJF C;  1FPO A;  1AR4 A;  2DMX A;  5GW7 A;  2DQ3 A;  2R9A A;  2ZE7 A;  1EN4 A;  2GDS A;  3HB3 B;  4N21 A;  5LYJ B;  5CBG A;  3CP1 A;  5KAF Z;  4JAA A;  2YS8 A;  1SC5 B;  1WPX A;  3UO3 A;  4JI2 O;  3HKC B;  5EIB C;  5KA5 A;  1PP9 H;  5LA6 A;  2QKA A;  3AG4 B;  4Z2W A;  1WPB A;  2IH3 C;  2Q7E A;  2L6L A;  2YEV A;  2P7T C;  3OR7 C;  2QKC A;  4G2K A;  3CJH A;  1WN7 A;  2ZDI C;  3OAA G;  4OXS A;  3CRA A;  1HNZ B;  3SDL A;  5KAI Z;  1NTZ H;  1XBL A;  2JVD A;  1LNQ A;  1IVS A;  3LDD A;  4KUM A;  1VQ9 V;  3X2Q C;  2JGD B;  2X6C A;  3J7A U;  1DK1 A;  3RYC A;  4JI6 B;  3K58 A;  4JI6 O;  4P30 A;  3BRC A;  1P7G A;  3AG7 A;  4NB5 A;  2ZQM A;  4GX1 A;  2XAQ A;  1U97 A;  5CB4 A;  1KP3 A;  2QWQ B;  2AGA A;  2OT5 A;  3BEH A;  3ASO B;  4J9Y B;  5H6R A;  4LF8 B;  1NTK H;  4FM1 A;  3OMA B;  1JFF A;  3ZHV A;  3B77 A;  4WFG A;  5IY5 C;  2A06 H;  4B7K A;  1YIT V;  2E75 B;  2UU9 B;  3BAA A;  3QG5 A;  3QO5 A;  4ZBM A;  2E76 B;  1SKV A;  3B8M A;  3OD4 A;  4PA9 A;  1AR1 B;  4U7N A;  3ZRV A;  1PV0 A;  2W6I G;  2ZCE A;  3GWK C;  1K9M W;  1UPG A;  2ZIM A;  3VQV A;  3ZN1 A;  4GKJ O;  4IYI A;  5B1B B;  4JI3 O;  2EIJ B;  1XEQ A;  1YEW A;  3D8C A;  2ZXW B;  3SYQ A;  2YXH A;  2XAF A;  3DTU B;  5LHG A;  4GKK O;  4WBN A;  1IBK B;  2IU3 A;  1BQZ A;  5KHI A;  4Z1V A;  3K5O A;  5J9P C;  3RVY A;  5EIB D;  1TVK A;  1QVF U;  1UJW B;  2DOS A;  2F43 G;  2V1D A;  3W7S A;  1O9H A;  3I5D A;  4WF9 V;  2LQT A;  3LNM B;  1IUR A;  4LNU B;  4DR7 B;  4PA6 A;  4CH4 A;  4LF8 O;  4LWS B;  4DW1 A;  1WA8 A;  2IH1 C;  3BA9 A;  2LW1 A;  3JAL B;  4YY3 O;  5JCO C;  1ZSP A;  4MS2 A;  4LF9 O;  3RN4 A;  3RGB A;  4TV9 A;  1OCR C;  2PZS A;  4DV7 O;  4O4L A;  1KP2 A;  2Z3Y A;  4ZI7 A;  4F4L A;  2ZXW C;  3WG7 C;  3ZMZ A;  1GM8 A;  2IJH A;  1Q82 W;  1AVM A;  4O4J A;  2NR5 A;  5DM6 V;  4MVR A;  2QGN A;  3ABU A;  5AG2 A;  3E22 B;  4WCE V;  1WP7 A;  3D3I A;  1P84 F;  4IT5 A;  1DGS A;  1D5A A;  4JYB A;  1SZT A;  2EIK B;  4ZOL B;  2EIL B;  3CSX A;  5HFM A;  3BPZ A;  4J10 A;  2YXY A;  2IJI A;  1PNK A;  2HP8 A;  4LF4 O;  2JJ2 G;  2F23 A;  4FM2 A;  4QPK A;  5GON B;  2H3O A;  2YDE A;  1Z2G A;  4WFE A;  5CB4 B;  5L3E A;  1Y6X A;  1I5Y A;  5BZB A;  1RPO A;  4FLV A;  3IJ4 A;  5BXZ A;  4RUE A;  1F4N A;  3MD0 A;  4B3S B;  1P4R A;  1SZX A;  2UXX A;  3E86 A;  3PJS K;  5KUK A;  5IT9 N;  1R3J C;  1XHX A;  1V54 C;  1M56 B;  1QCE A;  3CCE V;  3LUT B;  4TQF A;  5CA1 A;  2XT9 A;  5A2Q N;  4DV3 O;  1GMG A;  4PI0 A;  3HKE B;  4ZHQ A;  4X9Q A;  4CH5 A;  1OHH G;  3DC5 A;  3FAV B;  3K5M A;  3KCY A;  4FFB B;  5CA3 A;  1VEW A;  1YDX A;  2VWK A;  1SQG A;  4D6T H;  4LF6 B;  3L9D A;  3ZRS A;  4QIW F;  1WA8 B;  2WWW A;  3QF7 A;  2EX3 A;  2LW7 A;  1K97 A;  4JYC A;  2F1M A;  2Q0A A;  1EN6 A;  2XAS A;  3JAW A;  2ZR3 A;  2D3O W;  1VQ5 V;  5E1A C;  3QO7 A;  5LP6 B;  1OCR B;  2GBO A;  1B3Q A;  3W7U A;  3SYP A;  4PDM A;  5IJ9 B;  5HFL A;  1TUB B;  4UUJ C;  3CXC U;  4DR3 O;  4B3M O;  2W0X A;  4DV2 O;  5IYZ A;  5CA0 B;  3OR6 C;  5EYP A;  1ZAU A;  3ETG A;  4JI0 B;  1G8M A;  1Q6U A;  2VQE B;  4DRX B;  5FNV B;  4J41 A;  5CA0 A;  3I56 V;  3K5N A;  2HR3 A;  1KYO F;  4J9Z B;  1NS1 A;  1VQK V;  3E83 A;  2ILM A;  3HKB B;  3T2M A;  5FNV A;  4KHP O;  2DWE C;  3ML0 A;  1I94 O;  3W7X A;  4TV8 B;  4DR2 B;  5LGN A;  2Q7H A;  1HW7 A;  2Q67 A;  3E2E A;  1EZJ A;  3K9A A;  4I50 B;  3JAT B;  3HKD B;  3DC6 A;  4X1Y A;  1XHZ A;  2R9I A;  4E4E A;  3CB2 A;  3AK1 A;  1Y74 B;  1JVM A;  3QTC A;  4D7T A;  3F7V C;  3U0Z A;  1TGO A;  1URF A;  4NTX A;  5LMU O;  5LP6 A;  4JYA O;  4X64 O;  4JYA B;  4DR4 B;  2WPD G;  1BS3 A;  4K3A A;  2NNU A;  2PI5 A;  4TUY B;  4FLY A;  1K8A W;  4WFA V;  5EZY B;  1I08 A;  1AI7 A;  1THZ A;  3THO A;  4DR5 B;  3F5W C;  5B1N A;  3ZHQ A;  3K08 A;  3KKY A;  4AQY B;  4B08 A;  3ICX A;  4JI4 O;  2EIM C;  1HNW O;  1Q3E A;  4CH6 A;  5F2V O;  3TCU A;  1GM7 A;  1HNZ O;  1I94 B;  5FL7 G;  4DO2 A;  4O2A B;  1FXV A;  4DV4 B;  2HVK C;  2UUA O;  4NYK A;  4O2B A;  5CA1 B;  2QWN B;  1XUQ A;  3JAR B;  5KA6 A;  5KHK A;  3R65 A;  5IWA O;  5TIS Z;  1PM9 A;  1JJ2 U;  1MSW D;  2NN4 A;  5LMN B;  2F4V O;  2KG7 A;  3IFX A;  3JD4 A;  2PTM A;  4L8J A;  4YIO A;  1U96 A;  2QTS A;  3JD1 A;  3BFR A;  1YTF D;  4O4I B;  1WB7 A;  1S5H C;  2PF4 E;  1N34 O;  2WLM A;  4FK5 C;  3OGC C;  4X88 A;  1Y66 A;  1Z5W A;  1YZB A;  1VQM V;  3FB7 C;  3LSS A;  2OCH A;  2W6J G;  1QLN A;  4X89 A;  4HZ3 A;  4JGS A;  3AG3 C;  3ASN B;  3L71 H;  3IC7 A;  3J81 N;  3T1Y B;  1O9G A;  5E79 Z;  2LGQ A;  1S72 V;  4O2A A;  3VQW A;  1ARO P;  2MK3 A;  4ASU G;  3KCX A;  1XL6 A;  3BY6 A;  1N32 B;  2VS0 A;  5IYZ B;  2OCC B;  3ETQ A;  2XND G;  4LH6 A;  3JAS B;  3BA8 A;  4MVS A;  1IBM B;  2UXD O;  1FD9 A;  3FB6 C;  3E8B A;  4WFF A;  1US6 A;  4LNU A;  1MG1 A;  5B3S C;  4TWK A;  4HBN A;  1N4C A;  3KG2 A;  5FLX N;  4AHC A;  4UCT A;  1N8R W;  1JX9 A;  3OMI B;  3C3T A;  1IBL B;  4UCV A;  1GM9 A;  1MZF A;  3JAK B;  3UCS C;  3SJQ C;  3I55 V;  2P5O A;  3FFQ A;  1Q86 W;  1CXZ B;  1HNX O;  3M7M X;  4FIP C;  5BY1 A;  1YJW V;  1JQ0 A;  4Z1M G;  4PA3 A;  1N36 B;  1L1F A;  4OX9 O;  1PNM A;  2QEX V;  3VBB A;  2OYQ A;  5J2U A;  4JI5 B;  4JZG A;  1MMM A;  1R3I C;  4DV6 B;  3G80 A;  3DGE A;  4L87 A;  4YY3 B;  1FFT B;  2Q0O C;  4JF3 A;  5IY5 B;  5D5Q A;  1PPJ H;  2ZNJ A;  4DUY O;  1Q7Y W;  1SA0 B;  1XMQ O;  1OZ0 A;  2ODM A;  2QWO B;  4DRX A;  1V9P A;  1ZTE A;  1NI8 A;  4NXM B;  3CRC A;  2GV9 A;  3OEH G;  3CX5 F;  5C93 A;  4J7Z A;  4JAS A;  1K4D C;  1WP8 A;  2ITD C;  1WNS A;  3ZHR A;  4OPA A;  1XRE A;  3CYO A;  5C8Y B;  4LFC O;  3FB5 C;  4JI8 O;  1VF5 B;  2D2C B;  1XMO O;  3ZRW B;  5GON A;  2AHY A;  2WLH A;  4MVZ A;  5H6Q A;  2VQF O;  2X6B A;  3UT5 A;  3RW0 A;  2ZDI A;  5ITZ B;  3U10 A;  3K79 A;  2JGD A;  1OCO B;  4HNA A;  3TJT A;  5EBW C;  2OCC C;  2ARH A;  4X66 O;  3OUF A;  4KFM A;  2QWP B;  4X20 A;  1QQC A;  4DUZ O;  1R3K C;  4CC5 A;  4A5U B;  1R6N A;  2YI9 A;  3CRQ A;  2H94 A;  3ABL C;  4RUF A;  3ZBH A;  4QGP A;  5IDJ A;  3EVK A;  1JJO A;  5L3F A;  1PD3 A;  3T4Z A;  3GWO A;  3CME V;  4WFH A;  4FLZ A;  3LDE A;  3H1K H;  1NU1 H;  1VQ6 V;  3UM7 A;  3HKE A;  5J2U B;  1QNM A;  3L75 H;  2RDC A;  1BT8 A;  3NR7 A;  2E74 B;  4D7S A;  1WJZ A;  2IJJ A;  2CTP A;  1R6T A;  1S5L Z;  1BMF G;  3E89 A;  4JI8 B;  2HG5 C;  4LF7 B;  1VQ4 V;  4OPH A;  1HP8 A;  4KP4 A;  2P22 C;  3WU2 Z;  3OFN G;  2K9P A;  2R72 A;  4PHZ A;  3SJB C;  3AEI A;  1S3J A;  3HKD A;  1SQX H;  4X1Y B;  2AZ2 A;  4H37 A;  4TSF G;  4HYO A;  3M8A A;  1AIL A;  2CUG A;  1QHT A;  2Q73 A;  2QWR B;  4O4H A;  1TUE B;  5GTH Z;  3RYI B;  3SYC A;  1M90 W;  2Q68 A;  3LDC A;  2DJV A;  5BR8 B;  4PI2 A;  2FTK A;  1BQ0 A;  1KU9 A;  1OJH A;  2V4D A;  3G6E V;  2PY5 A;  2AZ0 A;  2WLJ A;  2BTQ A;  3JD3 A;  1XOU A;  1BCC H;  3A0R A;  3B4S A;  4I55 B;  1GN2 A;  2IU0 A;  4GX0 A;  1GN4 A;  2PUS A;  2R9R B;  4J80 A;  4NXN B;  1KKC A;  2A3Q A;  3TET A;  1Y4M A;  2EJR A;  3ZMV A;  3UT5 B;  2ZD9 A;  1NVP D;  1FFX A;  4DR4 O;  1N34 B;  1OCC C;  3ZRW A;  4EKW A;  1B6Q A;  5FPR A;  3FYE B;  2YIA A;  2WA3 A;  4C7U A;  2EIL C;  1JCH A;  3L70 H;  4HAM A;  2CH7 B;  4AQY O;  4JTC B;  3ZN0 A;  1M57 C;  4LWS A;  2EIJ C;  4X8A A;  4I4T A;  4GKK B;  2HLD G;  5IJ0 B;  1RM1 C;  1YVW A;  3CJH B;  5H2F Z;  1KBH A;  2UUC O;  1GN6 A;  1NH2 B;  1MA1 A;  3ZRX A;  1DF5 A;  4NR1 A;  2JIZ G;  1TVK B;  4H33 A;  2XHB A;  3CCL V;  2WAM A;  1SQV H;  2E5L B;  3MAQ A;  1MAB G;  2HHH B;  2HKO A;  4UB6 Z;  4XDL A;  3QVN A;  3S3X A;  4CS2 A;  4DR7 O;  1T5E A;  2LO1 A;  4AI8 A;  3OW2 U;  1M5I A;  1R73 A;  3STZ C;  1XNQ B;  3D36 C;  1KQS U;  5JVD B;  1K4C C;  4GUN A;  1E1Q G;  1OCZ B;  2UU9 O;  3K9S A;  3K59 A;  2ZIO A;  4UVA A;  5L3D A;  1VAR A;  1DF4 A;  5DN6 G;  5LL6 Y;  2YC0 A;  4X64 B;  2UXN A;  4I9W A;  2GUZ A;  2Y0I A;  2QSA A;  4J7J A;  4KL1 A;  2ADQ B;  2N04 A;  2DYS C;  1K5Q A;  4BIO A;  4IGG A;  1B04 A;  1QVG U;  1FAF A;  2FYU H;  3HR0 A;  4I9Q A;  1E79 G;  1XIL A;  5IE9 A;  2IBZ H;  3ABK B;  4XBF A;  1Z5V A;  3UQ8 A;  4P9P A;  3SPJ A;  1RFY A;  1H38 A;  4I50 A;  4PEL A;  3H1L H;  4PA4 A;  2EZP A;  1XNQ O;  3WG7 B;  1Y67 A;  1PNL A;  4DXW A;  4DR6 B;  2QTO A;  2BSK B;  2JS3 A;  4F6R A;  4X65 B;  2P67 A;  2XUM A;  4G28 B;  3ZCC A;  1L0N H;  1NZ6 A;  1Q90 D;  3CEI A;  2WLL A;  1NVP B;  1WB8 A;  3AG2 B;  1VQO V;  2QDO A;  1KEC A;  2AW9 A;  4DV7 B;  1N33 O;  5IYB O;  1I7F A;  3O9O A;  2VRZ A;  2FKX A;  5B66 Z;  2HFE C;  3GB7 C;  3ZMT A;  4DW0 A;  2CDY A;  5LBQ A;  2WLK A;  3ZX6 A;  4TT3 G;  5KHH A;  1SQQ H;  4FZ0 A;  4XDJ A;  2KG7 B;  4QJF B;  4WFB V;  3RYF A;  4DUZ B;  2Q9L A;  1FXK C;  1L8D A;  3TXS A;  2ADP A;  3ZIA G;  3N2K B;  4X62 O;  3JCZ A;  4IL6 Z;  2RN9 A;  5L3B A;  2FML A;  2QE7 G;  3IGA C;  1H2M A;  5LGU A;  2JJ1 G;  2KQX A;  4LF4 B;  4JI1 O;  1XMQ B;  4JI1 B;  1FKA O;  4RQE A;  3BHP A;  1I0H A;  1N32 O;  2IM9 A;  1BHB A;  1D2D A;  5B1A B;  2FL4 A;  1KKD A;  1D5N A;  4UVB A;  2PYJ A;  1Q5O A;  1I5X A;  2WLI B;  4YJ3 B;  4FPP A;  3CHX A;  2MW2 B;  3SPI A;  4UXN A;  4B3S O;  1L0L H;  4LF7 O;  4NTY A;  4RWU A;  2PYL A;  3H1I H;  2UUB B;  4DV1 B;  3CCR V;  3UKM A;  1IBL O;  1X59 A;  3CRR A;  2FB5 A;  2B5U A;  4MTF A;  5JQG B;  1NJI W;  5L3G A;  4BW9 A;  3DSQ A;  4JTD B;  3SJA C;  3T4D A;  4ZKI A;  1VQ8 V;  4JI5 O;  2Y69 C;  1DLB A;  4X62 B;  3JD0 A;  4HNA B;  4O4I A;  2DWD C;  1RSO B;  4TOI A;  1N36 O;  1VQ7 V;  2QA4 V;  4P9O A;  2ZT9 B;  1Q8I A;  3OGI B;  4GZR B;  5LP6 C;  2CGN A;  2X6A A;  4GT1 A;  1VMG A;  2RQ6 A;  1GN3 A;  4UCO A;  1AI6 A;  4JV5 B;  4EB6 A;  1M9N A;  3K57 A;  3SYA A;  5L3C A;  1WAZ A;  3HKC A;  4LP8 A;  3PN1 A;  1G4Y B;  4I55 A;  3WFV A;  4BIU A;  3TXQ A;  5LGT A;  2ETN A;  2UUB O;  3P32 A;  4LC1 A;  5EYP B;  2VWJ A;  3E22 A;  4DV2 B;  2VQE O;  5EBM C;  5EC1 C;  4JAV A;  3APQ A;  1N0N A;  1QLE C;  4KXR A;  4O4J B;  1OCZ C;  5GTI Z;  1BL8 A;  3E8G A;  1HWY A;  3JSL A;  4LFB B;  1G6U A;  1SES A;  3ABK C;  1FXK B;  1IDS A;  3T1C A;  3CCM V;  1OCO C;  3CCV V;  5LHI A;  2JRI A;  1RPR A;  4EEQ A;  1Q43 A;  1XQ8 A;  4ZIB A;  1ZUQ A;  5BMV A;  1QR8 A;  4Q6G A;  4CS3 A;  4MTG A;  5LXT A;  3FYI B;  4W4L A;  1BGY H;  5LXT B;  2UXC B;  3L72 H;  1GAX A;  2A0L A;  2CTQ A;  3DXR A;  4G27 B;  4H44 B;  4JV5 O;  1TA8 A;  5EC2 C;  2DW4 A;  1KUQ A;  3G4S V;  2RMK B;  1A32 A;  1YF2 A;  4UCS A;  3SPC A;  4R8C A;  3T1H O;  4YIP A;  1XL4 A;  4BWA A;  3H01 A;  4NXN O;  1YJN V;  3W7T A;  1ZL8 B;  4FLU A;  1NH2 D;  1FJG O;  4JTA B;  3OT7 A; 
#chains in the Genus database with same CATH homology
 4AQY O;  5FLX N;  1DK1 A;  1FYJ A;  2Z0A A;  4JI6 O;  1HNZ O;  1N33 O;  3R66 A;  4DV0 O;  2AGA A;  2FKX A;  1HNX O;  2ZM6 O;  1J5E O;  2UUA O;  4DV5 O;  5BY1 A;  4X65 O;  4DR3 O;  1R6T A;  2UUC O;  4B3M O;  4DV2 O;  3OTO O;  2N74 A;  3O65 A;  4OX9 O;  5IWA O;  4LF4 O;  3T1Y O;  1IBM O;  4OPH A;  4DR7 O;  2UXB O;  4YHH O;  2F4V O;  4NXM O;  3JAM N;  2UUB O;  4X62 O;  2VQE O;  5BXZ A;  4GKJ O;  1NS1 A;  4JI3 O;  1AB3 A;  4DUY O;  3M8A A;  1XMQ O;  1AIL A;  2UU9 O;  1N34 O;  1XEQ A;  4KHP O;  4GKK O;  4JI1 O;  4JI7 O;  4DV1 O;  1F7Y A;  4LF5 O;  1FKA O;  1I94 O;  5IT9 N;  4DR1 O;  1R1B A;  5LL6 Y;  1YZB A;  1N32 O;  1HR0 O;  2ZKO A;  1D2D A;  4LFB O;  2DJV A;  4LFA O;  3F5T A;  2JRI A;  2DOS A;  1XNR O;  5A2Q N;  4OPA A;  4DV3 O;  3J81 N;  5LMN O;  4LFC O;  4JI8 O;  4JI0 O;  4DR6 O;  4DR5 O;  4B3S O;  4K0K O;  4LF8 O;  4LF7 O;  1XMO O;  1IBK O;  4JI2 O;  4DV4 O;  5LMU O;  5H5N A;  2VQF O;  2UXC O;  4JV5 O;  5BR8 O;  4JYA O;  1IBL O;  4YY3 O;  4B3R O;  4X64 O;  4DR2 O;  1X59 A;  1KUQ A;  4LF9 O;  4LF6 O;  1G1X B;  4X66 O;  2E5L O;  1A32 A;  4DV7 O;  4DR4 O;  1XNQ O;  4DUZ O;  2UXD O;  3RT3 C;  3SDL A;  4A5U B;  3T1H O;  4JI5 O;  4NXN O;  2LW7 A;  4B3T O;  3J80 N;  4DV6 O;  4JI4 O;  1N36 O;  2HHH O;  1HNW O;  1FJG O;  3J7A U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...