4JI5D

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
208
structure length
208
Chain Sequence
GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRPSDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRLDNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQLVIEFYSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 59
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00163 Ribosomal_S4 Ribosomal protein S4/S9 N-terminal domain
D PF01479 S4 S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1050.10 Mainly Alpha Orthogonal Bundle Ribosomal Protein S4 Delta 41; Chain A, domain 1 Ribosomal Protein S4 Delta 41; Chain A, domain 1 4ji5D01
3.10.290.10 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A RNA-binding S4 domain 4ji5D02
1P9KA 1IBKD 2UXDD 1C06A 2F4VD 3KBGA 4JI7D 4GKKD 2VQFD 1VIOA 4YY3D 4B3TD 1N34D 4JI5D 4JYAD 1XNRD 1KSVA 4NXMD 4DUZD 4DR5D 1J5ED 4DV0D 3OTOD 4DR6D 4LF5D 1XMOD 5BR8D 1H3FA 1HR0D 2UXCD 2ISTA 4DV2D 2UUCD 4DR7D 2HHHD 4DV4D 3HP7A 1HNZD 2K6PA 4K0KD 4GKJD 1HNWD 4LFBD 5LMUD 4DV7D 4B3RD 2ZM6D 4AQYD 4LF6D 4LF7D 4X62D 4LF4D 2UUAD 4X66D 1IBLD 4JI4D 1C05A 4LFCD 1H3EA 1JH3A 4JI0D 4LFAD 4B3SD 2UU9D 4JI2D 3T1HD 2E5LD 4JI1D 4DR2D 4JI3D 4YHHD 4DR1D 1IBMD 4LGTA 1DM9A 4OUDA 1N36D 2JANA 4DR4D 4JV5D 4OX9D 5IWAD 1HNXD 4DV6D 1FKAD 2UUBD 4LF9D 4DR3D 3T1YD 4KHPD 5LMND 1KSLA 4DV5D 1N33D 4X65D 4JI8D 4DV1D 4DV3D 4B3MD 1XNQD 1KSKA 4X64D 1XMQD 1I94D 4JI6D 4NXND 2KTLA 2VQED 2UXBD 4DUYD 4LF8D 3DH3A 1N32D 1FJGD
chains in the Genus database with same CATH superfamily
1P9KA 1IBKD 2UXDD 1C06A 2I1SA 2F4VD 3KBGA 4JI7D 4GKKD 2VQFD 1VIOA 4YY3D 3FN1A 4B3TD 1N34D 4JI5D 4JYAD 1XNRD 3ONHA 1KSVA 4NXMD 4DUZD 4DR5D 1J5ED 4DV0D 3OTOD 3CMMA 1Y8QB 4DR6D 4LF5D 5FQ2B 1XMOD 5BR8D 4W5VB 1H3FA 2L3NA 1HR0D 2UXCD 3J7AF 2ISTA 4DV2D 2UUCD 4DR7D 2HHHD 4DV4D 2LQ7A 3HP7A 1HNZD 2K6PA 4K0KD 4GKJD 1HNWD 4LFBD 3KYCB 4NNJA 5LMUD 4DV7D 4B3RD 2ZM6D 5LL6S 4AQYD 4LF6D 4LF7D 4X62D 4LF4D 2UUAD 5A2QE 4X66D 1IBLD 4JI4D 1C05A 4LFCD 1H3EA 1JH3A 4JI0D 4LFAD 1Y8XB 4B3SD 2UU9D 4JI2D 3T1HD 2E5LD 4JI1D 4DR2D 4JI3D 4YHHD 4DR1D 1IBMD 4II3A 4LGTA 3JAME 3KYDB 1DM9A 4OUDA 1N36D 2JANA 4DR4D 2NVUB 1Y8RB 4JV5D 4OX9D 5FLXE 5IWAD 1HNXD 4DV6D 1FKAD 2UUBD 4II2A 4LF9D 4DR3D 3T1YD 4KHPD 5LMND 5KNLA 1KSLA 4DV5D 1N33D 4X65D 4JI8D 4DV1D 4DV3D 4B3MD 1XNQD 1KSKA 4X64D 1XMQD 1I94D 4JI6D 4NXND 2KTLA 2VQED 2UXBD 2ZTBA 4DUYD 4LF8D 3J80E 3J81E 5IT9E 3DH3A 1N32D 1FJGD 3ONGA
chains in the Genus database with same CATH topology
1P9KA 1IBKD 2UXDD 1C06A 2F4VD 3KBGA 4JI7D 4GKKD 2VQFD 1VIOA 4YY3D 4B3TD 1N34D 4JI5D 4JYAD 1XNRD 1KSVA 4NXMD 4DUZD 4DR5D 1J5ED 4DV0D 3OTOD 4DR6D 4LF5D 1XMOD 5BR8D 1H3FA 2L3NA 1HR0D 2UXCD 2ISTA 4DV2D 2UUCD 4DR7D 2HHHD 4DV4D 3HP7A 1HNZD 2K6PA 4K0KD 4GKJD 1HNWD 4LFBD 5LMUD 4DV7D 4B3RD 2ZM6D 4AQYD 4LF6D 4LF7D 4X62D 4LF4D 2UUAD 4X66D 1IBLD 4JI4D 1C05A 4LFCD 1H3EA 1JH3A 4JI0D 4LFAD 4B3SD 2UU9D 4JI2D 3T1HD 2E5LD 4JI1D 4DR2D 4JI3D 4YHHD 4DR1D 1IBMD 4LGTA 1DM9A 4OUDA 1N36D 2JANA 4DR4D 4JV5D 4OX9D 5IWAD 1HNXD 4DV6D 1FKAD 2UUBD 4LF9D 4DR3D 3T1YD 4KHPD 5LMND 1KSLA 4DV5D 1N33D 4X65D 4JI8D 4DV1D 4DV3D 4B3MD 1XNQD 1KSKA 4X64D 1XMQD 1I94D 4JI6D 4NXND 2KTLA 2VQED 2UXBD 4DUYD 4LF8D 3DH3A 1N32D 1FJGD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P9K A;  1IBK D;  2UXD D;  1C06 A;  2F4V D;  3KBG A;  4JI7 D;  4GKK D;  2VQF D;  1VIO A;  4YY3 D;  4B3T D;  1N34 D;  4JI5 D;  4JYA D;  1XNR D;  1KSV A;  4NXM D;  4DUZ D;  4DR5 D;  1J5E D;  4DV0 D;  3OTO D;  4DR6 D;  4LF5 D;  1XMO D;  5BR8 D;  1H3F A;  1HR0 D;  2UXC D;  2IST A;  4DV2 D;  2UUC D;  4DR7 D;  2HHH D;  4DV4 D;  3HP7 A;  1HNZ D;  2K6P A;  4K0K D;  4GKJ D;  1HNW D;  4LFB D;  5LMU D;  4DV7 D;  4B3R D;  2ZM6 D;  4AQY D;  4LF6 D;  4LF7 D;  4X62 D;  4LF4 D;  2UUA D;  4X66 D;  1IBL D;  4JI4 D;  1C05 A;  4LFC D;  1H3E A;  1JH3 A;  4JI0 D;  4LFA D;  4B3S D;  2UU9 D;  4JI2 D;  3T1H D;  2E5L D;  4JI1 D;  4DR2 D;  4JI3 D;  4YHH D;  4DR1 D;  1IBM D;  4LGT A;  1DM9 A;  4OUD A;  1N36 D;  2JAN A;  4DR4 D;  4JV5 D;  4OX9 D;  5IWA D;  1HNX D;  4DV6 D;  1FKA D;  2UUB D;  4LF9 D;  4DR3 D;  3T1Y D;  4KHP D;  5LMN D;  1KSL A;  4DV5 D;  1N33 D;  4X65 D;  4JI8 D;  4DV1 D;  4DV3 D;  4B3M D;  1XNQ D;  1KSK A;  4X64 D;  1XMQ D;  1I94 D;  4JI6 D;  4NXN D;  2KTL A;  2VQE D;  2UXB D;  4DUY D;  4LF8 D;  3DH3 A;  1N32 D;  1FJG D; 
#chains in the Genus database with same CATH topology
 1P9K A;  1IBK D;  2UXD D;  1C06 A;  2I1S A;  2F4V D;  3KBG A;  4JI7 D;  4GKK D;  2VQF D;  1VIO A;  4YY3 D;  3FN1 A;  4B3T D;  1N34 D;  4JI5 D;  4JYA D;  1XNR D;  3ONH A;  1KSV A;  4NXM D;  4DUZ D;  4DR5 D;  1J5E D;  4DV0 D;  3OTO D;  3CMM A;  1Y8Q B;  4DR6 D;  4LF5 D;  5FQ2 B;  1XMO D;  5BR8 D;  4W5V B;  1H3F A;  2L3N A;  1HR0 D;  2UXC D;  3J7A F;  2IST A;  4DV2 D;  2UUC D;  4DR7 D;  2HHH D;  4DV4 D;  2LQ7 A;  3HP7 A;  1HNZ D;  2K6P A;  4K0K D;  4GKJ D;  1HNW D;  4LFB D;  3KYC B;  4NNJ A;  5LMU D;  4DV7 D;  4B3R D;  2ZM6 D;  5LL6 S;  4AQY D;  4LF6 D;  4LF7 D;  4X62 D;  4LF4 D;  2UUA D;  5A2Q E;  4X66 D;  1IBL D;  4JI4 D;  1C05 A;  4LFC D;  1H3E A;  1JH3 A;  4JI0 D;  4LFA D;  1Y8X B;  4B3S D;  2UU9 D;  4JI2 D;  3T1H D;  2E5L D;  4JI1 D;  4DR2 D;  4JI3 D;  4YHH D;  4DR1 D;  1IBM D;  4II3 A;  4LGT A;  3JAM E;  3KYD B;  1DM9 A;  4OUD A;  1N36 D;  2JAN A;  4DR4 D;  2NVU B;  1Y8R B;  4JV5 D;  4OX9 D;  5FLX E;  5IWA D;  1HNX D;  4DV6 D;  1FKA D;  2UUB D;  4II2 A;  4LF9 D;  4DR3 D;  3T1Y D;  4KHP D;  5LMN D;  5KNL A;  1KSL A;  4DV5 D;  1N33 D;  4X65 D;  4JI8 D;  4DV1 D;  4DV3 D;  4B3M D;  1XNQ D;  1KSK A;  4X64 D;  1XMQ D;  1I94 D;  4JI6 D;  4NXN D;  2KTL A;  2VQE D;  2UXB D;  2ZTB A;  4DUY D;  4LF8 D;  3J80 E;  3J81 E;  5IT9 E;  3DH3 A;  1N32 D;  1FJG D;  3ONG A; 
#chains in the Genus database with same CATH homology
 1P9K A;  1IBK D;  2UXD D;  1C06 A;  2F4V D;  3KBG A;  4JI7 D;  4GKK D;  2VQF D;  1VIO A;  4YY3 D;  4B3T D;  1N34 D;  4JI5 D;  4JYA D;  1XNR D;  1KSV A;  4NXM D;  4DUZ D;  4DR5 D;  1J5E D;  4DV0 D;  3OTO D;  4DR6 D;  4LF5 D;  1XMO D;  5BR8 D;  1H3F A;  2L3N A;  1HR0 D;  2UXC D;  2IST A;  4DV2 D;  2UUC D;  4DR7 D;  2HHH D;  4DV4 D;  3HP7 A;  1HNZ D;  2K6P A;  4K0K D;  4GKJ D;  1HNW D;  4LFB D;  5LMU D;  4DV7 D;  4B3R D;  2ZM6 D;  4AQY D;  4LF6 D;  4LF7 D;  4X62 D;  4LF4 D;  2UUA D;  4X66 D;  1IBL D;  4JI4 D;  1C05 A;  4LFC D;  1H3E A;  1JH3 A;  4JI0 D;  4LFA D;  4B3S D;  2UU9 D;  4JI2 D;  3T1H D;  2E5L D;  4JI1 D;  4DR2 D;  4JI3 D;  4YHH D;  4DR1 D;  1IBM D;  4LGT A;  1DM9 A;  4OUD A;  1N36 D;  2JAN A;  4DR4 D;  4JV5 D;  4OX9 D;  5IWA D;  1HNX D;  4DV6 D;  1FKA D;  2UUB D;  4LF9 D;  4DR3 D;  3T1Y D;  4KHP D;  5LMN D;  1KSL A;  4DV5 D;  1N33 D;  4X65 D;  4JI8 D;  4DV1 D;  4DV3 D;  4B3M D;  1XNQ D;  1KSK A;  4X64 D;  1XMQ D;  1I94 D;  4JI6 D;  4NXN D;  2KTL A;  2VQE D;  2UXB D;  4DUY D;  4LF8 D;  3DH3 A;  1N32 D;  1FJG D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...