4JI4O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4ji4O00
1NS1A 1N36O 1G1XB 2VQEO 3T1HO 1IBLO 3O65A 5LMUO 2DJVA 2HHHO 4K0KO 2LW7A 4DV1O 1XNRO 1IBKO 1D2DA 1F7YA 2DOSA 4LF7O 5H5NA 5BXZA 3J81N 1A32A 2UXBO 4DR4O 3J80N 4NXNO 2FKXA 2E5LO 3JAMN 5LMNO 4JI5O 4DR5O 2UUAO 1R6TA 4LF4O 4LFCO 4KHPO 4B3SO 1HNWO 2Z0AA 4JI8O 1X59A 4DV6O 4LF6O 4B3TO 4JI1O 4JI2O 2ZM6O 1N33O 4B3MO 1XMQO 1AILA 4JI4O 5A2QN 3M8AA 4LF8O 4GKKO 1AB3A 5LL6Y 4DV5O 3F5TA 4JI6O 2N74A 2UUBO 1HNXO 4AQYO 4DR6O 4A5UB 4DV0O 4DUZO 4DV7O 4LF9O 2UUCO 5BY1A 4DR2O 2UU9O 4OPHA 1FYJA 4LF5O 4DUYO 1N34O 1IBMO 2AGAA 3RT3C 4LFBO 4NXMO 5IT9N 1YZBA 1KUQA 4JI0O 4X62O 4X64O 5FLXN 1HNZO 5IWAO 1FJGO 2JRIA 1XMOO 1N32O 4X65O 1I94O 3T1YO 5BR8O 4JYAO 1DK1A 4X66O 4DR3O 4DV3O 4JV5O 2F4VO 4DV4O 4JI3O 3OTOO 1R1BA 4JI7O 1J5EO 1XEQA 1FKAO 4OPAA 2ZKOA 3J7AU 4B3RO 3SDLA 2UXCO 2VQFO 4DV2O 1HR0O 3R66A 4OX9O 4GKJO 2UXDO 4LFAO 4YY3O 4DR1O 4DR7O 4YHHO 1XNQO
chains in the Genus database with same CATH superfamily
4TUYA 1QR8A 1TUEB 4Z1MG 2AW9A 2DYRB 4MVQA 5IYDO 3G67A 1E1RG 1V55C 4DW1A 3CC7V 2E74B 1W2BU 4YIPA 3JAWB 3ZRXA 3EFFK 4EEQA 2EX3A 2Q5ZA 2R70A 3ZRWB 3GB7C 2FKXA 4QE9A 4UFZA 2DQ3A 3E8BA 4EFEA 5JVDB 1SETA 2QM4A 2EULA 1N4CA 4NB5A 2YIBA 4F6RB 4Q20A 3JCZA 4MTFA 4D6TH 1VQ8V 2QTOA 4TUYB 4ZI7A 4U7OA 4PA6A 1ZAUA 1VMGA 4JI6O 1Q6HA 5BY1A 3B40A 1UJWB 1FPOA 4WBNA 2D3OW 5B1BC 4O4IA 2LJ2A 3D36C 1I5XA 4CBCA 5GW7A 2Q7GA 1R3IC 2UXXA 4LWSA 1M93A 5C93A 3RYCA 3I55V 2L35A 4DUZB 2OTJV 2Q0OC 2OCCC 4G27B 5FL7G 3ZJZA 4C7UA 4ZI7B 1HNZB 5TISZ 1GN6A 3K59A 1TUBA 2YIDA 3SDLA 5KX5B 2QKSA 3SJQC 3W7UA 2A79B 2YUAA 3DC5A 4WBNB 3WG7B 2BE3A 5L3EA 1PNLA 2VQEB 5GTHZ 4DO2A 3C3TA 4LCUC 1JOYA 1AP6A 1OV9A 4PHZA 2PTMA 4K0KB 1G1XB 4B3RB 2VQEO 2GHYA 3K03A 4XBFA 5LP6B 3RYFB 4CS2A 2UXCB 2VQFB 3RYCB 2A9HA 4K0KO 5KA6A 2OWOA 5L3FA 2UXDB 3H01A 1IXBA 1S0VA 1OCRC 4J41A 4UVBA 3HKCA 1O9GA 1TUBB 4E2LA 2HJFC 2BOCC 4LP8A 2EIMC 1Y76A 1AR1B 4D7TA 4FLVA 1H2NA 1YJWV 1X59A 2KG7A 1KECA 3CP1A 3B8MA 1K9MW 2PYLA 1JQ0A 3BHPA 1M90W 3LNNA 3QO8A 2HP8A 2ZE8A 1K8AW 5CN0A 2YICA 1GM8A 4JI5B 1ZSPA 2UUBO 4AQYO 3CRQA 1FYJA 4B7EA 2JGDA 4PA4A 4J9ZB 5DN6G 4KP4A 5B1AB 1K34A 2M6YA 1Y76B 5IY5B 5KUKA 2BOBC 1Q3EA 4DV5B 1YTFB 3FB6C 2YXLA 5IYCO 2KG7B 3CYOA 2Q8VA 3MHHC 3SJCC 3AG1B 3X2QB 3UKMA 2FB5A 3AG4C 1YTFD 3OTOO 4NXMB 3U11A 3ETGA 5J2UA 1PV0A 3N2GA 1G8MA 1HP8A 2CGNA 4FIPC 4LH6A 2LQTA 3C90A 1YVWA 5CA1A 2ZR2A 3STZC 1H2SB 2QM8A 1JR9A 4JYBA 5J2TA 4ZIBA 5EZYA 1K92A 1N0NA 1YJNV 4BW9A 1XNQO 1O9HA 3CS5A 2Q68A 2Y4TA 1K73W 5H9CA 4KXRA 3OFNG 3SPCA 4TWKA 3E89A 3K9AA 4OX9B 1D5NA 1F7YA 2UXBB 2K1EA 1AI5A 4LFAB 3NXSA 3S3XA 5J2UB 2UXBO 3N2GB 3K5MA 1VF7A 1S5JA 1KC8W 2WLHA 4JAVA 1LUWA 3B77A 2YXHA 3F7VC 2FTKA 3BA8A 4ZBMA 4LC1A 4AHCA 4AI8A 2PY5A 3RN4A 3OEHG 4B3SO 2H8PC 3OEEG 4JI8O 1SERA 3GWOA 5CB4B 5L3BA 2ZR3A 4O2BA 1GO3F 1MSDA 3O9OA 1OZ0A 3BY6A 3ZHRA 3P32A 1UPGA 1NT2B 4LF4B 1HNWB 5B3SB 1N34O 4LF6B 5LA6A 2ZQMA 2LFSA 2OT5A 2QDOA 3OT7A 1KB9F 3HPLC 2MW2B 5E1AC 4MTXA 4RUEA 1YI2V 3CCRV 3ZHTA 4N23A 5L3DA 1T5EA 1QLEB 1P49A 1KD1W 4DV7B 1M56C 1BZKA 2F66C 4O2BB 2NN4A 4H44B 1XI1A 3AG3B 1NTZH 3FAVB 5FPRA 5K1PA 4K8ZA 4DV2B 1M57B 4X1YA 3KCXA 2JVDA 2Q9LA 3ZBHA 4DV2O 2HEPA 3ASOC 2CTQA 5LA6B 2QEXV 2QGNA 4DW0A 1QU7A 5C8YA 2W0XA 3AG2C 2JEUA 4NTYA 1QBZA 5A9GA 4MW8A 2A7WA 2LW7A 3ABLB 1XNRO 1CPYA 3R65A 4BIZA 2XASA 2QWPB 2Q69A 2NNUA 4BR6A 2DYSC 1YCIA 4X1YB 3RYHA 3JYCA 3A0RA 4B3TB 4JI1B 3TK1A 3DXRB 2LFRA 5EIBD 4B3TO 4JI1O 4D7SA 4FM2A 5L3CA 1K4DC 2EJRA 3G6BA 4UCUA 5C8YB 5H2FZ 3CCVV 2UUCB 4DR5B 1ZL8A 3EXAA 2IM9A 2AXTZ 1KMIZ 1NTMH 2UUCO 4DUYO 4X64B 4DV6B 4GT1A 4RQEA 3JD1A 1EZVH 4QPKA 4MVMA 3RYHB 4X64O 5KHJA 5LYJB 5FLXN 5IE9A 4ABMA 2XOKG 4JPRA 1DK1A 5EBWC 1WP7A 2RDCA 2YI9A 1JJOA 2Q6AA 4DR2B 1TGOA 2YEVA 3WB1A 4CC5A 3CPWU 3CE2A 5IYZA 2YC0A 1GK9A 1RPOA 1ZL8B 1MABG 2IH3C 3W7XA 2ZNIA 1CXZB 3NR7A 1VIBA 3D3IA 3DGEA 1AROP 1F23A 2DE0X 2ZE6A 4DR1O 3RW0A 4JI7B 3QF7A 3K5OA 3B4SA 4FM0A 2OCHA 4PV1B 4PDRA 5L3GA 3CXCU 4GZRB 4JTCB 3ABTA 4NR1A 4CC6A 2V7QG 5IJ9A 4N21A 2YEVB 2Q4PA 2ITCC 1VQOV 3K06A 3B2EE 1JCHA 5IYZB 2E5LB 3L74H 4X88A 5CBHA 3BVOA 1GMGA 3T4DA 4ASUG 2PGGA 2E5LO 3JAMN 2HR3A 4NKGB 3CMEV 1L1FA 3CCLV 4X1IB 1VQMV 3E8FA 5KHKA 4DV1B 1G6UA 2EBOA 1LNQA 2JJ1G 4BW5A 3JASA 1WN7A 4CS3A 1WP8A 2QJ1A 3LNMB 3IGAC 5A2QN 1GKFA 3FB5C 1EM1A 4KFMA 4CS4A 4K8XA 1F51A 4WFEA 3CD6V 4HNAA 4G2KA 4FLWA 4IL6Z 4KHPB 4UUJC 4UCOA 5IWAB 3BAAA 3SYOA 2ZIMA 1K7DA 3SJAC 5IWAO 3VOUA 4JI4B 2EIKC 3WB0A 4DV4B 1SZXA 1N8RW 3AK1A 3JASB 1YXBA 4DV4O 1AR4A 3CX5F 4J7KA 5EC2C 1R1BA 1WPXA 3OW2U 4FPPA 1XMOB 4QIWF 3K58A 2KQXA 2XUMA 1HR0B 3WU2Z 4HNAB 1RSOA 3QNEA 3JATB 3CHXA 1HR0O 1AJPA 1BGYH 1QVGU 1SESA 1P4RA 4FFKA 4JI3B 2W6IG 2PUSA 1OCOB 5LMUB 4XDJA 1LUVA 1HW7A 1F4MA 5D5QA 2DWDC 2V1DA 5LMUO 2QWOB 3TETA 1PL4A 1XDCA 4LF7B 1R73A 4JZGA 1TA8A 4WFAV 4LF7O 1Q6UA 4YXWG 4DK0A 1B3QA 1H8HG 3KKYA 5KHIA 1WA8A 4GLXA 4GCZA 4NXNO 1BL8A 1RSOB 4NTWA 1SQXH 3QTCA 2Z3YA 4FLUA 3K5LA 1XOUA 4O4JA 3ZS8C 2WLJA 1X4TA 2OIGA 3SYPA 3BRCA 4JTDB 1VQKV 1BHAA 1V54C 3P3PA 2R9RB 2Y48A 5B1OA 1HWYA 1H38A 4X62B 1KP2A 1WA8B 3ABKC 1QLNA 1K3EA 3ZMTA 3CCMV 1XBLA 4X62O 1PP9H 1Y74A 4FLXA 1L0NH 5LBQA 4DV3B 2ZDIA 3UT5B 4TOIA 1GM9A 1VQ4V 1R3KC 4MVSA 4O4JB 4DR3O 4JI6B 4DV3O 2N05A 3LUTB 2F4VO 3HKBA 2IJHA 3JD2A 3CCJV 2XAHA 4XDLA 2QA4V 4OPAA 3VQYA 1VQ7V 5HFMA 1SQVH 4GKJB 1U96A 3APQA 3R66A 1EN6A 4GKJO 4PELA 1XHZA 1I5YA 1SZTA 3K79A 3JD4A 3STLC 1Y74B 1E79G 1VF6A 2Y0IA 3ASOB 1L0LH 2JJ2G 2X6AA 2E75B 1EN4A 1G4YB 1YEWA 3AK2A 2DQ0A 2YIBD 5KLVH 5CBFA 3HKBB 2BCCH 2DOSA 2QTSA 5BZBA 3AG2B 2QR4A 3A2FA 1ZLZA 4K3AA 4O4IB 1AI4A 2CE4A 1OCZB 1EN5A 1JX9A 3K57A 1ENVA 4J10A 4UVAA 3SPHA 4LWSB 1HDJA 1THZA 2ZM6O 2BTQA 3F5WC 1K4CC 4J9YB 3L72H 3DC6A 3LSQA 1BQ0A 4LF8O 2ITDC 5LOVA 5LL6Y 3CCUV 2UU9B 3F5TA 3OUSA 2EIJB 4P2ZA 1ORQC 4LF9O 2JK5C 3SYCA 2UU9O 3ZRSA 1N0JA 2PZSA 4FM1A 4PI2A 1FJGB 3LDDA 3ASNB 2X6BA 4JASA 1FJGO 1RPRA 4MSWC 2Z5UA 3DTUB 2B1IA 3RFRA 1OCCB 3MDSA 2UUBB 4AQYB 5GTIZ 4FJCC 4X1KA 4LNUA 5KUMA 5LOVB 3HKCB 1FXKC 1GRJA 2YSUB 1RM1C 4B7KA 4IYIA 3CCSV 3LDEA 2CAZC 3LSUA 5CMUA 4I55A 1IZ3A 4YY3B 1WB7A 1SQFA 2EILB 2PI5A 3ABMB 2GV9A 4J11A 3IC9A 1Q5OA 2OTLV 4YY3O 3OTOB 4G28B 4UV9A 4I50A 1NS1A 1SQQH 2LW1A 1KKDA 4U3FH 3ZMSA 2E3CA 3OD4A 2DJVA 3D8CA 2R72A 1WNSA 5CA3A 4X1KB 2F95B 5LGUA 2IJIA 4FVMA 2ILMA 2AHZA 3TXSA 4ZKIA 1XNQB 2JGDB 1EBOA 1Z5WA 4JI2B 3K0GA 4UVCA 4LFCO 3IJ4A 5BMVA 2RMKB 4JI2O 2QWNB 1L8DA 1H2KA 4I50B 2ADQB 1YITV 3N2KA 1XHXA 4PDLA 4DV0O 5CA1B 5D5PA 3THOA 4B3SB 4JI8B 2JDIG 1W0KG 2B5UA 2PF4E 1Y4MA 3FFQA 5J2TB 5EZYB 4JYAB 2Y69C 2PI4A 3SPIA 1KP3A 3JALA 4JYAO 3H1IH 1WAZA 4J80A 1BMFG 2RJZA 4JYCA 4MVZA 2DYRC 3I5DA 1ROPA 5BMVB 3B8NA 4YIOA 1N34B 4DRXA 1M1KW 2P90A 4GUNA 1GM7A 4WFHA 3W7WA 4CZZA 3MHSC 2EINB 4UB8Z 2ZE7A 2F43G 5J9PC 3ZN0A 1OJHA 4J7ZA 2WA4A 2B1GA 1Q8IA 2HFEC 2F23A 4H0LB 4PJ0Z 2HHHO 4CH4A 3ZMUA 2PYJA 2P4KA 2IU0A 2E76B 3ZMVA 4DRXB 1ZTEA 4I4TA 5FPOA 3G80A 1DLBA 3K9SA 2RCVA 1QR9A 4IHJA 4JAAA 1KYOF 5AG2A 4EB6A 3UM7A 3TGUH 1MMMA 1RP3B 1XNRB 1EFRG 1H2MA 4BIOA 3P30A 3QVNA 3A0HZ 1JMKC 1KU9A 1I7FA 1N33O 3L71H 4BAYA 3F7YC 2DN9A 1B06A 3H1JH 1V55B 3OE7G 2DW4A 3L9DA 3E8GA 1KKCA 4I4TB 3SYQA 3OMNB 3VQXA 3WG7C 2YXYA 4UB6Z 3AG7A 1I94B 4IIJA 4EFBA 1KBHA 4WCEV 1KUQA 4IHJB 3D36A 4EB6B 4GX0A 3UCSC 3H1KH 1I94O 1QHTA 1VQ6V 4GYCB 1MG1A 5LP6C 3ABKB 3K08A 1E1QG 1AJNA 5DEDA 5KHGA 4Q6GA 4JV5O 4L8JA 4DUYB 2OIEA 1SQBH 2JS5A 4LBEC 3SPGA 3A0BZ 2WLLA 5JJJB 1W0JG 3QG5A 4PA9A 3CC2V 2HLDG 1PKXA 5JQGA 1AVMA 2JIZG 3BA9A 3L73H 2P7TC 2Q7EA 3FB7C 5B1BB 1XREA 4IIJB 1US6A 1IDSA 3T1HB 3HKEA 2HKOA 3T1HO 1SF9A 3C3SA 2BSKA 5IJ0A 2ZT9B 3N27A 2OCCB 1CEZA 1VQ5V 2WLLB 3AK3A 3CXHF 2FL4A 4DR1B 5B1AC 5JQGB 3K3WA 3VBBA 2AZ2A 2BTOA 1SQPH 1J95A 1XMQB 3HKEB 1JPXA 3AG1C 3X2QC 1FFXA 3OMIB 2V4DA 1XMQO 1DF5A 2P06A 1ZX3A 4TQDA 2BSKB 5IJ0B 2XTAA 4A5UB 4BWAA 1U97A 4YJ3A 3PN1A 1KQSU 3RT3C 1OCRB 4LFBO 3FKSG 1FXKA 3JCUZ 1IX9A 1BE3H 2EIMB 4X65O 1IURA 4JTAB 1MOFA 3ZHUA 3OR7C 4O2AA 3APOA 3JD0A 4F6EA 4W4LA 5IJ9B 2O57A 5DECA 3ZMZA 1R6NA 1OHHG 2QSAA 2JS3A 1CP9A 4MT8A 3SGIA 3CWBH 3EVKA 1GN4A 4IT5A 1S5LZ 4H37A 3GVMA 2ZCEA 3CCQV 2NR5A 4I9WA 1FXKB 2HG5C 2CTPA 3W7SA 4FK5C 3JSNA 4EKWA 2WA3A 1N36O 1H8EG 4R50A 1S3JA 3G71V 4O2AB 4U7NA 2QM7A 1GH6A 4FFBA 4QJFB 5KAFZ 4ZHQA 1F4NA 3AG4B 5BXZA 5B3SC 1K5SA 3T2MA 3K04A 2A0LA 3IAYA 1R3LC 1Z5VA 3ML0A 1GN2A 2YS8A 3Q4HA 1SS3A 4I0XA 4X9QA 4H13B 3ZIAG 3E2EA 1QLEC 1XUQA 1YDXA 5H6QA 3DSQA 4B3MO 2X0LA 3AG3C 3CRAA 1FS0G 2ZXWC 3CRMA 4XDKA 4NXNB 2GDSA 4DR6B 4MTGA 1LR1A 4TT3G 1AP5A 1IBMB 4DR6O 2CGOA 4ZHQB 5EK0A 5LGNA 2JGUA 1IBMO 2LGWA 2RN9A 3L75H 3PJSK 4OGQB 1ZUQA 3FX7A 3Q4HB 2QKCA 4P30A 3HB3B 5KMGA 4I0XB 5B1NA 2GBOA 5JVDA 4NYKA 5EBLC 5JCOC 3E86A 2ZNJA 1SQGA 2D2CB 3S3WA 5B66Z 4AILC 4J42A 4FLYA 1FKAO 2ZKOA 1JVMA 3BFRA 4HZ3A 5EIBC 1WJZA 3EHBB 3MAQA 4DR3B 2IH1C 3A8TA 1VQLV 2YDEA 2F4VB 3P3NA 1MA1A 2CUGA 4NTXA 1PNMA 5KMGB 1WB8A 2EZPA 1SA0A 4MS2A 4RQFA 1YIJV 4JF3A 5E79Z 2H94A 1M56B 2VRZA 1NBMG 3IFXA 3J81N 4DR4B 1VARA 3JAKA 1Y66A 5KX5A 4J7JA 4CH3A 3TXQA 4DR4O 3J80N 5KAIZ 1PD3A 2X6CA 1AI6A 5CA0A 4UCRA 4Z2WA 3ZN1A 1H2GA 1GAXA 1R6TA 5FNVA 1JFFA 3E35A 4RWUA 2FYUH 2XAJA 1NU1H 1GTOA 2ZE5A 2X7RB 3SJBC 5LP6A 1SA0B 3RYFA 5LGTA 5LHGA 1AILA 4CH6A 4LF5B 5HFLA 1PL0A 1NTKH 3CB2A 2HVJC 4FZ0A 4NVPA 4DUZO 2W6JG 4LF5O 3ETDA 4P9PA 2QWQB 3JAKB 1N32B 2DYSB 2ZM6B 4Z1VA 1Z2GA 1HNZO 1P84F 4PD4F 1N32O 5CA0B 4LF8B 3L70H 2ZD9A 5FNVB 3H1LH 4YJ2A 1JFFB 4WF9V 2LGQA 4LF9B 1MNGA 1XL4A 2ATKC 1J5EB 2XAGA 4LR3A 1J5EO 2ETNA 1Y6XA 4PDMA 3ZHVA 4B3RO 4MVRA 1QCEA 2UXCO 2VQFO 2EZOA 3KG2A 3CJHA 2ODMA 4JZ2A 3OR6C 3HR0A 1H2LA 1PM9A 4IGGA 1JJ2U 2UXDO 2UXNA 4DR7B 2KKWA 1NR1A 1B04A 3OAAG 1IBLB 3OM3B 1SC5B 2Q73A 4UCVA 4DR7O 1Q86W 3ABUA 2QKAA 2BTQB 3ZRVA 3H1HH 1IBLO 3IC7A 5LXTA 4OXSA 4YJ2B 1IBKB 1M9NA 1VF5B 3E22A 1IBKO 2WLKA 4HBNA 3TCUA 1Q6IA 1A32A 2P6JA 1QVFU 1RFYA 2XAFA 3OUFA 2UUAB 3ETQA 3CJHB 3ZCCA 3T1CA 2WLIA 4JI5O 2UUAO 4JGSA 5JJEB 1YSCA 4O4LA 2Z0AA 1M5IA 4X89A 1NJIW 3UQ8A 2P67A 4DXWA 1NKDA 2XAQA 4LNUB 1Q7YW 4QGPA 4CH5A 4FLTA 5LXTB 3JSLA 3QO5A 4PI0A 5KHHA 4R8CA 5EYPA 4DV5O 4MVOA 2LP7A 3G4SV 3E22B 2MK3A 2A06H 2M7WA 4LFCB 3ZEDA 2DMXA 1VP7A 2ZIOA 4I55B 3E83A 2P5OA 5IYBO 3BABA 2GSMB 3FB8C 4NXMO 3WB2A 1OCOC 3CMAV 2WLIB 1NH2B 1M4UA 2CH7A 1DGSA 4O4LB 2WWWA 3FYEB 4DV0B 2RQ6A 5CB4A 2IU3A 4KL1A 3BEHA 1XL6A 1NH2D 3I56V 5F2VO 2XT9A 4FZ1A 1XEQA 3VQVA 5EYPB 1K5QA 1D5AA 2W0FC 2B9ZA 3QO7A 4U3JA 2WPDG 5GONA 4OX9O 2GTAA 4W4KA 4LFAO 3GWKC 4PA3A 4JAUA 1K33A 2ARHA 4RAIA 5JH7A 5ITZA 1XILA 2EIKB 1I08A 2CH7B 3B09A 1NZ6A 4MW3A 4ZOLA 4O4HA 3UO2A 3N2KB 1MZEA 1GN3A 2YI8A 1D2DA 4KUMA 3ZHSA 4MVUA 5JWPA 5H5NA 1SKVA 1UFIA 3FAVA 2ZINA 3CRCA 3OGIB 3MD0A 4U3JB 4PDVA 5GONB 2HHHB 3JALB 4LF4O 1WPBA 2IJKA 1HNWO 4LF6O 1FXVA 1JA8A 2IBZH 5JH7B 5EC1C 5ITZB 1R6KA 1NVPB 4QNHB 4ZOLB 4O4HB 1NI8A 5JCOA 1VQ9V 1MSWD 1IVSA 4DV7O 1NVPD 3SYAA 3CCEV 4OPHA 2ZXWB 2AGAA 4DK1A 1N33B 4WFBV 5BR8B 3AEIA 2ZDIC 1COWG 5BR8O 1DF4A 3DXRA 2AHYA 1FAFA 3CC4V 1XQ8A 2P4VA 2GUZA 1VEWA 3OTFA 1P7BA 1FD9A 3SPJA 1V54B 4MTOA 4WFFA 4R7CA 2R9AA 2CK3G 1OCZC 5IDJA 3JARA 2C2AA 3JD3A 4X20A 4JV5B 1DTOA 2EJ7A 2F93B 2WAMA 2HJDA 5LYJA 1BS3A 3TJTA 1VF6C 3T4ZA 2L6LA 4HYOA 1QQCA 2LO1A 2WSSG 2Y4UA 1S76D 2GUZB 3WFVA 4FLZA 2Q7HA 2EIJC 2GTSA 3RBZA 1URFA 2QE7G 3ASNC 2CDYA 1Q43A 4GX1A 5LMNB 4QPJA 5H6RA 5CBGA 1YF2A 4DYLA 2IJJA 3SR2C 5LMNO 3JARB 3LDCA 4DR5O 1W59A 4I9QA 1OCCC 2IW5A 3M7MX 2VS0A 4X20B 2OYQA 1AI7A 4DV6O 4GKKB 1TAEA 3HKDA 4GKKO 1Y67A 2KB1A 1HNXB 4UCTA 3BPZA 1AB3A 1BQZA 5KA5A 1HNXO 3VQWA 1NR7A 2Q67A 4B08A 5IY5C 4ICGA 4DR2O 1R3JC 2EILC 3CRRA 4UV8A 1EZJA 3FD9A 3ABMC 3RYIA 3T1YB 5IT9N 3OMAB 4GX5A 4TQFA 1K97A 4X66B 2DWEC 3OGCC 4X1IA 3K5NA 3T1YO 3ZX6A 5B5EZ 3M99B 3RGBA 3E8HA 4P9OA 4X66O 3KZIZ 2CTRA 3UO3A 2VWKA 1MZFA 3CSXA 1Q90D 4LFBB 1S77D 4JI7O 3U0ZA 2K9PA 3HKDB 1YJ9V 3U10A 2Y0PA 4X65B 4TV8A 3K0DA 2HVKC 3ETEA 4E4EA 3CEIA 2NLJC 4BIUA 3RYIB 4YHHB 4LH7A 4GX2A 1WLEA 2KSDA 3RWRD 1BHBA 1FFXB 5K1XA 4YHHO 1P7GA 1I0HA 3O65A 3RVZA 1NQTA 4DV1O 4UCSA 3FYIB 4I7ZB 1FFTB 4YJ3B 1V9PA 4PA7A 2CTWA 4RUFA 2G38A 3D3QA 4UXNA 3RVYA 1FXHA 1PPJH 1IXMA 4TV8B 1N36B 5DM6V 1RM1B 2JEXA 2ADPA 1B6QA 1Q82W 3JATA 4X8AA 2R9IA 2XNDG 2QWRB 4KHPO 4IYHA 3W7TA 4R6ZA 4TV9A 3ICXA 2F1MA 1Q81W 1BSMA 2RNBA 1QNMA 1VQPV 4QE7A 4TSFG 4JI4O 2A3QA 3M8AA 4I5SA 3BCCH 2AZ0A 2EINC 2N74A 2VWJA 5EBMC 3G6EV 4K35A 5LHHA 2H3OA 4JI0B 2WLNA 1TVKA 4B3MB 1YZBA 1BT8A 4JI0O 1YHQV 1ZWIC 2JRIA 1XMOO 2Q0AA 1SRYA 4HAMA 3H9VA 2P22C 4WFGA 1M57C 2YIAA 4TV9B 4L87A 4FFBB 5JJNB 1AR5A 4JI3O 3LSSA 4RO2A 2XHBA 3JAWA 1BCCH 1PNKA 1S5HC 2FMLA 3ZHQA 5LHIA 3J7AU 2WLMA 3ZRWA 1VQNV 4F4LA 4JYYA 1AJQA 4H33A 1S72V 1TVKB 2N04A 3KCYA 4F6RA 3ABLC 2Y69B 4FMTA 3UT5A
chains in the Genus database with same CATH topology
1NS1A 1N36O 1G1XB 2VQEO 3T1HO 1IBLO 3O65A 5LMUO 2DJVA 2HHHO 4K0KO 2LW7A 4DV1O 1XNRO 1IBKO 1D2DA 1F7YA 2DOSA 4LF7O 5H5NA 5BXZA 3J81N 1A32A 2UXBO 4DR4O 3J80N 4NXNO 2FKXA 2E5LO 3JAMN 5LMNO 4JI5O 4DR5O 2UUAO 1R6TA 4LF4O 4LFCO 4KHPO 4B3SO 1HNWO 2Z0AA 4JI8O 1X59A 4DV6O 4LF6O 4B3TO 4JI1O 4JI2O 2ZM6O 1N33O 4B3MO 1XMQO 1AILA 4JI4O 5A2QN 3M8AA 4LF8O 4GKKO 1AB3A 5LL6Y 4DV5O 3F5TA 4JI6O 2N74A 2UUBO 1HNXO 4AQYO 4DR6O 4A5UB 4DV0O 4DUZO 4DV7O 4LF9O 2UUCO 5BY1A 4DR2O 2UU9O 4OPHA 1FYJA 4LF5O 4DUYO 1N34O 1IBMO 2AGAA 3RT3C 4LFBO 4NXMO 5IT9N 1YZBA 1KUQA 4JI0O 4X62O 4X64O 5FLXN 1HNZO 5IWAO 1FJGO 2JRIA 1XMOO 1N32O 4X65O 1I94O 3T1YO 5BR8O 4JYAO 1DK1A 4X66O 4DR3O 4DV3O 4JV5O 2F4VO 4DV4O 4JI3O 3OTOO 1R1BA 4JI7O 1J5EO 1XEQA 1FKAO 4OPAA 2ZKOA 3J7AU 4B3RO 3SDLA 2UXCO 2VQFO 4DV2O 1HR0O 3R66A 4OX9O 4GKJO 2UXDO 4LFAO 4YY3O 4DR1O 4DR7O 4YHHO 1XNQO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NS1 A;  1N36 O;  1G1X B;  2VQE O;  3T1H O;  1IBL O;  3O65 A;  5LMU O;  2DJV A;  2HHH O;  4K0K O;  2LW7 A;  4DV1 O;  1XNR O;  1IBK O;  1D2D A;  1F7Y A;  2DOS A;  4LF7 O;  5H5N A;  5BXZ A;  3J81 N;  1A32 A;  2UXB O;  4DR4 O;  3J80 N;  4NXN O;  2FKX A;  2E5L O;  3JAM N;  5LMN O;  4JI5 O;  4DR5 O;  2UUA O;  1R6T A;  4LF4 O;  4LFC O;  4KHP O;  4B3S O;  1HNW O;  2Z0A A;  4JI8 O;  1X59 A;  4DV6 O;  4LF6 O;  4B3T O;  4JI1 O;  4JI2 O;  2ZM6 O;  1N33 O;  4B3M O;  1XMQ O;  1AIL A;  4JI4 O;  5A2Q N;  3M8A A;  4LF8 O;  4GKK O;  1AB3 A;  5LL6 Y;  4DV5 O;  3F5T A;  4JI6 O;  2N74 A;  2UUB O;  1HNX O;  4AQY O;  4DR6 O;  4A5U B;  4DV0 O;  4DUZ O;  4DV7 O;  4LF9 O;  2UUC O;  5BY1 A;  4DR2 O;  2UU9 O;  4OPH A;  1FYJ A;  4LF5 O;  4DUY O;  1N34 O;  1IBM O;  2AGA A;  3RT3 C;  4LFB O;  4NXM O;  5IT9 N;  1YZB A;  1KUQ A;  4JI0 O;  4X62 O;  4X64 O;  5FLX N;  1HNZ O;  5IWA O;  1FJG O;  2JRI A;  1XMO O;  1N32 O;  4X65 O;  1I94 O;  3T1Y O;  5BR8 O;  4JYA O;  1DK1 A;  4X66 O;  4DR3 O;  4DV3 O;  4JV5 O;  2F4V O;  4DV4 O;  4JI3 O;  3OTO O;  1R1B A;  4JI7 O;  1J5E O;  1XEQ A;  1FKA O;  4OPA A;  2ZKO A;  3J7A U;  4B3R O;  3SDL A;  2UXC O;  2VQF O;  4DV2 O;  1HR0 O;  3R66 A;  4OX9 O;  4GKJ O;  2UXD O;  4LFA O;  4YY3 O;  4DR1 O;  4DR7 O;  4YHH O;  1XNQ O; 
#chains in the Genus database with same CATH topology
 4TUY A;  1QR8 A;  1TUE B;  4Z1M G;  2AW9 A;  2DYR B;  4MVQ A;  5IYD O;  3G67 A;  1E1R G;  1V55 C;  4DW1 A;  3CC7 V;  2E74 B;  1W2B U;  4YIP A;  3JAW B;  3ZRX A;  3EFF K;  4EEQ A;  2EX3 A;  2Q5Z A;  2R70 A;  3ZRW B;  3GB7 C;  2FKX A;  4QE9 A;  4UFZ A;  2DQ3 A;  3E8B A;  4EFE A;  5JVD B;  1SET A;  2QM4 A;  2EUL A;  1N4C A;  4NB5 A;  2YIB A;  4F6R B;  4Q20 A;  3JCZ A;  4MTF A;  4D6T H;  1VQ8 V;  2QTO A;  4TUY B;  4ZI7 A;  4U7O A;  4PA6 A;  1ZAU A;  1VMG A;  4JI6 O;  1Q6H A;  5BY1 A;  3B40 A;  1UJW B;  1FPO A;  4WBN A;  2D3O W;  5B1B C;  4O4I A;  2LJ2 A;  3D36 C;  1I5X A;  4CBC A;  5GW7 A;  2Q7G A;  1R3I C;  2UXX A;  4LWS A;  1M93 A;  5C93 A;  3RYC A;  3I55 V;  2L35 A;  4DUZ B;  2OTJ V;  2Q0O C;  2OCC C;  4G27 B;  5FL7 G;  3ZJZ A;  4C7U A;  4ZI7 B;  1HNZ B;  5TIS Z;  1GN6 A;  3K59 A;  1TUB A;  2YID A;  3SDL A;  5KX5 B;  2QKS A;  3SJQ C;  3W7U A;  2A79 B;  2YUA A;  3DC5 A;  4WBN B;  3WG7 B;  2BE3 A;  5L3E A;  1PNL A;  2VQE B;  5GTH Z;  4DO2 A;  3C3T A;  4LCU C;  1JOY A;  1AP6 A;  1OV9 A;  4PHZ A;  2PTM A;  4K0K B;  1G1X B;  4B3R B;  2VQE O;  2GHY A;  3K03 A;  4XBF A;  5LP6 B;  3RYF B;  4CS2 A;  2UXC B;  2VQF B;  3RYC B;  2A9H A;  4K0K O;  5KA6 A;  2OWO A;  5L3F A;  2UXD B;  3H01 A;  1IXB A;  1S0V A;  1OCR C;  4J41 A;  4UVB A;  3HKC A;  1O9G A;  1TUB B;  4E2L A;  2HJF C;  2BOC C;  4LP8 A;  2EIM C;  1Y76 A;  1AR1 B;  4D7T A;  4FLV A;  1H2N A;  1YJW V;  1X59 A;  2KG7 A;  1KEC A;  3CP1 A;  3B8M A;  1K9M W;  2PYL A;  1JQ0 A;  3BHP A;  1M90 W;  3LNN A;  3QO8 A;  2HP8 A;  2ZE8 A;  1K8A W;  5CN0 A;  2YIC A;  1GM8 A;  4JI5 B;  1ZSP A;  2UUB O;  4AQY O;  3CRQ A;  1FYJ A;  4B7E A;  2JGD A;  4PA4 A;  4J9Z B;  5DN6 G;  4KP4 A;  5B1A B;  1K34 A;  2M6Y A;  1Y76 B;  5IY5 B;  5KUK A;  2BOB C;  1Q3E A;  4DV5 B;  1YTF B;  3FB6 C;  2YXL A;  5IYC O;  2KG7 B;  3CYO A;  2Q8V A;  3MHH C;  3SJC C;  3AG1 B;  3X2Q B;  3UKM A;  2FB5 A;  3AG4 C;  1YTF D;  3OTO O;  4NXM B;  3U11 A;  3ETG A;  5J2U A;  1PV0 A;  3N2G A;  1G8M A;  1HP8 A;  2CGN A;  4FIP C;  4LH6 A;  2LQT A;  3C90 A;  1YVW A;  5CA1 A;  2ZR2 A;  3STZ C;  1H2S B;  2QM8 A;  1JR9 A;  4JYB A;  5J2T A;  4ZIB A;  5EZY A;  1K92 A;  1N0N A;  1YJN V;  4BW9 A;  1XNQ O;  1O9H A;  3CS5 A;  2Q68 A;  2Y4T A;  1K73 W;  5H9C A;  4KXR A;  3OFN G;  3SPC A;  4TWK A;  3E89 A;  3K9A A;  4OX9 B;  1D5N A;  1F7Y A;  2UXB B;  2K1E A;  1AI5 A;  4LFA B;  3NXS A;  3S3X A;  5J2U B;  2UXB O;  3N2G B;  3K5M A;  1VF7 A;  1S5J A;  1KC8 W;  2WLH A;  4JAV A;  1LUW A;  3B77 A;  2YXH A;  3F7V C;  2FTK A;  3BA8 A;  4ZBM A;  4LC1 A;  4AHC A;  4AI8 A;  2PY5 A;  3RN4 A;  3OEH G;  4B3S O;  2H8P C;  3OEE G;  4JI8 O;  1SER A;  3GWO A;  5CB4 B;  5L3B A;  2ZR3 A;  4O2B A;  1GO3 F;  1MSD A;  3O9O A;  1OZ0 A;  3BY6 A;  3ZHR A;  3P32 A;  1UPG A;  1NT2 B;  4LF4 B;  1HNW B;  5B3S B;  1N34 O;  4LF6 B;  5LA6 A;  2ZQM A;  2LFS A;  2OT5 A;  2QDO A;  3OT7 A;  1KB9 F;  3HPL C;  2MW2 B;  5E1A C;  4MTX A;  4RUE A;  1YI2 V;  3CCR V;  3ZHT A;  4N23 A;  5L3D A;  1T5E A;  1QLE B;  1P49 A;  1KD1 W;  4DV7 B;  1M56 C;  1BZK A;  2F66 C;  4O2B B;  2NN4 A;  4H44 B;  1XI1 A;  3AG3 B;  1NTZ H;  3FAV B;  5FPR A;  5K1P A;  4K8Z A;  4DV2 B;  1M57 B;  4X1Y A;  3KCX A;  2JVD A;  2Q9L A;  3ZBH A;  4DV2 O;  2HEP A;  3ASO C;  2CTQ A;  5LA6 B;  2QEX V;  2QGN A;  4DW0 A;  1QU7 A;  5C8Y A;  2W0X A;  3AG2 C;  2JEU A;  4NTY A;  1QBZ A;  5A9G A;  4MW8 A;  2A7W A;  2LW7 A;  3ABL B;  1XNR O;  1CPY A;  3R65 A;  4BIZ A;  2XAS A;  2QWP B;  2Q69 A;  2NNU A;  4BR6 A;  2DYS C;  1YCI A;  4X1Y B;  3RYH A;  3JYC A;  3A0R A;  4B3T B;  4JI1 B;  3TK1 A;  3DXR B;  2LFR A;  5EIB D;  4B3T O;  4JI1 O;  4D7S A;  4FM2 A;  5L3C A;  1K4D C;  2EJR A;  3G6B A;  4UCU A;  5C8Y B;  5H2F Z;  3CCV V;  2UUC B;  4DR5 B;  1ZL8 A;  3EXA A;  2IM9 A;  2AXT Z;  1KMI Z;  1NTM H;  2UUC O;  4DUY O;  4X64 B;  4DV6 B;  4GT1 A;  4RQE A;  3JD1 A;  1EZV H;  4QPK A;  4MVM A;  3RYH B;  4X64 O;  5KHJ A;  5LYJ B;  5FLX N;  5IE9 A;  4ABM A;  2XOK G;  4JPR A;  1DK1 A;  5EBW C;  1WP7 A;  2RDC A;  2YI9 A;  1JJO A;  2Q6A A;  4DR2 B;  1TGO A;  2YEV A;  3WB1 A;  4CC5 A;  3CPW U;  3CE2 A;  5IYZ A;  2YC0 A;  1GK9 A;  1RPO A;  1ZL8 B;  1MAB G;  2IH3 C;  3W7X A;  2ZNI A;  1CXZ B;  3NR7 A;  1VIB A;  3D3I A;  3DGE A;  1ARO P;  1F23 A;  2DE0 X;  2ZE6 A;  4DR1 O;  3RW0 A;  4JI7 B;  3QF7 A;  3K5O A;  3B4S A;  4FM0 A;  2OCH A;  4PV1 B;  4PDR A;  5L3G A;  3CXC U;  4GZR B;  4JTC B;  3ABT A;  4NR1 A;  4CC6 A;  2V7Q G;  5IJ9 A;  4N21 A;  2YEV B;  2Q4P A;  2ITC C;  1VQO V;  3K06 A;  3B2E E;  1JCH A;  5IYZ B;  2E5L B;  3L74 H;  4X88 A;  5CBH A;  3BVO A;  1GMG A;  3T4D A;  4ASU G;  2PGG A;  2E5L O;  3JAM N;  2HR3 A;  4NKG B;  3CME V;  1L1F A;  3CCL V;  4X1I B;  1VQM V;  3E8F A;  5KHK A;  4DV1 B;  1G6U A;  2EBO A;  1LNQ A;  2JJ1 G;  4BW5 A;  3JAS A;  1WN7 A;  4CS3 A;  1WP8 A;  2QJ1 A;  3LNM B;  3IGA C;  5A2Q N;  1GKF A;  3FB5 C;  1EM1 A;  4KFM A;  4CS4 A;  4K8X A;  1F51 A;  4WFE A;  3CD6 V;  4HNA A;  4G2K A;  4FLW A;  4IL6 Z;  4KHP B;  4UUJ C;  4UCO A;  5IWA B;  3BAA A;  3SYO A;  2ZIM A;  1K7D A;  3SJA C;  5IWA O;  3VOU A;  4JI4 B;  2EIK C;  3WB0 A;  4DV4 B;  1SZX A;  1N8R W;  3AK1 A;  3JAS B;  1YXB A;  4DV4 O;  1AR4 A;  3CX5 F;  4J7K A;  5EC2 C;  1R1B A;  1WPX A;  3OW2 U;  4FPP A;  1XMO B;  4QIW F;  3K58 A;  2KQX A;  2XUM A;  1HR0 B;  3WU2 Z;  4HNA B;  1RSO A;  3QNE A;  3JAT B;  3CHX A;  1HR0 O;  1AJP A;  1BGY H;  1QVG U;  1SES A;  1P4R A;  4FFK A;  4JI3 B;  2W6I G;  2PUS A;  1OCO B;  5LMU B;  4XDJ A;  1LUV A;  1HW7 A;  1F4M A;  5D5Q A;  2DWD C;  2V1D A;  5LMU O;  2QWO B;  3TET A;  1PL4 A;  1XDC A;  4LF7 B;  1R73 A;  4JZG A;  1TA8 A;  4WFA V;  4LF7 O;  1Q6U A;  4YXW G;  4DK0 A;  1B3Q A;  1H8H G;  3KKY A;  5KHI A;  1WA8 A;  4GLX A;  4GCZ A;  4NXN O;  1BL8 A;  1RSO B;  4NTW A;  1SQX H;  3QTC A;  2Z3Y A;  4FLU A;  3K5L A;  1XOU A;  4O4J A;  3ZS8 C;  2WLJ A;  1X4T A;  2OIG A;  3SYP A;  3BRC A;  4JTD B;  1VQK V;  1BHA A;  1V54 C;  3P3P A;  2R9R B;  2Y48 A;  5B1O A;  1HWY A;  1H38 A;  4X62 B;  1KP2 A;  1WA8 B;  3ABK C;  1QLN A;  1K3E A;  3ZMT A;  3CCM V;  1XBL A;  4X62 O;  1PP9 H;  1Y74 A;  4FLX A;  1L0N H;  5LBQ A;  4DV3 B;  2ZDI A;  3UT5 B;  4TOI A;  1GM9 A;  1VQ4 V;  1R3K C;  4MVS A;  4O4J B;  4DR3 O;  4JI6 B;  4DV3 O;  2N05 A;  3LUT B;  2F4V O;  3HKB A;  2IJH A;  3JD2 A;  3CCJ V;  2XAH A;  4XDL A;  2QA4 V;  4OPA A;  3VQY A;  1VQ7 V;  5HFM A;  1SQV H;  4GKJ B;  1U96 A;  3APQ A;  3R66 A;  1EN6 A;  4GKJ O;  4PEL A;  1XHZ A;  1I5Y A;  1SZT A;  3K79 A;  3JD4 A;  3STL C;  1Y74 B;  1E79 G;  1VF6 A;  2Y0I A;  3ASO B;  1L0L H;  2JJ2 G;  2X6A A;  2E75 B;  1EN4 A;  1G4Y B;  1YEW A;  3AK2 A;  2DQ0 A;  2YIB D;  5KLV H;  5CBF A;  3HKB B;  2BCC H;  2DOS A;  2QTS A;  5BZB A;  3AG2 B;  2QR4 A;  3A2F A;  1ZLZ A;  4K3A A;  4O4I B;  1AI4 A;  2CE4 A;  1OCZ B;  1EN5 A;  1JX9 A;  3K57 A;  1ENV A;  4J10 A;  4UVA A;  3SPH A;  4LWS B;  1HDJ A;  1THZ A;  2ZM6 O;  2BTQ A;  3F5W C;  1K4C C;  4J9Y B;  3L72 H;  3DC6 A;  3LSQ A;  1BQ0 A;  4LF8 O;  2ITD C;  5LOV A;  5LL6 Y;  3CCU V;  2UU9 B;  3F5T A;  3OUS A;  2EIJ B;  4P2Z A;  1ORQ C;  4LF9 O;  2JK5 C;  3SYC A;  2UU9 O;  3ZRS A;  1N0J A;  2PZS A;  4FM1 A;  4PI2 A;  1FJG B;  3LDD A;  3ASN B;  2X6B A;  4JAS A;  1FJG O;  1RPR A;  4MSW C;  2Z5U A;  3DTU B;  2B1I A;  3RFR A;  1OCC B;  3MDS A;  2UUB B;  4AQY B;  5GTI Z;  4FJC C;  4X1K A;  4LNU A;  5KUM A;  5LOV B;  3HKC B;  1FXK C;  1GRJ A;  2YSU B;  1RM1 C;  4B7K A;  4IYI A;  3CCS V;  3LDE A;  2CAZ C;  3LSU A;  5CMU A;  4I55 A;  1IZ3 A;  4YY3 B;  1WB7 A;  1SQF A;  2EIL B;  2PI5 A;  3ABM B;  2GV9 A;  4J11 A;  3IC9 A;  1Q5O A;  2OTL V;  4YY3 O;  3OTO B;  4G28 B;  4UV9 A;  4I50 A;  1NS1 A;  1SQQ H;  2LW1 A;  1KKD A;  4U3F H;  3ZMS A;  2E3C A;  3OD4 A;  2DJV A;  3D8C A;  2R72 A;  1WNS A;  5CA3 A;  4X1K B;  2F95 B;  5LGU A;  2IJI A;  4FVM A;  2ILM A;  2AHZ A;  3TXS A;  4ZKI A;  1XNQ B;  2JGD B;  1EBO A;  1Z5W A;  4JI2 B;  3K0G A;  4UVC A;  4LFC O;  3IJ4 A;  5BMV A;  2RMK B;  4JI2 O;  2QWN B;  1L8D A;  1H2K A;  4I50 B;  2ADQ B;  1YIT V;  3N2K A;  1XHX A;  4PDL A;  4DV0 O;  5CA1 B;  5D5P A;  3THO A;  4B3S B;  4JI8 B;  2JDI G;  1W0K G;  2B5U A;  2PF4 E;  1Y4M A;  3FFQ A;  5J2T B;  5EZY B;  4JYA B;  2Y69 C;  2PI4 A;  3SPI A;  1KP3 A;  3JAL A;  4JYA O;  3H1I H;  1WAZ A;  4J80 A;  1BMF G;  2RJZ A;  4JYC A;  4MVZ A;  2DYR C;  3I5D A;  1ROP A;  5BMV B;  3B8N A;  4YIO A;  1N34 B;  4DRX A;  1M1K W;  2P90 A;  4GUN A;  1GM7 A;  4WFH A;  3W7W A;  4CZZ A;  3MHS C;  2EIN B;  4UB8 Z;  2ZE7 A;  2F43 G;  5J9P C;  3ZN0 A;  1OJH A;  4J7Z A;  2WA4 A;  2B1G A;  1Q8I A;  2HFE C;  2F23 A;  4H0L B;  4PJ0 Z;  2HHH O;  4CH4 A;  3ZMU A;  2PYJ A;  2P4K A;  2IU0 A;  2E76 B;  3ZMV A;  4DRX B;  1ZTE A;  4I4T A;  5FPO A;  3G80 A;  1DLB A;  3K9S A;  2RCV A;  1QR9 A;  4IHJ A;  4JAA A;  1KYO F;  5AG2 A;  4EB6 A;  3UM7 A;  3TGU H;  1MMM A;  1RP3 B;  1XNR B;  1EFR G;  1H2M A;  4BIO A;  3P30 A;  3QVN A;  3A0H Z;  1JMK C;  1KU9 A;  1I7F A;  1N33 O;  3L71 H;  4BAY A;  3F7Y C;  2DN9 A;  1B06 A;  3H1J H;  1V55 B;  3OE7 G;  2DW4 A;  3L9D A;  3E8G A;  1KKC A;  4I4T B;  3SYQ A;  3OMN B;  3VQX A;  3WG7 C;  2YXY A;  4UB6 Z;  3AG7 A;  1I94 B;  4IIJ A;  4EFB A;  1KBH A;  4WCE V;  1KUQ A;  4IHJ B;  3D36 A;  4EB6 B;  4GX0 A;  3UCS C;  3H1K H;  1I94 O;  1QHT A;  1VQ6 V;  4GYC B;  1MG1 A;  5LP6 C;  3ABK B;  3K08 A;  1E1Q G;  1AJN A;  5DED A;  5KHG A;  4Q6G A;  4JV5 O;  4L8J A;  4DUY B;  2OIE A;  1SQB H;  2JS5 A;  4LBE C;  3SPG A;  3A0B Z;  2WLL A;  5JJJ B;  1W0J G;  3QG5 A;  4PA9 A;  3CC2 V;  2HLD G;  1PKX A;  5JQG A;  1AVM A;  2JIZ G;  3BA9 A;  3L73 H;  2P7T C;  2Q7E A;  3FB7 C;  5B1B B;  1XRE A;  4IIJ B;  1US6 A;  1IDS A;  3T1H B;  3HKE A;  2HKO A;  3T1H O;  1SF9 A;  3C3S A;  2BSK A;  5IJ0 A;  2ZT9 B;  3N27 A;  2OCC B;  1CEZ A;  1VQ5 V;  2WLL B;  3AK3 A;  3CXH F;  2FL4 A;  4DR1 B;  5B1A C;  5JQG B;  3K3W A;  3VBB A;  2AZ2 A;  2BTO A;  1SQP H;  1J95 A;  1XMQ B;  3HKE B;  1JPX A;  3AG1 C;  3X2Q C;  1FFX A;  3OMI B;  2V4D A;  1XMQ O;  1DF5 A;  2P06 A;  1ZX3 A;  4TQD A;  2BSK B;  5IJ0 B;  2XTA A;  4A5U B;  4BWA A;  1U97 A;  4YJ3 A;  3PN1 A;  1KQS U;  3RT3 C;  1OCR B;  4LFB O;  3FKS G;  1FXK A;  3JCU Z;  1IX9 A;  1BE3 H;  2EIM B;  4X65 O;  1IUR A;  4JTA B;  1MOF A;  3ZHU A;  3OR7 C;  4O2A A;  3APO A;  3JD0 A;  4F6E A;  4W4L A;  5IJ9 B;  2O57 A;  5DEC A;  3ZMZ A;  1R6N A;  1OHH G;  2QSA A;  2JS3 A;  1CP9 A;  4MT8 A;  3SGI A;  3CWB H;  3EVK A;  1GN4 A;  4IT5 A;  1S5L Z;  4H37 A;  3GVM A;  2ZCE A;  3CCQ V;  2NR5 A;  4I9W A;  1FXK B;  2HG5 C;  2CTP A;  3W7S A;  4FK5 C;  3JSN A;  4EKW A;  2WA3 A;  1N36 O;  1H8E G;  4R50 A;  1S3J A;  3G71 V;  4O2A B;  4U7N A;  2QM7 A;  1GH6 A;  4FFB A;  4QJF B;  5KAF Z;  4ZHQ A;  1F4N A;  3AG4 B;  5BXZ A;  5B3S C;  1K5S A;  3T2M A;  3K04 A;  2A0L A;  3IAY A;  1R3L C;  1Z5V A;  3ML0 A;  1GN2 A;  2YS8 A;  3Q4H A;  1SS3 A;  4I0X A;  4X9Q A;  4H13 B;  3ZIA G;  3E2E A;  1QLE C;  1XUQ A;  1YDX A;  5H6Q A;  3DSQ A;  4B3M O;  2X0L A;  3AG3 C;  3CRA A;  1FS0 G;  2ZXW C;  3CRM A;  4XDK A;  4NXN B;  2GDS A;  4DR6 B;  4MTG A;  1LR1 A;  4TT3 G;  1AP5 A;  1IBM B;  4DR6 O;  2CGO A;  4ZHQ B;  5EK0 A;  5LGN A;  2JGU A;  1IBM O;  2LGW A;  2RN9 A;  3L75 H;  3PJS K;  4OGQ B;  1ZUQ A;  3FX7 A;  3Q4H B;  2QKC A;  4P30 A;  3HB3 B;  5KMG A;  4I0X B;  5B1N A;  2GBO A;  5JVD A;  4NYK A;  5EBL C;  5JCO C;  3E86 A;  2ZNJ A;  1SQG A;  2D2C B;  3S3W A;  5B66 Z;  4AIL C;  4J42 A;  4FLY A;  1FKA O;  2ZKO A;  1JVM A;  3BFR A;  4HZ3 A;  5EIB C;  1WJZ A;  3EHB B;  3MAQ A;  4DR3 B;  2IH1 C;  3A8T A;  1VQL V;  2YDE A;  2F4V B;  3P3N A;  1MA1 A;  2CUG A;  4NTX A;  1PNM A;  5KMG B;  1WB8 A;  2EZP A;  1SA0 A;  4MS2 A;  4RQF A;  1YIJ V;  4JF3 A;  5E79 Z;  2H94 A;  1M56 B;  2VRZ A;  1NBM G;  3IFX A;  3J81 N;  4DR4 B;  1VAR A;  3JAK A;  1Y66 A;  5KX5 A;  4J7J A;  4CH3 A;  3TXQ A;  4DR4 O;  3J80 N;  5KAI Z;  1PD3 A;  2X6C A;  1AI6 A;  5CA0 A;  4UCR A;  4Z2W A;  3ZN1 A;  1H2G A;  1GAX A;  1R6T A;  5FNV A;  1JFF A;  3E35 A;  4RWU A;  2FYU H;  2XAJ A;  1NU1 H;  1GTO A;  2ZE5 A;  2X7R B;  3SJB C;  5LP6 A;  1SA0 B;  3RYF A;  5LGT A;  5LHG A;  1AIL A;  4CH6 A;  4LF5 B;  5HFL A;  1PL0 A;  1NTK H;  3CB2 A;  2HVJ C;  4FZ0 A;  4NVP A;  4DUZ O;  2W6J G;  4LF5 O;  3ETD A;  4P9P A;  2QWQ B;  3JAK B;  1N32 B;  2DYS B;  2ZM6 B;  4Z1V A;  1Z2G A;  1HNZ O;  1P84 F;  4PD4 F;  1N32 O;  5CA0 B;  4LF8 B;  3L70 H;  2ZD9 A;  5FNV B;  3H1L H;  4YJ2 A;  1JFF B;  4WF9 V;  2LGQ A;  4LF9 B;  1MNG A;  1XL4 A;  2ATK C;  1J5E B;  2XAG A;  4LR3 A;  1J5E O;  2ETN A;  1Y6X A;  4PDM A;  3ZHV A;  4B3R O;  4MVR A;  1QCE A;  2UXC O;  2VQF O;  2EZO A;  3KG2 A;  3CJH A;  2ODM A;  4JZ2 A;  3OR6 C;  3HR0 A;  1H2L A;  1PM9 A;  4IGG A;  1JJ2 U;  2UXD O;  2UXN A;  4DR7 B;  2KKW A;  1NR1 A;  1B04 A;  3OAA G;  1IBL B;  3OM3 B;  1SC5 B;  2Q73 A;  4UCV A;  4DR7 O;  1Q86 W;  3ABU A;  2QKA A;  2BTQ B;  3ZRV A;  3H1H H;  1IBL O;  3IC7 A;  5LXT A;  4OXS A;  4YJ2 B;  1IBK B;  1M9N A;  1VF5 B;  3E22 A;  1IBK O;  2WLK A;  4HBN A;  3TCU A;  1Q6I A;  1A32 A;  2P6J A;  1QVF U;  1RFY A;  2XAF A;  3OUF A;  2UUA B;  3ETQ A;  3CJH B;  3ZCC A;  3T1C A;  2WLI A;  4JI5 O;  2UUA O;  4JGS A;  5JJE B;  1YSC A;  4O4L A;  2Z0A A;  1M5I A;  4X89 A;  1NJI W;  3UQ8 A;  2P67 A;  4DXW A;  1NKD A;  2XAQ A;  4LNU B;  1Q7Y W;  4QGP A;  4CH5 A;  4FLT A;  5LXT B;  3JSL A;  3QO5 A;  4PI0 A;  5KHH A;  4R8C A;  5EYP A;  4DV5 O;  4MVO A;  2LP7 A;  3G4S V;  3E22 B;  2MK3 A;  2A06 H;  2M7W A;  4LFC B;  3ZED A;  2DMX A;  1VP7 A;  2ZIO A;  4I55 B;  3E83 A;  2P5O A;  5IYB O;  3BAB A;  2GSM B;  3FB8 C;  4NXM O;  3WB2 A;  1OCO C;  3CMA V;  2WLI B;  1NH2 B;  1M4U A;  2CH7 A;  1DGS A;  4O4L B;  2WWW A;  3FYE B;  4DV0 B;  2RQ6 A;  5CB4 A;  2IU3 A;  4KL1 A;  3BEH A;  1XL6 A;  1NH2 D;  3I56 V;  5F2V O;  2XT9 A;  4FZ1 A;  1XEQ A;  3VQV A;  5EYP B;  1K5Q A;  1D5A A;  2W0F C;  2B9Z A;  3QO7 A;  4U3J A;  2WPD G;  5GON A;  4OX9 O;  2GTA A;  4W4K A;  4LFA O;  3GWK C;  4PA3 A;  4JAU A;  1K33 A;  2ARH A;  4RAI A;  5JH7 A;  5ITZ A;  1XIL A;  2EIK B;  1I08 A;  2CH7 B;  3B09 A;  1NZ6 A;  4MW3 A;  4ZOL A;  4O4H A;  3UO2 A;  3N2K B;  1MZE A;  1GN3 A;  2YI8 A;  1D2D A;  4KUM A;  3ZHS A;  4MVU A;  5JWP A;  5H5N A;  1SKV A;  1UFI A;  3FAV A;  2ZIN A;  3CRC A;  3OGI B;  3MD0 A;  4U3J B;  4PDV A;  5GON B;  2HHH B;  3JAL B;  4LF4 O;  1WPB A;  2IJK A;  1HNW O;  4LF6 O;  1FXV A;  1JA8 A;  2IBZ H;  5JH7 B;  5EC1 C;  5ITZ B;  1R6K A;  1NVP B;  4QNH B;  4ZOL B;  4O4H B;  1NI8 A;  5JCO A;  1VQ9 V;  1MSW D;  1IVS A;  4DV7 O;  1NVP D;  3SYA A;  3CCE V;  4OPH A;  2ZXW B;  2AGA A;  4DK1 A;  1N33 B;  4WFB V;  5BR8 B;  3AEI A;  2ZDI C;  1COW G;  5BR8 O;  1DF4 A;  3DXR A;  2AHY A;  1FAF A;  3CC4 V;  1XQ8 A;  2P4V A;  2GUZ A;  1VEW A;  3OTF A;  1P7B A;  1FD9 A;  3SPJ A;  1V54 B;  4MTO A;  4WFF A;  4R7C A;  2R9A A;  2CK3 G;  1OCZ C;  5IDJ A;  3JAR A;  2C2A A;  3JD3 A;  4X20 A;  4JV5 B;  1DTO A;  2EJ7 A;  2F93 B;  2WAM A;  2HJD A;  5LYJ A;  1BS3 A;  3TJT A;  1VF6 C;  3T4Z A;  2L6L A;  4HYO A;  1QQC A;  2LO1 A;  2WSS G;  2Y4U A;  1S76 D;  2GUZ B;  3WFV A;  4FLZ A;  2Q7H A;  2EIJ C;  2GTS A;  3RBZ A;  1URF A;  2QE7 G;  3ASN C;  2CDY A;  1Q43 A;  4GX1 A;  5LMN B;  4QPJ A;  5H6R A;  5CBG A;  1YF2 A;  4DYL A;  2IJJ A;  3SR2 C;  5LMN O;  3JAR B;  3LDC A;  4DR5 O;  1W59 A;  4I9Q A;  1OCC C;  2IW5 A;  3M7M X;  2VS0 A;  4X20 B;  2OYQ A;  1AI7 A;  4DV6 O;  4GKK B;  1TAE A;  3HKD A;  4GKK O;  1Y67 A;  2KB1 A;  1HNX B;  4UCT A;  3BPZ A;  1AB3 A;  1BQZ A;  5KA5 A;  1HNX O;  3VQW A;  1NR7 A;  2Q67 A;  4B08 A;  5IY5 C;  4ICG A;  4DR2 O;  1R3J C;  2EIL C;  3CRR A;  4UV8 A;  1EZJ A;  3FD9 A;  3ABM C;  3RYI A;  3T1Y B;  5IT9 N;  3OMA B;  4GX5 A;  4TQF A;  1K97 A;  4X66 B;  2DWE C;  3OGC C;  4X1I A;  3K5N A;  3T1Y O;  3ZX6 A;  5B5E Z;  3M99 B;  3RGB A;  3E8H A;  4P9O A;  4X66 O;  3KZI Z;  2CTR A;  3UO3 A;  2VWK A;  1MZF A;  3CSX A;  1Q90 D;  4LFB B;  1S77 D;  4JI7 O;  3U0Z A;  2K9P A;  3HKD B;  1YJ9 V;  3U10 A;  2Y0P A;  4X65 B;  4TV8 A;  3K0D A;  2HVK C;  3ETE A;  4E4E A;  3CEI A;  2NLJ C;  4BIU A;  3RYI B;  4YHH B;  4LH7 A;  4GX2 A;  1WLE A;  2KSD A;  3RWR D;  1BHB A;  1FFX B;  5K1X A;  4YHH O;  1P7G A;  1I0H A;  3O65 A;  3RVZ A;  1NQT A;  4DV1 O;  4UCS A;  3FYI B;  4I7Z B;  1FFT B;  4YJ3 B;  1V9P A;  4PA7 A;  2CTW A;  4RUF A;  2G38 A;  3D3Q A;  4UXN A;  3RVY A;  1FXH A;  1PPJ H;  1IXM A;  4TV8 B;  1N36 B;  5DM6 V;  1RM1 B;  2JEX A;  2ADP A;  1B6Q A;  1Q82 W;  3JAT A;  4X8A A;  2R9I A;  2XND G;  2QWR B;  4KHP O;  4IYH A;  3W7T A;  4R6Z A;  4TV9 A;  3ICX A;  2F1M A;  1Q81 W;  1BSM A;  2RNB A;  1QNM A;  1VQP V;  4QE7 A;  4TSF G;  4JI4 O;  2A3Q A;  3M8A A;  4I5S A;  3BCC H;  2AZ0 A;  2EIN C;  2N74 A;  2VWJ A;  5EBM C;  3G6E V;  4K35 A;  5LHH A;  2H3O A;  4JI0 B;  2WLN A;  1TVK A;  4B3M B;  1YZB A;  1BT8 A;  4JI0 O;  1YHQ V;  1ZWI C;  2JRI A;  1XMO O;  2Q0A A;  1SRY A;  4HAM A;  3H9V A;  2P22 C;  4WFG A;  1M57 C;  2YIA A;  4TV9 B;  4L87 A;  4FFB B;  5JJN B;  1AR5 A;  4JI3 O;  3LSS A;  4RO2 A;  2XHB A;  3JAW A;  1BCC H;  1PNK A;  1S5H C;  2FML A;  3ZHQ A;  5LHI A;  3J7A U;  2WLM A;  3ZRW A;  1VQN V;  4F4L A;  4JYY A;  1AJQ A;  4H33 A;  1S72 V;  1TVK B;  2N04 A;  3KCY A;  4F6R A;  3ABL C;  2Y69 B;  4FMT A;  3UT5 A; 
#chains in the Genus database with same CATH homology
 1NS1 A;  1N36 O;  1G1X B;  2VQE O;  3T1H O;  1IBL O;  3O65 A;  5LMU O;  2DJV A;  2HHH O;  4K0K O;  2LW7 A;  4DV1 O;  1XNR O;  1IBK O;  1D2D A;  1F7Y A;  2DOS A;  4LF7 O;  5H5N A;  5BXZ A;  3J81 N;  1A32 A;  2UXB O;  4DR4 O;  3J80 N;  4NXN O;  2FKX A;  2E5L O;  3JAM N;  5LMN O;  4JI5 O;  4DR5 O;  2UUA O;  1R6T A;  4LF4 O;  4LFC O;  4KHP O;  4B3S O;  1HNW O;  2Z0A A;  4JI8 O;  1X59 A;  4DV6 O;  4LF6 O;  4B3T O;  4JI1 O;  4JI2 O;  2ZM6 O;  1N33 O;  4B3M O;  1XMQ O;  1AIL A;  4JI4 O;  5A2Q N;  3M8A A;  4LF8 O;  4GKK O;  1AB3 A;  5LL6 Y;  4DV5 O;  3F5T A;  4JI6 O;  2N74 A;  2UUB O;  1HNX O;  4AQY O;  4DR6 O;  4A5U B;  4DV0 O;  4DUZ O;  4DV7 O;  4LF9 O;  2UUC O;  5BY1 A;  4DR2 O;  2UU9 O;  4OPH A;  1FYJ A;  4LF5 O;  4DUY O;  1N34 O;  1IBM O;  2AGA A;  3RT3 C;  4LFB O;  4NXM O;  5IT9 N;  1YZB A;  1KUQ A;  4JI0 O;  4X62 O;  4X64 O;  5FLX N;  1HNZ O;  5IWA O;  1FJG O;  2JRI A;  1XMO O;  1N32 O;  4X65 O;  1I94 O;  3T1Y O;  5BR8 O;  4JYA O;  1DK1 A;  4X66 O;  4DR3 O;  4DV3 O;  4JV5 O;  2F4V O;  4DV4 O;  4JI3 O;  3OTO O;  1R1B A;  4JI7 O;  1J5E O;  1XEQ A;  1FKA O;  4OPA A;  2ZKO A;  3J7A U;  4B3R O;  3SDL A;  2UXC O;  2VQF O;  4DV2 O;  1HR0 O;  3R66 A;  4OX9 O;  4GKJ O;  2UXD O;  4LFA O;  4YY3 O;  4DR1 O;  4DR7 O;  4YHH O;  1XNQ O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...