4JI4O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule keywords 16S rRNA
molecule tags Ribosome/antibiotic
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4ji4O00
1I94O 5BY1A 2ZKOA 4JI2O 2JRIA 2AGAA 1HNWO 1HR0O 1AILA 4LFBO 1YZBA 1NS1A 4JI0O 4X64O 3J7AU 4DR3O 4JI4O 2F4VO 5H5NA 4DR1O 4DR6O 4GKJO 4K0KO 4JI5O 4GKKO 2DJVA 3JAMN 2UUBO 1X59A 4DV4O 4DUYO 1FJGO 4LFAO 4DR4O 2UXCO 2DOSA 5A2QN 4YY3O 3O65A 4LF6O 5FLXN 4AQYO 3T1HO 1XEQA 4X65O 4DR5O 4JI8O 2N74A 1XMOO 4JI3O 1N34O 4LF4O 4DV7O 4YHHO 1J5EO 2LW7A 4DV6O 2UUAO 1IBKO 4B3RO 3J81N 2FKXA 1D2DA 1R1BA 1HNZO 3R66A 5LMNO 4OPHA 2HHHO 1FYJA 4JYAO 1FKAO 1G1XB 4X62O 4DV5O 4DV2O 1HNXO 1N36O 4LF8O 1XNQO 4B3MO 4NXMO 5BR8O 2E5LO 3J80N 3OTOO 1A32A 4JI1O 1R6TA 4DR7O 1N32O 1F7YA 4B3TO 2UXBO 3F5TA 3SDLA 2VQEO 4A5UB 1DK1A 5LMUO 4LF5O 5BXZA 4X66O 4LF9O 4DV3O 4OPAA 1IBLO 1XNRO 3RT3C 1AB3A 4KHPO 3M8AA 1N33O 4DUZO 4DV0O 2UXDO 4B3SO 2Z0AA 2VQFO 1IBMO 4JI6O 4DR2O 1KUQA 4LFCO 2UU9O 4NXNO 4JV5O 2ZM6O 4JI7O 2UUCO 5LL6Y 4DV1O 4LF7O 4OX9O 3T1YO 5IWAO 1XMQO 5IT9N
chains in the Genus database with same CATH superfamily
2WLLB 3B40A 4GKKB 1P7GA 5EBWC 1NT2B 1VQ7V 2R9IA 3J7AU 4OGQB 4JI4O 1VQ8V 1BHAA 2BOCC 3KCYA 1V54C 2EINC 1K8AW 3VOUA 1Y74B 3G80A 5LGTA 3ZHQA 4B3MB 4NXMB 5IYZA 3ABLB 2HLDG 3RYCA 2EILC 4WBNB 1SQGA 2G38A 5BZBA 4JI8O 4ZOLA 5B66Z 2F93B 3BY6A 1F23A 4ZIBA 2WWWA 4GYCB 2FKXA 4LH7A 5CBFA 3ABTA 1HNZO 1W2BU 1XNRB 2LW1A 4DV5B 2L6LA 1MNGA 5DEDA 1V55C 2ODMA 3BHPA 3OTOB 2QWRB 4AILC 3CC4V 1SQVH 2CTQA 1KQSU 2MK3A 3L72H 4PA9A 1IZ3A 1BCCH 3J80N 1WP8A 3K9SA 3MD0A 2FMLA 4JI1O 2A0LA 2OYQA 4EEQA 3SDLA 3JATA 4F4LA 1URFA 3MHHC 1DF4A 2EJ7A 4CH3A 1X4TA 4LF5O 5JJEB 4X66O 1ZX3A 2YC0A 4X20B 1IXBA 4MVQA 4X64B 1HWYA 4IGGA 3HKBA 1AB3A 1VMGA 3K5NA 2V4DA 2DWEC 2GUZB 4FFBA 4JTAB 2CE4A 2P06A 3RW0A 2P5OA 1MG1A 1KYOF 3B8MA 2Q6AA 1I5YA 1J95A 2ZNIA 1BHBA 4JI3B 4FLTA 2ZQMA 1K4DC 4JYCA 1IBKB 3CJHA 1SRYA 4FVMA 2WLHA 4PELA 2Q69A 1AILA 2UUBB 4JI0O 4QGPA 3BAAA 1MSWD 1JJOA 5IYCO 3KG2A 4X62B 5CA1B 1BGYH 1FXKA 1OHHG 3N27A 4TSFG 4CH6A 2E5LB 1VQ4V 4IIJA 4DR4O 2E3CA 1FFXA 3SPCA 1N32B 4AQYO 3FX7A 1FS0G 2QWPB 2XAFA 3K0GA 4JZ2A 4FLZA 1DF5A 1AR4A 3LSSA 2DQ0A 3W7XA 1VQ6V 3P3NA 1QR8A 3CMEV 2IBZH 3JD2A 1R1BA 1VARA 2JGUA 4HZ3A 2CGOA 1HNXB 1Q6HA 2IH1C 2JS5A 5BMVB 3RVZA 5IDJA 4JYAO 2LGWA 3JCZA 3ZRVA 4UCRA 4KXRA 3GWOA 1ZAUA 1US6A 1L8DA 4DR7O 3D3QA 2OWOA 2UXBO 3F5WC 3ABUA 4J42A 2ZR2A 1AI4A 5GTIZ 3K0DA 4J9ZB 3GWKC 1WN7A 2WLJA 2Q68A 4JTCB 2Q7GA 3M7MX 1ZSPA 2PUSA 1YHQV 2PI5A 2IH3C 2OCHA 2QR4A 1FD9A 1EZJA 5EZYA 3M8AA 5L3BA 1NTMH 4DV0O 3QNEA 5LGNA 1GTOA 2QEXV 4TQDA 2Z0AA 3JD1A 1H8HG 2O57A 3ZHTA 4I7ZB 1RPOA 4NXNO 2ADQB 2HKOA 1N34B 3RFRA 4PI0A 2XT9A 1GN3A 3CCSV 3OMIB 3H1JH 1VIBA 4U3JA 3UQ8A 2D3OW 2AHZA 2H8PC 3OFNG 2BOBC 5LOVA 2KKWA 5E79Z 1L0LH 4WFHA 2ZE5A 2ADPA 4Z1MG 4O4IB 2PY5A 2QM8A 2CH7B 2YEVA 4PDVA 3T1HO 2Z3YA 3EVKA 2NR5A 4YHHO 2QWOB 4TOIA 1DTOA 1EN5A 4FLUA 5KUKA 3SPJA 3ASOB 1SZTA 1K5QA 3O9OA 5ITZA 2HHHO 5CMUA 2Q7HA 5J9PC 3B77A 1FYJA 2F43G 3CRAA 4N23A 4JAUA 4LP8A 5FNVB 5D5PA 4B3MO 4NXMO 4FFKA 5EIBC 3AG7A 1PNKA 1MSDA 2UXNA 4FM0A 4JV5B 4UCUA 4MVMA 4P2ZA 4FLVA 2IM9A 1WJZA 3E8HA 4IT5A 5EC2C 2RJZA 3CSXA 3DXRA 2NLJC 5JH7A 1XNRO 1I0HA 4LR3A 3HKDB 3JSNA 4UVAA 3QO8A 1JFFA 2JJ2G 5B1AC 5FPOA 1YTFD 4XDLA 2QKSA 4BWAA 4BIOA 2OT5A 4O2AB 2VRZA 2LGQA 3D36A 4UV9A 5EC1C 1ORQC 1QLEB 3EXAA 2QE7G 4WFEA 2P4KA 3LDDA 2Y0PA 2ZD9A 4DK1A 3IC9A 2YXLA 1NU1H 1Y76A 2V1DA 2GDSA 4JI4B 3B2EE 2WLNA 2WLMA 3OM3B 3FFQA 2CUGA 4TV8B 1YEWA 3VQVA 4X64O 2IJIA 3N2KB 1M9NA 1OCOB 3JALA 2ILMA 4MT8A 1N36B 1V54B 2IJKA 1YJ9V 4PDLA 4JI8B 3SJAC 1P4RA 1FXKC 2BCCH 3ZCCA 1NH2D 4MTXA 4I0XB 3HKCA 4JI3O 3AG2C 2EILB 4I50A 2RDCA 3CXCU 4W4KA 1AVMA 4DV6O 4CS4A 1KU9A 1IBKO 4DRXA 2OTLV 3J81N 1FPOA 1XBLA 1O9GA 4E4EA 1D2DA 4JF3A 3K06A 1EM1A 2QKAA 4WFBV 2CK3G 2K1EA 2QKCA 5B1BC 1BE3H 2KG7A 4O4JB 2WPDG 4X62O 1V55B 3FAVB 5JVDA 2F66C 4AHCA 2R9RB 4FK5C 1SS3A 2E5LO 4UCOA 3H1KH 1R73A 4LFCB 1N32O 1JJ2U 1K33A 4X66B 2X6AA 2R70A 2BSKB 2KB1A 2HFEC 4EFEA 1IX9A 4J11A 1QBZA 1H2LA 3AG3C 1Q86W 3I56V 1P84F 4GCZA 2NNUA 4X1IB 4ZBMA 4GKJB 1O9HA 1GM7A 1M4UA 1CPYA 4UVCA 1D5NA 3IJ4A 1IBMO 2YUAA 1VQ5V 5LP6A 5KHJA 1XOUA 3ZRWB 2ZXWC 3DC6A 3SYCA 4DR5B 3SPGA 3L9DA 1OCZB 4ABMA 2W0XA 3RYIB 3CS5A 1XI1A 4N21A 4NTWA 1ZL8A 3CRRA 4YJ3A 1YTFB 1W0JG 5CA0A 1JX9A 4RO2A 1K34A 2W6JG 4K0KO 1R6NA 2RNBA 5CB4B 4DR4B 4MSWC 3RYHB 5CBHA 1QR9A 5JWPA 1R3JC 2OCCC 4LF8B 4KFMA 3ZHSA 1K92A 4U3FH 4X1YA 3H1HH 4PA3A 5IY5B 5J2UB 4L8JA 1QVFU 3ASNC 1N0JA 4X65O 1M56C 4PDRA 2XAHA 4LCUC 3JD3A 1N34O 2DN9A 5J2TB 2P7TC 2DYSB 1S77D 4MVUA 4ICGA 1SQBH 3AK2A 3I55V 5L3FA 1VEWA 1TVKA 4UCTA 2ZNJA 3RYFA 5LHIA 4J7ZA 3A8TA 4DR7B 1NH2B 1N8RW 1PPJH 2UXBB 4GX1A 4EB6B 1AI5A 1XNQO 2RN9A 1A32A 1Q6UA 1WPXA 3OGCC 1GM8A 4CH5A 4GX2A 3SYAA 1PNMA 3HPLC 1XMQB 3ZHRA 3JAKA 2AHYA 4FMTA 3CWBH 3K79A 3TJTA 5F2VO 1VQOV 4ZI7B 4DR3B 4QNHB 2HJDA 2Y69C 4FIPC 5IJ9B 1YXBA 4WF9V 2ZCEA 4C7UA 5B3SC 4D7TA 4B08A 1OCCB 4O4LB 4NXNB 3ZN1A 3K03A 4BAYA 4FLWA 1FXVA 3G67A 3RGBA 3T4ZA 1KP3A 2UU9O 4JV5O 1PM9A 1PP9H 1MABG 3D36C 3CX5F 5DM6V 3L75H 1GO3F 5JQGA 3Q4HA 3P32A 4I55B 4PA4A 1KC8W 3SR2C 1CEZA 1DGSA 2YIBA 2DYRB 1WLEA 1YZBA 3CYOA 5H5NA 5KHHA 4J9YB 4JI5O 1GN6A 4JAAA 3THOA 4NVPA 5LYJA 2ITDC 2WLIA 1XUQA 4UCSA 3DGEA 3OR7C 4YHHB 1H2NA 5C8YA 2EIJC 5FLXN 1BZKA 3W7TA 5KA6A 2HHHB 2ITCC 3RYCB 4ZOLB 2E76B 4OXSA 1SKVA 2XTAA 2DWDC 2UXXA 3U10A 1VF7A 1N36O 1XL6A 3UT5A 1M93A 1BT8A 3K58A 3FB8C 2DMXA 1S72V 4UB8Z 2PF4E 5KAIZ 4LF7B 2VQEO 3CRCA 1I94B 5BXZA 1KD1W 3SGIA 4CH4A 1HR0B 3JATB 3N2GA 3ZMZA 1TGOA 3CC2V 2Y0IA 3JASA 5B1AB 3ETDA 2YI9A 3HKBB 3K57A 1PV0A 4WBNA 1VQMV 1YIJV 4DR2O 3NXSA 4LFCO 5LP6C 3OMNB 2BTQA 4CC5A 4LF4B 1HW7A 4HNAA 1LUWA 3FYEB 3C3TA 2HEPA 2EBOA 5BY1A 2P90A 3OEEG 3WB0A 4B7EA 2QTSA 2GHYA 2F4VO 1XREA 3CJHB 1RP3B 3PJSK 4GKJO 3FB7C 5CN0A 4U7NA 4UFZA 3LDCA 4DUYO 4J80A 4KUMA 5GONB 4RUFA 5KHKA 2Q4PA 4DV6B 1NQTA 1H2SB 3LNMB 1AJQA 4DR5O 2GTAA 4IIJB 1FFXB 3AG2B 4GT1A 1KB9F 4J7JA 3SYOA 3HR0A 2QM7A 3QO7A 1OZ0A 2P67A 5LHHA 2XAJA 5KHGA 3E86A 4TT3G 3CPWU 5EBLC 3OE7G 1TUBA 2HP8A 2GUZA 2IJJA 1SQPH 4LF8O 4F6EA 2QA4V 1YSCA 3K04A 4JI7B 3ML0A 3AG4C 2EZOA 2Q5ZA 3LSQA 4DV3O 3SJQC 1GKFA 3AG3B 3AG1C 2LO1A 4ZKIA 1IBMB 5CA1A 4UB6Z 3IFXA 1KP2A 2XUMA 4TV9B 3ZIAG 5A9GA 3A0RA 1YDXA 1ROPA 4PI2A 4B7KA 1SA0B 3R65A 1SQQH 4JTDB 5EZYB 3TXQA 3NR7A 5B1NA 2Q0AA 1QNMA 4FM2A 4ZHQB 1AROP 4PV1B 2UUCO 1XHXA 2P4VA 3OGIB 3RBZA 1XMQO 1FFTB 4K35A 4K0KB 3H01A 2QGNA 1K9MW 1GN2A 1NS1A 4DR3O 1NKDA 3ZMSA 3T2MA 1S0VA 4HYOA 2B1GA 3BFRA 1FXHA 1L1FA 3RWRD 3CP1A 5DECA 4WFAV 4DV4O 5LOVB 2CTRA 4X65B 1B06A 2OCCB 1IURA 2JK5C 3O65A 1S76D 2ZIMA 4IHJB 2N74A 3C90A 1J5EO 4I9QA 3E2EA 1M56B 3CMAV 2CAZC 2Q73A 2PZSA 2ZE6A 4G2KA 1MOFA 3JARA 1UPGA 4KHPB 1XNQB 1XDCA 3UO3A 2QM4A 2EULA 5KMGA 5IJ0B 3TXSA 1BQZA 4J41A 5JJJB 4CZZA 3ZHUA 5AG2A 4O4HA 1K4CC 3ETEA 2EIMB 1M57C 2EIKC 1W0KG 3WG7C 4JASA 2YICA 4F6RA 2YDEA 3HKEB 5EYPA 4MVRA 5L3EA 1QCEA 4O2BB 4HBNA 4MTGA 1RM1C 1JOYA 4UCVA 2X6CA 3RT3C 1XILA 2HVKC 4O4IA 2YIDA 1NI8A 1JR9A 2Y69B 4FLXA 5JH7B 5IE9A 2UU9B 5B3SB 2CH7A 3K08A 3I5DA 4BIUA 1JFFB 5EBMC 4X1KB 3ABLC 1KUQA 5L3DA 2ZM6O 3CRQA 4LF7O 4JYYA 1Q3EA 1TUEB 2QWNB 2JGDB 1I94O 2AW9A 2ZKOA 1HNWO 1HR0O 4JI5B 1Y4MA 5LMNB 1Y76B 1AI7A 2GTSA 4QPJA 5KX5B 3B4SA 2RQ6A 3IAYA 5FNVA 3JD4A 3FKSG 1N4CA 4PA7A 3OEHG 2Q7EA 3UCSC 4FPPA 3RVYA 3JYCA 1FAFA 3DSQA 3JALB 4K8XA 2AXTZ 4LF4O 1M90W 2P22C 1WB7A 3MAQA 4PDMA 2UUAO 1NTZH 3E83A 1N0NA 3ZEDA 1B6QA 1I7FA 3TK1A 3BPZA 4OPHA 2EINB 1R3KC 4XBFA 3L70H 1T5EA 2PYLA 5GW7A 4H33A 4PJ0Z 5D5QA 2VQEB 2F95B 2X0LA 2Y48A 1M1KW 5KHIA 2LP7A 3F5TA 3FD9A 1SETA 1Z5VA 1YJNV 1W59A 4R7CA 1H2MA 4DK0A 1Z2GA 3N2KA 4TUYB 1EN6A 2CTPA 2VWKA 3L74H 4I4TA 4XDJA 1PD3A 1YJWV 5E1AC 4DR2B 4FLYA 4QE9A 1OCRC 1KECA 2PTMA 1NR7A 1RFYA 2QWQB 2YIBD 2IU0A 1NVPD 4JI7O 5LL6Y 3G4SV 2KSDA 5LP6B 3GB7C 3DC5A 1SF9A 2R72A 4RAIA 4X8AA 2F4VB 2XHBA 1TA8A 4P9OA 1K97A 5H6QA 5TISZ 2QTOA 3CCRV 3EHBB 4LNUA 4O4JA 3ZX6A 4DUYB 3G6EV 1ZL8B 5CA0B 3OMAB 1ZLZA 2Z5UA 2ZR3A 3K5OA 1FJGO 1MZEA 1VF6A 1VQLV 3FB6C 4LF6O 2VS0A 1WA8A 3APOA 1RPRA 3ZRSA 4DV7O 1H2KA 2BSKA 4MVOA 3AK1A 3UO2A 1D5AA 4D6TH 4JZGA 4X1IA 4BW5A 1H2GA 5JCOA 2NN4A 2FL4A 3TCUA 3VBBA 1N33B 2M7WA 4HAMA 1FKAO 4Z1VA 2CDYA 4MTFA 2YIAA 4PD4F 4H0LB 3KKYA 4LWSA 1E1QG 1JA8A 4YXWG 4MTOA 4DV3B 1S5LZ 4NYKA 3OW2U 1KKCA 3T1CA 3IC7A 5LXTB 1HDJA 3OR6C 1BS3A 4OPAA 3E8FA 1PL4A 4DW1A 4DR6B 3CB2A 4KHPO 1MMMA 2CGNA 1VQPV 4J10A 2UUCB 2UXCB 3QG5A 1RSOA 1SERA 5LA6A 5L3GA 3JAWB 5J2TA 4DV1O 1SZXA 3F7VC 1YF2A 1ZUQA 1KBHA 4ASUG 1R3IC 3PN1A 2D2CB 3QO5A 2AGAA 3FB5C 2A79B 3AK3A 4QIWF 3MHSC 4MW8A 4UV8A 3ASOC 1JCHA 1LUVA 3QF7A 5JQGB 3Q4HB 4DW0A 4DV4B 4CS3A 2YI8A 1XQ8A 2DJVA 2JEUA 4DV2B 4H37A 2FTKA 4EB6A 1F51A 1NVPB 1QLNA 2ZE7A 1VQNV 4X9QA 1Q43A 2ZIOA 4YJ2A 4TQFA 2DOSA 1J5EB 3K5MA 5LBQA 2Q8VA 2WLIB 2GV9A 3B09A 1P49A 3BEHA 3UKMA 2OTJV 3CCQV 3S3WA 5C8YB 3U11A 4B3RO 2WAMA 1TAEA 1G8MA 1I08A 1GMGA 4R6ZA 3E8BA 2EZPA 1IBLB 4P9PA 1K3EA 3R66A 5LMNO 2ETNA 1Q8IA 1QVGU 1H38A 2UXDB 4O4LA 1K7DA 3WU2Z 1MZFA 1WP7A 3D8CA 5BR8O 2RMKB 2JEXA 1WPBA 2JIZG 5IYZB 3CCUV 5HFMA 2LQTA 1QLEC 4WFGA 4I55A 5FPRA 4A5UB 4QJFB 1M57B 2BTOA 3WG7B 4JGSA 3T4DA 1EN4A 2FB5A 3JD0A 1U96A 4YIOA 3STZC 3CCLV 4WCEV 1BL8A 1GN4A 1RM1B 1NTKH 1GAXA 3N2GB 4DUZO 4CC6A 1OCOC 3A0BZ 2ZM6B 5H9CA 3E22A 4YIPA 4MVZA 3JASB 2WLLA 4RUEA 3DTUB 3HB3B 1HNWB 3E89A 4CBCA 3P30A 3K9AA 2QJ1A 1VF5B 3CEIA 2B5UA 2RCVA 2BTQB 3CCEV 4GZRB 4LFBO 3SYPA 1Y74A 4HNAB 3ZBHA 3CRMA 2W0FC 4IYIA 1YI2V 3WFVA 3H1IH 4FFBB 4NKGB 1R3LC 5CA3A 5KA5A 1QHTA 3TETA 2UUAB 4YY3O 2X6BA 1VF6C 4IL6Z 4BW9A 1LR1A 2LFRA 2QDOA 4RQFA 2H3OA 3F7YC 3KZIZ 1BQ0A 1B04A 2F23A 2JJ1G 2E75B 1COWG 4Q20A 5JCOC 1Q90D 4LBEC 3BCCH 1FXKB 3LSUA 5IYDO 1YITV 1TUBB 2XOKG 5EK0A 3L73H 2WA3A 3A0HZ 4L87A 2L35A 4JYBA 4W4LA 1OV9A 4QPKA 1VP7A 3ETQA 4X20A 1OCZC 1Z5WA 1AJNA 1V9PA 3ICXA 3G6BA 3CE2A 3U0ZA 3STLC 5B1BB 4DR1B 4UXNA 2AZ0A 5FL7G 1N33O 3ABMC 1S5JA 1E1RG 3M99B 5GONA 3CCJV 4FZ1A 4LFAB 2N04A 1OCRB 3K3WA 1SQFA 5IY5C 1AP6A 4Q6GA 1SESA 1PL0A 4FZ0A 1F4NA 3P3PA 3T1YO 4UVBA 1UFIA 4PA6A 2R9AA 4JI2O 2DYSC 2JRIA 5K1PA 2LFSA 2A7WA 3BA8A 1H8EG 3JSLA 1FJGB 5K1XA 4DR6O 2WSSG 4LC1A 4LF6B 2HVJC 1IVSA 4LH6A 3ABKC 2Q0OC 1GRJA 5KLVH 3X2QC 5DN6G 2ZXWB 4DV7B 2UXCO 3WB1A 1SC5B 3KCXA 1Y6XA 3IGAC 2LJ2A 2LW7A 2DW4A 3JCUZ 3SJCC 1BSMA 1EZVH 5BMVA 4X88A 2IU3A 1KKDA 1Q5OA 2ZE8A 1MA1A 4U3JB 2AZ2A 4PHZA 4TV9A 1JMKC 1UJWB 3LUTB 3FYIB 1SQXH 1G1XB 3JARB 1IXMA 2IW5A 4DV2O 4B3SB 1PNLA 2VQFB 1OJHA 1QQCA 1SA0A 1OCCC 1AP5A 5H2FZ 3ASNB 2ZDIA 4ZHQA 5KMGB 2YEVB 1NBMG 4OX9B 1S3JA 1LNQA 4O4HB 4R50A 5LMUO 4G28B 2BE3A 3SYQA 3OD4A 3H9VA 1NJIW 2ATKC 4LF9O 1IBLO 5LGUA 3CC7V 1AR5A 2DYRC 3D3IA 4F6RB 5ITZB 5EYPB 5B5EZ 2HG5C 1Y66A 2UXDO 3VQWA 3RN4A 1AJPA 2M6YA 4DV1B 4I9WA 1E79G 1P7BA 2WA4A 3SJBC 3GVMA 3ZMTA 4JI6O 3APQA 4IHJA 4R8CA 2B1IA 1XMOB 3SPIA 3OTFA 5IWAO 2PYJA 2H94A 3BRCA 3DXRB 1EFRG 4FJCC 2DQ3A 3A2FA 4H13B 2XASA 1GK9A 4GKKO 1PKXA 5IJ0A 2ZT9B 3ZHVA 2A06H 3C3SA 2HR3A 3UM7A 1Q6IA 3E35A 2DE0X 1ENVA 1Q81W 4B3TB 4B3RB 1XEQA 3HKEA 1JPXA 5L3CA 4O2BA 3LNNA 1F4MA 4E2LA 1G6UA 1AI6A 5BR8B 3ZN0A 3H1LH 4H44B 4U7OA 4DV5O 4D7SA 3ZMVA 4K3AA 3OT7A 4X1KA 2EIJB 1NR1A 3OTOO 4DO2A 1S5HC 2B9ZA 4GX5A 4BIZA 1K73W 3HKCB 2JGDA 3MDSA 4I50B 4CS2A 3HKDA 1GM9A 4DRXB 4TWKA 1K5SA 3CHXA 1ZWIC 2ZINA 2IJHA 4DUZB 5GTHZ 5KX5A 3OAAG 4O2AA 3L71H 1DLBA 2A3QA 2KG7B 2EJRA 3W7SA 3OUSA 4DXWA 1KMIZ 5JVDB 4GLXA 1R6KA 4I4TB 4RQEA 4TV8A 4LFBB 3EFFK 3ZJZA 1M5IA 2KQXA 4GX0A 5C93A 1HNZB 2YXHA 1GH6A 4EKWA 4X89A 4Z2WA 1G4YB 3BA9A 4DR1O 2X7RB 3CXHF 2F1MA 1Y67A 2UUBO 2W6IG 4YY3B 1B3QA 1X59A 4GUNA 4LNUB 4I0XA 3W7UA 5KUMA 1YCIA 4LFAO 2ARHA 4JI1B 3WB2A 2Q9LA 4MVSA 3LDEA 4UUJC 3W7WA 3ZS8C 4LF5B 3BABA 4WFFA 5KAFZ 5HFLA 4BR6A 3OUFA 3TGUH 1WA8B 4TUYA 2PI4A 3FAVA 4YJ3B 2GSMB 2Y4UA 3ZRXA 3QTCA 4NR1A 4NB5A 1HNXO 1EBOA 1L0NH 2HJFC 5JJNB 2E74B 4G27B 2XNDG 1R6TA 4X1YB 5B1OA 2QSAA 1F7YA 4IYHA 2ZDIC 4JAVA 4LWSB 4DYLA 3ZMUA 4JI0B 2P6JA 1CXZB 1AR1B 3QVNA 1ZTEA 1TVKB 2XAQA 3ZRWA 3RYFB 2JDIG 3VQYA 2Q67A 4AI8A 4B3SO 3ABMB 2VQFO 3G71V 2V7QG 3RYIA 4MS2A 3T1YB 4AQYB 4RWUA 3AG4B 4JI2B 4J7KA 4I5SA 2A9HA 4OX9O 1RSOB 2JS3A 1XL4A 5IT9N 2YXYA 5LA6B 3JAKB 2YSUB 2N05A 3VQXA 5CB4A 5LHGA 3RYHA 3AG1B 3AEIA 2GBOA 5EIBD 4JYAB 2WLKA 3JAMN 5IYBO 4K8ZA 5J2UA 2PGGA 2K9PA 1WB8A 4KL1A 1I5XA 4P30A 3K5LA 3ABKB 5A2QN 2CTWA 1WNSA 3X2QB 3K59A 1JVMA 1HP8A 1XMOO 2EIMC 2XAGA 4QE7A 4YJ2B 5LXTA 1CP9A 2EX3A 4KP4A 3CCVV 1U97A 2Y4TA 1XHZA 1IDSA 3S3XA 2VWJA 4MW3A 5CBGA 1BMFG 3BVOA 4DV0B 1Q7YW 2FYUH 3ETGA 1NZ6A 5LYJB 4NTYA 2MW2B 5LMUB 3JAWA 4B3TO 1VQ9V 4FM1A 4LF9B 4ZI7A 1DK1A 4NTXA 5IJ9A 3E8GA 1THZA 1Q82W 3CCMV 2JVDA 4EFBA 2OIEA 4XDKA 2OIGA 3B8NA 4JI6B 1YVWA 1JQ0A 5H6RA 3CD6V 3UT5B 5IWAB 3SPHA 3T1HB 2C2AA 2EIKB 4JPRA 1QU7A 2YS8A 1WAZA 1VQKV 3E22B
chains in the Genus database with same CATH topology
1I94O 5BY1A 2ZKOA 4JI2O 2JRIA 2AGAA 1HNWO 1HR0O 1AILA 4LFBO 1YZBA 1NS1A 4JI0O 4X64O 3J7AU 4DR3O 4JI4O 2F4VO 5H5NA 4DR1O 4DR6O 4GKJO 4K0KO 4JI5O 4GKKO 2DJVA 3JAMN 2UUBO 1X59A 4DV4O 4DUYO 1FJGO 4LFAO 4DR4O 2UXCO 2DOSA 5A2QN 4YY3O 3O65A 4LF6O 5FLXN 4AQYO 3T1HO 1XEQA 4X65O 4DR5O 4JI8O 2N74A 1XMOO 4JI3O 1N34O 4LF4O 4DV7O 4YHHO 1J5EO 2LW7A 4DV6O 2UUAO 1IBKO 4B3RO 3J81N 2FKXA 1D2DA 1R1BA 1HNZO 3R66A 5LMNO 4OPHA 2HHHO 1FYJA 4JYAO 1FKAO 1G1XB 4X62O 4DV5O 4DV2O 1HNXO 1N36O 4LF8O 1XNQO 4B3MO 4NXMO 5BR8O 2E5LO 3J80N 3OTOO 1A32A 4JI1O 1R6TA 4DR7O 1N32O 1F7YA 4B3TO 2UXBO 3F5TA 3SDLA 2VQEO 4A5UB 1DK1A 5LMUO 4LF5O 5BXZA 4X66O 4LF9O 4DV3O 4OPAA 1IBLO 1XNRO 3RT3C 1AB3A 4KHPO 3M8AA 1N33O 4DUZO 4DV0O 2UXDO 4B3SO 2Z0AA 2VQFO 1IBMO 4JI6O 4DR2O 1KUQA 4LFCO 2UU9O 4NXNO 4JV5O 2ZM6O 4JI7O 2UUCO 5LL6Y 4DV1O 4LF7O 4OX9O 3T1YO 5IWAO 1XMQO 5IT9N
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I94 O;  5BY1 A;  2ZKO A;  4JI2 O;  2JRI A;  2AGA A;  1HNW O;  1HR0 O;  1AIL A;  4LFB O;  1YZB A;  1NS1 A;  4JI0 O;  4X64 O;  3J7A U;  4DR3 O;  4JI4 O;  2F4V O;  5H5N A;  4DR1 O;  4DR6 O;  4GKJ O;  4K0K O;  4JI5 O;  4GKK O;  2DJV A;  3JAM N;  2UUB O;  1X59 A;  4DV4 O;  4DUY O;  1FJG O;  4LFA O;  4DR4 O;  2UXC O;  2DOS A;  5A2Q N;  4YY3 O;  3O65 A;  4LF6 O;  5FLX N;  4AQY O;  3T1H O;  1XEQ A;  4X65 O;  4DR5 O;  4JI8 O;  2N74 A;  1XMO O;  4JI3 O;  1N34 O;  4LF4 O;  4DV7 O;  4YHH O;  1J5E O;  2LW7 A;  4DV6 O;  2UUA O;  1IBK O;  4B3R O;  3J81 N;  2FKX A;  1D2D A;  1R1B A;  1HNZ O;  3R66 A;  5LMN O;  4OPH A;  2HHH O;  1FYJ A;  4JYA O;  1FKA O;  1G1X B;  4X62 O;  4DV5 O;  4DV2 O;  1HNX O;  1N36 O;  4LF8 O;  1XNQ O;  4B3M O;  4NXM O;  5BR8 O;  2E5L O;  3J80 N;  3OTO O;  1A32 A;  4JI1 O;  1R6T A;  4DR7 O;  1N32 O;  1F7Y A;  4B3T O;  2UXB O;  3F5T A;  3SDL A;  2VQE O;  4A5U B;  1DK1 A;  5LMU O;  4LF5 O;  5BXZ A;  4X66 O;  4LF9 O;  4DV3 O;  4OPA A;  1IBL O;  1XNR O;  3RT3 C;  1AB3 A;  4KHP O;  3M8A A;  1N33 O;  4DUZ O;  4DV0 O;  2UXD O;  4B3S O;  2Z0A A;  2VQF O;  1IBM O;  4JI6 O;  4DR2 O;  1KUQ A;  4LFC O;  2UU9 O;  4NXN O;  4JV5 O;  2ZM6 O;  4JI7 O;  2UUC O;  5LL6 Y;  4DV1 O;  4LF7 O;  4OX9 O;  3T1Y O;  5IWA O;  1XMQ O;  5IT9 N; 
#chains in the Genus database with same CATH topology
 2WLL B;  3B40 A;  4GKK B;  1P7G A;  5EBW C;  1NT2 B;  1VQ7 V;  2R9I A;  3J7A U;  4OGQ B;  4JI4 O;  1VQ8 V;  1BHA A;  2BOC C;  3KCY A;  1V54 C;  2EIN C;  1K8A W;  3VOU A;  1Y74 B;  3G80 A;  5LGT A;  3ZHQ A;  4B3M B;  4NXM B;  5IYZ A;  3ABL B;  2HLD G;  3RYC A;  2EIL C;  4WBN B;  1SQG A;  2G38 A;  5BZB A;  4JI8 O;  4ZOL A;  5B66 Z;  2F93 B;  3BY6 A;  1F23 A;  4ZIB A;  2WWW A;  4GYC B;  2FKX A;  4LH7 A;  5CBF A;  3ABT A;  1HNZ O;  1W2B U;  1XNR B;  2LW1 A;  4DV5 B;  2L6L A;  1MNG A;  5DED A;  1V55 C;  2ODM A;  3BHP A;  3OTO B;  2QWR B;  4AIL C;  3CC4 V;  1SQV H;  2CTQ A;  1KQS U;  2MK3 A;  3L72 H;  4PA9 A;  1IZ3 A;  1BCC H;  3J80 N;  1WP8 A;  3K9S A;  3MD0 A;  2FML A;  4JI1 O;  2A0L A;  2OYQ A;  4EEQ A;  3SDL A;  3JAT A;  4F4L A;  1URF A;  3MHH C;  1DF4 A;  2EJ7 A;  4CH3 A;  1X4T A;  4LF5 O;  5JJE B;  4X66 O;  1ZX3 A;  2YC0 A;  4X20 B;  1IXB A;  4MVQ A;  4X64 B;  1HWY A;  4IGG A;  3HKB A;  1AB3 A;  1VMG A;  3K5N A;  2V4D A;  2DWE C;  2GUZ B;  4FFB A;  4JTA B;  2CE4 A;  2P06 A;  3RW0 A;  2P5O A;  1MG1 A;  1KYO F;  3B8M A;  2Q6A A;  1I5Y A;  1J95 A;  2ZNI A;  1BHB A;  4JI3 B;  4FLT A;  2ZQM A;  1K4D C;  4JYC A;  1IBK B;  3CJH A;  1SRY A;  4FVM A;  2WLH A;  4PEL A;  2Q69 A;  1AIL A;  2UUB B;  4JI0 O;  4QGP A;  3BAA A;  1MSW D;  1JJO A;  5IYC O;  3KG2 A;  4X62 B;  5CA1 B;  1BGY H;  1FXK A;  1OHH G;  3N27 A;  4TSF G;  4CH6 A;  2E5L B;  1VQ4 V;  4IIJ A;  4DR4 O;  2E3C A;  1FFX A;  3SPC A;  1N32 B;  4AQY O;  3FX7 A;  1FS0 G;  2QWP B;  2XAF A;  3K0G A;  4JZ2 A;  4FLZ A;  1DF5 A;  1AR4 A;  3LSS A;  2DQ0 A;  3W7X A;  1VQ6 V;  3P3N A;  1QR8 A;  3CME V;  2IBZ H;  3JD2 A;  1R1B A;  1VAR A;  2JGU A;  4HZ3 A;  2CGO A;  1HNX B;  1Q6H A;  2IH1 C;  2JS5 A;  5BMV B;  3RVZ A;  5IDJ A;  4JYA O;  2LGW A;  3JCZ A;  3ZRV A;  4UCR A;  4KXR A;  3GWO A;  1ZAU A;  1US6 A;  1L8D A;  4DR7 O;  3D3Q A;  2OWO A;  2UXB O;  3F5W C;  3ABU A;  4J42 A;  2ZR2 A;  1AI4 A;  5GTI Z;  3K0D A;  4J9Z B;  3GWK C;  1WN7 A;  2WLJ A;  2Q68 A;  4JTC B;  2Q7G A;  3M7M X;  1ZSP A;  2PUS A;  1YHQ V;  2PI5 A;  2IH3 C;  2OCH A;  2QR4 A;  1FD9 A;  1EZJ A;  5EZY A;  3M8A A;  5L3B A;  1NTM H;  4DV0 O;  3QNE A;  5LGN A;  1GTO A;  2QEX V;  4TQD A;  2Z0A A;  3JD1 A;  1H8H G;  2O57 A;  3ZHT A;  4I7Z B;  1RPO A;  4NXN O;  2ADQ B;  2HKO A;  1N34 B;  3RFR A;  4PI0 A;  2XT9 A;  1GN3 A;  3CCS V;  3OMI B;  3H1J H;  1VIB A;  4U3J A;  3UQ8 A;  2D3O W;  2AHZ A;  2H8P C;  3OFN G;  2BOB C;  5LOV A;  2KKW A;  5E79 Z;  1L0L H;  4WFH A;  2ZE5 A;  2ADP A;  4Z1M G;  4O4I B;  2PY5 A;  2QM8 A;  2CH7 B;  2YEV A;  4PDV A;  3T1H O;  2Z3Y A;  3EVK A;  2NR5 A;  4YHH O;  2QWO B;  4TOI A;  1DTO A;  1EN5 A;  4FLU A;  5KUK A;  3SPJ A;  3ASO B;  1SZT A;  1K5Q A;  3O9O A;  5ITZ A;  2HHH O;  5CMU A;  2Q7H A;  5J9P C;  3B77 A;  1FYJ A;  2F43 G;  3CRA A;  4N23 A;  4JAU A;  4LP8 A;  5FNV B;  5D5P A;  4B3M O;  4NXM O;  4FFK A;  5EIB C;  3AG7 A;  1PNK A;  1MSD A;  2UXN A;  4FM0 A;  4JV5 B;  4UCU A;  4MVM A;  4P2Z A;  4FLV A;  2IM9 A;  1WJZ A;  3E8H A;  4IT5 A;  5EC2 C;  2RJZ A;  3CSX A;  3DXR A;  2NLJ C;  5JH7 A;  1XNR O;  1I0H A;  4LR3 A;  3HKD B;  3JSN A;  4UVA A;  3QO8 A;  1JFF A;  2JJ2 G;  5B1A C;  5FPO A;  1YTF D;  4XDL A;  2QKS A;  4BWA A;  4BIO A;  2OT5 A;  4O2A B;  2VRZ A;  2LGQ A;  3D36 A;  4UV9 A;  5EC1 C;  1ORQ C;  1QLE B;  3EXA A;  2QE7 G;  4WFE A;  2P4K A;  3LDD A;  2Y0P A;  2ZD9 A;  4DK1 A;  3IC9 A;  2YXL A;  1NU1 H;  1Y76 A;  2V1D A;  2GDS A;  4JI4 B;  3B2E E;  2WLN A;  2WLM A;  3OM3 B;  3FFQ A;  2CUG A;  4TV8 B;  1YEW A;  3VQV A;  4X64 O;  2IJI A;  3N2K B;  1M9N A;  1OCO B;  3JAL A;  2ILM A;  4MT8 A;  1N36 B;  1V54 B;  2IJK A;  1YJ9 V;  4PDL A;  4JI8 B;  3SJA C;  1P4R A;  1FXK C;  2BCC H;  3ZCC A;  1NH2 D;  4MTX A;  4I0X B;  3HKC A;  4JI3 O;  3AG2 C;  2EIL B;  4I50 A;  2RDC A;  3CXC U;  4W4K A;  1AVM A;  4DV6 O;  4CS4 A;  1KU9 A;  1IBK O;  4DRX A;  2OTL V;  3J81 N;  1FPO A;  1XBL A;  1O9G A;  4E4E A;  1D2D A;  4JF3 A;  3K06 A;  1EM1 A;  2QKA A;  4WFB V;  2CK3 G;  2K1E A;  2QKC A;  5B1B C;  1BE3 H;  2KG7 A;  4O4J B;  2WPD G;  4X62 O;  1V55 B;  3FAV B;  5JVD A;  2F66 C;  4AHC A;  2R9R B;  4FK5 C;  1SS3 A;  2E5L O;  4UCO A;  3H1K H;  1R73 A;  4LFC B;  1N32 O;  1JJ2 U;  1K33 A;  4X66 B;  2X6A A;  2R70 A;  2BSK B;  2KB1 A;  2HFE C;  4EFE A;  1IX9 A;  4J11 A;  1QBZ A;  1H2L A;  3AG3 C;  1Q86 W;  3I56 V;  1P84 F;  4GCZ A;  2NNU A;  4X1I B;  4ZBM A;  4GKJ B;  1O9H A;  1GM7 A;  1M4U A;  1CPY A;  4UVC A;  1D5N A;  3IJ4 A;  1IBM O;  2YUA A;  1VQ5 V;  5LP6 A;  5KHJ A;  1XOU A;  3ZRW B;  2ZXW C;  3DC6 A;  3SYC A;  4DR5 B;  3SPG A;  3L9D A;  1OCZ B;  4ABM A;  2W0X A;  3RYI B;  3CS5 A;  1XI1 A;  4N21 A;  4NTW A;  1ZL8 A;  3CRR A;  4YJ3 A;  1YTF B;  1W0J G;  5CA0 A;  1JX9 A;  4RO2 A;  1K34 A;  2W6J G;  4K0K O;  1R6N A;  2RNB A;  5CB4 B;  4DR4 B;  4MSW C;  3RYH B;  5CBH A;  1QR9 A;  5JWP A;  1R3J C;  2OCC C;  4LF8 B;  4KFM A;  3ZHS A;  1K92 A;  4U3F H;  4X1Y A;  3H1H H;  4PA3 A;  5IY5 B;  5J2U B;  4L8J A;  1QVF U;  3ASN C;  1N0J A;  4X65 O;  1M56 C;  4PDR A;  2XAH A;  4LCU C;  3JD3 A;  1N34 O;  2DN9 A;  5J2T B;  2P7T C;  2DYS B;  1S77 D;  4MVU A;  4ICG A;  1SQB H;  3AK2 A;  3I55 V;  5L3F A;  1VEW A;  1TVK A;  4UCT A;  2ZNJ A;  3RYF A;  5LHI A;  4J7Z A;  3A8T A;  4DR7 B;  1NH2 B;  1N8R W;  1PPJ H;  2UXB B;  4GX1 A;  4EB6 B;  1AI5 A;  1XNQ O;  2RN9 A;  1A32 A;  1Q6U A;  1WPX A;  3OGC C;  1GM8 A;  4CH5 A;  4GX2 A;  3SYA A;  1PNM A;  3HPL C;  1XMQ B;  3ZHR A;  3JAK A;  2AHY A;  4FMT A;  3CWB H;  3K79 A;  3TJT A;  5F2V O;  1VQO V;  4ZI7 B;  4DR3 B;  4QNH B;  2HJD A;  2Y69 C;  4FIP C;  5IJ9 B;  1YXB A;  4WF9 V;  2ZCE A;  4C7U A;  5B3S C;  4D7T A;  4B08 A;  1OCC B;  4O4L B;  4NXN B;  3ZN1 A;  3K03 A;  4BAY A;  4FLW A;  1FXV A;  3G67 A;  3RGB A;  3T4Z A;  1KP3 A;  2UU9 O;  4JV5 O;  1PM9 A;  1PP9 H;  1MAB G;  3D36 C;  3CX5 F;  5DM6 V;  3L75 H;  1GO3 F;  5JQG A;  3Q4H A;  3P32 A;  4I55 B;  4PA4 A;  1KC8 W;  3SR2 C;  1CEZ A;  1DGS A;  2YIB A;  2DYR B;  1WLE A;  1YZB A;  3CYO A;  5H5N A;  5KHH A;  4J9Y B;  4JI5 O;  1GN6 A;  4JAA A;  3THO A;  4NVP A;  5LYJ A;  2ITD C;  2WLI A;  1XUQ A;  4UCS A;  3DGE A;  3OR7 C;  4YHH B;  1H2N A;  5C8Y A;  2EIJ C;  5FLX N;  1BZK A;  3W7T A;  5KA6 A;  2HHH B;  2ITC C;  3RYC B;  4ZOL B;  2E76 B;  4OXS A;  1SKV A;  2XTA A;  2DWD C;  2UXX A;  3U10 A;  1VF7 A;  1N36 O;  1XL6 A;  3UT5 A;  1M93 A;  1BT8 A;  3K58 A;  3FB8 C;  2DMX A;  1S72 V;  4UB8 Z;  2PF4 E;  5KAI Z;  4LF7 B;  2VQE O;  3CRC A;  1I94 B;  5BXZ A;  1KD1 W;  3SGI A;  4CH4 A;  1HR0 B;  3JAT B;  3N2G A;  3ZMZ A;  1TGO A;  3CC2 V;  2Y0I A;  3JAS A;  5B1A B;  3ETD A;  2YI9 A;  3HKB B;  3K57 A;  1PV0 A;  4WBN A;  1VQM V;  1YIJ V;  4DR2 O;  3NXS A;  4LFC O;  5LP6 C;  3OMN B;  2BTQ A;  4CC5 A;  4LF4 B;  1HW7 A;  4HNA A;  1LUW A;  3FYE B;  3C3T A;  2HEP A;  2EBO A;  5BY1 A;  2P90 A;  3OEE G;  3WB0 A;  4B7E A;  2QTS A;  2GHY A;  2F4V O;  1XRE A;  3CJH B;  1RP3 B;  3PJS K;  4GKJ O;  3FB7 C;  5CN0 A;  4U7N A;  4UFZ A;  3LDC A;  4DUY O;  4J80 A;  4KUM A;  5GON B;  4RUF A;  5KHK A;  2Q4P A;  4DV6 B;  1NQT A;  1H2S B;  3LNM B;  1AJQ A;  4DR5 O;  2GTA A;  4IIJ B;  1FFX B;  3AG2 B;  4GT1 A;  1KB9 F;  4J7J A;  3SYO A;  3HR0 A;  2QM7 A;  3QO7 A;  1OZ0 A;  2P67 A;  5LHH A;  2XAJ A;  5KHG A;  3E86 A;  4TT3 G;  3CPW U;  5EBL C;  3OE7 G;  1TUB A;  2HP8 A;  2GUZ A;  2IJJ A;  1SQP H;  4LF8 O;  4F6E A;  2QA4 V;  1YSC A;  3K04 A;  4JI7 B;  3ML0 A;  3AG4 C;  2EZO A;  2Q5Z A;  3LSQ A;  4DV3 O;  3SJQ C;  1GKF A;  3AG3 B;  3AG1 C;  2LO1 A;  4ZKI A;  1IBM B;  5CA1 A;  4UB6 Z;  3IFX A;  1KP2 A;  2XUM A;  4TV9 B;  3ZIA G;  5A9G A;  3A0R A;  1YDX A;  1ROP A;  4PI2 A;  4B7K A;  1SA0 B;  3R65 A;  1SQQ H;  4JTD B;  5EZY B;  3TXQ A;  3NR7 A;  5B1N A;  2Q0A A;  1QNM A;  4FM2 A;  4ZHQ B;  1ARO P;  4PV1 B;  2UUC O;  1XHX A;  2P4V A;  3OGI B;  3RBZ A;  1XMQ O;  1FFT B;  4K35 A;  4K0K B;  3H01 A;  2QGN A;  1K9M W;  1GN2 A;  1NS1 A;  4DR3 O;  1NKD A;  3ZMS A;  3T2M A;  1S0V A;  4HYO A;  2B1G A;  3BFR A;  1FXH A;  1L1F A;  3RWR D;  3CP1 A;  5DEC A;  4WFA V;  4DV4 O;  5LOV B;  2CTR A;  4X65 B;  1B06 A;  2OCC B;  1IUR A;  2JK5 C;  3O65 A;  1S76 D;  2ZIM A;  4IHJ B;  2N74 A;  3C90 A;  1J5E O;  4I9Q A;  3E2E A;  1M56 B;  3CMA V;  2CAZ C;  2Q73 A;  2PZS A;  2ZE6 A;  4G2K A;  1MOF A;  3JAR A;  1UPG A;  4KHP B;  1XNQ B;  1XDC A;  3UO3 A;  2QM4 A;  2EUL A;  5KMG A;  5IJ0 B;  3TXS A;  1BQZ A;  4J41 A;  5JJJ B;  4CZZ A;  3ZHU A;  5AG2 A;  4O4H A;  1K4C C;  3ETE A;  2EIM B;  1M57 C;  2EIK C;  1W0K G;  3WG7 C;  4JAS A;  2YIC A;  4F6R A;  2YDE A;  3HKE B;  5EYP A;  4MVR A;  5L3E A;  1QCE A;  4O2B B;  4HBN A;  4MTG A;  1RM1 C;  1JOY A;  4UCV A;  2X6C A;  3RT3 C;  1XIL A;  2HVK C;  4O4I A;  2YID A;  1NI8 A;  1JR9 A;  2Y69 B;  4FLX A;  5JH7 B;  5IE9 A;  2UU9 B;  5B3S B;  2CH7 A;  3K08 A;  3I5D A;  4BIU A;  1JFF B;  5EBM C;  4X1K B;  3ABL C;  1KUQ A;  5L3D A;  2ZM6 O;  3CRQ A;  4LF7 O;  4JYY A;  1Q3E A;  1TUE B;  2QWN B;  2JGD B;  1I94 O;  2AW9 A;  2ZKO A;  1HNW O;  1HR0 O;  4JI5 B;  1Y4M A;  5LMN B;  1Y76 B;  1AI7 A;  2GTS A;  4QPJ A;  5KX5 B;  3B4S A;  2RQ6 A;  3IAY A;  5FNV A;  3JD4 A;  3FKS G;  1N4C A;  4PA7 A;  3OEH G;  2Q7E A;  3UCS C;  4FPP A;  3RVY A;  3JYC A;  1FAF A;  3DSQ A;  3JAL B;  4K8X A;  2AXT Z;  4LF4 O;  1M90 W;  2P22 C;  1WB7 A;  3MAQ A;  4PDM A;  2UUA O;  1NTZ H;  3E83 A;  1N0N A;  3ZED A;  1B6Q A;  1I7F A;  3TK1 A;  3BPZ A;  4OPH A;  2EIN B;  1R3K C;  4XBF A;  3L70 H;  1T5E A;  2PYL A;  5GW7 A;  4H33 A;  4PJ0 Z;  5D5Q A;  2VQE B;  2F95 B;  2X0L A;  2Y48 A;  1M1K W;  5KHI A;  2LP7 A;  3F5T A;  3FD9 A;  1SET A;  1Z5V A;  1YJN V;  1W59 A;  4R7C A;  1H2M A;  4DK0 A;  1Z2G A;  3N2K A;  4TUY B;  1EN6 A;  2CTP A;  2VWK A;  3L74 H;  4I4T A;  4XDJ A;  1PD3 A;  1YJW V;  5E1A C;  4DR2 B;  4FLY A;  4QE9 A;  1OCR C;  1KEC A;  2PTM A;  1NR7 A;  1RFY A;  2QWQ B;  2YIB D;  2IU0 A;  1NVP D;  4JI7 O;  5LL6 Y;  3G4S V;  2KSD A;  5LP6 B;  3GB7 C;  3DC5 A;  1SF9 A;  2R72 A;  4RAI A;  4X8A A;  2F4V B;  2XHB A;  1TA8 A;  4P9O A;  1K97 A;  5H6Q A;  5TIS Z;  2QTO A;  3CCR V;  3EHB B;  4LNU A;  4O4J A;  3ZX6 A;  4DUY B;  3G6E V;  1ZL8 B;  5CA0 B;  3OMA B;  1ZLZ A;  2Z5U A;  2ZR3 A;  3K5O A;  1FJG O;  1MZE A;  1VF6 A;  1VQL V;  3FB6 C;  4LF6 O;  2VS0 A;  1WA8 A;  3APO A;  1RPR A;  3ZRS A;  4DV7 O;  1H2K A;  2BSK A;  4MVO A;  3AK1 A;  3UO2 A;  1D5A A;  4D6T H;  4JZG A;  4X1I A;  4BW5 A;  1H2G A;  5JCO A;  2NN4 A;  2FL4 A;  3TCU A;  3VBB A;  1N33 B;  2M7W A;  4HAM A;  1FKA O;  4Z1V A;  2CDY A;  4MTF A;  2YIA A;  4PD4 F;  4H0L B;  3KKY A;  4LWS A;  1E1Q G;  1JA8 A;  4YXW G;  4MTO A;  4DV3 B;  1S5L Z;  4NYK A;  3OW2 U;  1KKC A;  3T1C A;  3IC7 A;  5LXT B;  1HDJ A;  3OR6 C;  1BS3 A;  4OPA A;  3E8F A;  1PL4 A;  4DW1 A;  4DR6 B;  3CB2 A;  4KHP O;  1MMM A;  2CGN A;  1VQP V;  4J10 A;  2UUC B;  2UXC B;  3QG5 A;  1RSO A;  1SER A;  5LA6 A;  5L3G A;  3JAW B;  5J2T A;  4DV1 O;  1SZX A;  3F7V C;  1YF2 A;  1ZUQ A;  1KBH A;  4ASU G;  1R3I C;  3PN1 A;  2D2C B;  3QO5 A;  2AGA A;  3FB5 C;  2A79 B;  3AK3 A;  4QIW F;  3MHS C;  4MW8 A;  4UV8 A;  3ASO C;  1JCH A;  1LUV A;  3QF7 A;  5JQG B;  3Q4H B;  4DW0 A;  4DV4 B;  4CS3 A;  2YI8 A;  1XQ8 A;  2DJV A;  2JEU A;  4DV2 B;  4H37 A;  2FTK A;  4EB6 A;  1F51 A;  1NVP B;  1QLN A;  2ZE7 A;  1VQN V;  4X9Q A;  1Q43 A;  2ZIO A;  4YJ2 A;  4TQF A;  2DOS A;  1J5E B;  3K5M A;  5LBQ A;  2Q8V A;  2WLI B;  2GV9 A;  3B09 A;  1P49 A;  3BEH A;  3UKM A;  2OTJ V;  3CCQ V;  3S3W A;  5C8Y B;  3U11 A;  4B3R O;  2WAM A;  1TAE A;  1G8M A;  1I08 A;  1GMG A;  4R6Z A;  3E8B A;  2EZP A;  1IBL B;  4P9P A;  1K3E A;  3R66 A;  5LMN O;  2ETN A;  1Q8I A;  1QVG U;  1H38 A;  2UXD B;  4O4L A;  1K7D A;  3WU2 Z;  1MZF A;  1WP7 A;  3D8C A;  5BR8 O;  2RMK B;  2JEX A;  1WPB A;  2JIZ G;  5IYZ B;  3CCU V;  5HFM A;  2LQT A;  1QLE C;  4WFG A;  4I55 A;  5FPR A;  4A5U B;  4QJF B;  1M57 B;  2BTO A;  3WG7 B;  4JGS A;  3T4D A;  1EN4 A;  2FB5 A;  3JD0 A;  1U96 A;  4YIO A;  3STZ C;  3CCL V;  4WCE V;  1BL8 A;  1GN4 A;  1RM1 B;  1NTK H;  1GAX A;  3N2G B;  4DUZ O;  4CC6 A;  1OCO C;  3A0B Z;  2ZM6 B;  5H9C A;  3E22 A;  4YIP A;  4MVZ A;  3JAS B;  2WLL A;  4RUE A;  3DTU B;  3HB3 B;  1HNW B;  3E89 A;  4CBC A;  3P30 A;  3K9A A;  2QJ1 A;  1VF5 B;  3CEI A;  2B5U A;  2RCV A;  2BTQ B;  3CCE V;  4GZR B;  4LFB O;  3SYP A;  1Y74 A;  4HNA B;  3ZBH A;  3CRM A;  2W0F C;  4IYI A;  1YI2 V;  3WFV A;  3H1I H;  4FFB B;  4NKG B;  1R3L C;  5CA3 A;  5KA5 A;  1QHT A;  3TET A;  2UUA B;  4YY3 O;  2X6B A;  1VF6 C;  4IL6 Z;  4BW9 A;  1LR1 A;  2LFR A;  2QDO A;  4RQF A;  2H3O A;  3F7Y C;  3KZI Z;  1BQ0 A;  1B04 A;  2F23 A;  2JJ1 G;  2E75 B;  1COW G;  4Q20 A;  5JCO C;  1Q90 D;  4LBE C;  3BCC H;  1FXK B;  3LSU A;  5IYD O;  1YIT V;  1TUB B;  2XOK G;  5EK0 A;  3L73 H;  2WA3 A;  3A0H Z;  4L87 A;  2L35 A;  4JYB A;  4W4L A;  1OV9 A;  4QPK A;  1VP7 A;  3ETQ A;  4X20 A;  1OCZ C;  1Z5W A;  1AJN A;  1V9P A;  3ICX A;  3G6B A;  3CE2 A;  3U0Z A;  3STL C;  5B1B B;  4DR1 B;  4UXN A;  2AZ0 A;  5FL7 G;  1N33 O;  3ABM C;  1S5J A;  1E1R G;  3M99 B;  5GON A;  3CCJ V;  4FZ1 A;  4LFA B;  2N04 A;  1OCR B;  3K3W A;  1SQF A;  5IY5 C;  1AP6 A;  4Q6G A;  1SES A;  1PL0 A;  4FZ0 A;  1F4N A;  3P3P A;  3T1Y O;  4UVB A;  1UFI A;  4PA6 A;  2R9A A;  4JI2 O;  2DYS C;  2JRI A;  5K1P A;  2LFS A;  2A7W A;  3BA8 A;  1H8E G;  3JSL A;  1FJG B;  5K1X A;  4DR6 O;  2WSS G;  4LC1 A;  4LF6 B;  2HVJ C;  1IVS A;  4LH6 A;  3ABK C;  2Q0O C;  1GRJ A;  5KLV H;  3X2Q C;  5DN6 G;  2ZXW B;  4DV7 B;  2UXC O;  3WB1 A;  1SC5 B;  3KCX A;  1Y6X A;  3IGA C;  2LJ2 A;  2LW7 A;  2DW4 A;  3JCU Z;  3SJC C;  1BSM A;  1EZV H;  5BMV A;  4X88 A;  2IU3 A;  1KKD A;  1Q5O A;  2ZE8 A;  1MA1 A;  4U3J B;  2AZ2 A;  4PHZ A;  4TV9 A;  1JMK C;  1UJW B;  3LUT B;  3FYI B;  1SQX H;  1G1X B;  3JAR B;  1IXM A;  2IW5 A;  4DV2 O;  4B3S B;  1PNL A;  2VQF B;  1OJH A;  1QQC A;  1SA0 A;  1OCC C;  1AP5 A;  5H2F Z;  3ASN B;  2ZDI A;  4ZHQ A;  5KMG B;  2YEV B;  1NBM G;  4OX9 B;  1S3J A;  1LNQ A;  4O4H B;  4R50 A;  5LMU O;  4G28 B;  2BE3 A;  3SYQ A;  3OD4 A;  3H9V A;  1NJI W;  2ATK C;  4LF9 O;  1IBL O;  5LGU A;  3CC7 V;  1AR5 A;  2DYR C;  3D3I A;  4F6R B;  5ITZ B;  5EYP B;  5B5E Z;  2HG5 C;  1Y66 A;  2UXD O;  3VQW A;  3RN4 A;  1AJP A;  2M6Y A;  4DV1 B;  4I9W A;  1E79 G;  1P7B A;  2WA4 A;  3SJB C;  3GVM A;  3ZMT A;  4JI6 O;  3APQ A;  4IHJ A;  4R8C A;  2B1I A;  1XMO B;  3SPI A;  3OTF A;  5IWA O;  2PYJ A;  2H94 A;  3BRC A;  3DXR B;  1EFR G;  4FJC C;  2DQ3 A;  3A2F A;  4H13 B;  2XAS A;  1GK9 A;  4GKK O;  1PKX A;  5IJ0 A;  2ZT9 B;  3ZHV A;  2A06 H;  3C3S A;  2HR3 A;  3UM7 A;  1Q6I A;  3E35 A;  2DE0 X;  1ENV A;  1Q81 W;  4B3T B;  4B3R B;  1XEQ A;  3HKE A;  1JPX A;  5L3C A;  4O2B A;  3LNN A;  1F4M A;  4E2L A;  1G6U A;  1AI6 A;  5BR8 B;  3ZN0 A;  3H1L H;  4H44 B;  4U7O A;  4DV5 O;  4D7S A;  3ZMV A;  4K3A A;  3OT7 A;  4X1K A;  2EIJ B;  1NR1 A;  3OTO O;  4DO2 A;  1S5H C;  2B9Z A;  4GX5 A;  4BIZ A;  1K73 W;  3HKC B;  2JGD A;  3MDS A;  4I50 B;  4CS2 A;  3HKD A;  1GM9 A;  4DRX B;  4TWK A;  1K5S A;  3CHX A;  1ZWI C;  2ZIN A;  2IJH A;  4DUZ B;  5GTH Z;  5KX5 A;  3OAA G;  4O2A A;  3L71 H;  1DLB A;  2A3Q A;  2KG7 B;  2EJR A;  3W7S A;  3OUS A;  4DXW A;  1KMI Z;  5JVD B;  4GLX A;  1R6K A;  4I4T B;  4RQE A;  4TV8 A;  4LFB B;  3EFF K;  3ZJZ A;  1M5I A;  2KQX A;  4GX0 A;  5C93 A;  1HNZ B;  2YXH A;  1GH6 A;  4EKW A;  4X89 A;  4Z2W A;  1G4Y B;  3BA9 A;  4DR1 O;  2X7R B;  3CXH F;  2F1M A;  1Y67 A;  2UUB O;  2W6I G;  4YY3 B;  1B3Q A;  1X59 A;  4GUN A;  4LNU B;  4I0X A;  3W7U A;  5KUM A;  1YCI A;  4LFA O;  2ARH A;  4JI1 B;  3WB2 A;  2Q9L A;  4MVS A;  3LDE A;  4UUJ C;  3W7W A;  3ZS8 C;  4LF5 B;  3BAB A;  4WFF A;  5KAF Z;  5HFL A;  4BR6 A;  3OUF A;  3TGU H;  1WA8 B;  4TUY A;  2PI4 A;  3FAV A;  4YJ3 B;  2GSM B;  2Y4U A;  3ZRX A;  3QTC A;  4NR1 A;  4NB5 A;  1HNX O;  1EBO A;  1L0N H;  2HJF C;  5JJN B;  2E74 B;  4G27 B;  2XND G;  1R6T A;  4X1Y B;  5B1O A;  2QSA A;  1F7Y A;  4IYH A;  2ZDI C;  4JAV A;  4LWS B;  4DYL A;  3ZMU A;  4JI0 B;  2P6J A;  1CXZ B;  1AR1 B;  3QVN A;  1ZTE A;  1TVK B;  2XAQ A;  3ZRW A;  3RYF B;  2JDI G;  3VQY A;  2Q67 A;  4AI8 A;  4B3S O;  3ABM B;  2VQF O;  3G71 V;  2V7Q G;  3RYI A;  4MS2 A;  3T1Y B;  4AQY B;  4RWU A;  3AG4 B;  4JI2 B;  4J7K A;  4I5S A;  2A9H A;  4OX9 O;  1RSO B;  2JS3 A;  1XL4 A;  5IT9 N;  2YXY A;  5LA6 B;  3JAK B;  2YSU B;  2N05 A;  3VQX A;  5CB4 A;  5LHG A;  3RYH A;  3AG1 B;  3AEI A;  2GBO A;  5EIB D;  4JYA B;  2WLK A;  3JAM N;  5IYB O;  4K8Z A;  5J2U A;  2PGG A;  2K9P A;  1WB8 A;  4KL1 A;  1I5X A;  4P30 A;  3K5L A;  3ABK B;  5A2Q N;  2CTW A;  1WNS A;  3X2Q B;  3K59 A;  1JVM A;  1HP8 A;  1XMO O;  2EIM C;  2XAG A;  4QE7 A;  4YJ2 B;  5LXT A;  1CP9 A;  2EX3 A;  4KP4 A;  3CCV V;  1U97 A;  2Y4T A;  1XHZ A;  1IDS A;  3S3X A;  2VWJ A;  4MW3 A;  5CBG A;  1BMF G;  3BVO A;  4DV0 B;  1Q7Y W;  2FYU H;  3ETG A;  1NZ6 A;  5LYJ B;  4NTY A;  2MW2 B;  5LMU B;  3JAW A;  4B3T O;  1VQ9 V;  4FM1 A;  4LF9 B;  4ZI7 A;  1DK1 A;  4NTX A;  5IJ9 A;  3E8G A;  1THZ A;  1Q82 W;  3CCM V;  2JVD A;  4EFB A;  2OIE A;  4XDK A;  2OIG A;  3B8N A;  4JI6 B;  1YVW A;  1JQ0 A;  5H6R A;  3CD6 V;  3UT5 B;  5IWA B;  3SPH A;  3T1H B;  2C2A A;  2EIK B;  4JPR A;  1QU7 A;  2YS8 A;  1WAZ A;  1VQK V;  3E22 B; 
#chains in the Genus database with same CATH homology
 1I94 O;  5BY1 A;  2ZKO A;  4JI2 O;  2JRI A;  2AGA A;  1HNW O;  1HR0 O;  1AIL A;  4LFB O;  1YZB A;  1NS1 A;  4JI0 O;  4X64 O;  3J7A U;  4DR3 O;  4JI4 O;  2F4V O;  5H5N A;  4DR1 O;  4DR6 O;  4GKJ O;  4K0K O;  4JI5 O;  4GKK O;  2DJV A;  3JAM N;  2UUB O;  1X59 A;  4DV4 O;  4DUY O;  1FJG O;  4LFA O;  4DR4 O;  2UXC O;  2DOS A;  5A2Q N;  4YY3 O;  3O65 A;  4LF6 O;  5FLX N;  4AQY O;  3T1H O;  1XEQ A;  4X65 O;  4DR5 O;  4JI8 O;  2N74 A;  1XMO O;  4JI3 O;  1N34 O;  4LF4 O;  4DV7 O;  4YHH O;  1J5E O;  2LW7 A;  4DV6 O;  2UUA O;  1IBK O;  4B3R O;  3J81 N;  2FKX A;  1D2D A;  1R1B A;  1HNZ O;  3R66 A;  5LMN O;  4OPH A;  2HHH O;  1FYJ A;  4JYA O;  1FKA O;  1G1X B;  4X62 O;  4DV5 O;  4DV2 O;  1HNX O;  1N36 O;  4LF8 O;  1XNQ O;  4B3M O;  4NXM O;  5BR8 O;  2E5L O;  3J80 N;  3OTO O;  1A32 A;  4JI1 O;  1R6T A;  4DR7 O;  1N32 O;  1F7Y A;  4B3T O;  2UXB O;  3F5T A;  3SDL A;  2VQE O;  4A5U B;  1DK1 A;  5LMU O;  4LF5 O;  5BXZ A;  4X66 O;  4LF9 O;  4DV3 O;  4OPA A;  1IBL O;  1XNR O;  3RT3 C;  1AB3 A;  4KHP O;  3M8A A;  1N33 O;  4DUZ O;  4DV0 O;  2UXD O;  4B3S O;  2Z0A A;  2VQF O;  1IBM O;  4JI6 O;  4DR2 O;  1KUQ A;  4LFC O;  2UU9 O;  4NXN O;  4JV5 O;  2ZM6 O;  4JI7 O;  2UUC O;  5LL6 Y;  4DV1 O;  4LF7 O;  4OX9 O;  3T1Y O;  5IWA O;  1XMQ O;  5IT9 N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...