4JI4O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4ji4O00
2ZM6O 1I94O 4GKKO 5LMNO 4JI4O 4AQYO 1XMOO 1HNZO 4DUYO 5BXZA 4JI7O 1NS1A 2UUCO 5BY1A 1AB3A 1XNQO 1R6TA 4JI2O 1FKAO 4DR2O 4JV5O 1HR0O 4DV6O 1IBKO 4K0KO 5IT9N 2FKXA 4NXNO 4JI0O 1XMQO 2F4VO 3SDLA 5IWAO 2VQEO 2E5LO 4X64O 1YZBA 4X66O 4LF6O 4OX9O 2UXCO 1FYJA 4DR5O 2N74A 3RT3C 2UUBO 1FJGO 4JI3O 4OPAA 2VQFO 5A2QN 1N36O 4DV0O 4KHPO 1G1XB 4DV5O 4JI5O 2UUAO 3F5TA 4A5UB 3T1YO 4DV1O 4LFAO 1D2DA 4B3SO 2AGAA 3O65A 1N33O 1KUQA 4GKJO 2JRIA 2DJVA 1R1BA 2UXBO 2HHHO 1HNWO 4X65O 4JI1O 4YY3O 4DV2O 5H5NA 3J80N 1XNRO 1J5EO 1N34O 3JAMN 5LL6Y 4JI6O 4YHHO 4B3MO 4B3RO 3J7AU 2ZKOA 4DR4O 4DV7O 1IBLO 4DR7O 1HNXO 4DV3O 4JI8O 1F7YA 4X62O 2UXDO 4JYAO 5LMUO 3J81N 1X59A 5BR8O 4LF7O 4LF9O 4LFCO 4LF4O 4LF8O 3OTOO 4LF5O 3R66A 4DR1O 3T1HO 2LW7A 4DV4O 4DR3O 4LFBO 3M8AA 1A32A 1DK1A 4DR6O 1N32O 1IBMO 2Z0AA 2UU9O 4NXMO 4B3TO 4DUZO 1XEQA 2DOSA 5FLXN 4OPHA 1AILA
chains in the Genus database with same CATH superfamily
3AG4C 4ZOLB 2LFSA 1N36B 3IC9A 3CE2A 1K33A 1NVPB 2KKWA 4RAIA 2DYRB 3K79A 2FMLA 1NS1A 1WA8B 1GMGA 1XQ8A 5CA1B 1VQNV 2DE0X 5KUMA 2JS3A 1Y76B 2BTQA 3WB1A 4X20B 1JFFA 2OCHA 4QJFB 3RN4A 3SDLA 5J2UB 4DYLA 3SJBC 1HNWB 1V9PA 3X2QC 1FJGO 5EZYA 1M4UA 1MA1A 1BGYH 2LQTA 3GB7C 3W7UA 4B3MB 3D3IA 2GTAA 3RYCB 2UUAB 3EVKA 1TVKA 5GONB 4JYAB 3U0ZA 3B4SA 3IAYA 2JJ2G 4LFCB 4PA4A 5CA0B 1VMGA 3SPHA 1Q6IA 5IYZA 4PELA 1X4TA 4FFBA 2WAMA 4GLXA 4H33A 1CPYA 3OMNB 2JEXA 3ZN0A 2JRIA 1YDXA 2CH7A 2MK3A 1WNSA 5JVDA 3SJQC 1DF5A 1ORQC 1BT8A 3STLC 1I94B 1LR1A 4W4LA 4H13B 2JIZG 4P9OA 2AXTZ 4I55B 1R3IC 3HPLC 4X1IA 3ZHQA 2ZDIC 1SERA 5K1PA 2M7WA 4UVCA 2ZNJA 3B09A 1H2KA 1OCCB 4DR6B 4RQEA 2LW7A 1IBKB 2Y4TA 3E8BA 4K3AA 2VWKA 4NXMB 4LFBO 2QWNB 3QTCA 2WLKA 1KECA 5E79Z 1S76D 2BTQB 4B3TO 1KKDA 1SZTA 1XL4A 5HFLA 2DOSA 2WLJA 1PL4A 4I9WA 1K4CC 2AW9A 2QTSA 5H2FZ 2R72A 5BXZA 5E1AC 2ZNIA 1NBMG 3EXAA 4BR6A 4EKWA 4WFBV 5EZYB 4ABMA 2QM8A 4IHJA 1Y74A 5EC1C 4B3SB 4DRXA 1ENVA 1TVKB 3CEIA 5EC2C 3EFFK 1FPOA 2X6CA 3UCSC 2GTSA 4PJ0Z 4HAMA 1LNQA 3W7XA 1M56B 2E76B 5IYZB 4FFBB 1VF5B 4JZ2A 3AK2A 4J10A 1N36O 3ABMB 1WPBA 4YJ3A 1I08A 2CH7B 4UV8A 1W2BU 4WFEA 5JVDB 4XDLA 3WG7B 2Z5UA 4A5UB 1YJNV 1L0NH 2HVKC 3CHXA 4JTAB 2GSMB 1WN7A 1U96A 4I50A 4JPRA 2JVDA 2FYUH 4X1IB 2E3CA 5B1NA 3CRCA 3CX5F 1HNWO 1SA0B 2HR3A 1JMKC 3BVOA 5ITZB 5CMUA 4PA9A 2P4VA 5LL6Y 2LGQA 2IJIA 4B3MO 3KKYA 4JI4B 2ITCC 2WLNA 3G67A 4YIPA 2IBZH 3OM3B 3L72H 3CJHA 4JYYA 4JYAO 2CGOA 2YIDA 4LFCO 4TOIA 1KB9F 4PDLA 1RM1C 4DR2B 1HR0B 1JOYA 1QVGU 2C2AA 1Q43A 3M7MX 4NXNB 4L8JA 2LW1A 2Q8VA 5H6QA 2UXXA 5IWAB 5FPOA 3GWKC 1M9NA 4IHJB 2EINC 1V55C 3AG1C 1CXZB 4DRXB 1I94O 1L0LH 2EIMC 2HLDG 2UUCO 3LSSA 2QSAA 1PL0A 3B40A 3KCYA 4GX1A 4NKGB 1FD9A 2E74B 3R65A 5C8YA 1IBKO 4YJ3B 4GYCB 2ZE6A 1YVWA 4BW5A 4WF9V 4HBNA 4FZ1A 1VF6C 4CH6A 4RO2A 3ZRWA 4I50B 4P2ZA 5B5EZ 2PY5A 4CBCA 4R6ZA 1R3KC 1WP8A 1NQTA 3U10A 4UCOA 2AZ2A 4LF7B 1VQ7V 2P4KA 3BA8A 2EBOA 2PI4A 4AHCA 1IXBA 4B3SO 2K1EA 1AVMA 3CJHB 4LH6A 4DV4B 1SQBH 3K9SA 4BIZA 3CCUV 1VARA 4UB6Z 3RYHA 2YXLA 4QE9A 2QWQB 3ICXA 1GM8A 1PKXA 2IU0A 5JJNB 1SZXA 4QPJA 3K5LA 2ZM6B 3J7AU 3C3SA 4AQYB 1WPXA 2LGWA 4HZ3A 2HP8A 1RPOA 3JD1A 2ZIOA 3W7TA 1RFYA 4YJ2A 5JJJB 3E89A 1VQ8V 4P30A 2EILC 3BAAA 5LGNA 1Z5WA 1FXHA 2E75B 1EN4A 1LUWA 2YIBD 3D36C 2UXNA 1VF7A 4ZI7A 1XMQB 2JJ1G 3I5DA 4E2LA 3B8MA 4FFKA 4JTCB 5B1AB 3SPJA 5CBGA 2CK3G 5LA6A 1BCCH 5C8YB 4ZIBA 4OPHA 2ZD9A 3CS5A 4JASA 4JI4O 1Z5VA 4UB8Z 4KHPB 4JI2O 3ZRWB 2BTOA 4DR2O 1HR0O 1XUQA 1QR9A 4NXNO 3OE7G 4QIWF 3OMIB 4PA6A 2ARHA 1J95A 3OEEG 3NXSA 5IWAO 3K0DA 3SPGA 1YZBA 1NR1A 4CS2A 2DQ3A 2EIKC 3CRQA 2QTOA 2YUAA 1DTOA 4UCTA 4KFMA 2XASA 3LDEA 3I55V 4B3RB 3ZHUA 3TXQA 1NH2B 2LO1A 2UXDB 4PD4F 3BCCH 1FFXA 3P32A 1K4DC 3GWOA 3K5NA 3K5OA 4MVRA 1VQOV 4F4LA 2ADQB 1R6NA 1HP8A 3ETEA 3SJAC 2CTPA 1OHHG 1US6A 4JYBA 4YJ2B 4CS4A 1AI6A 5JJEB 4FLTA 1EN6A 3H1JH 5LOVA 4ZI7B 1XMOB 3QNEA 2W0XA 3TGUH 3PN1A 1QLNA 4FLUA 5LA6B 3OEHG 3STZC 1YIJV 5FPRA 4LF7O 5KHKA 3WB2A 4DV4O 2ILMA 4UCUA 2ADPA 1T5EA 1RP3B 2QWRB 5FNVA 1MZEA 2YEVB 4X64B 4FJCC 3DSQA 4R8CA 4TSFG 4UCSA 2ZE5A 1GH6A 1GM7A 2GV9A 1H2SB 1N0JA 4R7CA 2ZM6O 3APOA 4AQYO 5KMGA 1WP7A 3VQWA 1DGSA 4G2KA 3A0HZ 3K0GA 3TK1A 1TUBA 2AZ0A 2A3QA 3SJCC 1JQ0A 2PUSA 3HKEA 4LFAB 2OIGA 3JAWB 4HNAA 1PNLA 5IT9N 1XMQO 1OCRC 4RWUA 1N4CA 2FTKA 2YIAA 5IYDO 2PF4E 1Q3EA 4LC1A 3ZIAG 3ETDA 4TV8A 1IZ3A 4PDVA 1QR8A 4KHPO 1G1XB 3BABA 1ZSPA 3JSLA 2VWJA 3A8TA 4X62B 4G27B 3AK3A 4U7NA 2DWEC 3NR7A 5LOVB 5B3SC 1QCEA 2YI8A 4LF5B 1B04A 2OCCC 1YF2A 2AGAA 3UM7A 3RW0A 4ICGA 4DR3B 1YITV 3ZMZA 3ML0A 4ZBMA 4MTGA 1W0JG 2P67A 2R9AA 2CTWA 4YXWG 5DM6V 5LP6A 4B3RO 1ZWIC 2Y4UA 1CP9A 2DYRC 5FNVB 3VBBA 1Q6HA 2UXDO 3K03A 1XNQB 2P22C 2P7TC 4LF8O 1ROPA 4LFBB 5KMGB 1K9MW 1KYOF 3M8AA 1TUBB 1SS3A 3K9AA 1SQXH 2WA4A 3JSNA 4X66B 3HKEB 4HNAB 2OYQA 4DW0A 1YSCA 3E2EA 1XMOO 5BMVA 4X9QA 3E8GA 4MTXA 3QG5A 2QWPB 1FKAO 2KSDA 3ASOB 4TV8B 1MNGA 3MAQA 2PTMA 4IT5A 2F4VO 4FVMA 2XAJA 5JCOC 4X64O 3JCUZ 4FLYA 2BOCC 1BQ0A 4YY3B 5EYPA 1G6UA 1VQ4V 1J5EB 1M93A 4JI6B 1JJ2U 1LUVA 1EZJA 4DV7B 2PI5A 1QHTA 3P3NA 1HNXB 4DR7B 3SPIA 2YIBA 4MT8A 3W7WA 5LP6B 1OCCC 4LFAO 3OT7A 2JS5A 2Q0OC 4B08A 2RMKB 4I7ZB 5CA3A 5LHIA 3OTFA 5H5NA 4DUZB 2CGNA 1ZUQA 1S0VA 4FZ0A 4X1KA 1NTMH 2OTLV 1MSDA 1N8RW 2IH1C 1MABG 4X62O 5KLVH 1SC5B 3DXRA 1K5SA 3K59A 1S5HC 1Q5OA 4LF5O 5BMVB 2F95B 4OXSA 2ZR3A 1O9HA 3CRMA 3ZCCA 3ZMUA 4DR3O 1N0NA 2IH3C 2Y69B 4PA3A 2QGNA 4UV9A 4D6TH 4BIUA 4DW1A 4O4LB 2B1IA 1YEWA 2HHHO 4LP8A 3CYOA 1G8MA 3ABMC 2UUCB 2ITDC 3CRAA 2BOBC 1GM9A 1EFRG 2LFRA 5BY1A 5L3BA 4FLZA 3AG4B 1AB3A 3JCZA 1XNQO 4JI5B 5EYPB 3VQXA 4UXNA 1HW7A 4MVMA 2RJZA 4PI2A 4CS3A 3FB8C 3FKSG 4FLWA 1QBZA 3CC7V 2WA3A 2E5LO 3T4DA 4X66O 2V7QG 1JFFB 3C90A 2EIJC 1KQSU 1Y67A 1XHXA 1Q6UA 1XNRB 5A2QN 1H38A 1TAEA 2GBOA 4B7EA 4H37A 4WFFA 4GZRB 4NVPA 4DV3B 1M57B 3X2QB 4ZHQA 1KBHA 3OR6C 4KP4A 4O2BA 4J41A 1O9GA 3G6BA 3K3WA 3U11A 4X1KB 3ABKB 3ABLB 4HYOA 3LNNA 5JH7A 3HKDA 3QVNA 4R50A 1K7DA 1QLEC 1K92A 3DXRB 2DJVA 2UU9B 1VEWA 1AI5A 4YY3O 1D5NA 4Q20A 1J5EO 4JI6O 1H8HG 1S77D 4DV7O 4DR7O 1HNXO 4JI7B 3W7SA 3OAAG 1X59A 1FXKC 3SYCA 4FM1A 3WU2Z 3JATA 1IX9A 4LF6B 1SQVH 2EJ7A 4DUZO 1P7GA 3G6EV 3AK1A 2WLHA 4NTYA 4FM2A 1DF4A 2KQXA 5EK0A 4JI2B 4X8AA 4UVBA 4DV5B 2Q7GA 4CZZA 3BY6A 4J42A 4TUYA 4GUNA 3IGAC 1OZ0A 1VIBA 5IDJA 2ZE8A 2ZE7A 3E22A 4PDRA 1N33B 3QO5A 2K9PA 1Y74B 4FK5C 3CRRA 4O2BB 2Y0PA 3G80A 2RN9A 2HJDA 4CC5A 4JI1B 5EIBC 4MVOA 3HKDB 3ZHRA 2M6YA 4YHHB 1PD3A 3AG7A 3E8FA 2Q67A 4JI5O 3RBZA 3RFRA 2G38A 2IJHA 4LF4B 3I56V 5IE9A 5F2VO 2XHBA 3AG3B 2NNUA 1PV0A 1KUQA 1VF6A 5B1AC 4MTFA 3ABUA 1YHQV 4DO2A 1XNRO 4BW9A 2Q6AA 3JATB 3C3TA 2D3OW 4PDMA 2H8PC 3D8CA 1D5AA 1S5LZ 4DV3O 3K57A 4JI8O 4MVSA 4P9PA 3HKBA 3J81N 2LJ2A 1ZX3A 1AP5A 3HKCA 1THZA 4JV5B 1G4YB 4YIOA 1XHZA 4JI0B 2ZT9B 3B77A 4J9YB 4TUYB 3SYQA 2UU9O 5IY5B 3E22B 3H1HH 1E1QG 4GKKO 1Q86W 2JEUA 5DECA 3ZHSA 4L87A 4JI7O 3AG1B 3TETA 1BE3H 3JYCA 4H0LB 2V4DA 2A79B 3CCMV 3CC2V 4DV1B 2YC0A 3D36A 1K34A 3H01A 5LYJA 1P84F 5B1OA 3RYFA 2B9ZA 4O2AA 2Q7EA 3RWRD 1IDSA 1U97A 5EBMC 4LF6O 2KG7A 3SYAA 2OTJV 3JARA 2OWOA 1S72V 3RT3C 3G71V 2EZPA 2H3OA 1BSMA 2EX3A 3FYEB 4DR4B 1RSOA 3E86A 3JAKA 3OUFA 3VQYA 4DV5O 3WB0A 1PM9A 1BHBA 3ABTA 4MTOA 5LMUB 1OCZC 5LXTA 3BRCA 1ZTEA 2JGUA 3UKMA 1GN6A 3AG2B 1N33O 3HKBB 3AEIA 5LBQA 1JCHA 3CCJV 3CXCU 4MW8A 1OCOC 1V54B 3HKCB 3G4SV 4FLVA 5JQGA 4JI1O 4WBNA 3K06A 2VS0A 3JAMN 3RYHB 4YHHO 2Q9LA 5L3CA 4E4EA 5TISZ 3CD6V 4DUYB 4LF8B 3FFQA 2A0LA 2XOKG 1WB8A 2IJJA 3QO8A 4Z1MG 1ZLZA 4I0XA 2BE3A 4LF4O 3CCSV 4DR1O 5AG2A 2YS8A 4FPPA 2KB1A 3CSXA 1Q82W 1DK1A 4O4IA 4XDKA 2VQEB 4GCZA 2EILB 2OT5A 1TGOA 4K8ZA 3S3WA 5LYJB 5GW7A 3E83A 3RYFB 2X7RB 4O2AB 1K97A 4O4JA 1HNZO 1GK9A 1GO3F 1AJQA 2Q68A 2KG7B 1I7FA 1PNKA 3JARB 5CN0A 1SETA 2Q5ZA 4JV5O 3LDCA 2RNBA 2NR5A 5KA5A 2BCCH 5L3EA 2F4VB 2FKXA 4O4HA 1RSOB 3JAKB 3S3XA 4JI0O 1XI1A 2H94A 4GX0A 4JZGA 5DEDA 4GKJB 2DMXA 3L74H 2CUGA 2GDSA 1KC8W 1PP9H 2N74A 3KZIZ 3CP1A 2ZXWC 3L9DA 3T1CA 1FS0G 1IBLB 2Q7HA 5IJ9A 5JQGB 1HDJA 1NT2B 4WBNB 1JR9A 1H2NA 2Y48A 5BR8B 2Q69A 4DV1O 1FFXB 4LWSA 1COWG 2RDCA 4QPKA 2WSSG 2QKCA 1DLBA 1N32B 4I0XB 1IBMB 2QKAA 2DYSC 4MVUA 3SPCA 1K8AW 1IURA 2YSUB 1XL6A 1AJPA 2HFEC 3ZHTA 5LMNB 4TQFA 4DR4O 1JX9A 1I5XA 3FYIB 1B3QA 5LMUO 2B1GA 4JAAA 3ASOC 3EHBB 2F1MA 3UT5A 3P3PA 4I5SA 1RPRA 4O4JB 1S5JA 4K0KB 4GX5A 1BS3A 1R3LC 2DN9A 1A32A 3B8NA 2Z0AA 2HHHB 3RVZA 1I5YA 1BHAA 4X88A 4O4HB 4DR5B 4U7OA 3H9VA 4QNHB 4DUYO 1UPGA 2Q4PA 5EIBD 3A0BZ 3RYIA 3ASNB 3QF7A 1TA8A 1L8DA 5KHJA 5LP6C 2FB5A 3BEHA 4IIJA 2E5LB 3FB6C 4D7TA 3Q4HA 1XOUA 1XDCA 2VQEO 3WFVA 1EBOA 2XAGA 4LWSB 4W4KA 4X65B 1R6KA 1NI8A 1KKCA 1AI4A 1N34B 3ETQA 3OFNG 1AP6A 4FMTA 4U3JA 4NB5A 1FXVA 1B06A 5B66Z 2NLJC 3RGBA 5CBHA 4I9QA 1AJNA 3T1YO 3OTOB 4WFAV 2F66C 2QE7G 2Y69C 3N2KA 4NR1A 5B3SB 4GKJO 1R1BA 1AROP 1S3JA 4UCVA 4IL6Z 1QU7A 4J9ZB 4PHZA 2EJRA 3ZBHA 3L70H 1IBLO 5B1BB 5LGTA 3CCRV 3OGCC 1NH2D 1GN4A 2RCVA 5BR8O 3LNMB 3N27A 2ETNA 4TV9A 4DK0A 3RYIB 1M5IA 3JASA 1R73A 1N32O 1IBMO 2JDIG 4UVAA 1YTFD 3LUTB 4JF3A 2UXCB 1VQPV 4IIJB 4CC6A 1P49A 2Z3YA 5LMNO 3Q4HB 1KP3A 2ODMA 2QJ1A 4JI3B 4DK1A 4J7JA 3RVYA 1M57C 2HG5C 5CBFA 1NR7A 2PYLA 2P6JA 1JA8A 2X0LA 3ABKC 3ABLC 1I0HA 4FM0A 2BSKA 4U3JB 4K0KO 1M56C 3SGIA 1B6QA 3OR7C 4PI0A 2WPDG 1FYJA 2UXBB 5KAFZ 4DR5O 1SQPH 1UFIA 2ZDIA 4CH5A 2UUBO 1ZAUA 2HJFC 3N2KB 1K73W 3WG7C 4DXWA 4Z2WA 1P4RA 4MW3A 5IYBO 2HEPA 4NTXA 3CMAV 2HKOA 4LR3A 1L1FA 5KHHA 3LDDA 3ZMSA 1F51A 4LNUA 4F6EA 1E79G 1BL8A 3DC5A 3K5MA 1AI7A 3IJ4A 1SA0A 3DTUB 1UJWB 5ITZA 4J7ZA 4C7UA 5GTIZ 4X65O 1XBLA 2NN4A 4TV9B 2B5UA 1E1RG 1N34O 1F4MA 3JASB 4JI8B 1SKVA 2QM4A 5LHGA 3L73H 1YJWV 2WWWA 4EFEA 3ZRVA 1F7YA 1HWYA 1NJIW 3N2GA 4BIOA 3OTOO 3IFXA 1NTZH 4PV1B 2FL4A 4DV6B 3FB5C 3CB2A 5L3GA 3K08A 3HR0A 2AHYA 5KHGA 1WLEA 2V1DA 4OX9B 2DQ0A 2EZOA 3P30A 4JYCA 4GKKB 3SR2C 2BSKB 5L3FA 2QA4V 1TUEB 2W6JG 2VQFB 4WFGA 3OW2U 3ZRSA 4IYHA 1FXKA 1CEZA 2OIEA 2MW2B 4BAYA 5JWPA 3AG3C 4AI8A 2P06A 4MVQA 2AHZA 4RUEA 1SRYA 2UXCO 1QVFU 1SQQH 2IM9A 1YXBA 1Y66A 1VP7A 3UQ8A 4LNUB 4DV2B 2N05A 2D2CB 3TXSA 3D3QA 4JI3O 4J80A 4B7KA 4KL1A 2ZR2A 5H6RA 2O57A 4H44B 2EIJB 4ZKIA 4LCUC 2CDYA 3IC7A 2UUAO 2Y0IA 3BHPA 1YJ9V 1GN2A 3OUSA 4ZHQB 2JK5C 3T1HB 1JPXA 2PGGA 3JD2A 4RUFA 3MD0A 3ZX6A 4AILC 4UFZA 5JH7B 3LSQA 3N2GB 5IY5C 2F23A 2UXBO 4LH7A 5K1XA 1BQZA 1QLEB 4NTWA 4Z1VA 1NVPD 4EB6A 4WCEV 5IJ0A 3CCEV 3OGIB 1K5QA 4X89A 1Y4MA 3T4ZA 4D7SA 2YXYA 4DR1B 1VQ9V 4TWKA 2XAFA 2XNDG 1SF9A 4QE7A 2XT9A 4G28B 1H8EG 3THOA 2XAQA 3DGEA 1SQFA 4LBEC 1NZ6A 1FXKB 4DR6O 5GTHZ 4NXMO 2WLIA 3JD4A 3K04A 3O9OA 2GUZA 1HNZB 2VRZA 5LGUA 4DV0B 5EBLC 3UO3A 2CTRA 5KA6A 4WFHA 1MG1A 1AR5A 1R6TA 3JALA 2IJKA 1GKFA 3AG2C 3QO7A 1BZKA 4DV6O 1RM1B 1W0KG 3BPZA 5LHHA 1Q81W 3F7YC 1MMMA 3APQA 3FAVA 4XDJA 2CTQA 3L75H 1V54C 1JVMA 4EFBA 4OX9O 3MHSC 2PYJA 2EINB 2ZCEA 1V55B 2VQFO 1BMFG 2LP7A 5CB4A 1IXMA 1EN5A 4UUJC 4IYIA 2EIMB 3LSUA 1Q90D 4JTDB 1VQ6V 4BWAA 5BZBA 4EB6B 5IJ0B 1VQLV 5A9GA 3B2EE 1MOFA 3O65A 1Q8IA 2L35A 4XBFA 4JGSA 4KUMA 3ETGA 2R9RB 2QWOB 3K58A 3A2FA 4DV2O 3J80N 3CCLV 4X1YA 2QKSA 2WLIB 5C93A 2CE4A 1GN3A 2GUZB 3A0RA 3FX7A 5J9PC 4U3FH 2Q0AA 1IVSA 3T1HO 3H1IH 3CPWU 2YEVA 3CC4V 3JALB 3SYOA 2ZIMA 4NYKA 2P5OA 5L3DA 4K35A 1SQGA 3CCQV 1XEQA 3CXHF 2YI9A 5FLXN 2DW4A 3OD4A 5D5QA 3E8HA 2A06H 4QGPA 3FAVB 1Y6XA 2WLLA 2A9HA 4CH3A 1MZFA 2QDOA 5J2TA 1MSWD 3FD9A 3JAWA 4KXRA 5D5PA 5CB4B 3SYPA 4GX2A 1KP2A 3HB3B 1NTKH 1SESA 4CH4A 1PNMA 1NU1H 2QEXV 3VOUA 1YTFB 3CMEV 2F93B 2QM7A 3PJSK 4DV0O 1M1KW 4N21A 3T1YB 2XTAA 4ASUG 5KHIA 1NKDA 4I4TA 4Q6GA 4LF9B 1FAFA 4X1YB 1D2DA 5LXTB 2IU3A 3H1KH 1OCZB 1XILA 2N04A 1GRJA 4TQDA 5FL7G 3TJTA 4FLXA 1QNMA 1KU9A 1WAZA 2EIKB 4J7KA 1YI2V 1AR4A 2GHYA 5EBWC 1R3JC 2P90A 4F6RA 1OCOB 1GAXA 2L6LA 2ZKOA 1F4NA 3ASNC 3KG2A 1H2GA 2EULA 1ZL8A 3ZMTA 2R70A 1OJHA 1PPJH 4UCRA 2WLLB 2F43G 2R9IA 3TCUA 2X6AA 3FB7C 3ZS8C 4JAVA 5DN6G 5J2TB 1EZVH 3MDSA 3ZHVA 3MHHC 4O4IB 1URFA 4PA7A 3ZEDA 1FJGB 2YICA 4IGGA 1P7BA 3GVMA 3ZJZA 3F7VC 1KD1W 3OMAB 4RQFA 2JGDA 3ZN1A 4FIPC 2WLMA 1EM1A 5KX5A 2ZINA 5HFMA 4ZOLA 3F5WC 3H1LH 4I4TB 2UUBB 1JJOA 1WA8A 2ZQMA 3UO2A 4J11A 5CA1A 3JD0A 3DC6A 3VQVA 1XREA 4OPAA 3M99B 1Y76A 5B1BC 4X20A 2CAZC 1VQMV 4K8XA 2ZXWB 1KMIZ 1WJZA 3CWBH 3F5TA 5J2UA 1VQKV 4F6RB 2HVJC 3KCXA 1Z2GA 5IJ9B 3L71H 3ZMVA 1H2MA 2X6BA 2PZSA 5IYCO 1VQ5V 1Q7YW 2W6IG 1ZL8B 2RQ6A 4MVZA 4TT3G 1OCRB 3RYCA 2ATKC 1OV9A 2QR4A 3ZRXA 2A7WA 5GONA 4JAUA 4B3TB 2IW5A 2Q73A 1WB7A 3BFRA 5CA0A 2DYSB 4MSWC 2XUMA 4EEQA 1QQCA 2YDEA 3E35A 1K3EA 4OGQB 2YXHA 1YCIA 4LF9O 5JCOA 3R66A 1AR1B 4N23A 3BA9A 3CCVV 2OCCB 3UT5B 1GTOA 3T2MA 1M90W 2W0FC 3JD3A 5KAIZ 4O4LA 4MS2A 5KUKA 1H2LA 5H9CA 2XAHA 4I55A 1F23A 2JGDB 4GT1A 5KX5B 2DWDC 1W59A 1AILA 1FFTB
chains in the Genus database with same CATH topology
2ZM6O 1I94O 4GKKO 5LMNO 4JI4O 4AQYO 1XMOO 1HNZO 4DUYO 5BXZA 4JI7O 1NS1A 2UUCO 5BY1A 1AB3A 1XNQO 1R6TA 4JI2O 1FKAO 4DR2O 4JV5O 1HR0O 4DV6O 1IBKO 4K0KO 5IT9N 2FKXA 4NXNO 4JI0O 1XMQO 2F4VO 3SDLA 5IWAO 2VQEO 2E5LO 4X64O 1YZBA 4X66O 4LF6O 4OX9O 2UXCO 1FYJA 4DR5O 2N74A 3RT3C 2UUBO 1FJGO 4JI3O 4OPAA 2VQFO 5A2QN 1N36O 4DV0O 4KHPO 1G1XB 4DV5O 4JI5O 2UUAO 3F5TA 4A5UB 3T1YO 4DV1O 4LFAO 1D2DA 4B3SO 2AGAA 3O65A 1N33O 1KUQA 4GKJO 2JRIA 2DJVA 1R1BA 2UXBO 2HHHO 1HNWO 4X65O 4JI1O 4YY3O 4DV2O 5H5NA 3J80N 1XNRO 1J5EO 1N34O 3JAMN 5LL6Y 4JI6O 4YHHO 4B3MO 4B3RO 3J7AU 2ZKOA 4DR4O 4DV7O 1IBLO 4DR7O 1HNXO 4DV3O 4JI8O 1F7YA 4X62O 2UXDO 4JYAO 5LMUO 3J81N 1X59A 5BR8O 4LF7O 4LF9O 4LFCO 4LF4O 4LF8O 3OTOO 4LF5O 3R66A 4DR1O 3T1HO 2LW7A 4DV4O 4DR3O 4LFBO 3M8AA 1A32A 1DK1A 4DR6O 1N32O 1IBMO 2Z0AA 2UU9O 4NXMO 4B3TO 4DUZO 1XEQA 2DOSA 5FLXN 4OPHA 1AILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZM6 O;  1I94 O;  4GKK O;  5LMN O;  4JI4 O;  4AQY O;  1XMO O;  1HNZ O;  4DUY O;  5BXZ A;  4JI7 O;  1NS1 A;  2UUC O;  5BY1 A;  1AB3 A;  1XNQ O;  1R6T A;  4JI2 O;  1FKA O;  4DR2 O;  4JV5 O;  1HR0 O;  4DV6 O;  1IBK O;  4K0K O;  5IT9 N;  2FKX A;  4NXN O;  4JI0 O;  1XMQ O;  2F4V O;  3SDL A;  5IWA O;  2VQE O;  2E5L O;  4X64 O;  1YZB A;  4X66 O;  4LF6 O;  4OX9 O;  2UXC O;  1FYJ A;  4DR5 O;  2N74 A;  3RT3 C;  2UUB O;  1FJG O;  4JI3 O;  4OPA A;  2VQF O;  5A2Q N;  1N36 O;  4DV0 O;  4KHP O;  1G1X B;  4DV5 O;  4JI5 O;  2UUA O;  3F5T A;  4A5U B;  3T1Y O;  4DV1 O;  4LFA O;  1D2D A;  4B3S O;  2AGA A;  3O65 A;  1N33 O;  1KUQ A;  4GKJ O;  2JRI A;  2DJV A;  1R1B A;  2UXB O;  2HHH O;  1HNW O;  4X65 O;  4JI1 O;  4YY3 O;  4DV2 O;  5H5N A;  3J80 N;  1XNR O;  1J5E O;  1N34 O;  3JAM N;  5LL6 Y;  4JI6 O;  4YHH O;  4B3M O;  4B3R O;  3J7A U;  2ZKO A;  4DR4 O;  4DV7 O;  1IBL O;  4DR7 O;  1HNX O;  4DV3 O;  4JI8 O;  1F7Y A;  4X62 O;  2UXD O;  4JYA O;  5LMU O;  3J81 N;  1X59 A;  5BR8 O;  4LF7 O;  4LF9 O;  4LFC O;  4LF4 O;  4LF8 O;  3OTO O;  4LF5 O;  3R66 A;  4DR1 O;  3T1H O;  2LW7 A;  4DV4 O;  4DR3 O;  4LFB O;  3M8A A;  1A32 A;  1DK1 A;  4DR6 O;  1N32 O;  1IBM O;  2Z0A A;  2UU9 O;  4NXM O;  4B3T O;  4DUZ O;  1XEQ A;  2DOS A;  5FLX N;  4OPH A;  1AIL A; 
#chains in the Genus database with same CATH topology
 3AG4 C;  4ZOL B;  2LFS A;  1N36 B;  3IC9 A;  3CE2 A;  1K33 A;  1NVP B;  2KKW A;  4RAI A;  2DYR B;  3K79 A;  2FML A;  1NS1 A;  1WA8 B;  1GMG A;  1XQ8 A;  5CA1 B;  1VQN V;  2DE0 X;  5KUM A;  2JS3 A;  1Y76 B;  2BTQ A;  3WB1 A;  4X20 B;  1JFF A;  2OCH A;  4QJF B;  3RN4 A;  3SDL A;  5J2U B;  4DYL A;  3SJB C;  1HNW B;  1V9P A;  3X2Q C;  1FJG O;  5EZY A;  1M4U A;  1MA1 A;  1BGY H;  2LQT A;  3GB7 C;  3W7U A;  4B3M B;  3D3I A;  2GTA A;  3RYC B;  2UUA B;  3EVK A;  1TVK A;  5GON B;  4JYA B;  3U0Z A;  3B4S A;  3IAY A;  2JJ2 G;  4LFC B;  4PA4 A;  5CA0 B;  1VMG A;  3SPH A;  1Q6I A;  5IYZ A;  4PEL A;  1X4T A;  4FFB A;  2WAM A;  4GLX A;  4H33 A;  1CPY A;  3OMN B;  2JEX A;  3ZN0 A;  2JRI A;  1YDX A;  2CH7 A;  2MK3 A;  1WNS A;  5JVD A;  3SJQ C;  1DF5 A;  1ORQ C;  1BT8 A;  3STL C;  1I94 B;  1LR1 A;  4W4L A;  4H13 B;  2JIZ G;  4P9O A;  2AXT Z;  4I55 B;  1R3I C;  3HPL C;  4X1I A;  3ZHQ A;  2ZDI C;  1SER A;  5K1P A;  2M7W A;  4UVC A;  2ZNJ A;  3B09 A;  1H2K A;  1OCC B;  4DR6 B;  4RQE A;  2LW7 A;  1IBK B;  2Y4T A;  3E8B A;  4K3A A;  2VWK A;  4NXM B;  4LFB O;  2QWN B;  3QTC A;  2WLK A;  1KEC A;  5E79 Z;  1S76 D;  2BTQ B;  4B3T O;  1KKD A;  1SZT A;  1XL4 A;  5HFL A;  2DOS A;  2WLJ A;  1PL4 A;  4I9W A;  1K4C C;  2AW9 A;  2QTS A;  5H2F Z;  2R72 A;  5BXZ A;  5E1A C;  2ZNI A;  1NBM G;  3EXA A;  4BR6 A;  4EKW A;  4WFB V;  5EZY B;  4ABM A;  2QM8 A;  4IHJ A;  1Y74 A;  5EC1 C;  4B3S B;  4DRX A;  1ENV A;  1TVK B;  3CEI A;  5EC2 C;  3EFF K;  1FPO A;  2X6C A;  3UCS C;  2GTS A;  4PJ0 Z;  4HAM A;  1LNQ A;  3W7X A;  1M56 B;  2E76 B;  5IYZ B;  4FFB B;  1VF5 B;  4JZ2 A;  3AK2 A;  4J10 A;  1N36 O;  3ABM B;  1WPB A;  4YJ3 A;  1I08 A;  2CH7 B;  4UV8 A;  1W2B U;  4WFE A;  5JVD B;  4XDL A;  3WG7 B;  2Z5U A;  4A5U B;  1YJN V;  1L0N H;  2HVK C;  3CHX A;  4JTA B;  2GSM B;  1WN7 A;  1U96 A;  4I50 A;  4JPR A;  2JVD A;  2FYU H;  4X1I B;  2E3C A;  5B1N A;  3CRC A;  3CX5 F;  1HNW O;  1SA0 B;  2HR3 A;  1JMK C;  3BVO A;  5ITZ B;  5CMU A;  4PA9 A;  2P4V A;  5LL6 Y;  2LGQ A;  2IJI A;  4B3M O;  3KKY A;  4JI4 B;  2ITC C;  2WLN A;  3G67 A;  4YIP A;  2IBZ H;  3OM3 B;  3L72 H;  3CJH A;  4JYY A;  4JYA O;  2CGO A;  2YID A;  4LFC O;  4TOI A;  1KB9 F;  4PDL A;  1RM1 C;  4DR2 B;  1HR0 B;  1JOY A;  1QVG U;  2C2A A;  1Q43 A;  3M7M X;  4NXN B;  4L8J A;  2LW1 A;  2Q8V A;  5H6Q A;  2UXX A;  5IWA B;  5FPO A;  3GWK C;  1M9N A;  4IHJ B;  2EIN C;  1V55 C;  3AG1 C;  1CXZ B;  4DRX B;  1I94 O;  1L0L H;  2EIM C;  2HLD G;  2UUC O;  3LSS A;  2QSA A;  1PL0 A;  3B40 A;  3KCY A;  4GX1 A;  4NKG B;  1FD9 A;  2E74 B;  3R65 A;  5C8Y A;  1IBK O;  4YJ3 B;  4GYC B;  2ZE6 A;  1YVW A;  4BW5 A;  4WF9 V;  4HBN A;  4FZ1 A;  1VF6 C;  4CH6 A;  4RO2 A;  3ZRW A;  4I50 B;  4P2Z A;  5B5E Z;  2PY5 A;  4CBC A;  4R6Z A;  1R3K C;  1WP8 A;  1NQT A;  3U10 A;  4UCO A;  2AZ2 A;  4LF7 B;  1VQ7 V;  2P4K A;  3BA8 A;  2EBO A;  2PI4 A;  4AHC A;  1IXB A;  4B3S O;  2K1E A;  1AVM A;  3CJH B;  4LH6 A;  4DV4 B;  1SQB H;  3K9S A;  4BIZ A;  3CCU V;  1VAR A;  4UB6 Z;  3RYH A;  2YXL A;  4QE9 A;  2QWQ B;  3ICX A;  1GM8 A;  1PKX A;  2IU0 A;  5JJN B;  1SZX A;  4QPJ A;  3K5L A;  2ZM6 B;  3J7A U;  3C3S A;  4AQY B;  1WPX A;  2LGW A;  4HZ3 A;  2HP8 A;  1RPO A;  3JD1 A;  2ZIO A;  3W7T A;  1RFY A;  4YJ2 A;  5JJJ B;  3E89 A;  1VQ8 V;  4P30 A;  2EIL C;  3BAA A;  5LGN A;  1Z5W A;  1FXH A;  2E75 B;  1EN4 A;  1LUW A;  2YIB D;  3D36 C;  2UXN A;  1VF7 A;  4ZI7 A;  1XMQ B;  2JJ1 G;  3I5D A;  4E2L A;  3B8M A;  4FFK A;  4JTC B;  5B1A B;  3SPJ A;  5CBG A;  2CK3 G;  5LA6 A;  1BCC H;  5C8Y B;  4ZIB A;  4OPH A;  2ZD9 A;  3CS5 A;  4JAS A;  4JI4 O;  1Z5V A;  4UB8 Z;  4KHP B;  4JI2 O;  3ZRW B;  2BTO A;  4DR2 O;  1HR0 O;  1XUQ A;  1QR9 A;  4NXN O;  3OE7 G;  4QIW F;  3OMI B;  4PA6 A;  2ARH A;  1J95 A;  3OEE G;  3NXS A;  5IWA O;  3K0D A;  3SPG A;  1YZB A;  1NR1 A;  4CS2 A;  2DQ3 A;  2EIK C;  3CRQ A;  2QTO A;  2YUA A;  1DTO A;  4UCT A;  4KFM A;  2XAS A;  3LDE A;  3I55 V;  4B3R B;  3ZHU A;  3TXQ A;  1NH2 B;  2LO1 A;  2UXD B;  4PD4 F;  3BCC H;  1FFX A;  3P32 A;  1K4D C;  3GWO A;  3K5N A;  3K5O A;  4MVR A;  1VQO V;  4F4L A;  2ADQ B;  1R6N A;  1HP8 A;  3ETE A;  3SJA C;  2CTP A;  1OHH G;  1US6 A;  4JYB A;  4YJ2 B;  4CS4 A;  1AI6 A;  5JJE B;  4FLT A;  1EN6 A;  3H1J H;  5LOV A;  4ZI7 B;  1XMO B;  3QNE A;  2W0X A;  3TGU H;  3PN1 A;  1QLN A;  4FLU A;  5LA6 B;  3OEH G;  3STZ C;  1YIJ V;  5FPR A;  4LF7 O;  5KHK A;  3WB2 A;  4DV4 O;  2ILM A;  4UCU A;  2ADP A;  1T5E A;  1RP3 B;  2QWR B;  5FNV A;  1MZE A;  2YEV B;  4X64 B;  4FJC C;  3DSQ A;  4R8C A;  4TSF G;  4UCS A;  2ZE5 A;  1GH6 A;  1GM7 A;  2GV9 A;  1H2S B;  1N0J A;  4R7C A;  2ZM6 O;  3APO A;  4AQY O;  5KMG A;  1WP7 A;  3VQW A;  1DGS A;  4G2K A;  3A0H Z;  3K0G A;  3TK1 A;  1TUB A;  2AZ0 A;  2A3Q A;  3SJC C;  1JQ0 A;  2PUS A;  3HKE A;  4LFA B;  2OIG A;  3JAW B;  4HNA A;  1PNL A;  5IT9 N;  1XMQ O;  1OCR C;  4RWU A;  1N4C A;  2FTK A;  2YIA A;  5IYD O;  2PF4 E;  1Q3E A;  4LC1 A;  3ZIA G;  3ETD A;  4TV8 A;  1IZ3 A;  4PDV A;  1QR8 A;  4KHP O;  1G1X B;  3BAB A;  1ZSP A;  3JSL A;  2VWJ A;  3A8T A;  4X62 B;  4G27 B;  3AK3 A;  4U7N A;  2DWE C;  3NR7 A;  5LOV B;  5B3S C;  1QCE A;  2YI8 A;  4LF5 B;  1B04 A;  2OCC C;  1YF2 A;  2AGA A;  3UM7 A;  3RW0 A;  4ICG A;  4DR3 B;  1YIT V;  3ZMZ A;  3ML0 A;  4ZBM A;  4MTG A;  1W0J G;  2P67 A;  2R9A A;  2CTW A;  4YXW G;  5DM6 V;  5LP6 A;  4B3R O;  1ZWI C;  2Y4U A;  1CP9 A;  2DYR C;  5FNV B;  3VBB A;  1Q6H A;  2UXD O;  3K03 A;  1XNQ B;  2P22 C;  2P7T C;  4LF8 O;  1ROP A;  4LFB B;  5KMG B;  1K9M W;  1KYO F;  3M8A A;  1TUB B;  1SS3 A;  3K9A A;  1SQX H;  2WA4 A;  3JSN A;  4X66 B;  3HKE B;  4HNA B;  2OYQ A;  4DW0 A;  1YSC A;  3E2E A;  1XMO O;  5BMV A;  4X9Q A;  3E8G A;  4MTX A;  3QG5 A;  2QWP B;  1FKA O;  2KSD A;  3ASO B;  4TV8 B;  1MNG A;  3MAQ A;  2PTM A;  4IT5 A;  2F4V O;  4FVM A;  2XAJ A;  5JCO C;  4X64 O;  3JCU Z;  4FLY A;  2BOC C;  1BQ0 A;  4YY3 B;  5EYP A;  1G6U A;  1VQ4 V;  1J5E B;  1M93 A;  4JI6 B;  1JJ2 U;  1LUV A;  1EZJ A;  4DV7 B;  2PI5 A;  1QHT A;  3P3N A;  1HNX B;  4DR7 B;  3SPI A;  2YIB A;  4MT8 A;  3W7W A;  5LP6 B;  1OCC C;  4LFA O;  3OT7 A;  2JS5 A;  2Q0O C;  4B08 A;  2RMK B;  4I7Z B;  5CA3 A;  5LHI A;  3OTF A;  5H5N A;  4DUZ B;  2CGN A;  1ZUQ A;  1S0V A;  4FZ0 A;  4X1K A;  1NTM H;  2OTL V;  1MSD A;  1N8R W;  2IH1 C;  1MAB G;  4X62 O;  5KLV H;  1SC5 B;  3DXR A;  1K5S A;  3K59 A;  1S5H C;  1Q5O A;  4LF5 O;  5BMV B;  2F95 B;  4OXS A;  2ZR3 A;  1O9H A;  3CRM A;  3ZCC A;  3ZMU A;  4DR3 O;  1N0N A;  2IH3 C;  2Y69 B;  4PA3 A;  2QGN A;  4UV9 A;  4D6T H;  4BIU A;  4DW1 A;  4O4L B;  2B1I A;  1YEW A;  2HHH O;  4LP8 A;  3CYO A;  1G8M A;  3ABM C;  2UUC B;  2ITD C;  3CRA A;  2BOB C;  1GM9 A;  1EFR G;  2LFR A;  5BY1 A;  5L3B A;  4FLZ A;  3AG4 B;  1AB3 A;  3JCZ A;  1XNQ O;  4JI5 B;  5EYP B;  3VQX A;  4UXN A;  1HW7 A;  4MVM A;  2RJZ A;  4PI2 A;  4CS3 A;  3FB8 C;  3FKS G;  4FLW A;  1QBZ A;  3CC7 V;  2WA3 A;  2E5L O;  3T4D A;  4X66 O;  2V7Q G;  1JFF B;  3C90 A;  2EIJ C;  1KQS U;  1Y67 A;  1XHX A;  1Q6U A;  1XNR B;  5A2Q N;  1H38 A;  1TAE A;  2GBO A;  4B7E A;  4H37 A;  4WFF A;  4GZR B;  4NVP A;  4DV3 B;  1M57 B;  3X2Q B;  4ZHQ A;  1KBH A;  3OR6 C;  4KP4 A;  4O2B A;  4J41 A;  1O9G A;  3G6B A;  3K3W A;  3U11 A;  4X1K B;  3ABK B;  3ABL B;  4HYO A;  3LNN A;  5JH7 A;  3HKD A;  3QVN A;  4R50 A;  1K7D A;  1QLE C;  1K92 A;  3DXR B;  2DJV A;  2UU9 B;  1VEW A;  1AI5 A;  4YY3 O;  1D5N A;  4Q20 A;  1J5E O;  4JI6 O;  1H8H G;  1S77 D;  4DV7 O;  4DR7 O;  1HNX O;  4JI7 B;  3W7S A;  3OAA G;  1X59 A;  1FXK C;  3SYC A;  4FM1 A;  3WU2 Z;  3JAT A;  1IX9 A;  4LF6 B;  1SQV H;  2EJ7 A;  4DUZ O;  1P7G A;  3G6E V;  3AK1 A;  2WLH A;  4NTY A;  4FM2 A;  1DF4 A;  2KQX A;  5EK0 A;  4JI2 B;  4X8A A;  4UVB A;  4DV5 B;  2Q7G A;  4CZZ A;  3BY6 A;  4J42 A;  4TUY A;  4GUN A;  3IGA C;  1OZ0 A;  1VIB A;  5IDJ A;  2ZE8 A;  2ZE7 A;  3E22 A;  4PDR A;  1N33 B;  3QO5 A;  2K9P A;  1Y74 B;  4FK5 C;  3CRR A;  4O2B B;  2Y0P A;  3G80 A;  2RN9 A;  2HJD A;  4CC5 A;  4JI1 B;  5EIB C;  4MVO A;  3HKD B;  3ZHR A;  2M6Y A;  4YHH B;  1PD3 A;  3AG7 A;  3E8F A;  2Q67 A;  4JI5 O;  3RBZ A;  3RFR A;  2G38 A;  2IJH A;  4LF4 B;  3I56 V;  5IE9 A;  5F2V O;  2XHB A;  3AG3 B;  2NNU A;  1PV0 A;  1KUQ A;  1VF6 A;  5B1A C;  4MTF A;  3ABU A;  1YHQ V;  4DO2 A;  1XNR O;  4BW9 A;  2Q6A A;  3JAT B;  3C3T A;  2D3O W;  4PDM A;  2H8P C;  3D8C A;  1D5A A;  1S5L Z;  4DV3 O;  3K57 A;  4JI8 O;  4MVS A;  4P9P A;  3HKB A;  3J81 N;  2LJ2 A;  1ZX3 A;  1AP5 A;  3HKC A;  1THZ A;  4JV5 B;  1G4Y B;  4YIO A;  1XHZ A;  4JI0 B;  2ZT9 B;  3B77 A;  4J9Y B;  4TUY B;  3SYQ A;  2UU9 O;  5IY5 B;  3E22 B;  3H1H H;  1E1Q G;  4GKK O;  1Q86 W;  2JEU A;  5DEC A;  3ZHS A;  4L87 A;  4JI7 O;  3AG1 B;  3TET A;  1BE3 H;  3JYC A;  4H0L B;  2V4D A;  2A79 B;  3CCM V;  3CC2 V;  4DV1 B;  2YC0 A;  3D36 A;  1K34 A;  3H01 A;  5LYJ A;  1P84 F;  5B1O A;  3RYF A;  2B9Z A;  4O2A A;  2Q7E A;  3RWR D;  1IDS A;  1U97 A;  5EBM C;  4LF6 O;  2KG7 A;  3SYA A;  2OTJ V;  3JAR A;  2OWO A;  1S72 V;  3RT3 C;  3G71 V;  2EZP A;  2H3O A;  1BSM A;  2EX3 A;  3FYE B;  4DR4 B;  1RSO A;  3E86 A;  3JAK A;  3OUF A;  3VQY A;  4DV5 O;  3WB0 A;  1PM9 A;  1BHB A;  3ABT A;  4MTO A;  5LMU B;  1OCZ C;  5LXT A;  3BRC A;  1ZTE A;  2JGU A;  3UKM A;  1GN6 A;  3AG2 B;  1N33 O;  3HKB B;  3AEI A;  5LBQ A;  1JCH A;  3CCJ V;  3CXC U;  4MW8 A;  1OCO C;  1V54 B;  3HKC B;  3G4S V;  4FLV A;  5JQG A;  4JI1 O;  4WBN A;  3K06 A;  2VS0 A;  3JAM N;  3RYH B;  4YHH O;  2Q9L A;  5L3C A;  4E4E A;  5TIS Z;  3CD6 V;  4DUY B;  4LF8 B;  3FFQ A;  2A0L A;  2XOK G;  1WB8 A;  2IJJ A;  3QO8 A;  4Z1M G;  1ZLZ A;  4I0X A;  2BE3 A;  4LF4 O;  3CCS V;  4DR1 O;  5AG2 A;  2YS8 A;  4FPP A;  2KB1 A;  3CSX A;  1Q82 W;  1DK1 A;  4O4I A;  4XDK A;  2VQE B;  4GCZ A;  2EIL B;  2OT5 A;  1TGO A;  4K8Z A;  3S3W A;  5LYJ B;  5GW7 A;  3E83 A;  3RYF B;  2X7R B;  4O2A B;  1K97 A;  4O4J A;  1HNZ O;  1GK9 A;  1GO3 F;  1AJQ A;  2Q68 A;  2KG7 B;  1I7F A;  1PNK A;  3JAR B;  5CN0 A;  1SET A;  2Q5Z A;  4JV5 O;  3LDC A;  2RNB A;  2NR5 A;  5KA5 A;  2BCC H;  5L3E A;  2F4V B;  2FKX A;  4O4H A;  1RSO B;  3JAK B;  3S3X A;  4JI0 O;  1XI1 A;  2H94 A;  4GX0 A;  4JZG A;  5DED A;  4GKJ B;  2DMX A;  3L74 H;  2CUG A;  2GDS A;  1KC8 W;  1PP9 H;  2N74 A;  3KZI Z;  3CP1 A;  2ZXW C;  3L9D A;  3T1C A;  1FS0 G;  1IBL B;  2Q7H A;  5IJ9 A;  5JQG B;  1HDJ A;  1NT2 B;  4WBN B;  1JR9 A;  1H2N A;  2Y48 A;  5BR8 B;  2Q69 A;  4DV1 O;  1FFX B;  4LWS A;  1COW G;  2RDC A;  4QPK A;  2WSS G;  2QKC A;  1DLB A;  1N32 B;  4I0X B;  1IBM B;  2QKA A;  2DYS C;  4MVU A;  3SPC A;  1K8A W;  1IUR A;  2YSU B;  1XL6 A;  1AJP A;  2HFE C;  3ZHT A;  5LMN B;  4TQF A;  4DR4 O;  1JX9 A;  1I5X A;  3FYI B;  1B3Q A;  5LMU O;  2B1G A;  4JAA A;  3ASO C;  3EHB B;  2F1M A;  3UT5 A;  3P3P A;  4I5S A;  1RPR A;  4O4J B;  1S5J A;  4K0K B;  4GX5 A;  1BS3 A;  1R3L C;  2DN9 A;  1A32 A;  3B8N A;  2Z0A A;  2HHH B;  3RVZ A;  1I5Y A;  1BHA A;  4X88 A;  4O4H B;  4DR5 B;  4U7O A;  3H9V A;  4QNH B;  4DUY O;  1UPG A;  2Q4P A;  5EIB D;  3A0B Z;  3RYI A;  3ASN B;  3QF7 A;  1TA8 A;  1L8D A;  5KHJ A;  5LP6 C;  2FB5 A;  3BEH A;  4IIJ A;  2E5L B;  3FB6 C;  4D7T A;  3Q4H A;  1XOU A;  1XDC A;  2VQE O;  3WFV A;  1EBO A;  2XAG A;  4LWS B;  4W4K A;  4X65 B;  1R6K A;  1NI8 A;  1KKC A;  1AI4 A;  1N34 B;  3ETQ A;  3OFN G;  1AP6 A;  4FMT A;  4U3J A;  4NB5 A;  1FXV A;  1B06 A;  5B66 Z;  2NLJ C;  3RGB A;  5CBH A;  4I9Q A;  1AJN A;  3T1Y O;  3OTO B;  4WFA V;  2F66 C;  2QE7 G;  2Y69 C;  3N2K A;  4NR1 A;  5B3S B;  4GKJ O;  1R1B A;  1ARO P;  1S3J A;  4UCV A;  4IL6 Z;  1QU7 A;  4J9Z B;  4PHZ A;  2EJR A;  3ZBH A;  3L70 H;  1IBL O;  5B1B B;  5LGT A;  3CCR V;  3OGC C;  1NH2 D;  1GN4 A;  2RCV A;  5BR8 O;  3LNM B;  3N27 A;  2ETN A;  4TV9 A;  4DK0 A;  3RYI B;  1M5I A;  3JAS A;  1R73 A;  1N32 O;  1IBM O;  2JDI G;  4UVA A;  1YTF D;  3LUT B;  4JF3 A;  2UXC B;  1VQP V;  4IIJ B;  4CC6 A;  1P49 A;  2Z3Y A;  5LMN O;  3Q4H B;  1KP3 A;  2ODM A;  2QJ1 A;  4JI3 B;  4DK1 A;  4J7J A;  3RVY A;  1M57 C;  2HG5 C;  5CBF A;  1NR7 A;  2PYL A;  2P6J A;  1JA8 A;  2X0L A;  3ABK C;  3ABL C;  1I0H A;  4FM0 A;  2BSK A;  4U3J B;  4K0K O;  1M56 C;  3SGI A;  1B6Q A;  3OR7 C;  4PI0 A;  2WPD G;  1FYJ A;  2UXB B;  5KAF Z;  4DR5 O;  1SQP H;  1UFI A;  2ZDI A;  4CH5 A;  2UUB O;  1ZAU A;  2HJF C;  3N2K B;  1K73 W;  3WG7 C;  4DXW A;  4Z2W A;  1P4R A;  4MW3 A;  5IYB O;  2HEP A;  4NTX A;  3CMA V;  2HKO A;  4LR3 A;  1L1F A;  5KHH A;  3LDD A;  3ZMS A;  1F51 A;  4LNU A;  4F6E A;  1E79 G;  1BL8 A;  3DC5 A;  3K5M A;  1AI7 A;  3IJ4 A;  1SA0 A;  3DTU B;  1UJW B;  5ITZ A;  4J7Z A;  4C7U A;  5GTI Z;  4X65 O;  1XBL A;  2NN4 A;  4TV9 B;  2B5U A;  1E1R G;  1N34 O;  1F4M A;  3JAS B;  4JI8 B;  1SKV A;  2QM4 A;  5LHG A;  3L73 H;  1YJW V;  2WWW A;  4EFE A;  3ZRV A;  1F7Y A;  1HWY A;  1NJI W;  3N2G A;  4BIO A;  3OTO O;  3IFX A;  1NTZ H;  4PV1 B;  2FL4 A;  4DV6 B;  3FB5 C;  3CB2 A;  5L3G A;  3K08 A;  3HR0 A;  2AHY A;  5KHG A;  1WLE A;  2V1D A;  4OX9 B;  2DQ0 A;  2EZO A;  3P30 A;  4JYC A;  4GKK B;  3SR2 C;  2BSK B;  5L3F A;  2QA4 V;  1TUE B;  2W6J G;  2VQF B;  4WFG A;  3OW2 U;  3ZRS A;  4IYH A;  1FXK A;  1CEZ A;  2OIE A;  2MW2 B;  4BAY A;  5JWP A;  3AG3 C;  4AI8 A;  2P06 A;  4MVQ A;  2AHZ A;  4RUE A;  1SRY A;  2UXC O;  1QVF U;  1SQQ H;  2IM9 A;  1YXB A;  1Y66 A;  1VP7 A;  3UQ8 A;  4LNU B;  4DV2 B;  2N05 A;  2D2C B;  3TXS A;  3D3Q A;  4JI3 O;  4J80 A;  4B7K A;  4KL1 A;  2ZR2 A;  5H6R A;  2O57 A;  4H44 B;  2EIJ B;  4ZKI A;  4LCU C;  2CDY A;  3IC7 A;  2UUA O;  2Y0I A;  3BHP A;  1YJ9 V;  1GN2 A;  3OUS A;  4ZHQ B;  2JK5 C;  3T1H B;  1JPX A;  2PGG A;  3JD2 A;  4RUF A;  3MD0 A;  3ZX6 A;  4AIL C;  4UFZ A;  5JH7 B;  3LSQ A;  3N2G B;  5IY5 C;  2F23 A;  2UXB O;  4LH7 A;  5K1X A;  1BQZ A;  1QLE B;  4NTW A;  4Z1V A;  1NVP D;  4EB6 A;  4WCE V;  5IJ0 A;  3CCE V;  3OGI B;  1K5Q A;  4X89 A;  1Y4M A;  3T4Z A;  4D7S A;  2YXY A;  4DR1 B;  1VQ9 V;  4TWK A;  2XAF A;  2XND G;  1SF9 A;  4QE7 A;  2XT9 A;  4G28 B;  1H8E G;  3THO A;  2XAQ A;  3DGE A;  1SQF A;  4LBE C;  1NZ6 A;  1FXK B;  4DR6 O;  5GTH Z;  4NXM O;  2WLI A;  3JD4 A;  3K04 A;  3O9O A;  2GUZ A;  1HNZ B;  2VRZ A;  5LGU A;  4DV0 B;  5EBL C;  3UO3 A;  2CTR A;  5KA6 A;  4WFH A;  1MG1 A;  1AR5 A;  1R6T A;  3JAL A;  2IJK A;  1GKF A;  3AG2 C;  3QO7 A;  1BZK A;  4DV6 O;  1RM1 B;  1W0K G;  3BPZ A;  5LHH A;  1Q81 W;  3F7Y C;  1MMM A;  3APQ A;  3FAV A;  4XDJ A;  2CTQ A;  3L75 H;  1V54 C;  1JVM A;  4EFB A;  4OX9 O;  3MHS C;  2PYJ A;  2EIN B;  2ZCE A;  1V55 B;  2VQF O;  1BMF G;  2LP7 A;  5CB4 A;  1IXM A;  1EN5 A;  4UUJ C;  4IYI A;  2EIM B;  3LSU A;  1Q90 D;  4JTD B;  1VQ6 V;  4BWA A;  5BZB A;  4EB6 B;  5IJ0 B;  1VQL V;  5A9G A;  3B2E E;  1MOF A;  3O65 A;  1Q8I A;  2L35 A;  4XBF A;  4JGS A;  4KUM A;  3ETG A;  2R9R B;  2QWO B;  3K58 A;  3A2F A;  4DV2 O;  3J80 N;  3CCL V;  4X1Y A;  2QKS A;  2WLI B;  5C93 A;  2CE4 A;  1GN3 A;  2GUZ B;  3A0R A;  3FX7 A;  5J9P C;  4U3F H;  2Q0A A;  1IVS A;  3T1H O;  3H1I H;  3CPW U;  2YEV A;  3CC4 V;  3JAL B;  3SYO A;  2ZIM A;  4NYK A;  2P5O A;  5L3D A;  4K35 A;  1SQG A;  3CCQ V;  1XEQ A;  3CXH F;  2YI9 A;  5FLX N;  2DW4 A;  3OD4 A;  5D5Q A;  3E8H A;  2A06 H;  4QGP A;  3FAV B;  1Y6X A;  2WLL A;  2A9H A;  4CH3 A;  1MZF A;  2QDO A;  5J2T A;  1MSW D;  3FD9 A;  3JAW A;  4KXR A;  5D5P A;  5CB4 B;  3SYP A;  4GX2 A;  1KP2 A;  3HB3 B;  1NTK H;  1SES A;  4CH4 A;  1PNM A;  1NU1 H;  2QEX V;  3VOU A;  1YTF B;  3CME V;  2F93 B;  2QM7 A;  3PJS K;  4DV0 O;  1M1K W;  4N21 A;  3T1Y B;  2XTA A;  4ASU G;  5KHI A;  1NKD A;  4I4T A;  4Q6G A;  4LF9 B;  1FAF A;  4X1Y B;  1D2D A;  5LXT B;  2IU3 A;  3H1K H;  1OCZ B;  1XIL A;  2N04 A;  1GRJ A;  4TQD A;  5FL7 G;  3TJT A;  4FLX A;  1QNM A;  1KU9 A;  1WAZ A;  2EIK B;  4J7K A;  1YI2 V;  1AR4 A;  2GHY A;  5EBW C;  1R3J C;  2P90 A;  4F6R A;  1OCO B;  1GAX A;  2L6L A;  2ZKO A;  1F4N A;  3ASN C;  3KG2 A;  1H2G A;  2EUL A;  1ZL8 A;  3ZMT A;  2R70 A;  1OJH A;  1PPJ H;  4UCR A;  2WLL B;  2F43 G;  2R9I A;  3TCU A;  2X6A A;  3FB7 C;  3ZS8 C;  4JAV A;  5DN6 G;  5J2T B;  1EZV H;  3MDS A;  3ZHV A;  3MHH C;  4O4I B;  1URF A;  4PA7 A;  3ZED A;  1FJG B;  2YIC A;  4IGG A;  1P7B A;  3GVM A;  3ZJZ A;  3F7V C;  1KD1 W;  3OMA B;  4RQF A;  2JGD A;  3ZN1 A;  4FIP C;  2WLM A;  1EM1 A;  5KX5 A;  2ZIN A;  5HFM A;  4ZOL A;  3F5W C;  3H1L H;  4I4T B;  2UUB B;  1JJO A;  1WA8 A;  2ZQM A;  3UO2 A;  4J11 A;  5CA1 A;  3JD0 A;  3DC6 A;  3VQV A;  1XRE A;  4OPA A;  3M99 B;  1Y76 A;  5B1B C;  4X20 A;  2CAZ C;  1VQM V;  4K8X A;  2ZXW B;  1KMI Z;  1WJZ A;  3CWB H;  3F5T A;  5J2U A;  1VQK V;  4F6R B;  2HVJ C;  3KCX A;  1Z2G A;  5IJ9 B;  3L71 H;  3ZMV A;  1H2M A;  2X6B A;  2PZS A;  5IYC O;  1VQ5 V;  1Q7Y W;  2W6I G;  1ZL8 B;  2RQ6 A;  4MVZ A;  4TT3 G;  1OCR B;  3RYC A;  2ATK C;  1OV9 A;  2QR4 A;  3ZRX A;  2A7W A;  5GON A;  4JAU A;  4B3T B;  2IW5 A;  2Q73 A;  1WB7 A;  3BFR A;  5CA0 A;  2DYS B;  4MSW C;  2XUM A;  4EEQ A;  1QQC A;  2YDE A;  3E35 A;  1K3E A;  4OGQ B;  2YXH A;  1YCI A;  4LF9 O;  5JCO A;  3R66 A;  1AR1 B;  4N23 A;  3BA9 A;  3CCV V;  2OCC B;  3UT5 B;  1GTO A;  3T2M A;  1M90 W;  2W0F C;  3JD3 A;  5KAI Z;  4O4L A;  4MS2 A;  5KUK A;  1H2L A;  5H9C A;  2XAH A;  4I55 A;  1F23 A;  2JGD B;  4GT1 A;  5KX5 B;  2DWD C;  1W59 A;  1AIL A;  1FFT B; 
#chains in the Genus database with same CATH homology
 2ZM6 O;  1I94 O;  4GKK O;  5LMN O;  4JI4 O;  4AQY O;  1XMO O;  1HNZ O;  4DUY O;  5BXZ A;  4JI7 O;  1NS1 A;  2UUC O;  5BY1 A;  1AB3 A;  1XNQ O;  1R6T A;  4JI2 O;  1FKA O;  4DR2 O;  4JV5 O;  1HR0 O;  4DV6 O;  1IBK O;  4K0K O;  5IT9 N;  2FKX A;  4NXN O;  4JI0 O;  1XMQ O;  2F4V O;  3SDL A;  5IWA O;  2VQE O;  2E5L O;  4X64 O;  1YZB A;  4X66 O;  4LF6 O;  4OX9 O;  2UXC O;  1FYJ A;  4DR5 O;  2N74 A;  3RT3 C;  2UUB O;  1FJG O;  4JI3 O;  4OPA A;  2VQF O;  5A2Q N;  1N36 O;  4DV0 O;  4KHP O;  1G1X B;  4DV5 O;  4JI5 O;  2UUA O;  3F5T A;  4A5U B;  3T1Y O;  4DV1 O;  4LFA O;  1D2D A;  4B3S O;  2AGA A;  3O65 A;  1N33 O;  1KUQ A;  4GKJ O;  2JRI A;  2DJV A;  1R1B A;  2UXB O;  2HHH O;  1HNW O;  4X65 O;  4JI1 O;  4YY3 O;  4DV2 O;  5H5N A;  3J80 N;  1XNR O;  1J5E O;  1N34 O;  3JAM N;  5LL6 Y;  4JI6 O;  4YHH O;  4B3M O;  4B3R O;  3J7A U;  2ZKO A;  4DR4 O;  4DV7 O;  1IBL O;  4DR7 O;  1HNX O;  4DV3 O;  4JI8 O;  1F7Y A;  4X62 O;  2UXD O;  4JYA O;  5LMU O;  3J81 N;  1X59 A;  5BR8 O;  4LF7 O;  4LF9 O;  4LFC O;  4LF4 O;  4LF8 O;  3OTO O;  4LF5 O;  3R66 A;  4DR1 O;  3T1H O;  2LW7 A;  4DV4 O;  4DR3 O;  4LFB O;  3M8A A;  1A32 A;  1DK1 A;  4DR6 O;  1N32 O;  1IBM O;  2Z0A A;  2UU9 O;  4NXM O;  4B3T O;  4DUZ O;  1XEQ A;  2DOS A;  5FLX N;  4OPH A;  1AIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...