4JI4O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4ji4O00
2DJVA 2VQEO 1R6TA 4DV3O 4JI6O 1XEQA 2HHHO 4X62O 4YHHO 1XNRO 1X59A 2FKXA 4NXNO 3J81N 1YZBA 2VQFO 1FJGO 3OTOO 4DV4O 4DV0O 4JI3O 4B3RO 2ZKOA 4JI1O 2DOSA 4JI0O 4LF5O 2LW7A 2N74A 4DV5O 5IT9N 4YY3O 2UXDO 4DR6O 4DUZO 4X65O 2UUBO 5FLXN 1AILA 4LF7O 3F5TA 4X64O 3M8AA 2AGAA 5LMNO 1A32A 4B3SO 3RT3C 1N36O 4OPAA 5BY1A 4LF4O 4LFCO 4DR4O 4NXMO 3J7AU 4DV6O 3J80N 3T1HO 4JV5O 4LF6O 3R66A 4DV2O 1DK1A 4GKKO 1G1XB 2UUCO 5BXZA 5LMUO 1FKAO 4JI7O 4KHPO 4LFBO 4A5UB 4DV7O 2F4VO 1IBKO 1XNQO 4DR7O 4DUYO 4B3TO 1D2DA 1XMOO 2Z0AA 4X66O 1HNWO 2UXCO 2JRIA 1F7YA 4JYAO 4AQYO 4OX9O 2UXBO 4JI2O 3T1YO 1HNZO 4B3MO 1N33O 1R1BA 3O65A 1N34O 5H5NA 1NS1A 1AB3A 1J5EO 1FYJA 1XMQO 4JI4O 2E5LO 1HNXO 3SDLA 2ZM6O 4DR2O 5A2QN 5LL6Y 5BR8O 1IBMO 1HR0O 4LFAO 4DR1O 4DR3O 1KUQA 4JI5O 3JAMN 4DR5O 1N32O 5IWAO 1IBLO 2UU9O 1I94O 2UUAO 4DV1O 4LF9O 4OPHA 4GKJO 4LF8O 4JI8O 4K0KO
chains in the Genus database with same CATH superfamily
1N33B 4BR6A 4PA7A 2HHHO 2OWOA 2AXTZ 4FZ0A 1H2GA 3PN1A 1ZTEA 3E22B 1YZBA 4MVZA 4J7KA 3CCSV 3RN4A 2XAGA 4JI3O 1VQOV 2ZKOA 4ZKIA 2PYLA 4PA9A 3OEEG 3SYQA 3FX7A 3SYOA 2UXBB 4YY3O 4TQDA 4GX1A 4NKGB 2UUAB 1Q6IA 1TVKB 4LNUA 3STZC 1YCIA 2WAMA 2P90A 4WBNA 4OX9B 1Q3EA 2B1GA 2NLJC 4I5SA 2ZR2A 1O9GA 3IC9A 3SGIA 4NB5A 4CBCA 3W7TA 3E8BA 4GCZA 1Q86W 3ABKB 3CC7V 3AG2C 2WPDG 1J95A 1SQPH 3SR2C 3G4SV 1VQKV 4U3JB 2EJ7A 1IXBA 5L3EA 3JAWA 1OCCC 1M9NA 4I0XA 3SPHA 1IURA 5K1PA 1I08A 2YXYA 3RYHB 3K79A 2Z5UA 1QR9A 4F4LA 3OTOB 1WA8B 1PNKA 2E3CA 1X4TA 4JYCA 3JCZA 2IH3C 1ENVA 2A79B 3N2KA 3JD4A 1GM9A 2DE0X 4O2BA 2W6JG 5EBLC 4X1IB 4N21A 1AI6A 5EC1C 3CRAA 3UT5B 2WLIB 4UVBA 2ZM6O 1B06A 3MHSC 4LWSB 3N2KB 4DW1A 2JGDB 3SJAC 4IYHA 4DYLA 3FB5C 5IWAO 1K8AW 1XILA 4K8XA 1SQFA 1G6UA 3DC6A 3E8GA 4JGSA 2Y4TA 1K3EA 3GWKC 5DN6G 1Q90D 2AHZA 2YC0A 2Q8VA 4EFEA 2P5OA 4DRXA 3J81N 3EVKA 2PZSA 3CCJV 4DV0O 3SPJA 4E2LA 1PNLA 4YJ2B 2HLDG 4NXNB 1JPXA 2IU3A 3BA9A 4LF7B 2EINB 4G28B 2UXDO 2E74B 1KD1W 3E86A 1VQLV 1D5AA 5B3SC 1Y6XA 1QVGU 3K57A 2FB5A 1U96A 5CMUA 4DV3B 4B3SO 3LDDA 2IBZH 1ZX3A 3LNMB 4LFCO 2YIAA 3ZX6A 1RSOB 1DTOA 4DV6O 3G71V 4X9QA 1KBHA 3JCUZ 3HKEB 3AK2A 3M7MX 5BXZA 3TK1A 5KHHA 5J2UA 4LFBO 3RYIA 3JALA 3ZHTA 3ZEDA 4X66O 2XOKG 1Q5OA 4CH4A 3G67A 1M1KW 1KU9A 1N36B 3OTFA 4LFCB 1YIJV 2ZR3A 3JALB 2XNDG 4MT8A 3QNEA 1H2LA 2OIGA 4ZBMA 2QWNB 1R1BA 4NR1A 1XL6A 2ODMA 1QLEB 1TA8A 2ZT9B 2BTQB 1KYOF 1SA0B 1XHZA 4DR3O 3JAMN 2QR4A 4X89A 1Y74B 3CRRA 2JGDA 3RFRA 3AG3B 2ZM6B 3A0HZ 3ZMSA 1YXBA 4GKJO 3K0GA 1FS0G 1FXVA 4EEQA 1VQ8V 1FFXB 2Q4PA 2DJVA 3E2EA 3E22A 1MABG 4KL1A 2Q69A 1WNSA 5CBHA 1Y74A 1P7GA 4TV8A 3MDSA 1R3IC 5EK0A 3W7XA 4BWAA 3BHPA 3TCUA 1OZ0A 4EFBA 4J10A 3ETQA 1N0JA 2WA4A 1GK9A 2XTAA 2QM4A 5LYJA 1TUBA 4R50A 1J5EB 4NTYA 2XASA 1IX9A 4H37A 4NXMO 5JH7B 3KCYA 2PGGA 3K0DA 2YI9A 4B3MB 1K97A 3ABTA 4TUYA 3WB1A 1JQ0A 3S3XA 3ZIAG 4JI7O 3NXSA 2QM7A 3N2GB 2HP8A 1K7DA 4DUYO 1QQCA 2Z0AA 4J11A 3CCUV 1EN4A 2H3OA 1XDCA 2UXCO 2BTOA 1SKVA 1QR8A 2EILC 3M99B 1H2SB 1GH6A 3P32A 3CJHB 1NU1H 3OEHG 4FZ1A 3EXAA 4X20B 4X1IA 4J80A 4QJFB 5CA1A 2QWRB 4RO2A 2W6IG 2CAZC 2QWQB 2R70A 1K9MW 5IJ9A 4DUYB 1XMQB 4DR5O 4MTGA 4G27B 4K3AA 3DXRB 2A9HA 1KC8W 1WN7A 5AG2A 2ZNJA 3L74H 5KLVH 4LF9O 3DSQA 1RFYA 4O4HB 3STLC 4X88A 4I55A 1XREA 3AG3C 3JD2A 1H2NA 3VQYA 3KG2A 4JI8O 2PUSA 3TGUH 2ETNA 1T5EA 4YHHO 5IDJA 2VRZA 4MVUA 1R3JC 4QE9A 1NH2D 4EB6B 2ZE5A 3ZHUA 1NTKH 4DV2B 4YJ3A 5L3FA 4DV5O 3WB0A 4FFKA 3B8MA 4BW9A 1M56B 3ETEA 4U7OA 1EZJA 3ASNC 4I7ZB 4JYAB 1XMOB 4U3JA 5FL7G 2EZOA 4JI2B 5DECA 4DV4B 3CXCU 3QO5A 3ZRVA 3J80N 1S0VA 2FTKA 2JK5C 1TUBB 2OTLV 1I7FA 4GKKO 2ATKC 4TSFG 1UJWB 3FFQA 3RYIB 4AI8A 4KHPO 1YHQV 2ZDIC 5J2UB 4AQYB 5IWAB 3CCVV 4FIPC 4R7CA 2LFSA 2YEVB 3JD1A 4JYAO 1JOYA 4D7TA 1S77D 1K34A 3UT5A 3GVMA 1MNGA 4ZIBA 2CGNA 1GRJA 1QVFU 5KX5A 1EZVH 4JYBA 5GW7A 1N33O 3ZMUA 2UUBB 2QKCA 1NS1A 4GKKB 3B4SA 1NKDA 3C3TA 2X0LA 2YDEA 2EULA 2IH1C 5LL6Y 3G6EV 1K33A 3SPGA 1EM1A 3VQVA 2UXNA 3K5LA 1FJGB 2RN9A 3SJBC 2B9ZA 4LCUC 2ITCC 4LF4B 5EZYA 2BSKA 4DW0A 2CH7B 1PL0A 2VQFO 3RVYA 3DTUB 1V55C 3CMEV 2Y0PA 1XOUA 1GAXA 2GV9A 4B3RO 1M93A 5CB4A 1IBMB 3ASOB 4UFZA 3T2MA 1BCCH 4J7ZA 1RM1C 2FYUH 3CCQV 3FYIB 5IYCO 4WFGA 3C3SA 3D3IA 3ABMB 2GTSA 2F95B 3F5TA 5LMNO 1SZXA 3P3NA 2X6BA 5JQGB 1Q82W 1HNXB 4J41A 2EX3A 4JI3B 4CS2A 1Y67A 3RGBA 1F23A 2QWPB 4DV7B 2JS5A 3ZJZA 2ZINA 2ZD9A 4O2AA 1DF4A 1SF9A 4DR3B 2DYSB 3LDEA 2YXLA 2PY5A 5KHKA 3SJCC 2L6LA 4GKJB 3AK3A 4AQYO 4O4IA 2UXBO 1BE3H 2OYQA 1N34B 1KKCA 3OM3B 1NTMH 3H1LH 3L71H 3T1HB 5H6QA 2X6CA 5IY5C 1GM7A 4MVRA 5H5NA 1AI5A 1XMQO 2ARHA 3ZBHA 4DR5B 2JIZG 2DWDC 5CN0A 4CS3A 4FLXA 5BR8O 1I94B 4TOIA 1HNWB 1S5JA 2CDYA 1WB8A 1IBLO 3QG5A 2F43G 3B2EE 3D36C 2O57A 4PJ0Z 4LF8O 5EBMC 3KZIZ 4JTAB 1XNRO 4LF5B 2Q68A 3VOUA 5JJJB 3BCCH 2DOSA 4NTXA 4JI0O 4TV9B 3R65A 1UPGA 1VQ9V 2K1EA 3WG7B 3T4DA 3OMNB 1YJ9V 1ZL8B 2UUBO 1Z2GA 2KG7B 3RYFA 5JJNB 3ZHQA 1FPOA 4QPKA 2WA3A 5KMGA 1RPOA 3AG7A 4GT1A 3UO3A 3RT3C 3UKMA 1SQGA 3P3PA 5B5EZ 5D5PA 3FAVB 4GX2A 4PDVA 2JJ1G 3N2GA 5EIBC 5B3SB 1WB7A 4J9ZB 1K73W 2X6AA 2D2CB 5LMUO 2F93B 2XT9A 2E5LB 3H1HH 4UVAA 5DEDA 1FXKC 1CP9A 5E1AC 5IYZB 4F6RA 1KP2A 2WLHA 3T4ZA 3TXSA 1HNWO 1ZLZA 5J9PC 3VBBA 2WLNA 3APQA 1MA1A 1L0NH 4P2ZA 3UQ8A 1YTFD 3CCEV 4O4IB 3B09A 1Y76A 1GO3F 3K08A 4C7UA 5IJ9B 4FPPA 2WLLA 3OE7G 1N8RW 3RBZA 1Q43A 2E5LO 1NI8A 4TQFA 2PI5A 4DV1B 3ZMTA 1E1QG 4CH5A 4P9OA 1QBZA 3LDCA 3OUFA 3ZMZA 4WFBV 5C8YA 5KA6A 3CPWU 3U10A 2VQFB 1MMMA 4WFAV 3N27A 4MW3A 2EILB 4EB6A 4BIZA 5LA6A 1K5SA 1L8DA 5B1AC 2R9IA 2QKSA 2N74A 3ABLC 5LMNB 1XI1A 1PP9H 4MVMA 3JSNA 4B08A 1NTZH 3CWBH 2HFEC 4LC1A 3M8AA 1JFFA 2WLMA 1Y4MA 2RCVA 4FLTA 4CC5A 5JWPA 4RAIA 2M6YA 1PD3A 2JEUA 2ITDC 3LSUA 5E79Z 1H38A 3WFVA 1R6KA 3A0BZ 3VQXA 4CZZA 3ABLB 5LHIA 4HBNA 4L87A 1FKAO 1VQPV 4UCUA 1MOFA 1IBKO 1PL4A 4BAYA 1HR0B 3CJHA 1ZSPA 3OT7A 4FM2A 4RQFA 2NN4A 1IDSA 3T1YO 1VEWA 4B3MO 1JJ2U 1OCOB 4Q6GA 1WJZA 2IJKA 3IAYA 2EINC 2BE3A 4ZHQA 2YXHA 1S76D 4JI4O 2JJ2G 4J42A 1P4RA 1DLBA 1BQ0A 1VF7A 2Y4UA 1BT8A 2BTQA 4JV5B 4DR2B 3FB6C 2Y69C 2HJFC 5L3CA 2QWOB 2LP7A 1YTFB 2P4KA 2UXCB 3G80A 1S72V 5JVDB 1JJOA 4JI6B 1VF6A 2ZNIA 5GTHZ 2FL4A 2KSDA 2VS0A 1F51A 3QO8A 4FVMA 4UCVA 4EKWA 1YDXA 4P30A 5KHJA 1BMFG 5FLXN 1N4CA 3B8NA 4QGPA 4FLWA 1VQ7V 3CSXA 1VARA 3X2QB 4IGGA 4U3FH 1MG1A 3S3WA 5BMVA 2YICA 1RSOA 4IIJA 1AR5A 2EIMB 1QCEA 2W0FC 1I5XA 1GMGA 5TISZ 5B1BC 2EIMC 3JD0A 2IJIA 5LXTA 3CC2V 1FAFA 2JVDA 4TT3G 1AR1B 3L73H 1O9HA 3CC4V 1EBOA 4LR3A 4A5UB 1XNQO 1QU7A 2CGOA 4K35A 1E1RG 1XMOO 5JCOA 4UB8Z 5D5QA 2RQ6A 3KKYA 1YVWA 2DMXA 1RP3B 3ZMVA 1F4MA 1NVPD 3BVOA 3QO7A 5GONB 4FJCC 2PI4A 4DR6B 4LH6A 2YEVA 3O65A 3TXQA 3ABKC 4JAUA 2DN9A 1SQXH 5EBWC 1M5IA 1SERA 1IBMO 1SC5B 4PD4F 5EYPB 2ADQB 5IY5B 1FXKB 1Q7YW 4QE7A 4FLUA 5FPOA 4K0KO 4DRXB 2Z3YA 1SQVH 1Q6UA 2HJDA 4L8JA 4NXNO 1OJHA 4UVCA 1R3KC 3HKDA 2DYSC 1URFA 4FM1A 1SQQH 3D36A 3HKBB 5KMGB 4O4JB 1XUQA 2BSKB 5IT9N 4HYOA 3ICXA 2YIBD 1NZ6A 1H2KA 1SESA 1KECA 4JASA 4E4EA 5LYJB 3HKDB 3JATB 3SPIA 1YI2V 4B3TB 3JYCA 2HVKC 2Q73A 4JPRA 4O4LA 3BA8A 1U97A 4JI8B 2X7RB 4OPAA 2Q7EA 1SQBH 2HHHB 4YHHB 4MTOA 3FB8C 4I4TB 3CP1A 4UB6Z 3AG1C 2RDCA 1I5YA 4PA4A 1VQMV 1WA8A 4NXMB 1HW7A 5HFMA 3ASOC 5EC2C 1AJPA 4DV5B 4KP4A 2EJRA 4BIUA 3H9VA 3CRMA 1F7YA 1KMIZ 1PKXA 3LSQA 1YJNV 1FFTB 4OX9O 2PF4E 2LGWA 2LO1A 4JI2O 2AZ0A 4OXSA 3NR7A 4CH3A 3HB3B 3OW2U 1HNZO 1COWG 2H94A 4X20A 4X65B 2F1MA 1G8MA 3K04A 5KAFZ 3JSLA 4RUFA 4JTCB 5FPRA 5K1XA 4I50A 1FFXA 4RQEA 2Y48A 4DUZB 5FNVB 2VWJA 1MZFA 1EN6A 2HR3A 2QKAA 1GM8A 1VQ5V 2UUAO 4ZI7B 4ZOLA 2UXXA 5EYPA 4JI6O 3SPCA 4UCTA 4LF9B 3BAAA 4DR7B 5LA6B 1Q81W 2ADPA 4MVQA 1V54B 5ITZB 2CTWA 2UUCB 1E79G 4FLYA 5CA3A 3OD4A 4JI5B 2R72A 2KB1A 4XDLA 4DR6O 2OTJV 4DUZO 4PELA 4WFHA 4QNHB 1VF6C 3HPLC 1SRYA 4IIJB 1RPRA 1SS3A 4LNUB 1IXMA 3E89A 4W4KA 3ZS8C 1YEWA 4LF4O 2EIJC 1M90W 2EIKC 1OCZC 3WB2A 2YUAA 3MHHC 2P22C 3W7SA 1WLEA 4R6ZA 2JS3A 2UUCO 3IJ4A 2OT5A 1P49A 4LF6B 2HKOA 3F7YC 5KUMA 1BSMA 2VQEB 2ZXWC 4I0XB 2GDSA 3ZHSA 2GUZB 3K5OA 2CTPA 2OCHA 3BABA 4HNAA 4O2AB 3T1CA 5LHHA 5LP6A 2CTRA 2DQ0A 4XDKA 1WPBA 2B5UA 5KUKA 3AG4B 3OMAB 4HZ3A 1R73A 3L75H 3ZHVA 2Q6AA 4DV0B 3C90A 3SDLA 1AP5A 4DR1O 5KAIZ 4JI5O 3OGCC 3GWOA 3H01A 3O9OA 1S5HC 4NTWA 1JCHA 1S3JA 3CCLV 1AJQA 3A0RA 4DV3O 3RYCA 5JVDA 2PTMA 2YSUB 1IBKB 5CB4B 1FJGO 3AEIA 4GUNA 4Q20A 4ZOLB 4YJ3B 2CUGA 1TGOA 3L9DA 3K06A 3CX5F 4MVSA 3OR6C 5H6RA 3E35A 5CBGA 4TV8B 3T1YB 4X65O 4KXRA 3K03A 4LF7O 2F4VB 5BMVB 4ICGA 1ZAUA 4U7NA 2C2AA 1DGSA 4WF9V 5B1AB 5BY1A 3W7WA 4AHCA 4DR4O 4GX0A 4I4TA 4GLXA 3JARB 4WFEA 1LUWA 4JV5O 3E8FA 3R66A 4YIPA 2IU0A 2AZ2A 2K9PA 3FAVA 4DV7O 4MW8A 2A06H 3FD9A 1L1FA 3SYAA 2V4DA 5B1OA 1HWYA 3CEIA 1EN5A 4F6RB 2P6JA 3ABMC 3X2QC 1VMGA 2IW5A 3CCRV 1VQ4V 2OIEA 2YI8A 1RM1B 1Q8IA 1N34O 3CS5A 3U11A 1P84F 4HNAB 2R9RB 4K8ZA 2IJHA 1AROP 5A2QN 4H44B 1XBLA 1V9PA 2XAFA 2Q7HA 5IE9A 3IGAC 5BR8B 1JVMA 1WPXA 1I94O 5CA0A 1BHBA 2CTQA 2VQEO 2XHBA 4ABMA 1X59A 2AW9A 1XNQB 1BL8A 5F2VO 2G38A 1UFIA 3HKCB 3OAAG 3CB2A 1W59A 4MTFA 4DO2A 3WU2Z 1H8EG 1JMKC 3BEHA 4FM0A 5JQGA 1PNMA 3DGEA 3K3WA 1BQZA 4YJ2A 1YF2A 3AG4C 3B77A 4HAMA 4H0LB 3JATA 4TV9A 4B3SB 2YIDA 4X1KA 4X64O 3ZRXA 2Q9LA 3Q4HB 1AR4A 1GN4A 4UV9A 3OR7C 1Y66A 2B1IA 2AHYA 3LUTB 4X1KB 1HNZB 3VQWA 4H13B 1IZ3A 4LF6O 3SYCA 2Q0AA 4JZGA 3D3QA 4GYCB 2KQXA 1WAZA 4AILC 5DM6V 3JAKA 2F66C 2P67A 3CHXA 2BOBC 1QHTA 4IT5A 5LOVB 4G2KA 2JRIA 2LQTA 3ABUA 4IYIA 2WLLB 1JX9A 1W2BU 4I50B 5EIBD 1DF5A 2P06A 1YSCA 2IJJA 4YXWG 3ZN0A 3ZCCA 4X8AA 1F4NA 1AB3A 1ZWIC 1J5EO 3JASB 4Z1MG 5IJ0B 4ZI7A 4LWSA 1P7BA 4D6TH 2ZE7A 1CPYA 4MSWC 1BZKA 2A3QA 3B40A 5EZYB 1PM9A 1N32O 4Z1VA 2MK3A 2RJZA 3A8TA 4J9YB 3THOA 3ZRWB 1M57C 5ITZA 3ZN1A 5CA1B 4OPHA 4JI7B 5A9GA 1PPJH 1K5QA 2GHYA 1H2MA 3L72H 4PDRA 2HVJC 3IFXA 5B1BB 3DXRA 3F7VC 3E8HA 4I9QA 3I56V 2JEXA 3CMAV 2D3OW 2DYRB 2ZIOA 5KHGA 1BHAA 4GZRB 4LFBB 1NQTA 3UM7A 5H9CA 4JZ2A 4KHPB 2BCCH 4UV8A 3AG2B 2Y0IA 3CRCA 1VQNV 2AGAA 1A32A 3HKBA 3RVZA 2FMLA 3MD0A 4PI0A 1N36O 2VWKA 2Q0OC 3OFNG 2Q5ZA 1LNQA 1V55B 1WP8A 3J7AU 3K58A 4W4LA 5JH7A 2QDOA 4O4LB 4K0KB 2A0LA 2DW4A 2Q67A 1AJNA 2M7WA 3ETGA 3SJQC 1GN6A 3BPZA 1K4DC 4DR1B 4IHJA 5LXTB 3OUSA 4B3TO 2GUZA 2XAJA 5LBQA 1XL4A 2QM8A 2DYRC 4Z2WA 2V1DA 1HDJA 4LF8B 5BZBA 2JGUA 4X62B 1YJWV 3PJSK 4X64B 1TAEA 2GTAA 3WG7C 4PHZA 1M57B 3K5NA 1G4YB 4FK5C 5GONA 1K4CC 1GKFA 3K9SA 5IJ0A 2YS8A 1NT2B 3LSSA 5J2TA 4JAVA 2QJ1A 2P7TC 3SYPA 5C93A 1N0NA 4I55B 3BY6A 5CA0B 3DC5A 4LFAB 3LNNA 5LGUA 4X1YB 5KA5A 5LHGA 3P30A 1XEQA 2QTSA 4X62O 1PV0A 2WSSG 4OGQB 2PYJA 2HG5C 4FLZA 4JAAA 3OTOO 2KG7A 2RMKB 3RYFB 2ZXWB 1QLEC 4MVOA 2HEPA 1Z5VA 3APOA 1ROPA 2WLJA 1JFFB 4B3RB 4JYYA 4KUMA 4BW5A 2WWWA 3I55V 1M56C 1AILA 4JTDB 3RW0A 2MW2B 2LJ2A 2EIKB 1NR1A 2EIJB 4UCOA 2QA4V 2DWEC 1NBMG 3IC7A 2RNBA 4DK0A 3Q4HA 4WBNB 2QSAA 4JF3A 1XNRB 3GB7C 4PV1B 4TUYB 4UCSA 4CH6A 1G1XB 3BRCA 3EHBB 4RUEA 3CCMV 4FFBA 2YIBA 5L3GA 4DR7O 1ORQC 5LOVA 4WCEV 1W0JG 4N23A 1K92A 2QTOA 3AK1A 4ZHQB 1VF5B 1MSWD 2CK3G 2F23A 4GX5A 3H1JH 2XAHA 3ML0A 5KHIA 1H8HG 5HFLA 3U0ZA 1YITV 4DK1A 4PA3A 4YIOA 2OCCB 1N32B 4R8CA 1MSDA 4NVPA 4DR2O 5IYBO 2WLIA 1HR0O 2ILMA 3RYCB 2XUMA 2QEXV 3E83A 1AI7A 2Y69B 3QF7A 2BOCC 5H2FZ 1SZTA 1SA0A 3L70H 1GN3A 3UO2A 1HP8A 5FNVA 2ZCEA 3W7UA 3K59A 2Q7GA 2N04A 4JI1O 2EBOA 4QIWF 1KB9F 5C8YB 5B66Z 4LF5O 1V54C 3TETA 4MTXA 2E75B 5JCOC 2ZQMA 4B7EA 1OV9A 4NYKA 1US6A 2WLKA 3I5DA 1ZL8A 4D7SA 1R3LC 1NJIW 3ETDA 1SETA 1AVMA 4UCRA 1DK1A 1QNMA 1Z5WA 3JAWB 1JA8A 3G6BA 3CD6V 4IHJB 3HKEA 3QTCA 2F4VO 2LGQA 4ASUG 1D2DA 1R6NA 1B6QA 5KX5B 1THZA 3K5MA 3F5WC 1Q6HA 1OCZB 4JI0B 3RYHA 3OMIB 2W0XA 4CS4A 1MZEA 2GSMB 1OHHG 3ASNB 4MS2A 4B7KA 1ZUQA 5LP6B 1GN2A 1LR1A 2NNUA 1VQ6V 1Y76B 1FXKA 1B3QA 1GTOA 4XDJA 3TJTA 1FYJA 1AP6A 1IBLB 4DR4B 4CC6A 4I9WA 1CEZA 2P4VA 1FD9A 2OCCC 4LFAO 1KUQA 3CXHF 3ZRWA 2H8PC 4PA6A 2CH7A 4X66B 5J2TB 1KKDA 3BFRA 3CYOA 4DV1O 4FLVA 3A2FA 3JD3A 2QE7G 1R6TA 1S5LZ 4O4JA 2ZIMA 4X1YA 2KKWA 2FKXA 3ZHRA 1I0HA 1BGYH 3HR0A 1FXHA 4QPJA 4DV4O 2R9AA 2ZE8A 4O4HA 1TVKA 2LW1A 3CRQA 1JR9A 2LW7A 4BIOA 4JI4B 1NR7A 1QLNA 2GBOA 5IYDO 1D5NA 4LP8A 3HKCA 5GTIZ 1TUEB 2JDIG 4FMTA 1L0LH 3H1IH 1NH2B 1OCRB 1KP3A 2QGNA 1XHXA 2A7WA 4LBEC 5LMUB 3T1HO 5LP6C 3UCSC 4RWUA 4DV2O 3JARA 4IL6Z 5JJEB 4YY3B 4FFBB 2ZDIA 1NVPB 2XAQA 5IYZA 2L35A 3AG1B 1B04A 1VIBA 1WP7A 4UXNA 4F6EA 1BS3A 1CXZB 2ZE6A 4JI1B 3FYEB 4J7JA 5B1NA 4O2BB 4TWKA 2UU9B 1OCRC 3D8CA 5LGTA 1VP7A 3K9AA 4PDMA 4H33A 3JAKB 4XBFA 3RWRD 3ZRSA 1XQ8A 3QVNA 5LGNA 4P9PA 5L3DA 4UUJC 2UXDB 1OCOC 2DQ3A 4WFFA 1M4UA 4PI2A 1AI4A 1EFRG 2CE4A 4LH7A 2N05A 2IM9A 3KCXA 2NR5A 5CBFA 1HNXO 1KQSU 3EFFK 3OGIB 2E76B 1IVSA 3CE2A 5L3BA 2LFRA 2V7QG 3H1KH 4DV6B 3MAQA 3JASA 4KFMA 1OCCB 1W0KG 3FKSG 2UU9O 3FB7C 1LUVA 4DXWA 4PDLA 2EZPA
chains in the Genus database with same CATH topology
2DJVA 2VQEO 1R6TA 4DV3O 4JI6O 1XEQA 2HHHO 4X62O 4YHHO 1XNRO 1X59A 2FKXA 4NXNO 3J81N 1YZBA 2VQFO 1FJGO 3OTOO 4DV4O 4DV0O 4JI3O 4B3RO 2ZKOA 4JI1O 2DOSA 4JI0O 4LF5O 2LW7A 2N74A 4DV5O 5IT9N 4YY3O 2UXDO 4DR6O 4DUZO 4X65O 2UUBO 5FLXN 1AILA 4LF7O 3F5TA 4X64O 3M8AA 2AGAA 5LMNO 1A32A 4B3SO 3RT3C 1N36O 4OPAA 5BY1A 4LF4O 4LFCO 4DR4O 4NXMO 3J7AU 4DV6O 3J80N 3T1HO 4JV5O 4LF6O 3R66A 4DV2O 1DK1A 4GKKO 1G1XB 2UUCO 5BXZA 5LMUO 1FKAO 4JI7O 4KHPO 4LFBO 4A5UB 4DV7O 2F4VO 1IBKO 1XNQO 4DR7O 4DUYO 4B3TO 1D2DA 1XMOO 2Z0AA 4X66O 1HNWO 2UXCO 2JRIA 1F7YA 4JYAO 4AQYO 4OX9O 2UXBO 4JI2O 3T1YO 1HNZO 4B3MO 1N33O 1R1BA 3O65A 1N34O 5H5NA 1NS1A 1AB3A 1J5EO 1FYJA 1XMQO 4JI4O 2E5LO 1HNXO 3SDLA 2ZM6O 4DR2O 5A2QN 5LL6Y 5BR8O 1IBMO 1HR0O 4LFAO 4DR1O 4DR3O 1KUQA 4JI5O 3JAMN 4DR5O 1N32O 5IWAO 1IBLO 2UU9O 1I94O 2UUAO 4DV1O 4LF9O 4OPHA 4GKJO 4LF8O 4JI8O 4K0KO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DJV A;  2VQE O;  1R6T A;  4DV3 O;  4JI6 O;  1XEQ A;  2HHH O;  4X62 O;  4YHH O;  1XNR O;  1X59 A;  2FKX A;  4NXN O;  3J81 N;  1YZB A;  2VQF O;  1FJG O;  3OTO O;  4DV4 O;  4DV0 O;  4JI3 O;  4B3R O;  2ZKO A;  4JI1 O;  2DOS A;  4JI0 O;  4LF5 O;  2LW7 A;  2N74 A;  4DV5 O;  5IT9 N;  4YY3 O;  2UXD O;  4DR6 O;  4DUZ O;  4X65 O;  2UUB O;  5FLX N;  1AIL A;  4LF7 O;  3F5T A;  4X64 O;  3M8A A;  2AGA A;  5LMN O;  1A32 A;  4B3S O;  3RT3 C;  1N36 O;  4OPA A;  5BY1 A;  4LF4 O;  4LFC O;  4DR4 O;  4NXM O;  3J7A U;  4DV6 O;  3J80 N;  3T1H O;  4JV5 O;  4LF6 O;  3R66 A;  4DV2 O;  1DK1 A;  4GKK O;  1G1X B;  2UUC O;  5BXZ A;  5LMU O;  1FKA O;  4JI7 O;  4KHP O;  4LFB O;  4A5U B;  4DV7 O;  2F4V O;  1IBK O;  1XNQ O;  4DR7 O;  4DUY O;  4B3T O;  1D2D A;  1XMO O;  2Z0A A;  4X66 O;  1HNW O;  2UXC O;  2JRI A;  1F7Y A;  4JYA O;  4AQY O;  4OX9 O;  2UXB O;  4JI2 O;  3T1Y O;  1HNZ O;  4B3M O;  1N33 O;  1R1B A;  3O65 A;  1N34 O;  5H5N A;  1NS1 A;  1AB3 A;  1J5E O;  1FYJ A;  1XMQ O;  4JI4 O;  2E5L O;  1HNX O;  3SDL A;  2ZM6 O;  4DR2 O;  5A2Q N;  5LL6 Y;  5BR8 O;  1IBM O;  1HR0 O;  4LFA O;  4DR1 O;  4DR3 O;  1KUQ A;  4JI5 O;  3JAM N;  4DR5 O;  1N32 O;  5IWA O;  1IBL O;  2UU9 O;  1I94 O;  2UUA O;  4DV1 O;  4LF9 O;  4OPH A;  4GKJ O;  4LF8 O;  4JI8 O;  4K0K O; 
#chains in the Genus database with same CATH topology
 1N33 B;  4BR6 A;  4PA7 A;  2HHH O;  2OWO A;  2AXT Z;  4FZ0 A;  1H2G A;  3PN1 A;  1ZTE A;  3E22 B;  1YZB A;  4MVZ A;  4J7K A;  3CCS V;  3RN4 A;  2XAG A;  4JI3 O;  1VQO V;  2ZKO A;  4ZKI A;  2PYL A;  4PA9 A;  3OEE G;  3SYQ A;  3FX7 A;  3SYO A;  2UXB B;  4YY3 O;  4TQD A;  4GX1 A;  4NKG B;  2UUA B;  1Q6I A;  1TVK B;  4LNU A;  3STZ C;  1YCI A;  2WAM A;  2P90 A;  4WBN A;  4OX9 B;  1Q3E A;  2B1G A;  2NLJ C;  4I5S A;  2ZR2 A;  1O9G A;  3IC9 A;  3SGI A;  4NB5 A;  4CBC A;  3W7T A;  3E8B A;  4GCZ A;  1Q86 W;  3ABK B;  3CC7 V;  3AG2 C;  2WPD G;  1J95 A;  1SQP H;  3SR2 C;  3G4S V;  1VQK V;  4U3J B;  2EJ7 A;  1IXB A;  5L3E A;  3JAW A;  1OCC C;  1M9N A;  4I0X A;  3SPH A;  1IUR A;  5K1P A;  1I08 A;  2YXY A;  3RYH B;  3K79 A;  2Z5U A;  1QR9 A;  4F4L A;  3OTO B;  1WA8 B;  1PNK A;  2E3C A;  1X4T A;  4JYC A;  3JCZ A;  2IH3 C;  1ENV A;  2A79 B;  3N2K A;  3JD4 A;  1GM9 A;  2DE0 X;  4O2B A;  2W6J G;  5EBL C;  4X1I B;  4N21 A;  1AI6 A;  5EC1 C;  3CRA A;  3UT5 B;  2WLI B;  4UVB A;  2ZM6 O;  1B06 A;  3MHS C;  4LWS B;  3N2K B;  4DW1 A;  2JGD B;  3SJA C;  4IYH A;  4DYL A;  3FB5 C;  5IWA O;  1K8A W;  1XIL A;  4K8X A;  1SQF A;  1G6U A;  3DC6 A;  3E8G A;  4JGS A;  2Y4T A;  1K3E A;  3GWK C;  5DN6 G;  1Q90 D;  2AHZ A;  2YC0 A;  2Q8V A;  4EFE A;  2P5O A;  4DRX A;  3J81 N;  3EVK A;  2PZS A;  3CCJ V;  4DV0 O;  3SPJ A;  4E2L A;  1PNL A;  4YJ2 B;  2HLD G;  4NXN B;  1JPX A;  2IU3 A;  3BA9 A;  4LF7 B;  2EIN B;  4G28 B;  2UXD O;  2E74 B;  1KD1 W;  3E86 A;  1VQL V;  1D5A A;  5B3S C;  1Y6X A;  1QVG U;  3K57 A;  2FB5 A;  1U96 A;  5CMU A;  4DV3 B;  4B3S O;  3LDD A;  2IBZ H;  1ZX3 A;  3LNM B;  4LFC O;  2YIA A;  3ZX6 A;  1RSO B;  1DTO A;  4DV6 O;  3G71 V;  4X9Q A;  1KBH A;  3JCU Z;  3HKE B;  3AK2 A;  3M7M X;  5BXZ A;  3TK1 A;  5KHH A;  5J2U A;  4LFB O;  3RYI A;  3JAL A;  3ZHT A;  3ZED A;  4X66 O;  2XOK G;  1Q5O A;  4CH4 A;  3G67 A;  1M1K W;  1KU9 A;  1N36 B;  3OTF A;  4LFC B;  1YIJ V;  2ZR3 A;  3JAL B;  2XND G;  4MT8 A;  3QNE A;  1H2L A;  2OIG A;  4ZBM A;  2QWN B;  1R1B A;  4NR1 A;  1XL6 A;  2ODM A;  1QLE B;  1TA8 A;  2ZT9 B;  2BTQ B;  1KYO F;  1SA0 B;  1XHZ A;  4DR3 O;  3JAM N;  2QR4 A;  4X89 A;  1Y74 B;  3CRR A;  2JGD A;  3RFR A;  3AG3 B;  2ZM6 B;  3A0H Z;  3ZMS A;  1YXB A;  4GKJ O;  3K0G A;  1FS0 G;  1FXV A;  4EEQ A;  1VQ8 V;  1FFX B;  2Q4P A;  2DJV A;  3E2E A;  3E22 A;  1MAB G;  4KL1 A;  2Q69 A;  1WNS A;  5CBH A;  1Y74 A;  1P7G A;  4TV8 A;  3MDS A;  1R3I C;  5EK0 A;  3W7X A;  4BWA A;  3BHP A;  3TCU A;  1OZ0 A;  4EFB A;  4J10 A;  3ETQ A;  1N0J A;  2WA4 A;  1GK9 A;  2XTA A;  2QM4 A;  5LYJ A;  1TUB A;  4R50 A;  1J5E B;  4NTY A;  2XAS A;  1IX9 A;  4H37 A;  4NXM O;  5JH7 B;  3KCY A;  2PGG A;  3K0D A;  2YI9 A;  4B3M B;  1K97 A;  3ABT A;  4TUY A;  3WB1 A;  1JQ0 A;  3S3X A;  3ZIA G;  4JI7 O;  3NXS A;  2QM7 A;  3N2G B;  2HP8 A;  1K7D A;  4DUY O;  1QQC A;  2Z0A A;  4J11 A;  3CCU V;  1EN4 A;  2H3O A;  1XDC A;  2UXC O;  2BTO A;  1SKV A;  1QR8 A;  2EIL C;  3M99 B;  1H2S B;  1GH6 A;  3P32 A;  3CJH B;  1NU1 H;  3OEH G;  4FZ1 A;  3EXA A;  4X20 B;  4X1I A;  4J80 A;  4QJF B;  5CA1 A;  2QWR B;  4RO2 A;  2W6I G;  2CAZ C;  2QWQ B;  2R70 A;  1K9M W;  5IJ9 A;  4DUY B;  1XMQ B;  4DR5 O;  4MTG A;  4G27 B;  4K3A A;  3DXR B;  2A9H A;  1KC8 W;  1WN7 A;  5AG2 A;  2ZNJ A;  3L74 H;  5KLV H;  4LF9 O;  3DSQ A;  1RFY A;  4O4H B;  3STL C;  4X88 A;  4I55 A;  1XRE A;  3AG3 C;  3JD2 A;  1H2N A;  3VQY A;  3KG2 A;  4JI8 O;  2PUS A;  3TGU H;  2ETN A;  1T5E A;  4YHH O;  5IDJ A;  2VRZ A;  4MVU A;  1R3J C;  4QE9 A;  1NH2 D;  4EB6 B;  2ZE5 A;  3ZHU A;  1NTK H;  4DV2 B;  4YJ3 A;  5L3F A;  4DV5 O;  3WB0 A;  4FFK A;  3B8M A;  4BW9 A;  1M56 B;  3ETE A;  4U7O A;  1EZJ A;  3ASN C;  4I7Z B;  4JYA B;  1XMO B;  4U3J A;  5FL7 G;  2EZO A;  4JI2 B;  5DEC A;  4DV4 B;  3CXC U;  3QO5 A;  3ZRV A;  3J80 N;  1S0V A;  2FTK A;  2JK5 C;  1TUB B;  2OTL V;  1I7F A;  4GKK O;  2ATK C;  4TSF G;  1UJW B;  3FFQ A;  3RYI B;  4AI8 A;  4KHP O;  1YHQ V;  2ZDI C;  5J2U B;  4AQY B;  5IWA B;  3CCV V;  4FIP C;  4R7C A;  2LFS A;  2YEV B;  3JD1 A;  4JYA O;  1JOY A;  4D7T A;  1S77 D;  1K34 A;  3UT5 A;  3GVM A;  1MNG A;  4ZIB A;  2CGN A;  1GRJ A;  1QVF U;  5KX5 A;  1EZV H;  4JYB A;  5GW7 A;  1N33 O;  3ZMU A;  2UUB B;  2QKC A;  1NS1 A;  4GKK B;  3B4S A;  1NKD A;  3C3T A;  2X0L A;  2YDE A;  2EUL A;  2IH1 C;  5LL6 Y;  3G6E V;  1K33 A;  3SPG A;  1EM1 A;  3VQV A;  2UXN A;  3K5L A;  1FJG B;  2RN9 A;  3SJB C;  2B9Z A;  4LCU C;  2ITC C;  4LF4 B;  5EZY A;  2BSK A;  4DW0 A;  2CH7 B;  1PL0 A;  2VQF O;  3RVY A;  3DTU B;  1V55 C;  3CME V;  2Y0P A;  1XOU A;  1GAX A;  2GV9 A;  4B3R O;  1M93 A;  5CB4 A;  1IBM B;  3ASO B;  4UFZ A;  3T2M A;  1BCC H;  4J7Z A;  1RM1 C;  2FYU H;  3CCQ V;  3FYI B;  5IYC O;  4WFG A;  3C3S A;  3D3I A;  3ABM B;  2GTS A;  2F95 B;  3F5T A;  5LMN O;  1SZX A;  3P3N A;  2X6B A;  5JQG B;  1Q82 W;  1HNX B;  4J41 A;  2EX3 A;  4JI3 B;  4CS2 A;  1Y67 A;  3RGB A;  1F23 A;  2QWP B;  4DV7 B;  2JS5 A;  3ZJZ A;  2ZIN A;  2ZD9 A;  4O2A A;  1DF4 A;  1SF9 A;  4DR3 B;  2DYS B;  3LDE A;  2YXL A;  2PY5 A;  5KHK A;  3SJC C;  2L6L A;  4GKJ B;  3AK3 A;  4AQY O;  4O4I A;  2UXB O;  1BE3 H;  2OYQ A;  1N34 B;  1KKC A;  3OM3 B;  1NTM H;  3H1L H;  3L71 H;  3T1H B;  5H6Q A;  2X6C A;  5IY5 C;  1GM7 A;  4MVR A;  5H5N A;  1AI5 A;  1XMQ O;  2ARH A;  3ZBH A;  4DR5 B;  2JIZ G;  2DWD C;  5CN0 A;  4CS3 A;  4FLX A;  5BR8 O;  1I94 B;  4TOI A;  1HNW B;  1S5J A;  2CDY A;  1WB8 A;  1IBL O;  3QG5 A;  2F43 G;  3B2E E;  3D36 C;  2O57 A;  4PJ0 Z;  4LF8 O;  5EBM C;  3KZI Z;  4JTA B;  1XNR O;  4LF5 B;  2Q68 A;  3VOU A;  5JJJ B;  3BCC H;  2DOS A;  4NTX A;  4JI0 O;  4TV9 B;  3R65 A;  1UPG A;  1VQ9 V;  2K1E A;  3WG7 B;  3T4D A;  3OMN B;  1YJ9 V;  1ZL8 B;  2UUB O;  1Z2G A;  2KG7 B;  3RYF A;  5JJN B;  3ZHQ A;  1FPO A;  4QPK A;  2WA3 A;  5KMG A;  1RPO A;  3AG7 A;  4GT1 A;  3UO3 A;  3RT3 C;  3UKM A;  1SQG A;  3P3P A;  5B5E Z;  5D5P A;  3FAV B;  4GX2 A;  4PDV A;  2JJ1 G;  3N2G A;  5EIB C;  5B3S B;  1WB7 A;  4J9Z B;  1K73 W;  2X6A A;  2D2C B;  5LMU O;  2F93 B;  2XT9 A;  2E5L B;  3H1H H;  4UVA A;  5DED A;  1FXK C;  1CP9 A;  5E1A C;  5IYZ B;  4F6R A;  1KP2 A;  2WLH A;  3T4Z A;  3TXS A;  1HNW O;  1ZLZ A;  5J9P C;  3VBB A;  2WLN A;  3APQ A;  1MA1 A;  1L0N H;  4P2Z A;  3UQ8 A;  1YTF D;  3CCE V;  4O4I B;  3B09 A;  1Y76 A;  1GO3 F;  3K08 A;  4C7U A;  5IJ9 B;  4FPP A;  2WLL A;  3OE7 G;  1N8R W;  3RBZ A;  1Q43 A;  2E5L O;  1NI8 A;  4TQF A;  2PI5 A;  4DV1 B;  3ZMT A;  1E1Q G;  4CH5 A;  4P9O A;  1QBZ A;  3LDC A;  3OUF A;  3ZMZ A;  4WFB V;  5C8Y A;  5KA6 A;  3CPW U;  3U10 A;  2VQF B;  1MMM A;  4WFA V;  3N27 A;  4MW3 A;  2EIL B;  4EB6 A;  4BIZ A;  5LA6 A;  1K5S A;  1L8D A;  5B1A C;  2R9I A;  2QKS A;  2N74 A;  3ABL C;  5LMN B;  1XI1 A;  1PP9 H;  4MVM A;  3JSN A;  4B08 A;  1NTZ H;  3CWB H;  2HFE C;  4LC1 A;  3M8A A;  1JFF A;  2WLM A;  1Y4M A;  2RCV A;  4FLT A;  4CC5 A;  5JWP A;  4RAI A;  2M6Y A;  1PD3 A;  2JEU A;  2ITD C;  3LSU A;  5E79 Z;  1H38 A;  3WFV A;  1R6K A;  3A0B Z;  3VQX A;  4CZZ A;  3ABL B;  5LHI A;  4HBN A;  4L87 A;  1FKA O;  1VQP V;  4UCU A;  1MOF A;  1IBK O;  1PL4 A;  4BAY A;  1HR0 B;  3CJH A;  1ZSP A;  3OT7 A;  4FM2 A;  4RQF A;  2NN4 A;  1IDS A;  3T1Y O;  1VEW A;  4B3M O;  1JJ2 U;  1OCO B;  4Q6G A;  1WJZ A;  2IJK A;  3IAY A;  2EIN C;  2BE3 A;  4ZHQ A;  2YXH A;  1S76 D;  4JI4 O;  2JJ2 G;  4J42 A;  1P4R A;  1DLB A;  1BQ0 A;  1VF7 A;  2Y4U A;  1BT8 A;  2BTQ A;  4JV5 B;  4DR2 B;  3FB6 C;  2Y69 C;  2HJF C;  5L3C A;  2QWO B;  2LP7 A;  1YTF B;  2P4K A;  2UXC B;  3G80 A;  1S72 V;  5JVD B;  1JJO A;  4JI6 B;  1VF6 A;  2ZNI A;  5GTH Z;  2FL4 A;  2KSD A;  2VS0 A;  1F51 A;  3QO8 A;  4FVM A;  4UCV A;  4EKW A;  1YDX A;  4P30 A;  5KHJ A;  1BMF G;  5FLX N;  1N4C A;  3B8N A;  4QGP A;  4FLW A;  1VQ7 V;  3CSX A;  1VAR A;  3X2Q B;  4IGG A;  4U3F H;  1MG1 A;  3S3W A;  5BMV A;  2YIC A;  1RSO A;  4IIJ A;  1AR5 A;  2EIM B;  1QCE A;  2W0F C;  1I5X A;  1GMG A;  5TIS Z;  5B1B C;  2EIM C;  3JD0 A;  2IJI A;  5LXT A;  3CC2 V;  1FAF A;  2JVD A;  4TT3 G;  1AR1 B;  3L73 H;  1O9H A;  3CC4 V;  1EBO A;  4LR3 A;  4A5U B;  1XNQ O;  1QU7 A;  2CGO A;  4K35 A;  1E1R G;  1XMO O;  5JCO A;  4UB8 Z;  5D5Q A;  2RQ6 A;  3KKY A;  1YVW A;  2DMX A;  1RP3 B;  3ZMV A;  1F4M A;  1NVP D;  3BVO A;  3QO7 A;  5GON B;  4FJC C;  2PI4 A;  4DR6 B;  4LH6 A;  2YEV A;  3O65 A;  3TXQ A;  3ABK C;  4JAU A;  2DN9 A;  1SQX H;  5EBW C;  1M5I A;  1SER A;  1IBM O;  1SC5 B;  4PD4 F;  5EYP B;  2ADQ B;  5IY5 B;  1FXK B;  1Q7Y W;  4QE7 A;  4FLU A;  5FPO A;  4K0K O;  4DRX B;  2Z3Y A;  1SQV H;  1Q6U A;  2HJD A;  4L8J A;  4NXN O;  1OJH A;  4UVC A;  1R3K C;  3HKD A;  2DYS C;  1URF A;  4FM1 A;  1SQQ H;  3D36 A;  3HKB B;  5KMG B;  4O4J B;  1XUQ A;  2BSK B;  5IT9 N;  4HYO A;  3ICX A;  2YIB D;  1NZ6 A;  1H2K A;  1SES A;  1KEC A;  4JAS A;  4E4E A;  5LYJ B;  3HKD B;  3JAT B;  3SPI A;  1YI2 V;  4B3T B;  3JYC A;  2HVK C;  2Q73 A;  4JPR A;  4O4L A;  3BA8 A;  1U97 A;  4JI8 B;  2X7R B;  4OPA A;  2Q7E A;  1SQB H;  2HHH B;  4YHH B;  4MTO A;  3FB8 C;  4I4T B;  3CP1 A;  4UB6 Z;  3AG1 C;  2RDC A;  1I5Y A;  4PA4 A;  1VQM V;  1WA8 A;  4NXM B;  1HW7 A;  5HFM A;  3ASO C;  5EC2 C;  1AJP A;  4DV5 B;  4KP4 A;  2EJR A;  4BIU A;  3H9V A;  3CRM A;  1F7Y A;  1KMI Z;  1PKX A;  3LSQ A;  1YJN V;  1FFT B;  4OX9 O;  2PF4 E;  2LGW A;  2LO1 A;  4JI2 O;  2AZ0 A;  4OXS A;  3NR7 A;  4CH3 A;  3HB3 B;  3OW2 U;  1HNZ O;  1COW G;  2H94 A;  4X20 A;  4X65 B;  2F1M A;  1G8M A;  3K04 A;  5KAF Z;  3JSL A;  4RUF A;  4JTC B;  5FPR A;  5K1X A;  4I50 A;  1FFX A;  4RQE A;  2Y48 A;  4DUZ B;  5FNV B;  2VWJ A;  1MZF A;  1EN6 A;  2HR3 A;  2QKA A;  1GM8 A;  1VQ5 V;  2UUA O;  4ZI7 B;  4ZOL A;  2UXX A;  5EYP A;  4JI6 O;  3SPC A;  4UCT A;  4LF9 B;  3BAA A;  4DR7 B;  5LA6 B;  1Q81 W;  2ADP A;  4MVQ A;  1V54 B;  5ITZ B;  2CTW A;  2UUC B;  1E79 G;  4FLY A;  5CA3 A;  3OD4 A;  4JI5 B;  2R72 A;  2KB1 A;  4XDL A;  4DR6 O;  2OTJ V;  4DUZ O;  4PEL A;  4WFH A;  4QNH B;  1VF6 C;  3HPL C;  1SRY A;  4IIJ B;  1RPR A;  1SS3 A;  4LNU B;  1IXM A;  3E89 A;  4W4K A;  3ZS8 C;  1YEW A;  4LF4 O;  2EIJ C;  1M90 W;  2EIK C;  1OCZ C;  3WB2 A;  2YUA A;  3MHH C;  2P22 C;  3W7S A;  1WLE A;  4R6Z A;  2JS3 A;  2UUC O;  3IJ4 A;  2OT5 A;  1P49 A;  4LF6 B;  2HKO A;  3F7Y C;  5KUM A;  1BSM A;  2VQE B;  2ZXW C;  4I0X B;  2GDS A;  3ZHS A;  2GUZ B;  3K5O A;  2CTP A;  2OCH A;  3BAB A;  4HNA A;  4O2A B;  3T1C A;  5LHH A;  5LP6 A;  2CTR A;  2DQ0 A;  4XDK A;  1WPB A;  2B5U A;  5KUK A;  3AG4 B;  3OMA B;  4HZ3 A;  1R73 A;  3L75 H;  3ZHV A;  2Q6A A;  4DV0 B;  3C90 A;  3SDL A;  1AP5 A;  4DR1 O;  5KAI Z;  4JI5 O;  3OGC C;  3GWO A;  3H01 A;  3O9O A;  1S5H C;  4NTW A;  1JCH A;  1S3J A;  3CCL V;  1AJQ A;  3A0R A;  4DV3 O;  3RYC A;  5JVD A;  2PTM A;  2YSU B;  1IBK B;  5CB4 B;  1FJG O;  3AEI A;  4GUN A;  4Q20 A;  4ZOL B;  4YJ3 B;  2CUG A;  1TGO A;  3L9D A;  3K06 A;  3CX5 F;  4MVS A;  3OR6 C;  5H6R A;  3E35 A;  5CBG A;  4TV8 B;  3T1Y B;  4X65 O;  4KXR A;  3K03 A;  4LF7 O;  2F4V B;  5BMV B;  4ICG A;  1ZAU A;  4U7N A;  2C2A A;  1DGS A;  4WF9 V;  5B1A B;  5BY1 A;  3W7W A;  4AHC A;  4DR4 O;  4GX0 A;  4I4T A;  4GLX A;  3JAR B;  4WFE A;  1LUW A;  4JV5 O;  3E8F A;  3R66 A;  4YIP A;  2IU0 A;  2AZ2 A;  2K9P A;  3FAV A;  4DV7 O;  4MW8 A;  2A06 H;  3FD9 A;  1L1F A;  3SYA A;  2V4D A;  5B1O A;  1HWY A;  3CEI A;  1EN5 A;  4F6R B;  2P6J A;  3ABM C;  3X2Q C;  1VMG A;  2IW5 A;  3CCR V;  1VQ4 V;  2OIE A;  2YI8 A;  1RM1 B;  1Q8I A;  1N34 O;  3CS5 A;  3U11 A;  1P84 F;  4HNA B;  2R9R B;  4K8Z A;  2IJH A;  1ARO P;  5A2Q N;  4H44 B;  1XBL A;  1V9P A;  2XAF A;  2Q7H A;  5IE9 A;  3IGA C;  5BR8 B;  1JVM A;  1WPX A;  1I94 O;  5CA0 A;  1BHB A;  2CTQ A;  2VQE O;  2XHB A;  4ABM A;  1X59 A;  2AW9 A;  1XNQ B;  1BL8 A;  5F2V O;  2G38 A;  1UFI A;  3HKC B;  3OAA G;  3CB2 A;  1W59 A;  4MTF A;  4DO2 A;  3WU2 Z;  1H8E G;  1JMK C;  3BEH A;  4FM0 A;  5JQG A;  1PNM A;  3DGE A;  3K3W A;  1BQZ A;  4YJ2 A;  1YF2 A;  3AG4 C;  3B77 A;  4HAM A;  4H0L B;  3JAT A;  4TV9 A;  4B3S B;  2YID A;  4X1K A;  4X64 O;  3ZRX A;  2Q9L A;  3Q4H B;  1AR4 A;  1GN4 A;  4UV9 A;  3OR7 C;  1Y66 A;  2B1I A;  2AHY A;  3LUT B;  4X1K B;  1HNZ B;  3VQW A;  4H13 B;  1IZ3 A;  4LF6 O;  3SYC A;  2Q0A A;  4JZG A;  3D3Q A;  4GYC B;  2KQX A;  1WAZ A;  4AIL C;  5DM6 V;  3JAK A;  2F66 C;  2P67 A;  3CHX A;  2BOB C;  1QHT A;  4IT5 A;  5LOV B;  4G2K A;  2JRI A;  2LQT A;  3ABU A;  4IYI A;  2WLL B;  1JX9 A;  1W2B U;  4I50 B;  5EIB D;  1DF5 A;  2P06 A;  1YSC A;  2IJJ A;  4YXW G;  3ZN0 A;  3ZCC A;  4X8A A;  1F4N A;  1AB3 A;  1ZWI C;  1J5E O;  3JAS B;  4Z1M G;  5IJ0 B;  4ZI7 A;  4LWS A;  1P7B A;  4D6T H;  2ZE7 A;  1CPY A;  4MSW C;  1BZK A;  2A3Q A;  3B40 A;  5EZY B;  1PM9 A;  1N32 O;  4Z1V A;  2MK3 A;  2RJZ A;  3A8T A;  4J9Y B;  3THO A;  3ZRW B;  1M57 C;  5ITZ A;  3ZN1 A;  5CA1 B;  4OPH A;  4JI7 B;  5A9G A;  1PPJ H;  1K5Q A;  2GHY A;  1H2M A;  3L72 H;  4PDR A;  2HVJ C;  3IFX A;  5B1B B;  3DXR A;  3F7V C;  3E8H A;  4I9Q A;  3I56 V;  2JEX A;  3CMA V;  2D3O W;  2DYR B;  2ZIO A;  5KHG A;  1BHA A;  4GZR B;  4LFB B;  1NQT A;  3UM7 A;  5H9C A;  4JZ2 A;  4KHP B;  2BCC H;  4UV8 A;  3AG2 B;  2Y0I A;  3CRC A;  1VQN V;  2AGA A;  1A32 A;  3HKB A;  3RVZ A;  2FML A;  3MD0 A;  4PI0 A;  1N36 O;  2VWK A;  2Q0O C;  3OFN G;  2Q5Z A;  1LNQ A;  1V55 B;  1WP8 A;  3J7A U;  3K58 A;  4W4L A;  5JH7 A;  2QDO A;  4O4L B;  4K0K B;  2A0L A;  2DW4 A;  2Q67 A;  1AJN A;  2M7W A;  3ETG A;  3SJQ C;  1GN6 A;  3BPZ A;  1K4D C;  4DR1 B;  4IHJ A;  5LXT B;  3OUS A;  4B3T O;  2GUZ A;  2XAJ A;  5LBQ A;  1XL4 A;  2QM8 A;  2DYR C;  4Z2W A;  2V1D A;  1HDJ A;  4LF8 B;  5BZB A;  2JGU A;  4X62 B;  1YJW V;  3PJS K;  4X64 B;  1TAE A;  2GTA A;  3WG7 C;  4PHZ A;  1M57 B;  3K5N A;  1G4Y B;  4FK5 C;  5GON A;  1K4C C;  1GKF A;  3K9S A;  5IJ0 A;  2YS8 A;  1NT2 B;  3LSS A;  5J2T A;  4JAV A;  2QJ1 A;  2P7T C;  3SYP A;  5C93 A;  1N0N A;  4I55 B;  3BY6 A;  5CA0 B;  3DC5 A;  4LFA B;  3LNN A;  5LGU A;  4X1Y B;  5KA5 A;  5LHG A;  3P30 A;  1XEQ A;  2QTS A;  4X62 O;  1PV0 A;  2WSS G;  4OGQ B;  2PYJ A;  2HG5 C;  4FLZ A;  4JAA A;  3OTO O;  2KG7 A;  2RMK B;  3RYF B;  2ZXW B;  1QLE C;  4MVO A;  2HEP A;  1Z5V A;  3APO A;  1ROP A;  2WLJ A;  1JFF B;  4B3R B;  4JYY A;  4KUM A;  4BW5 A;  2WWW A;  3I55 V;  1M56 C;  1AIL A;  4JTD B;  3RW0 A;  2MW2 B;  2LJ2 A;  2EIK B;  1NR1 A;  2EIJ B;  4UCO A;  2QA4 V;  2DWE C;  1NBM G;  3IC7 A;  2RNB A;  4DK0 A;  3Q4H A;  4WBN B;  2QSA A;  4JF3 A;  1XNR B;  3GB7 C;  4PV1 B;  4TUY B;  4UCS A;  4CH6 A;  1G1X B;  3BRC A;  3EHB B;  4RUE A;  3CCM V;  4FFB A;  2YIB A;  5L3G A;  4DR7 O;  1ORQ C;  5LOV A;  4WCE V;  1W0J G;  4N23 A;  1K92 A;  2QTO A;  3AK1 A;  4ZHQ B;  1VF5 B;  1MSW D;  2CK3 G;  2F23 A;  4GX5 A;  3H1J H;  2XAH A;  3ML0 A;  5KHI A;  1H8H G;  5HFL A;  3U0Z A;  1YIT V;  4DK1 A;  4PA3 A;  4YIO A;  2OCC B;  1N32 B;  4R8C A;  1MSD A;  4NVP A;  4DR2 O;  5IYB O;  2WLI A;  1HR0 O;  2ILM A;  3RYC B;  2XUM A;  2QEX V;  3E83 A;  1AI7 A;  2Y69 B;  3QF7 A;  2BOC C;  5H2F Z;  1SZT A;  1SA0 A;  3L70 H;  1GN3 A;  3UO2 A;  1HP8 A;  5FNV A;  2ZCE A;  3W7U A;  3K59 A;  2Q7G A;  2N04 A;  4JI1 O;  2EBO A;  4QIW F;  1KB9 F;  5C8Y B;  5B66 Z;  4LF5 O;  1V54 C;  3TET A;  4MTX A;  2E75 B;  5JCO C;  2ZQM A;  4B7E A;  1OV9 A;  4NYK A;  1US6 A;  2WLK A;  3I5D A;  1ZL8 A;  4D7S A;  1R3L C;  1NJI W;  3ETD A;  1SET A;  1AVM A;  4UCR A;  1DK1 A;  1QNM A;  1Z5W A;  3JAW B;  1JA8 A;  3G6B A;  3CD6 V;  4IHJ B;  3HKE A;  3QTC A;  2F4V O;  2LGQ A;  4ASU G;  1D2D A;  1R6N A;  1B6Q A;  5KX5 B;  1THZ A;  3K5M A;  3F5W C;  1Q6H A;  1OCZ B;  4JI0 B;  3RYH A;  3OMI B;  2W0X A;  4CS4 A;  1MZE A;  2GSM B;  1OHH G;  3ASN B;  4MS2 A;  4B7K A;  1ZUQ A;  5LP6 B;  1GN2 A;  1LR1 A;  2NNU A;  1VQ6 V;  1Y76 B;  1FXK A;  1B3Q A;  1GTO A;  4XDJ A;  3TJT A;  1FYJ A;  1AP6 A;  1IBL B;  4DR4 B;  4CC6 A;  4I9W A;  1CEZ A;  2P4V A;  1FD9 A;  2OCC C;  4LFA O;  1KUQ A;  3CXH F;  3ZRW A;  2H8P C;  4PA6 A;  2CH7 A;  4X66 B;  5J2T B;  1KKD A;  3BFR A;  3CYO A;  4DV1 O;  4FLV A;  3A2F A;  3JD3 A;  2QE7 G;  1R6T A;  1S5L Z;  4O4J A;  2ZIM A;  4X1Y A;  2KKW A;  2FKX A;  3ZHR A;  1I0H A;  1BGY H;  3HR0 A;  1FXH A;  4QPJ A;  4DV4 O;  2R9A A;  2ZE8 A;  4O4H A;  1TVK A;  2LW1 A;  3CRQ A;  1JR9 A;  2LW7 A;  4BIO A;  4JI4 B;  1NR7 A;  1QLN A;  2GBO A;  5IYD O;  1D5N A;  4LP8 A;  3HKC A;  5GTI Z;  1TUE B;  2JDI G;  4FMT A;  1L0L H;  3H1I H;  1NH2 B;  1OCR B;  1KP3 A;  2QGN A;  1XHX A;  2A7W A;  4LBE C;  5LMU B;  3T1H O;  5LP6 C;  3UCS C;  4RWU A;  4DV2 O;  3JAR A;  4IL6 Z;  5JJE B;  4YY3 B;  4FFB B;  2ZDI A;  1NVP B;  2XAQ A;  5IYZ A;  2L35 A;  3AG1 B;  1B04 A;  1VIB A;  1WP7 A;  4UXN A;  4F6E A;  1BS3 A;  1CXZ B;  2ZE6 A;  4JI1 B;  3FYE B;  4J7J A;  5B1N A;  4O2B B;  4TWK A;  2UU9 B;  1OCR C;  3D8C A;  5LGT A;  1VP7 A;  3K9A A;  4PDM A;  4H33 A;  3JAK B;  4XBF A;  3RWR D;  3ZRS A;  1XQ8 A;  3QVN A;  5LGN A;  4P9P A;  5L3D A;  4UUJ C;  2UXD B;  1OCO C;  2DQ3 A;  4WFF A;  1M4U A;  4PI2 A;  1AI4 A;  1EFR G;  2CE4 A;  4LH7 A;  2N05 A;  2IM9 A;  3KCX A;  2NR5 A;  5CBF A;  1HNX O;  1KQS U;  3EFF K;  3OGI B;  2E76 B;  1IVS A;  3CE2 A;  5L3B A;  2LFR A;  2V7Q G;  3H1K H;  4DV6 B;  3MAQ A;  3JAS A;  4KFM A;  1OCC B;  1W0K G;  3FKS G;  2UU9 O;  3FB7 C;  1LUV A;  4DXW A;  4PDL A;  2EZP A; 
#chains in the Genus database with same CATH homology
 2DJV A;  2VQE O;  1R6T A;  4DV3 O;  4JI6 O;  1XEQ A;  2HHH O;  4X62 O;  4YHH O;  1XNR O;  1X59 A;  2FKX A;  4NXN O;  3J81 N;  1YZB A;  2VQF O;  1FJG O;  3OTO O;  4DV4 O;  4DV0 O;  4JI3 O;  4B3R O;  2ZKO A;  4JI1 O;  2DOS A;  4JI0 O;  4LF5 O;  2LW7 A;  2N74 A;  4DV5 O;  5IT9 N;  4YY3 O;  2UXD O;  4DR6 O;  4DUZ O;  4X65 O;  2UUB O;  5FLX N;  1AIL A;  4LF7 O;  3F5T A;  4X64 O;  3M8A A;  2AGA A;  5LMN O;  1A32 A;  4B3S O;  3RT3 C;  1N36 O;  4OPA A;  5BY1 A;  4LF4 O;  4LFC O;  4DR4 O;  4NXM O;  3J7A U;  4DV6 O;  3J80 N;  3T1H O;  4JV5 O;  4LF6 O;  3R66 A;  4DV2 O;  1DK1 A;  4GKK O;  1G1X B;  2UUC O;  5BXZ A;  5LMU O;  1FKA O;  4JI7 O;  4KHP O;  4LFB O;  4A5U B;  4DV7 O;  2F4V O;  1IBK O;  1XNQ O;  4DR7 O;  4DUY O;  4B3T O;  1D2D A;  1XMO O;  2Z0A A;  4X66 O;  1HNW O;  2UXC O;  2JRI A;  1F7Y A;  4JYA O;  4AQY O;  4OX9 O;  2UXB O;  4JI2 O;  3T1Y O;  1HNZ O;  4B3M O;  1N33 O;  1R1B A;  3O65 A;  1N34 O;  5H5N A;  1NS1 A;  1AB3 A;  1J5E O;  1FYJ A;  1XMQ O;  4JI4 O;  2E5L O;  1HNX O;  3SDL A;  2ZM6 O;  4DR2 O;  5A2Q N;  5LL6 Y;  5BR8 O;  1IBM O;  1HR0 O;  4LFA O;  4DR1 O;  4DR3 O;  1KUQ A;  4JI5 O;  3JAM N;  4DR5 O;  1N32 O;  5IWA O;  1IBL O;  2UU9 O;  1I94 O;  2UUA O;  4DV1 O;  4LF9 O;  4OPH A;  4GKJ O;  4LF8 O;  4JI8 O;  4K0K O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...