4JI5F

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 21
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ji5F00
2BXJA 4JI4F 1FJGF 2BVZA 4B3RF 1CQMA 1HR0F 2VQEF 4JI8F 2UUAF 4B3TF 2KJVA 4NXNF 1N34F 4DV0F 5LMUF 4B3SF 1N33F 4JI6F 2E5LF 4JI2F 1HNZF 4LF7F 1I94F 2UXCF 4JI1F 1LOUA 1G7CB 4LF5F 4LF8F 2F4VF 4DR7F 2HHHF 1IJEB 4AQYF 2J5AA 2UU9F 4JYAF 5LMNF 1G1XA 1B64A 1IBLF 4DV2F 1IBMF 1IJFB 5BR8F 4B3MF 4DR6F 4DV6F 4JI7F 3ZZPA 4KHPF 2B7BB 3OTOF 4LF6F 4LFAF 3R3TA 5AJ3F 4LFBF 4LFCF 1CQNA 4GKKF 4OX9F 4DV4F 1XMOF 4JI3F 4LF4F 4X64F 2UUCF 1HNWF 1XMQF 2KJWA 4DV3F 4NXMF 2UXBF 4DUZF 1N36F 4DR5F 1XNRF 4DR4F 4DR1F 3T1YF 2UXDF 4DV1F 1IBKF 4YY3F 5IWAF 4LF9F 2VQFF 1HNXF 4DR2F 1J5EF 4YHHF 2UUBF 4JI5F 1GH8A 2B7CB 4X62F 4DR3F 4JI0F 2ZM6F 1XNQF 1N32F 3T1HF 1QJHA 4X66F 1FKAF 2RJZA 1RISA 1VMBA 2YY3A 1F60B 4JV5F 4X65F 4K0KF 4GKJF 4DV5F 4DV7F 4DUYF
chains in the Genus database with same CATH superfamily
4DBQA 2BVZA 2ZVIA 1R0AA 2GV1A 2DIUA 3FMBA 1BC6A 3H0PA 1X31C 2L48A 4G6VB 3NWRA 1HNZF 1Y0HA 1SI9A 3V81B 3HHLC 1RCOB 2F8MA 4DPUA 4CO5A 8RUCA 2D1CA 3RZAA 4L6V3 2E29A 4HI1A 4XPCA 1O0PA 2MKJA 1EKSA 2XY7A 4OZ5A 3GB0A 2V67A 2LVWA 3IP0A 3FBEA 4KSEB 4EUVA 5DZ6A 2AHOB 4QIFA 1QSYA 4S0MA 1LK7A 2FTRA 1RZMA 5GMDA 4FS1A 3HSGA 2KI2A 4NLWA 4F67A 3M6XA 3RRHA 1U6ZA 2HQDA 4JI8J 3NBPA 1S4EA 1R8BA 3UPFA 4MT1A 4O0IA 1TQLA 4OYAA 3M8PB 3Q22A 3HSZA 4QWEA 2PI5A 3W8PA 2DY9A 4NLYA 3TNVA 1S4FA 3JS9A 1TKTA 1XEZA 1CJKB 5IV4A 1QY7A 4DV6J 2HVEA 3VHQA 1S9EB 1TV6B 2SXLA 2ADBA 1QAYA 1Q79A 4U7CA 4A47A 4W98A 2HGMA 1T9UA 2ACMA 3Q8PB 2FY8A 3H98A 2ALYB 2VPXB 2QA1A 4QYRA 1D09B 2DRBA 2Q6CA 1WHYA 3B6BA 3VAMA 3CJ2A 2V63A 3BO3A 4OQJA 4RNOA 3LH2S 1R8CA 3EWGA 3MDFA 1HBNB 4B9TA 4FBTA 2HAIA 4KC5A 1BWVA 5HSPA 3G6YA 3NGKA 3BEGB 4OZ0A 4L72B 4X66J 2XZTB 5A8KA 5L9NA 2FVSA 2HFUA 4PQUB 3HPOA 3M30B 2P8IA 1UAWA 2EPIA 4M5IA 5A0YA 5ETLA 4JV0A 2V0NA 5ETTA 2HQ3A 2RMLA 3V6JA 4ED8A 4D3HA 4DZDA 3G71S 1K0VA 4NLOA 2QX0A 2BJ7A 3VF0B 3D0GE 1UZHA 3CCRS 2CYYA 3R1HA 1FE0A 3A12A 3EJMA 2YKNA 3DOMA 2VA2A 1R27B 3R7BB 1SL1A 1AFJA 1T8EA 2CA9A 3ILLA 5DM7Q 3VALA 1D0EA 2QMXA 1DBDA 1NK9A 1U45A 1K73T 2MPUA 2O67A 1Y3KA 4PPDA 2B51A 4WP9A 2DH8A 3T3FA 4R0JA 4GO5X 3DDNA 1HNXJ 5AE1A 1FRHA 1D9AA 4X4PA 2HFVA 3MURP 4K4XA 1R31A 4NCAA 5L1IA 3FFIB 4U67Q 5F3ZA 3I56S 3HI9A 4A8XA 3HHEA 2XWXA 1UVNA 1B4SA 1ZZFA 2KZZA 2BQRA 4KTQA 1S6QA 2RQMA 1KQGB 2D3UA 3OFFA 2HVHA 4F3QA 2ZH5A 2HIYA 2BKPA 2DRAA 3LGMA 3FSYA 1N5YA 2F1FA 3LGHA 1R0AB 4FF4A 1X4GA 3ISND 1FNMA 5DG7A 2GJFA 3ZTPA 4Y65A 3CJ5A 4TQSA 2X1BA 3ZNUA 3KFWX 5KG2A 2ATCB 1FF2A 5C25A 5A2QY 2EBEA 1OYDA 5KFPA 4NYPA 4U8VA 2GFFA 2H54B 2PFDA 2Q6BA 4MKYA 5AE3A 3I5CA 2RQCA 2R7UA 2JDJA 4UY85 4KR0B 3FSIA 2DHGA 4CZCA 2YKQA 2Z2ZA 3HHLA 4HDHA 3N5BA 3W63A 4WWSA 5IZHA 2DB1A 4IQMA 1SH3A 2JFKA 3FZ2A 1N54B 3D9BA 3LGNA 4ED0A 2FDNA 3D1HA 1OY8A 1RLCL 4PWUA 1AB8A 4B3RJ 1XN9A 2CPEA 4OYBA 1WTBA 4B3TJ 4DR3F 1YLXA 1RJJA 1OS5A 3ZZZA 1QJHA 5BYQA 4IOCQ 1RWPB 2LECA 4F4WA 2DNHA 2W9CB 3EX7B 3CT9A 2XY6A 4J5OA 3MD1A 2OO4A 1DHMA 2Y1JA 2EG1A 4ECRA 4K4UA 2V5HG 1WOPA 1B7FA 3HVAA 3QSIA 1T3NA 1XMOJ 3KOAA 5K8PA 3IN5A 4PXCA 1KHWA 2NREA 3VGSA 4DFMA 2ZBQA 1Q1KA 2QLWA 1Q16B 5DDPC 3GSIA 1WG1A 1RHQB 2FHOB 3SEOA 9ATCB 3NAIA 3BPDA 2MZQA 3NOCA 2ZM6J 3VV2B 2FC9A 4FYYB 1T7PA 4HHHA 2R8GA 2HGLA 1E6VA 3DOLA 3DMJA 1KWMA 1I3OB 2EG2A 3CJ8A 4ZOSA 1S1TA 3R2DJ 2OPQA 3FSXA 4ZK7M 3TX0A 3C15B 5D4LA 2ZHOA 4E8UA 4IFVA 2YWEA 3S8SA 1R7IA 3J81Y 1F9FA 1QAIA 5FDLB 4J9PA 2ACYA 1UPPA 3GMGA 1F3VA 1FDNA 2CQ0A 4E98A 1IBMJ 1U4BA 3W5YA 3GG1A 2G9OA 1U7LA 5HN0A 3NOGA 1IR2A 2HWTA 4H4MB 4DR7F 3C2PA 3ILOA 3K2YA 2XEXA 2W1BA 3FBFA 1S48A 1UVJA 3H2UB 2OP5A 4K8RA 1RTHB 4C9DA 4DX6A 4DL5A 4NMXA 2V8HA 1JMTA 4KAIA 3ILIA 4DV3F 1ZA1B 2RIJA 3THVA 1N56A 2V94A 2B43A 3TP2A 4QR1A 3TUIC 1NU4A 1S6QB 3SCKE 4CLLA 4KPCA 1M5HA 1N5YB 2BJ8A 2VBYA 4ZJQA 4OZJA 2AGOA 3RB4A 4ED2A 2RH3A 1FRXA 1VCTA 1AXQA 5B0AA 1UVIA 3O44A 1HNVA 3VAKA 3UE2A 1GAOA 1QLNA 3OXGA 5M2RA 3F0NA 1DAXA 1EAYC 1JJCB 3NNCA 4A8QA 5C25B 4O4GB 4FZVA 1H98A 1HBOB 4B9MA 1CS4A 4KE5A 5D0EA 2QA4S 3FCVA 2JVRA 3T5KA 4LF8F 3BDPA 1F2HA 1IJEB 2RS2A 4LVNP 2AF6A 1HD1A 2COLA 4NLQA 3TUJC 5DRKA 3HHLB 1Q95G 2IM1A 3E2EA 4MK7A 1ZPVA 2GIRA 5HVFA 1YIJS 3GQCA 4PZVA 4LIRA 1T3OA 3C66A 4NLXA 3MMAA 4A8YA 4YR3A 3MM7A 4JI4J 2AJ0A 3UDCA 1REVA 2G2ZA 1SQGA 3D6FB 5KG0A 2UUAJ 1FEHA 4O23A 1T02A 2ERRA 2R7XA 4ZVSB 1Y7PA 4M94A 1C2PA 3IS9B 3BGRA 4AQYJ 4I7FB 2C3UA 1X9SA 5AXNA 2WVFA 4J9LA 3VZHA 2RT3A 4GKKJ 2BX6A 4PRFA 2Y8YA 2CZ4A 3DLKA 5KFKA 2BQ3A 2XWYA 4IYQA 3R7SB 3IFEA 3LWMA 1VLYA 5I3UA 5A8WA 4FXWA 3CIZA 2GMLA 4DSIA 1KRPA 2GJ2A 2UZAA 3NCQA 5DGAA 1YRTA 2J9EA 1UCNA 3QT6A 2I6WA 1JLQA 2CJAA 1FT8A 4KPYA 4C8YA 1X5SA 1NSPA 3AXKA 3GJQB 3SIPB 2IC3A 4P2XA 1VIXA 1FEEA 1UJ5A 4DCPB 3PRVA 3FUYA 7FD1A 1ZM9A 1HWUA 4IFVB 2CQ2A 2LQ9A 3IWXA 3GZ7A 3L4BC 3M9MB 2J9DE 4GRSA 3IRXA 4RW9A 1KQFB 4B3SJ 4OZ2A 5M2PA 2ASLA 1WHXA 2HHTA 2PGCA 1MN7A 3FQKA 2VICA 2ZOFA 2MZTA 2BEFA 4W4MA 1IVZA 3KK3B 4BS2A 2JX2A 3D7SB 1KFDA 4ZMMA 1MROA 2OI2A 2B4UA 1L3VA 2HVIA 2VF3A 1TUGB 2MKYA 3NMAA 1NPPA 2ALZA 2RS8A 2HNYA 3KLFA 1N48A 1MU2A 5HO4A 4ELVA 4F3OA 3W66A 4QIEA 3MPUB 2IJFA 4MIBA 1VBKA 1R8AA 2JC1A 1N36F 3NKYA 5SZTA 3GIJA 1FO1A 3BH6B 1HWJA 2Q43A 1WUUA 3BN7A 3QAEA 4CWBA 5KOWA 2XO7A 4ELTA 4UQTA 2AJFE 1JNRB 1WG5A 2LQBA 3MF5A 1VOMA 1IKVA 4YN3B 4KH0B 4X4TA 1C1BA 1N4LA 3Q83A 2HHVA 3DHWC 1D8YA 3N0VA 1S0OA 2QJ3A 3QO9B 4P6QA 2IBKA 5J1EA 3KLEB 5LSLA 1SKSA 4BCAA 2FYXA 2OPSA 2DNKA 3RAXA 3MTKA 1WC6A 1VQ8S 4Q43A 1VQ4S 5CQGA 3DKDA 2UU9F 2ROGA 1O8BA 1NCLA 4O0NA 1WF0A 1H74A 2DXDA 1M5VC 4Y00A 1WDTA 4DR1J 2K7JA 3WDOA 5GAHU 2BJ3A 4WCEQ 4LSLB 3NNAA 1NPKA 1QTNB 1YJWS 4OYZA 3DRSA 1U1KA 4MK9A 1RBOB 1YGYA 1RT5B 3K8VA 3U1MA 1ELOA 4L3KA 3HO1A 4O3QA 3MMAB 3MM7B 1NJXA 5DM6Q 2DBBA 5E7OB 4DV5J 3CJRA 2VDIA 1S7HA 2X1AA 1NZAA 3LANA 3MUVP 2PFFB 2ZBIA 2LQ5A 2RU3A 2C28A 2BR0A 4ZLPA 1LEOA 2DNYA 3FZBA 1KNZA 2VV5A 3F44A 3SZ2A 3BGOP 1WF2A 1YX2A 4KKOB 2ZBPA 3L09A 1LXJA 4Y2AA 1SJ3P 3W8GA 1JLCA 1HI0P 1PJ7A 3M2VA 3DLKB 1OPZA 1VISA 4TYBA 2VUGA 5EWEA 5E2QA 2OMOA 3DRYA 5I3UB 5A8WB 2HHHF 1HFEL 5KFZA 2DNNA 3TVKA 4X4VA 1RHMB 4FS2A 3I0SB 3MAAA 1NDKA 4N8OA 3M9NB 1SVDA 2J0XA 4OI4A 1JLQB 3GPAA 2XMVA 2IM2A 3OVBA 1FERA 4HYKA 1WELA 4EBEA 1EQ0A 2IC3B 4NOHA 3NGDA 4J9NA 2FVQA 1VLOA 3TZXA 2AKWB 3J7YI 3MR5A 2OD6A 4H4KC 4FBUA 3RU0A 1M5SA 1WACA 1RT4A 2PMWA 2IVFB 1Q81T 3W9IA 3LWLA 3IRXB 1WD6A 3KTQA 4IUFA 2GS8A 4K4TA 2WBMA 1FE4A 4JI0F 4ED6A 1B99A 3TA0A 2I8EA 5BYRA 3KLIB 1IJFB 3W64A 2N82B 1MROB 4V1Ak 3AAWB 3EGVA 4UTGA 3D54A 4C2MA 4PXEA 3PACA 2AYEA 1NEEA 3W5ZA 4FXVA 4QWBA 4WFAQ 4ZVRB 2F9DA 3IG1B 2DNGA 2FVCA 2EEYA 2HNYB 1G2EA 2DJWA 1OO0B 1MU2B 4DR5J 4OZ1A 1FRLA 3CCES 3HMJG 2NLWA 3RRKA 4LFBF 3MGJA 1TK8A 3CTRA 2G13A 1ZH5A 2XYGB 1RA6A 1HHTP 4DLEA 1WF1A 1RDRA 3QIDA 1NJZA 1R6YA 2W4PA 1RYSA 1V3SA 2R8HA 1RBAA 1IKVB 4M8LA 6AT1B 1C1BB 3KHRA 3GCWP 2NQPA 5HANA 4F3MA 4YR2A 2QL9B 5KFOA 2FGOA 2VHGA 3SQGA 2HMIA 1HNZJ 4WKRA 5J1EB 3GP9A 2DIVA 4DV7F 1BLUA 3MZIA 3CDAA 3K58A 4ATNA 2OPSB 3W9JA 2VDHA 3N28A 3PYGA 1SUQA 5K5MA 1VJWA 5DJBA 2EWHA 4PWWA 5JXSA 4ZPBA 3FCHA 2CNLB 5DG9A 4USUA 2M52A 3CJSA 1RAGB 1N5SA 5DG8A 1VRUB 2WVBA 5M2UA 2K2PA 2U1AA 5HMWA 4OFZA 2GA7A 2GHWA 3T19A 2J76E 5IT4A 1RXOB 3CDWA 2DPJA 3M1VB 2W2MP 1Y9OA 2D9OA 4OYWA 3GIMA 1LNQA 1NSKL 1M1GA 4ES1A 2XBPA 1ZTTA 2CQIA 4FF3A 1LW2A 3BQ1A 1J5EF 3PYDA 2V68A 4ZIWA 3QZ7A 3KJNB 2DGQA 3MM5A 3D68A 4KGVB 4WJBA 1VHIA 3BKTA 1RCXB 2BW7A 3CDUA 3ISZA 1RT2A 2DTJA 1HL6A 2Q79A 3M2VB 5KFMA 2R2SA 2MB0B 4I1TA 5LMUF 2M8DB 3JYTB 1DTQA 3BQ0A 4ID5A 1S57A 4W92B 3MAAB 4KGKA 3WQPA 4LRCA 4X2BA 2BRKA 1F5AA 3OTOF 2M0GB 3MOZA 2B9WA 3M8RA 2RF2B 1HA1A 3NS7B 4AD6A 1VK8A 4UOHA 4X64F 1FRKA 1HBMA 2BJ9A 3SBMA 1RT4B 2VC1A 4HDGA 3DRRA 3C19A 4M5HA 4RW8A 3WIVA 4M63A 4PWDB 1XERA 2YKPA 2KH9A 3FJ2A 5J1NA 2VA3A 4ECXA 3CGIA 1XNQF 2AYGA 2DXFA 3OTCA 3OLAA 2P2CB 1RISA 5F8HA 4DQQA 1BE4A 3LQVA 4USHA 3G8QA 3TWZA 1DARA 2H51B 1FI4A 2HZVA 2HHWA 5L8RC 1PC4A 2F5GA 2Q66A 4YUDA 3GLJA 4QBUA 1HYSA 2JSXA 3VAHA 4NLSA 5LMNF 4ZIVA 2R7TA 3DDKA 3IMQJ 4MAKA 3A3PB 4B02A 1F5BA 1RAAB 1NKCA 4IOBA 4LFCF 2LU2A 4P9SA 4RBVA 3TAMA 2UUCF 3DC2A 1OSDA 4CIOA 3PW5A 4F26A 2VIHA 4DPOA 1SJQA 4OX6A 3DLJA 3BF4A 3T1YF 1JLAB 3BBBA 2B9XA 2OUGA 4QW9A 3QFWA 3A8KA 2VPYB 2N4DA 3OR2A 3SQGB 2HMIB 1R0BG 4TXSA 1HW8A 4L76A 4HT7A 1AZSA 1A6LA 2QL5B 4BDPA 4ZP6A 5DGBA 3UDEA 4ZP9A 1YRUA 3HHNB 3CC2S 1CQMA 1LWCB 5F0WA 1X4BA 5T7LB 4XDCA 1RP5A 1R89A 3OFEA 4DX8H 2IAJB 1WOSA 3GV8B 1NJWA 1BQMA 5JVHQ 4C8LA 5D4PA 1NRKA 2PIIA 2FLLA 3GG0A 3MCSA 2XMTA 2CUYA 2R7VA 1OQ6A 1MMLA 5HBMA 3W2WB 2A6OA 2WONB 5BR8F 2PMHA 1Y11A 2W7OA 2VG6A 5AJ3F 2ASYA 5J2PA 5CXTA 3RR7A 4NZ7A 3BS9A 4WFZA 1U49A 3D3BJ 4DR3J 1T9YA 3F41A 3H5SA 3UCUP 4CO1A 1RBLA 1N52B 3AOBA 4U7UD 1ICEB 3CO0P 4LF9F 5KFTA 1RWVB 1KQKA 2WVDA 3MM5B 3LP0B 2V34A 3OJSA 3RBEA 1QUVA 4I6YA 5KG4A 4CLUA 3H40A 3IAS9 4DF4A 4P72A 3X1LB 2BOAA 1P8GA 3JSMA 4J9UE 2MGZA 1F60B 4X65F 1T03A 1JXVA 3I55S 2DGOA 5CCLA 4TU8A 1FDDA 5GAEU 2PE8A 1RT3A 3R5AA 1RAIB 4OHVA 4OJHA 2K3IA 4DL2A 5KFSA 5E3QA 1DTQB 1YJTA 4ZPAA 3OTBA 3CMES 2CFXA 4G1QA 2UVVA 2VL1A 3PEJA 2R42A 5ETSA 3S6EA 3O6QA 3PYEA 2YWKA 2LMIA 1S76D 3J80Y 2DNMA 3FC9A 2ZZMA 3QGIA 4LF6F 4KJIA 2L9NA 1KP6A 1HBMB 4LR7A 3DRRB 2VODA 3BBCA 1HQUA 2DGVA 2B5JA 4RW8B 1JLEA 4X4UA 3T9ZA 1U0HA 3RR8A 1KEKA 4USKA 2HFNA 1HARA 3TW0A 2DGXA 1TFWA 3MMJA 4OZNA 4I6AA 3JSBA 3BGFA 1VHFA 2UV8G 3Q8SB 2JC0A 3VAGA 3AQOA 3AD9C 1F9EB 3D0IE 2GNKA 2H5JB 1NBEB 2XSFA 2BJDA 1FDAA 3I5AA 1TMJA 4DR7J 1EHWA 4OYMA 1HYSB 4ED1A 2E5LF 3NS5A 2CQ1A 2G0IA 3NP5A 4DV3J 3R6GB 3FNNA 2OHDA 3PO4A 2P6TA 4F8RA 3H7HB 4JOUA 4RO0A 3VVTA 3GSDA 1IM4A 5J2NA 2IM0A 2NXJA 2AW0A 4NLDA 4EI2A 1UEUA 2IMOA 3IWNC 3O1LA 3TVYA 2QYCA 2J8SA 3OR2B 1G3OA 2VZ9A 3W65A 1GXTA 3QIPA 2DXEA 2YWHA 4L73A 2OPPA 1Y3JA 3PKYA 3QSYB 3DLEB 2AJQA 4ANEA 2XI2A 4JI5F 3G8SA 4ILLA 1TL3A 2WW4A 3AT1B 2HRTA 5F8GA 2H48B 1JXLA 2C2NA 2DEIA 5GADI 1CJUA 5C2GA 4GVLA 4JV5F 4J9VA 4LF8J 2QZ8A 4QCLA 1APSA 4Q8FA 3VGTA 3HKZD 2VKZG 4F4YA 3UNGC 4Z37A 2VKRA 3C6TA 5C24A 4M5LA 3CDEA 3C6UA 3K89A 2NSCA 5HBMB 1WOOA 2Y9HA 2HHSA 1UA0A 2VG6B 2ZNZA 4YMEA 4L75A 1WORA 2M70A 1DTTA 4DR6F 3RB6A 2K1RB 1UTAA 2DNLA 3KJFB 1KLNA 1YJRA 5KFAA 1AROP 3RRGA 3PV8A 4DSLA 3GYNA 4FPRA 2DNZA 2Y0BB 5L9XA 1S9FA 4P2FA 1UWBB 1W26A 4RL1A 4BWMA 2UVRA 3PKMA 3TI0A 4C4WA 3FBCA 2J6UA 1K44A 1F5CA 3TZYA 3JSMB 2MGZB 2AWZA 4B9VA 1T03B 1TKXA 1NDPA 2LKZA 5H9FJ 1RT3B 3KJVA 2YNIB 1QVFR 2Z0GA 3BR9A 3V6KA 2W01A 1QUPA 1HMVB 3U1LA 4ICLA 2WBRA 3OLBA 4G1QB 3M2RB 2V69A 1XC9A 5BYSA 2D7SA 3A8JA 1N33F 4LF7F 2AEJA 3OTEA 4CP5A 4NA2A 2IJNA 3H25A 4ELUA 2B3TB 1TMMA 1R3NA 3T41A 2QIFA 3GFXA 1D1UA 2B5JB 1Q7LB 2VFTA 1GFWB 1R8PA 1K1QA 2LEAA 1SC6A 4A8KA 1GXLA 2XC9A 2QO3A 1ZZNA 4DLGA 1TL1B 5KFLA 4LRFA 4DHVA 5CH7B 1GMWD 4QIVA 2OFHX 1RHRB 3UR3C 1SXLA 1X9WA 2C1EB 2KL8A 3R1LA 1PG5B 1J5OA 3U27A 2M4MA 3BM7A 4KV8B 4EGLA 2QMWA 5L38A 4EK2A 2FUG9 2WAQD 3US5A 1JLBB 4PUOA 4P2SA 2OMLA 2JVOA 2FY1A 4EWTA 3OXLA 4UZCA 4OYOA 4OI0A 2P5VA 2FHJA 5H1SV 2GAGC 2HYIB 4ILMA 3I32A 5ETNA 5J2NB 2DGUA 1BGXT 5HI7A 1N36J 4EYIB 5I42A 5HQLA 1V5VA 5KFBA 1FKPB 1OIAA 1H72C 2ZKUA 2K06A 2ZC4A 3LP1A 1KKHA 2MQLA 2OPPB 5EUHA 5EHHA 1KVKA 6FD1A 1JX4A 3V4IA 2NZCA 3DRPA 4BC9A 2OFGX 2YX1A 6FDRA 3GWCA 3JQMA 2VOPA 2E5IA 3MFIA 2DVIA 2M3DA 3D6HB 1CJUB 3AJ2A 3KLGA 3MEEA 3V6DA 3TRGA 3O3LA 4IH7A 3BGLA 2DH7A 3HZEA 1WEYA 2C42A 1J2VA 2GMHA 4DX5A 3C6TB 1NXIA 4GKJF 3C6UB 4BHQA 3U02A 2UU9J 4M5NA 3DNCA 5F8LA 5HQMA 3SI8A 2O3DA 3DXBA 1DTTB 5KFHA 3MUTP 1BHNA 2MHNA 3SV4A 1Q0NA 1SV5A 4K50A 3TA2A 4LFAF 2CWXA 2YWFA 3BSAA 4YDDB 4UZBA 4LF1A 4N76A 5I3QA 1K1SA 3J7A1 4IG0A 3MAHA 1TTHB 1TVRA 4M5DB 5KT6A 2YKMA 4NCGA 1TKXB 4NI2B 1FFWB 1UL3A 4C7QA 5KTQA 4Q45A 3Q2SC 3N5FA 5CD4H 2G0JA 2CQDA 2YKOA 2DKOB 1LWFA 4ICLB 2IYIA 1X60A 2CVEA 2HWIA 2JLFA 2HHHJ 3Q8UA 4I2QB 1WKJA 1UWAA 2N4CA 2EFGA 4DFJA 3TJ8A 3MR2A 1PBAA 2CIMA 1U26A 3NGTA 1FDBA 1Q82T 4JI1F 4ZPDA 5DQGA 3HKWA 5KFJA 2QL7B 1DLOB 3AA9A 3CPWR 4Y2KA 2CPHA 4RBTA 5B08A 5EWGA 1N0VC 2FZKB 3GFYA 2KG1A 2HLUA 2RDIA 1OQ3A 5E5NA 4NLVA 2QSFA 2KTQA 5B09A 3RUBL 4JI0J 1QE1B 3VCDA 1FKOA 2IA6A 2E7XA 2R2TA 1NK7A 2QYGA 3B78A 4C98A 2FJWA 1SQEA 3WC2A 1J5OB 1Q8KA 1T05A 3MEGA 3IWLA 4EEYA 1WC3A 1GMVA 4DQIA 2J7KA 1Y5NB 4WZMA 3MM6B 3ENWA 2GVDA 3FCWA 4DV0F 3D6MB 1N34J 3ELHA 4LFBJ 4DN9A 1XIQA 3ULHA 2XCAA 2KFZA 2UXCF 4QIGA 1X8DA 1S77D 2HZCA 2BANB 3RW7A 2HIQA 2A3JA 4F4AA 4KGMA 1NJYA 1VQ7S 5KAKA 1U8SA 2QG9B 3BSCA 1V6HA 4ANCA 2F40A 1X5OA 3LP1B 4WE1B 3V4IB 3OVSA 1FWPA 1ZM3A 3DRPB 4A8SA 4J9OA 4DFPA 4ER8A 3HVTB 3R5DA 3KLGB 3OQ2A 1X4FA 4DV7J 3MEEB 2H4YB 3QNWB 1NHVA 1RTDA 4LQ9A 4AL6A 3PCOB 1NKEA 5EDWA 2V2VA 2WSEC 4CLTA 3JTPA 4AT1B 2EKNA 4QWCA 4DUTA 3CD0A 5B0FA 2N7YA 3M32A 5A8RA 5KFVA 3QPIA 2AGPA 3PZPA 4KHMA 4EO8A 2HNZA 3M8SA 3OL6A 4OI3A 1TU0B 4QW8A 3TAQA 1D3WA 2IMWP 4EZ9A 3C14A 1S9GA 4GC7A 1P9YA 1WKLA 4FKXA 4H4OB 4IG0B 3THPA 2PO4A 3PIOQ 3IC1A 4KYZA 1J5EJ 4MYTA 4USTA 3GIRA 2I5JA 4ED7A 2MSSA 4NCGB 3QZ8A 2FHMA 3FEYB 5A6WA 4O3NA 3G6ES 3W5XA 2C2KB 3GV5B 3JQJA 2CPZA 2QT7A 3MM8B 4WIQA 3MPVA 5ETPA 2HHXA 1LWFB 3JTOA 3CCLS 3H8YA 4WK1A 4KO0B 1CBKA 1W25A 4J91A 5LMUJ 4BC7A 2C22A 4UW2A 4ZDNA 2FJDB 5HATA 2GGPB 5B7WA 4FVMA 2VJUA 2IDLA 3U1NA 4CDIA 4GMKA 3PX4A 1E6YA 2KFNA 1KS2A 3OTOJ 1R43A 4RNFA 1JLFB 1DZ5A 3PW4A 2QA4G 1N8RT 2UUTA 2ZDOA 3TEGA 1Q8LA 5ETOA 2JZ5A 1NB7A 2VOOA 2N3OA 4X64J 1V9OA 4TY9A 2VASA 1K0TA 4B3MF 1O51A 2OH2A 4XO0A 2H5IB 1DQ8A 4HLBA 5KFEA 4CO4A 5H9FK 2DR6A 2CQ3A 3UNYA 5MAOA 4ZVFA 3I9ZA 4C11A 2FJBB 3MOJB 1RWMB 4ED4A 3UDLA 2B8QA 2BE7D 1VQKS 3FGVA 1FKOB 1ZM2A 2KXHA 4P2MA 3L95X 2A2CA 1XNQJ 1XNRF 1NM2A 1VS3A 3ZZOA 3SCIE 3HHDA 2KHCA 2RVJA 3MEGB 5BJRA 1WNEA 2WSCC 2H4WB 3UN3A 5J2MA 2NPIA 4ETXA 1YZ6A 2MZJA 3EM1A 2BM0A 4WP3A 2GVDB 2HSEB 2FLNA 2BXJA 2XMJA 5LMNJ 2VQEF 4O3OA 3AB4B 1JNZB 1PAEX 1A0OB 1TZ0A 4LFCJ 4RW6B 3HX9A 4FF2A 1HPZA 2FB0A 1FRMA 3A4TA 2ILZA 2UUCJ 1H3DA 3M2UA 1QVGR 1IKWB 2RDDA 2G4BA 4HACA 4PYDA 4PYAA 3J7ZT 3T1YJ 1W2IA 3E51A 2HQFA 4OYPA 2IVMA 4IDKA 3L7UA 2CVIA 1KTVA 2UXBF 2X51A 3WBZA 5JUMA 1C1CA 3G6VA 1OPIA 1U1QA 4HKQA 5MLCV 3VVUA 2YTCA 4NLRA 1KONA 2HS3A 3W61A 3CSKA 5L1LA 2R8JA 1XQIA 1MMDA 3HULA 2B4PA 4MKAA 3D6TB 5CABA 2D3ZA 3M32B 3OL7A 1MG7A 5B0CA 4K0KF 2W8KA 4ILRA 2JEGA 1KVJA 4AL7A 3UO0A 1DURA 1HR0F 3QMQA 3MMCA 5FIIA 4ES3A 5BR8J 5CYJA 2BE2A 3OV7A 3KK1B 2AV5A 2HNZB 5AJ3J 4P74A 5LSOA 2F9JA 2XS5A 1RTIA 2V2ZA 3K57A 4WIIA 2ADCA 3C14B 1DQAA 1GT8A 3P45B 4B17A 2MLXA 3LPYA 2X3GA 2G0CA 2R2UA 2M88A 1LWEB 4M5GA 4P75A 3BDEA 5LXYA 2CPDA 2GQ2A 4LF9J 4PAAA 7AT1B 2V50A 3QGPA 4IRCA 4WTYA 5FJ4A 2DNQA 3LAMA 4WYLA 1OWXA 1IUJA 3JAMU 4X65J 1BMQB 3VWSA 2E9ZA 3TZWA 1JKHB 3D67A 1FX4A 4JV1A 1VQ5S 2FQQB 5D4NA 2F8HA 1WKKA 2QN6B 4LQ3A 4HHUA 3ZXWA 3CO9A 3UD4P 4NZ0A 1B0TA 1E6YB 3RB0A 3GJSB 2DGWA 4YB6A 2W9BA 4ENOA 1N5VA 3EVMA 3N6MA 3QRPA 3G82A 1VQ6S 3CC7S 2FGCA 4LF6J 3KLHB 1WJ9A 2H9ZA 4JI2F 1GK8A 1YWXA 2E7VA 2F8EX 2F4FA 5CYMA 2ZBRA 3ZTQA 4K4SA 5C2CA 2RSQA 5IV3A 4LUBA 1VC6A 1KTQA 3UVJA 3I5BA 2AZ3A 2L9DA 3NG8A 3WHIA 3O8WA 5IC4B 2GX8A 5KG1A 4B08A 3VGVA 4QIWD 4B3OA 2J6SA 1UFLA 3B82A 1WTFA 2FD2A 2YXLA 3M6WA 3QT5A 7FDRA 2AJ4A 5J2MB 2ZITA 2OD4A 4ZPTR 4OHWA 2CPJA 3HVWA 4AE5A 4ZPCA 5JJBA 2DH9A 1D8ZA 4P52A 1GQEA 1BUXA 5CYQB 4YB1P 3QFHA 1G6BA 4WYWA 2E5LJ 2KO1A 3I6PA 3SCJE 1T9XA 2P9CA 3OT9A 5KFDA 1XWLA 2BABA 1IM6A 5KFUA 4HEA9 4USMA 1SC1B 1C0UA 4W90B 1MWYA 2XHWA 1HPZB 2IA0A 1AUSL 4LR9A 1MN9A 2CQPA 3MEDA 4QR2A 5LM7E 4HACB 4FYXB 3BYRA 3CCJS 5CAAA 3DI6A 5ETVA 4GVBA 3BO2A 4B9UA 1ZM4A 4MFBA 2E1PA 3QT8A 3IAM9 4J37A 1QAXA 1C1CB 1HNWF 4JI5J 4ZP8A 2GCFA 4EO6A 3C16B 1Y4ZB 4A48A 2HS0A 4P7TA 3BPSP 3L7OA 4DUZF 1WC1A 1UJ6A 4URSA 4JV5J 3ITHA 5B0EA 2I1RA 4CO3A 2AJ1A 4PG7A 2AT1B 3FBBA 1RACB 3CW2C 3T1HF 4QQBA 1U48A 2HK2A 1U1NA 3SSSA 4X4QA 2OPRA 3EGWB 2BE2B 3C8YA 4DDFA 2E1CA 2Z2YB 3MXHP 2JLEA 1RTIB 2FC8A 2RUSA 4EZ6A 4DR6J 2W2NP 4HHJA 2CKWA 1LOUA 3HT0A 3GJTB 4KRWA 1HQEA 4QWAA 2FLOA 1SKUB 5AXKA 4ZVTB 4CI0B 1PYSB 2BV3A 4OLOA 3CJQA 3NBPB 1CG2A 2DO0A 1V5IB 5GVQA 5ITHA 1TKTB 2ZZTA 3KG0A 4OJGA 1YHQS 2J8AA 2AX0A 4K4ZA 2K3KA 2MYFA 3Q24A 4DWIA 1H7XA 3QWUA 2CJKA 2A2DA 2ZFHA 1N33J 2VFSA 2V2QA 2W9BB 4LF7J 4KGZB 2MZRA 3G82B 3HK2A 1T0TV 2ZOGA 3SV3A 1HIYA 1JJ4A 2F63A 4CM2A 4DOZA 4LRAA 1KDNA 2YBVA 1FHTA 2DHHA 3GONA 3JB9k 3UDVA 4CO0A 2OAUA 2RKIA 1U1MA 1RABB 3W60A 1W2BR 2GMJA 5A8KB 3RW6A 3UVJB 2RU9A 4Q7AA 2YNHA 2ILYA 5ETKA 4WXOA 1VBZA 4J9MA 2ZE2A 5CZVA 4Q8EA 3K5OA 2R9LA 1S0MA 3VAJA 5A0YB 1NK0A 2J7UA 2IVYA 5E41A 2CQCA 2NSBA 2BBEA 2J6TA 4K4WA 4I4BA 2AJ2A 4UT4A 4ZVGA 5IQ6A 3CD7A 4M95A 5KG7A 2YKNB 4EYHB 2VD3A 3DOMB 1FD2A 1S1XA 2DHSA 3HCXA 4WF9Q 1F6TA 5EX0A 4KHRA 4TLQA 1W7WA 1RT7A 3AFGA 1U2CA 1BQNA 4NRTA 4Y2CA 2XG8A 2KDOA 4F02A 1C0UB 1Z4UA 4RU2A 2HLTA 2GVZA 2HGNA 1Q78A 4DFKA 3EXCX 1PGZA 3UI3A 4IFYA 3Q23A 2QLJB 3DI6B 3HXMA 3JTNA 3NCPA 4GVBB 4YQWA 3EVOA 2R3VA 4ZHRA 1IBLF 3ET6A 1Q7YT 2B7BB 3I82A 2AQ4A 4P10A 3R3TA 4WK3A 4CRJA 3B54A 2AU0A 4LRBA 4TY8A 3NNHA 2LA6A 2BQUA 3FRYA 5D3GA 5EGYA 3P5BP 4A8MP 4OZ3A 5F9LA 4KIAA 4YDXA 3RGIA 4K2JA 1F3FA 1GXUA 4ED5A 2GIQA 3ISNC 2GHVC 4ID8A 3IRWP 1L3UA 4MKBA 1VBXA 2IYGA 3TJAA 5A6PA 1IN0A 3BSOA 2KM8C 3DFEA 4GKJJ 3DYAA 1M90T 2XB2D 3BB5A 3QJLA 2OPRB 1YITS 4PXDA 1S6PA 1HHQA 1KC8T 5D77A 3N6NA 4UOGA 3J7AN 1TK0A 3V4MA 4RWWA 4C48A 3MMBA 3AHPA 2PEHA 3EVWA 2HRYA 5IT0A 2BKNA 2KJVA 4OMFG 5DDRC 2YVSA 1HQEB 4LFAJ 2PT0A 1YBUA 2GO8A 1UPMB 2M9KA 4UQGA 4M5JA 3T5LA 1I6JA 2HK3A 1T9TA 4Q44A 3TZZA 1WWHA 2VG5A 3C3LA 1LV5A 3ZZPA 4LF2A 3QATA 1CJVA 2DITA 1UP1A 2A6MA 1S1VA 3ETOA 1N5TA 2HFOA 4HI2A 3CB4A 4I6WA 2O01C 2VFRA 5KFYA 3H42A 1JLGA 1YG0A 2E66A 2RHSB 3O2IA 1HWLA 3ONQA 2XZDB 5EN1A 4J9RA 1IKYA 2VPZB 2HFSA 4OHXA 4MIAA 2UUBF 4OV6A 3GR1A 2YNFA 2R8KA 1FKAF 4JI1J 5IT9U 4NLUA 2W24A 5BXIA 4K59A 2W2PP 2BACA 1AW0A 2MKIA 2ZNYA 4ECZA 1UEKA 2RKIB 4DXLA 2IDEA 1S1WA 3UR0A 3RB3A 3AOAA 3AY0A 1VQOS 1FRIA 3OTDA 1E6VB 4N7TA 3DOLB 3DMJB 4O44A 3K5NA 5LJ3Y 1S1TB 1NK8A 2OPQB 4HL9A 2XCPA 2XGPA 1N6QA 4PG6A 2AD9A 3HHLD 4RR5A 2DGTA 3V81A 4N41A 3JSYA 4DR4F 4KH1B 2LYVA 5K8MA 3EPIA 3UD3P 1CC8A 2VQFF 3DM2A 4DSEA 1YJ9S 1RT7B 4PPZA 1UW9A 4X84A 1RWKB 3FKBA 1B0VA 4F04B 4DV0J 3B8HA 1U47A 1VR6A 4CTAA 3MAQA 3I9V9 2UXCJ 3BN4A 5HJXA 3G4SS 2CQGA 1NH8A 4IFYB 1SH2A 4F4KA 4CLPA 1YDLA 4ECSA 4DPWA 1QM9A 1R6VA 2CNKB 4AYBD 4OX8A 3RBDA 4FF1A 5F8NA 3OXFA 3Q8QB 5U47A 1KOOA 2DISA 2YX7A 3AB2B 3ET6B 2Y1RI 3BBFA 2ZDPA 4NPOA 3M8PA 5B0GA 3PO5A 3B4DA 3KHHA 4FNHA 4HTJA 5KG5A 2NUHA 2LEBA 3NMRA 4PG8A 2R4FA 1YVFA 1CJKA 4LJMA 4YB7A 2DEJA 3DOKA 1S9EA 5T41A 2JL9A 4TU7A 1HNVB 4LVOP 2KT3A 2E5HA 4Z7YA 3DYAB 3NRBA 2VBZA 1SKRA 5D0GA 2MZSA 3H4DA 5RUBA 4DMZA 5CHCB 3DCAA 5F3TA 1CS4B 1S6PB 3E3XA 2QE5A 4ZS6A 4IH5A 3M6VA 3CCSS 1L3TA 2QLFB 2ZWOA 4NMLA 4FPIA 3TX8A 4USWA 3MMBB 1UJ4A 3W1YC 1LWXA 1RTZA 4N56A 2G2YA 1QSLA 2MHEA 2VG7A 4I2PA 4RBUA 2PMZD 1SBRA 3M30A 2HHPA 1Q53A 4DCJB 2XMKA 4AXJA 1SJFA 2FIUA 2YPYA 1FFGB 3DLHA 1XMBA 2O5DA 3GV7B 4DN0A 1EIYB 2X1FA 1CJVB 1NO8A 3UN5A 2Y0SD 4HTIA 2J0WA 4CLKA 1S1VB 3CCTA 2LDYA 1REVB 2HNDA 5F8MA 1SJ4P 1UVMA 3N4WA 3N6LA 3EZOA 3PW0A 4JI3F 1JLGB 3RBXA 1IKYB 3KDNA 3BGRB 1WC0A 3TANA 3ENAA 2V9WA 3AA8A 2YNFB 4OLPA 2KB2A 2MJNA 2DK2A 2PA8D 1N32F 4U6PA 1R8HA 2C2DA 4DZ6A 1RE1B 2XO6A 4ECUA 4F0KA 5KFWA 3BJYA 2HW3A 4PCQA 1DFDA 4R25A 4NYZA 1S1WB 4MK8A 2L08A 4B3MJ 3QJJA 2BRLA 2KRRA 4C8ZA 3H59A 1HWIA 1N88A 4O44B 1VK3A 5DLFA 2MZ1A 1GTHA 2KVIA 4XIUA 1TFYA 4LMZA 1XNRJ 1N6QB 2AMCB 3M4XA 1YK9A 2RQ4A 4CH1A 3TVZA 4DV4F 4RW9B 1VI7A 1UW4A 4QZVB 4Y3CA 3RBZA 1PBUA 1TR0A 3MPWA 3DM2B 4TN2A 5DQIA 3K59A 4DU7A 4TYAA 4YB5A 4CTAB 2VQEJ 2HFZA 2ZKTA 5HL7Q 4CM0A 4X62F 4LBPA 3LF0A 4C3MA 1VQMS 2PSZA 4UUWA 1WDDA 4Q5VA 2NPFA 2OKQA 3K0JA 2AZ1A 3GJRB 3L3CA 5KT3A 4K4YA 3N01A 3QBCA 3EPGA 3KLFB 2B9YA 3S01A 4IRDA 1RSCA 3ZFVA 1N34F 5IOLA 1S99A 3FMWA 3ZZUA 3W3SA 4RUCA 4A8WA 4NL5A 4WZQA 2NUUG 2YWGA 2Z8QA 2HEKA 3NAHA 3LALA 4OV1A 4JYAF 3H5YA 2W9CA 2UXBJ 4CLFA 2I38A 3PFEA 2HS4A 2MY7A 3DOKB 2EC2A 4J7CA 2W4DA 3CUNA 4A4JA 4IOAQ 3QYYA 4LF4F 4G65A 3Q89A 4C8MA 1JXEA 4USIA 2UXDF 2DR5A 2GW8A 3V5RA 3EICA 4K0KJ 1CJTA 3R8YA 2E1MC 1HR0J 2HHQA 3I87A 1GNKA 3DRXA 4AFFA 5DLGA 4HR2A 1MNEA 5K9FA 2KM8B 2I0XA 1LK5A 2DR9A 4RW4A 2WSFC 2VG7B 4I2PB 3P49B 2R2RA 2PI4A 1HKAA 2QTWA 4Y0FA 2RD5C 5L1KA 3DRSB 4FKYA 4JB8B 1WC5A 2FZGB 1M0SA 2POKA 2CJ9A 3C15A 3PHEA 1ITPA 1LW0A 1UMJA 1QAJA 2I9SA 2HNDB 1LQ9A 4JI7F 3IGNA 1X0PA 5FDLA 4BWJA 2XNQA 1IWAA 4CCHA 1VQPS 1U0SA 1VIOA 2CJXB 2X7IA 1AT1B 4OI6A 5KG6A 4H4MA 3OL8A 2Z57B 3IGVA 3CCMS 2DT9A 3CIMA 4N5SA 3K7RA 1FNOA 4KT0C 2LDIA 3MR3A 4ECWA 2DNPA 1JLCB 1RTHA 2EK1A 1QSSA 3FRZA 2OTJS 3WX4A 4JI2J 2ROEA 2ZWPA 2CJQA 4I68A 3UWTA 5K8OA 4CYUA 1PC5A 4DS5A 2HAFA 4ANDA 3PDNA 1SQFA 2MLYA 4NWBA 1CEZA 3G8TA 1EP4A 3CCZA 3T1AA 4B9NA 1VFJA 1FWLA 4RJVA 1M1KT 2MDAA 3SDEA 1RWNB 2WRMA 5GAGU 4QWDA 3LOUA 1U6FA 3S1TA 1Y00A 3ZTOA 4L3NA 1YTYA 4FP9A 2Y1IA 5GMKa 1TELA 3KWMA 5KOXA 4O4GA 1RK8A 1HBOA 2HKEA 2B6AA 1HLWA 2ZC3A 1KHVA 4QPXA 3KK2A 4HT5A 4DV1F 3QWPA 1RGVA 2DYAA 2C2OB 2RUGA 2XULA 1UVLA 5DO2A 2C3YA 4ES2A 3WC0A 1U6BA 4RNMA 1GEHA 4E0DA 5G0RA 1NB2A 5DDQC 2B8PA 2RRAA 2M5YA 3GFHA 3CCQS 2GZOA 2O66A 3PX0A 2A10A 1L5UA 2G1HA 1WEZA 2ZOMA 5LOQA 4C0BA 2V2KA 2DHAA 4FDFA 4ZJOA 1FESA 2XM3A 1HNWJ 2HURA 4OZLA 1BXNA 4DUZJ 2YNGA 3IS9A 4LSZB 4I7FA 1UFKA 1EX8A 3J7YU 5HLFA 4XAKA 3IBFB 4OX9J 1UKUA 3JXOA 4ALZA 3TR5A 2YH0A 4X4SA 1CJTB 1S6OA 2HPUA 4RZRA 3T1HJ 3PW7A 3D28A 4IG3A 1SUQB 2NXCA 2Y1LB 2C2MB 3GFZA 2XYPB 3HD1A 2ROPA 2NXNA 4RW4B 4C0HA 5K14A 2RQKA 2VONA 3QJPA 4RW7A 2UV8A 3FK4A 4OI1A 3SSRA 3D1QA 1DRZA 3TA1A 2PA3A 4ZLNA 4ZLJA 3CCVS 1NK4A 4YP3A 3PTWA 4OYIA 3BR8A 5HROA 1LW0B 2BJEA 5IQQA 5JVGQ 5F9NA 5DETA 4MIWA 2PN6A 1S7IA 1LW2B 3PY8A 1EARA 2D3OR 5EWFA 2RRNA 5C7PA 1ZOTA 3H2LA 4CLSA 3KK3A 3SXLA 1WI6A 2WB4A 3C46A 2JEFA 1WG4A 1CSJA 2E9TA 3MD3A 5A2QU 5GAHI 3ZC4A 4PR6A 2KFYA 1UFWA 2EFVA 1RT2B 1H73A 1U1PA 3R2CJ 3BKFA 3AD7C 3VZIA 4DR2F 5KT5A 4X4NA 3GTYX 4LR8A 1RKIA 3T6JA 2VFUA 3TYTA 4CYUB 2KG0A 1VRTA 4ID5B 2G2OA 2MQOA 4WU3A 3K5MA 2CPXA 1FFSB 3G2XA 1EP4B 3NGSA 4IO1A 2H65B 4K2XA 3SDEB 4DG1A 5KFGA 3GCXP 3H2VE 4M5MA 2J7WA 4KGXB 1MWQA 4RNHA 3MR6A 2R8IA 3D1OA 3AXMA 3KMSA 3AJ1A 2XS7A 1NK6A 4CNZA 4DX7A 3M8ZA 1NK5A 2FVPA 3PHTA 5L39A 1DJ0A 3I4HX 3QO9A 4NE9C 2B6AB 2ZH4A 3KUEA 3Q0AA 2MQNA 1VJQA 3KLEA 3J7Z5 2E44A 1X4HA 2AGQA 2DPIA 4DPYA 3KK2B 2ZZNA 3VQSA 1YQHA 1S49A 3EZ5A 1OJ4A 3N9UC 2PDAA 5IWAF 2BOPA 1S97A 2CNNB 3U7JA 2DCUB 3M8QA 4DS4A 4NLPA 4O4RA 5G0RB 4LSLA 1NJIT 4C8NA 2ZH7A 2ZH2A 2RNEA 2D69A 1RT5A 1JJHA 1X5PA 2RB7A 3N79A 4ZVPB 4Y2MA 2FHKA 4ZVQB 3HHKA 1IBLJ 4B9SA 1IBCB 2O1PA 1X4EA 3SFUA 1ZAVA 2Z56B 4XTTA 5I4MA 3TAMB 2UP1A 3UFCX 3KUHA 1JK9B 3DLLQ 4ZJLA 3F73A 1F0XA 3PXGa 2YNGB 1U1RA 4RNNA 4U8YA 3QRRA 3J81U 5KG3A 1HQ2A 2XY5A 4NEYA 3IM8A 5HLFB 1NAQA 3OSNA 3NLCA 2FJVA 4KKOA 1Z2ZA 2YKAA 3W2VA 4E2FB 4A8OA 1AZSB 4U9RA 1VQYA 1SIZA 2WHOA 4IG3B 1XR7A 3VTIA 1SH0A 1ZTWA 1CVJA 4ZA1A 2L41A 3AJDA 5K14B 1QDUB 3I0SA 4GO7X 4RW7B 2IJRA 3HFVA 2CAJA 4URGA 1BQMB 4I64A 4MJKA 2QSWA 5ADZA 3CWJA 2K7KA 4YR0A 2F7VA 3UCGA 3BH7B 3P6YC 5J2PB 5HROB 3NY0A 2HZAA 3HZGA 3G9CA 4DEZA 2W4CA 3OUYA 1HI1A 4G3IA 2HG4A 2ZUAA 1F9HA 3PEHA 4M1KA 4Z2XA 3T5HA 4Q2MA 1PIEA 2BE9B 3HDSA 3LW5C 1X5TA 2D9PA 3KYLA 2KYXA 3KLIA 3VQTA 2CZ9A 1A7GE 4N77A 2UUBJ 1S12A 5H9EJ 3QGGA 3EZUA 3PRBA 3SCLE 1K47A 4WXWA 2MQQA 1ZBTA 3IG1A 4WP8A 3FQLA 4F36A 5IM0A 2HQCA 5CA5A 1VRTB 2C3PA 2QFJA 5KFFA 5C42A 4DJBA 4CLWA 4QU6A 1UETA 2QMUB 4DG1B 1TUWA 3SMZA 1RHKB 4LRDA 3AQPA 1MWZA 1UZDA 5L1JA 5ETQA 1WHWA 1VC5A 2ZH9A 1YJUA 2VFVA 1HQUB 1JLEB 1GMUA 5HJYA 3VAFA 1TKDA 1RAHB 3CJ3A 3M8YA 1U0HB 1NZ8A 3S7RA 2E5JA 4A8FA 4B9LA 4DV2F 1TL5A 4C3KA 3JQKA 3DLBA 4DR4J 4EFAC 1CPZA 4WPAA 5E3AA 2R7RA 3EMTA 2VQFJ 1WSRA 3WX8A 2K8GA 2E9RX 3FEXB 3E01A 2J0SD 1X9MA 4RPFA 1IBKF 5GAGI 3NEKA 3M8QB 3HP6A 3I4PA 2FJAB 1VRUA 3EE3A 1YSJA 3MCMA 1U24A 2OSQA 2CPFA 2EFNA 4YHHF 4ED3A 4ECVA 2W25A 4FNIA 1U1LA 3VAIA 1V3ZA 3BO4A 1OSCA 3R9LA 3M1VA 3M6UA 1KLMA 2MXYA 2MQPA 3HT3A 1RLDA 2LQJA 3VGUA 2LQ8A 3R5BA 4OHYA 4ZP7A 2UVUA 3GIKA 5GMEA 3GYGA 3G96A 2ZJRQ 1GX5A 4ZCIA 1FXDA 4ZVUB 2JLGA 3K5PA 4NA3A 3QIPB 3W2VB 4XK8C 5IFMA 1VQLS 4MKVA 1RHJB 3BSNA 1TL3B 1URRA 3ETMA 4Z7CA 1WC4A 1H6KX 3NS6A 2ZHAA 2NCKL 2PEBA 2N7CA 3JYTA 4U95A 4ZVOB 1KFSA 3KMQA 4C3LA 3V2UC 3HJVA 4YY3F 5IS2A 1GTEA 2FPHX 1VC0A 5C24B 2V4JA 4UF4A 1FXRA 3H20A 1OYEA 5HMXA 4X4OA 5D8HB 1F1BB 4MMOA 5LJ5Y 2RF2A 2GQCA 4CT9A 4DPTA 3P4UB 5DZ7A 3HSDA 3QQCD 1RT1A 4Q2LA 4LIWA 3CCWA 3RTVA 1MW7A 4DUYF 3OUYB 3G6XA 5LL6d 1Q86T 1H0HB 4PWDA 4UOFA 4YS2A 1ZA2B 2QLBB 1JQGA 2AYMA 3CEDA 1TKZA 1B3TA 1MSWD 3GU0A 4LF5F 4DQRA 4PQAA 5KFNA 4JI3J 1NLKL 4F7VA 3H5XA 3KHGA 2XTJP 3D2WA 4EU0A 2QC3A 3M7VA 3ZO7A 4PG5A 1M5OC 4XPEA 3JSRA 2CJBA 1XMQF 3AD8C 4U96A 3H4BA 3KJVB 5IM0B 2CWKA 3BV8A 2F3JA 1X0FA 1N32J 3DN9A 4MTPA 2VB6A 4QYZJ 2VC0A 2MLZA 2WCXA 3MPDA 4D3GA 5GADU 5HVHA 2AEMA 3OD2A 3POTA 3OSPA 2RHQB 1FRJA 5C42B 3IA0A 1X7VA 3M8WA 1GH8A 4C8KA 1TK5A 3EDRB 1PKUA 3TAPA 2KT5A 2RJZA 2P6SA 3TARA 2LEPA 1HW9A 4GC6A 1FJGF 1JLAA 1IR1A 3HD2A 5IC6B 2HHUA 4NXNF 3PJWA 2W9AA 3CJ4A 2Q1LA 1FTCA 1TL7A 1VDHA 5GAEI 3MFHA 4F0MA 4DV4J 4RUBA 8ATCB 1UA1A 3SSQA 4ZCLA 1L3KA 1RTJA 1IWGA 1KSPA 2KHDA 4OL8A 1LWCA 3E01B 3NGUA 5T7LA 2IBOA 2Y3YA 2IAJA 2MKSA 2YWWA 5F41A 2KJWA 1TAQA 4X62J 1BY9A 2UVWA 2CJYB 2X3DA 2ZH1A 1M5PC 4CO2A 4ZN3A 2HQIA 2VH7A 3W2WA 4PUOB 3Q2TC 4A46A 2WONA 2KT2A 2IHR1 3QGHA 4ZCMA 2B7CB 4I0WA 4P7VA 1XR5A 1KLMB 3L7PA 4NCBA 5CD4A 1VMBA 3RYLA 5HVGA 1NHUA 1FWKA 3KNGA 4BLGA 5LXRA 1KOHA 2DCLA 2L3MA 2MMYA 5DQHA 2LP4A 2N3LA 4JYAJ 2MY8A 2F65A 3FDSA 3I96A 5I42B 3LP0A 2C3OA 4IO9Q 4JI6F 2QEXS 4PG4A 1I94F 4O3SA 3GE9A 3M9OB 1NDLA 1IR0A 4H54A 3A8EA 3OBIA 5K20B 4LF4J 1MMNA 2FJXA 1Z2LA 4UY8T 2KXNB 1H7WA 3A3NB 3BGUA 4KHPF 1NMEB 2UXDJ 3LUYA 1ZYQA 3DGVA 2R7WA 3V6DB 2JFDA 4FYDA 3CMQA 1FX2A 2OIHA 3IBCB 2V4JB 1U02A 1S72S 3MR7A 5KFRA 3RG6A 3CJTA 4TVAB 4USJC 4JUZA 2EBGA 4EBCA 1RT1B 1Y5IB 2Z2MA 1VQ9S 1C4AA 2CNOB 1S10A 1KVIA 1S79A 3LP2A 1ACMB 1N0UA 2V6AA 3ZTRA 3T6BA 4DL3A 4KBIA 5E33A 2MTLA 1SV5B 1J27A 3CF5Q 2H5EA 2J0QD 2OLWA 3TOQA 3W7BA 5F8IA 5D6GA 1TKZB 1YJNS 2CG4A 3LPEA 4JI7J 3D66A 4ITSA 2VPWB 4F50A 4C0OC 4I56A 2FHJD 2EK6A 2QLXA 4H4KA 4CH7A 3Q8YA 1TVRB 2DRDA 4PABA 4KQZA 2YKMB 2CQHA 4QR0A 2LA4A 5KFCA 2P9EA 1VRQC 3CULA 3PRDA 2M8HA 2APOA 2JWNA 3D4JA 1FA0A 4QJVA 1S5ZA 1EJ7L 3WZ0A 2W7AA 1IQZA 3R7NB 4NXMF 3CD5A 5HK4A 2YQ0A 2XLKA 3POTB 2BYCA 2NYHA 2HBYB 2ZD1A 3LA0A 2B4VA 1EB0A 3HFKA 2CQBA 1TL4A 2OEMA 3KDOA 4IH6A 1I51B 2LFVA 4RLEA 2AX1A 5D4OA 1BQXA 1NHKL 1NUEA 1T95A 3OW2R 2CQ4A 1FVSA 4CLZA 1ZETA 1JWWA 2MSTA 1XTZA 2ZVSA 2V8GA 2OGUA 1TL7B 1CLFA 2XNRA 5H9EK 1RA7A 2YPZA 3RJMB 3ICLA 2KU7A 3DLEA 4DSKA 2VBWA 4RKUC 1YBTA 2KKHA 3CMAS 1PJ6A 1RWOB 3R6LB 1RTJB 2F4VF 3JAMY 5LSRA 3D5MA 3CCUS 3R27A 1RUSA 2C3MA 2KVQE 4TQRA 4DV1J 4UOCA 2AYBA 2V9KA 4F2RA 2NXEA 1T05B 2P9GA 5ETMA 1X4CA 1RAOA 2C2EA 3BZQA 1EQMA 3O5TB 3BKUA 3CJ0A 1TUVA 1RB0A 4EBDA 3P5TL 2Z2LA 1T9VA 4CT8A 2OTLS 4NASA 5KFIA 2DY1A 1WI8A 2K1RA 1GMWA 1KQSR 1SJ1A 1QTMA 5EX3A 2JRSA 1KD1T 4MYUA 2WVCA 3DU6A 2WK4A 2IRYA 4ZLLA 2PC6A 1U1OA 2V4QA 4KY3A 4ZKAA 1FK9A 1JIHA 3OVAA 1H2UX 3K8WA 1UWBA 4JI8F 4NLGA 1U8WA 4DL4A 4LSNA 4YOEA 2C2RA 5AXLA 2IPOB 1C0TA 3MM9A 2JNJA 1SL0A 2JH3A 4ECYA 4NX9A 4RU9A 1SC4B 3CVKA 2LXFA 4DCOB 4HH0A 2XQCA 4WFBQ 1S0VA 1RWUA 2OEJA 2YNIA 1S1UA 4DV6F 1L3SA 1HMVA 4KFBA 2G1DA 2OJ3A 1U09A 3M2RA 3QT7A 4N47A 5HP1A 2D3O1 5I3PA 1RTDB 4P71A 1ZAXA 3MTJA 3TO8A 5JMNA 5D78A 3AOCA 5AXMA 1NNDA 2BMBA 4NZ6A 3OFHA 4I67A 4DI6A 2KZMA 3R5GA 3TUPA 3H90A 1C4CA 5A8RB 3PYFA 2ZUGA 4U7UK 2NYIA 2DD8S 1FTRA 3LP2B 4DL6A 2XSJA 2BDPA 4DSJA 5F8JA 2RRBA 2EKYA 2W8LA 3X3UA 3KKFA 4OI2A 4DSFA 4X66F 3TQ1A 4NYOA 3OPKA 1GX6A 4Q0BA 1TAUA 1RWXB 1S9GB 2CPIA 1TL1A 2R7OA 3GR0A 2W7PA 5B0DA 2MQ8A 2M2BA 2Z30B 1NPRA 1REGX 2Y8WA 2I5JB 2LLZA 4FVCA 2E1RA 3IR5B 3A1YG 4TNOA 4KV8A 1NH7A 3SFGA 2XMAA 4CLYA 4J9KA 1JLBA 2BUNA 3SYZA 2UUWA 3ZZRA 2CZVC 2XZWA 4FYVB 1PILA 4DR2J 2V8DA 4O3PA 1F2GA 1DQ9A 1H2TZ 3ZZTA 4C6AA 2ZD1B 2JOQA 2Z4PA 3LO3A 2GAHC 4F4ZA 1RWWB 1AYEA 1IQTA 1HNIA 4I69A 1HNXF 4IKAA 5FD1A 3BYPA 1VYAA 2CPYA 4N8NA 2WW8A 3OJUA 4X4RA 3OL9A 1FKPA 3TQEA 3K5LA 3ZNJ1 2YY3A 3QLHA 3ENQA 1YJVA 3PJ9A 4P73A 1SKWA 4Y6IA 4ETZA 4C11B 1FXLA 4XDDA 3NL0A 1RADB 4AXIA 4ZITA 2XMMA 1HBUA 2CG8A 4QYZK 2V8PA 2W2QP 4TLRA 3HM9A 4RX6A 1PAUB 2ZJQQ 2HBRB 4R0EA 1XR6A 3BQ2A 3G87A 1X4AA 3RAQA 4R8UA 3TUZC 1RAJA 3R97A 5E3CA 1XBWA 5IWAJ 1S0NA 4R5PA 2DHXA 2EW9A 3UN2A 2RAQA 2E1AA 3OR1A 3DDIA 1SC3B 2VJVA 2ZH8A 1LKZA 2X1GA 3WIUA 4RUAA 2ATLA 2EFOA 4JP8A 3J80U 2DR8A 1BD6A 4LBHA 3DU5A 1AFIA 3F56A 1FK9B 4ZVHA 2EI5A 1P1TA 5FLXY 3R5JB 3KG4A 4DQSA 5KFQA 3M2UB 3ZZ0A 4ECQA 4FXDA 2NZ4A 1SPBP 3DLGA 3CJKA 4NLTA 3PR5B 4LSNB 1H2VZ 5L46A 4M5DA 2XLIA 4B3RF 2WTFA 1C0TB 3MM9B 1SB6A 3R5CA 1RT6A 3EXYA 3CXCR 4B3TF 2WB1D 4TKTA 3BREA 1NSAA 4NI2A 5J2QA 4IDKB 9RUBA 1FJ7A 1S1UB 5THWA 4KFBB 4JBCA 5E3RA 2HQGA 2BKOA 3I0RA 3IBWA 4CH0S 2CDRB 1Y10A 5HP1B 4IR9A 4ZPWR 4I2QA 3EGZA 4WTOB 4K5SA 1RAEB 4RUHA 4ZPVR 2YQ3A 4OX9F 1XMOF 4QU7A 5DDOC 3M05A 2NXUA 2IY5B 5T14A 4DPXA 1DLOA 3OHBA 1RQ0A 3MMCB 2XSJB 2BZ2A 3PG9A 1T9WA 3IM9A 2GJIA 2FLPA 4Q0BB 2ZM6F 2PD1A 4C97A 1AUDA 1M5KC 5KFXA 1QE1A 3RAMA 1D9DA 3P8BB 2D41A 1HD0A 4ZCKA 2ZHBA 1FCAA 5HAOA 3UCZP 2YX4A 4DU8A 1ZPWX 5AT1B 4F2SA 1FVQA 2XMUA 4JV2A 2GIFA 4EMDA 1G7CB 1CULA 1U2FA 1UVKA 2B4OA 2B56A 3PNIA 1RU2A 2J5AA 3W62A 3ADAC 1IBMF 1ZAWA 2AEFA 1I1GA 5IXUA 3ILJA 3MM6A 4YEAA 1YZ7A 4G1IA 2GHPA 1URNA 4LT6A 2KN4A 2JHEA 2BM1A 2QRRA 2J9CA 2MKCA 4DF8A 2QGFB 1A9NB 1HNIB 3IR6B 2IM3A 3Q86A 2BANA 1SIWB 4OJ3A 4AL5A 2WOMA 1IKXA 1XK8A 2XLJA 1YI2S 4V19X 1ZS6A 4OHZA 5KT2A 2C2ZB 5D0RA 5C5JA 5D15A 3QLHB 2FZCB 4IQXA 4WE1A 5CYMB 3MECA 3D0HE 3AODA 1U25A 2ASDA 4O3RA 1DY3A 2CADA 5FLXU 2HBQB 1UEVA 1HBUB 5F0UA 4DV2J 3L9ZA 3LTOA 3HVTA 4MH8A 1P9QC 4WFXA 1EZZB 2HVZA 3CDBA 4B3OB 4CNYA 1FNXH 3MI7X 3E8OA 4R8UB 2R7SA 1HHSA 2DNOA 5A76A 1G1XA 4ZVEA 4R5PB 2HRUA 5G4DA 1RKJA 4Y34A 3T9NA 3OR1B 3SQOP 1FJEB 1IBKJ 4DL0C 1VQSA 4YHHJ 2IRUA 5IT9Y 5LT5A 2LU1A 1IXKA 3ZZYA 2ZH3A 2OSRA 1FD8A 2CXEA 3KJQB 1LFWA 3W9HA 3MEDB 2IIHA 1YJ7A 2WVEA 3DLGB 4H4OA 3CJKB 3CC4S 4FYWB 1YBAA 1KN6A 1WEXA 2E5GA 2A0FB 2QA2A 1RT6B 3T5JA 1LFPA 4FN5A 5HMZA 1PYTA 4MFBB 4JI4F 4F4XA 5J2QB 2UUAF 4DQPA 4WU2A 1OY6A 3MM8A 1ULRA 2XI3A 3I0RB 4KO0A 5KT4A 3KG1A 4M5KA 2A18A 4RWXA 2J9DA 4YFUA 4AQYF 1RU1A 3FVYA 3DXSX 3ITHB 2GGPA 4IR1A 1RI7A 2D74B 4YY3J 2NR0A 4GKKF 2JJ4D 1Q5VA 2HVDA 3UD5A 1SCJB 1JLFA 4OX7A 1G4CA 3IXQA 4J9QA 2H1YA 3CNQP 2DO4A 4WFNQ 2VBXA 4DUYJ 3HFZB 5HQ8A 1VQNS 3KNAA 3P96A 2GC8A 1JJ2R 2OEKA 5ETRA 3CE8A 1P6TA 4LF5J 1V3RA 4PXBA 3G86A 2XS2A 3PVXA 1WSVA 1SJRA 4ECTA 1CULB 1EETA 3Q8VA 3IO1A 2FJEB 2M7SA 4B3SF 5CCMA 1K8AT 3PIPQ 2JEIA 3PW2A 1XMQJ 1B64A 3D3CJ 2ZEJA 3DGPA 2JEJA 2OELA 2ABYA 3KXDA 1PYOB 2FVRA 2CDQA 1HI8A 1YKWA 4RW6A 3ZTSA 2WOMB 1IKXB 2EFPA 3PM9A 4UUXA 1PJ5A 1MLAA 2DR7A 3HSJA 1IKWA 2XHCA 3PX6A 1FJGJ 3MECB 2MQMA 2ZH6A 3DHXA 1VBYA 3EUNA 4NXNJ 4PEOA 3EYZA 2DGSA 1NSQA 1YRXA 4URQU 3H5UA 5K8NA 2YNHB 4F25A 5SUHA 2V4RA 2EC0A 2LXIA 2ZE2B 1Q8BA 2BJ1A 4LREA 4USVA 4NRUA 2KYZA 4J9SA 1QD1A 1I5OB 5J1PA 3MUMP 2YQ1A 1XJWB 2BW2A 1TP7A 2EXUA 2YH1A 3HF5A 2B0GA 3GYXB 1X4DA 3QAUA 1S59A 1JB0C 3A8IA 4OIXA 2I2YA 3MWBA 3UW1A 1ROFA 1K9MT 1S1XB 3CD6S 1O5JA 5B0BA 1B0PA 2ASJA 3KK1A 5KT7A 2WZ1A 4ERDA 2L9WA 3MCOA 1BQNB 1HWKA 1B7YB 4WKYA 2GQQA 1OY9A 4DR1F 5HMYA 1Q5YA 2GVZB 2XYHB 3NXZA 3A3OB 2MJUA 2Z58B 1T94A 4PKDB 3K17A 2QV6A 3QRQA 1NDCA 5CZXA 1LWEA 4NEZA 1B70B 4DL7A 3NCRA 4NA1A 4ZHRB 4QPTA 4JI6J 1S6UA 1I94J 1H38A 3B4MA 4CQ1A 2NS1B 4DV5F 4K5RA 5D0HA 4TY8B 2U2FA 3EGNA 3NWGA 1OMSA 2MKKA 1T11A 3OHAA 4KHPJ 2HWHA 1JKHA 5D3GB 3GILA 2H3EB 3HLUA 1PO6A 1KBRA 4K4VA 1TV6A 1U2RA 1Q4RA 1P27B 2HBZB 4LBIA 2Q3PA 3ENVA 3UQSA 2CRLA 5AE2A 4ZN1A 2LXUA 4Y2IA 4KB7A 2ZJPQ 1KR4A 1O6XA 2RILA 5DS7A 3KLHA 1NKBA 5E0OA 3NGRA 4AUKA 2RE1A 1CC7A 1Z1ZA 2MEWA 2QFIA 2IRXA 1HBNA 1RYRA 2EVZA 1WHVA 4WFYA 3TEHB 2E7WA 1LXNA 4OJ1A 1RHUB 3J81j 1BWEA 3A13A 2DNRA 3OFGA 4WBFA 4PQUA 3IR7B 3MCNA 4HVZA 3HVRA 4V19J 1Q8IA 2VU5A 1PCAA 2VG5B 3THTA 1SL2A 1EETB 1Y5LB 1VGYA 2XGQA 2W2OP 2KXFA 4OYXA 2GO9A 4F0HA 1RAFB 1EKRA 4C8OA 3I31A 3FEZA 5CYQA 3DGPB 1PSDA 2AP6A 4L74A 1P1LA 4G1PA 2KRBA 3PR4A 4NXMJ 3V6HA 3PJXA 1FJCA 3EDQB 3TJ9A 3MPYA 3Q8RB 2B9EA 3LAKA 4Y28C 3MEKA 4BBYA 3HJFA 2A1BA 1CQNA 2ZBCA 3P3DA 2IFXA 3VR1A 3KHLA 4QOTA 3KLVA 2EFQA 3GIIA 2XMWA 1M1HA 4DR5F 4IRKA 1R0CB 3PFOA 2AIRB 5E3PA 1N5QA 2RDJA 3FFIA 3AH6A 4K7QA 2V8VA 4J90A 4TU9A 3KUGA 2LCWA 2MKHA 4HH1A 8AT1B 2BA9A 3MHYA 1D9FA 3C16A 1AA1B 2R7QA 2F4VJ
chains in the Genus database with same CATH topology
3OUYB 4DBQA 3G6XA 2BVZA 4RU2A 2PE8A 5LL6d 1RT3A 3R5AA 2HLTA 1R0AA 1H0HB 1Q86T 4OHVA 2HGNA 1Q78A 4OJHA 2GV1A 4DFKA 4PWDA 2DIUA 3FMBA 2K3IA 4DL2A 5KFSA 5E3QA 1DTQB 1YJTA 3EXCX 1PGZA 1BC6A 3UI3A 4ZPAA 2L48A 3OTBA 4IFYA 3CMES 2CFXA 4G1QA 4G6VB 2AYMA 3CEDA 1TKZA 1HNZF 1MSWD 1Y0HA 3Q23A 2UVVA 1SI9A 4LF5F 3DI6B 3HXMA 3V81B 2VL1A 3HHLC 3JTNA 3NCPA 3PEJA 4DQRA 3S6EA 4PQAA 2F8MA 5KFNA 4YQWA 3O6QA 4CO5A 4ZHRA 2YWKA 3H5XA 1IBLF 2LMIA 3KHGA 2D1CA 3D2WA 3RZAA 1S76D 3J80Y 2DNMA 4L6V3 4EU0A 2ZZMA 3QGIA 1Q7YT 2E29A 4HI1A 2B7BB 3I82A 4XPCA 2AQ4A 4LF6F 4KJIA 3R3TA 4WK3A 2L9NA 2AU0A 1O0PA 1HBMB 2MKJA 4TY8A 3NNHA 2LA6A 2BQUA 3FRYA 2XY7A 4PG5A 4OZ5A 3DRRB 3GB0A 2VODA 1M5OC 1HQUA 4XPEA 2DGVA 2B5JA 3JSRA 2CJBA 5D3GA 4RW8B 1JLEA 5EGYA 1XMQF 2LVWA 4KSEB 4EUVA 4A8MP 5F9LA 3H4BA 3KJVB 5IM0B 4KIAA 4X4UA 4YDXA 2F3JA 1X0FA 3T9ZA 1GXUA 4ED5A 3DN9A 4MTPA 2GIQA 3ISNC 2VB6A 2GHVC 4ID8A 4QIFA 1QSYA 3RR8A 1LK7A 3IRWP 1L3UA 4MKBA 1VBXA 2IYGA 1KEKA 4QYZJ 2VC0A 2FTRA 2WCXA 2HFNA 1IN0A 5A6PA 3BSOA 1HARA 3TW0A 3DFEA 2KM8C 4D3GA 2KI2A 4FS1A 2DGXA 1TFWA 3MMJA 5GADU 4OZNA 3DYAA 3POTA 1M90T 3OSPA 4I6AA 1FRJA 5C42B 3IA0A 4NLWA 4F67A 3JSBA 2XB2D 3BGFA 1VHFA 3BB5A 2UV8G 3Q8SB 1X7VA 3M6XA 3RRHA 1U6ZA 1GH8A 4C8KA 2JC0A 3QJLA 3VAGA 1TK5A 3AQOA 2OPRB 3D0IE 3NBPA 1YITS 4PXDA 1R8BA 3UPFA 1S6PA 3TAPA 4O0IA 1TQLA 3M8PB 1KC8T 2GNKA 2KT5A 3Q22A 2RJZA 2P6SA 2XSFA 3TARA 2BJDA 2LEPA 5D77A 1FDAA 1HW9A 3N6NA 3I5AA 4QWEA 2PI5A 4NLYA 3TNVA 1TK0A 1S4FA 3V4MA 4GC6A 1FJGF 1JLAA 1TKTA 4RWWA 3MMBA 3AHPA 1XEZA 2PEHA 2HRYA 1QY7A 5IT0A 2HHUA 2KJVA 4NXNF 4OMFG 5DDRC 3PJWA 2W9AA 2YVSA 3CJ4A 1HYSB 2Q1LA 1HQEB 1S9EB 1TV6B 4ED1A 1FTCA 2PT0A 2SXLA 5GAEI 2E5LF 2ADBA 1QAYA 3MFHA 3NS5A 2CQ1A 1Q79A 4U7CA 4A47A 2GO8A 2M9KA 4UQGA 3T5LA 1I6JA 2HGMA 4Q44A 3Q8PB 3H98A 1UA1A 3NP5A 1WWHA 2VG5A 3FNNA 3SSQA 4ZCLA 2VPXB 1L3KA 3PO4A 2QA1A 4QYRA 3C3LA 1RTJA 1LV5A 2P6TA 4F8RA 2DRBA 3ZZPA 2Q6CA 1WHYA 3VAMA 3CJ2A 1KSPA 3BO3A 2KHDA 4OQJA 4OL8A 4RNOA 1LWCA 2DITA 4JOUA 3E01B 3GSDA 1UP1A 1IM4A 5J2NA 3LH2S 5T7LA 2IM0A 1R8CA 2AW0A 1S1VA 2IBOA 4NLDA 3MDFA 3ETOA 1HBNB 4B9TA 1UEUA 2IAJA 4FBTA 1N5TA 2HAIA 2MKSA 2IMOA 4KC5A 5F41A 2KJWA 3IWNC 3G6YA 2HFOA 1TAQA 3NGKA 4HI2A 3BEGB 3CB4A 4OZ0A 1BY9A 2UVWA 3O1LA 4I6WA 2O01C 2VFRA 2ZH1A 4L72B 5KFYA 1M5PC 4CO2A 1JLGA 1YG0A 2QYCA 3TVYA 2E66A 5A8KA 2HQIA 3OR2B 3O2IA 1G3OA 5L9NA 2VH7A 2VZ9A 3W2WA 4PUOB 3Q2TC 2FVSA 4A46A 1HWLA 3ONQA 2WONA 1GXTA 3QIPA 4PQUB 4J9RA 5EN1A 1IKYA 2YWHA 2VPZB 2KT2A 2OPPA 1Y3JA 3PKYA 3HPOA 3M30B 4OHXA 3DLEB 2AJQA 2IHR1 1UAWA 2XI2A 4MIAA 2UUBF 4JI5F 3G8SA 2EPIA 3QGHA 4ZCMA 4ILLA 1TL3A 2B7CB 4I0WA 4P7VA 5A0YA 1XR5A 5F8GA 4JV0A 1KLMB 2V0NA 3GR1A 2YNFA 3L7PA 1JXLA 4NCBA 2HQ3A 2R8KA 5GADI 2RMLA 1FKAF 1VMBA 3V6JA 4ED8A 4D3HA 3G71S 3RYLA 1K0VA 4JV5F 4NLUA 2W24A 4NLOA 1NHUA 3VF0B 2QZ8A 4K59A 4QCLA 1APSA 3D0GE 3KNGA 5LXRA 3CCRS 2L3MA 1KOHA 2DCLA 2CYYA 2MMYA 5DQHA 3HKZD 2BACA 4Q8FA 2N3LA 2VKZG 3R1HA 1AW0A 1FE0A 2MY8A 3UNGC 2ZNYA 4Z37A 2MKIA 3FDSA 2VKRA 3C6TA 3I96A 5I42B 4ECZA 5C24A 2RKIB 3CDEA 3LP0A 2YKNA 3DOMA 2VA2A 1R27B 3C6UA 1SL1A 1S1WA 2C3OA 4IO9Q 1AFJA 4JI6F 2QEXS 1T8EA 2NSCA 4PG4A 1I94F 5HBMB 4O3SA 3GE9A 3UR0A 3M9OB 5DM7Q 2HHSA 3VALA 1UA0A 1D0EA 3RB3A 1IR0A 4H54A 3A8EA 3OBIA 2QMXA 2VG6B 3AY0A 2ZNZA 1VQOS 1FRIA 1MMNA 4YMEA 1DBDA 3OTDA 1NK9A 2FJXA 1E6VB 1U45A 1K73T 1Z2LA 4UY8T 3DOLB 3DMJB 2M70A 1DTTA 2MPUA 4O44A 4DR6F 2KXNB 1H7WA 3RB6A 3BGUA 2O67A 1Y3KA 4KHPF 2K1RB 4PPDA 3K5NA 2B51A 2DNLA 5LJ3Y 3LUYA 1S1TB 2DH8A 1NK8A 1ZYQA 2OPQB 4HL9A 4R0JA 3T3FA 1YJRA 1KLNA 4GO5X 5KFAA 2R7WA 2XCPA 2XGPA 1N6QA 4PG6A 3V6DB 2JFDA 3DDNA 4FYDA 5AE1A 1AROP 1FRHA 1D9AA 4X4PA 2OIHA 3MURP 3PV8A 4K4XA 2AD9A 3RRGA 4DSLA 3HHLD 1R31A 2DGTA 4NCAA 5L1IA 3GYNA 3V81A 3FFIB 4N41A 4U67Q 3JSYA 2V4JB 5F3ZA 3I56S 4FPRA 4DR4F 2DNZA 2LYVA 5L9XA 5K8MA 1S72S 3HI9A 4A8XA 3HHEA 1S9FA 3EPIA 5KFRA 1UWBB 2XWXA 4BWMA 2UVRA 3PKMA 3TI0A 4C4WA 3UD3P 1CC8A 1UVNA 2VQFF 3DM2A 1ZZFA 4DSEA 1YJ9S 2KZZA 4USJC 4JUZA 2BQRA 2EBGA 2J6UA 4KTQA 1F5CA 1RT7B 4PPZA 1S6QA 3JSMB 2MGZB 2RQMA 4EBCA 2AWZA 4X84A 1KQGB 2D3UA 1RT1B 1Y5IB 1B0VA 2Z2MA 3OFFA 1C4AA 1VQ9S 4F3QA 2HVHA 4B9VA 2ZH5A 1S10A 1T03B 1KVIA 3B8HA 1S79A 1U47A 1TKXA 2DRAA 3LP2A 3LGMA 4CTAA 3MAQA 3FSYA 1N5YA 2LKZA 3I9V9 5H9FJ 2F1FA 1N0UA 1RT3B 1R0AB 3T6BA 4DL3A 4FF4A 4KBIA 1X4GA 3BN4A 5E33A 3KJVA 2YNIB 1SV5B 1QVFR 2Z0GA 3BR9A 3ISND 3G4SS 3CF5Q 3V6KA 2H5EA 1QUPA 1HMVB 2OLWA 3TOQA 2CQGA 3U1LA 1NH8A 3W7BA 2J0QD 4IFYB 4ICLA 2WBRA 1FNMA 1SH2A 5F8IA 5D6GA 3OLBA 5DG7A 4F4KA 4G1QB 4Y65A 1TKZB 3M2RB 1YJNS 4ECSA 2CG4A 1QM9A 1XC9A 3CJ5A 4TQSA 4AYBD 2X1BA 5BYSA 4ITSA 2VPWB 4OX8A 2D7SA 3KFWX 5KG2A 4F50A 3RBDA 4FF1A 4C0OC 1N33F 4I56A 4LF7F 5F8NA 3OXFA 1FF2A 2EK6A 2FHJD 3Q8QB 5C25A 5U47A 5A2QY 2QLXA 1KOOA 2DISA 2YX7A 3AB2B 2EBEA 3OTEA 4H4KA 4NA2A 4CH7A 2Y1RI 1TVRB 5KFPA 2IJNA 3H25A 4NYPA 2ZDPA 4ELUA 2B3TB 4NPOA 2GFFA 3M8PA 4KQZA 5B0GA 2YKMB 3PO5A 3B4DA 3KHHA 2Q6BA 1R3NA 2CQHA 4MKYA 4FNHA 4QR0A 5AE3A 3I5CA 2RQCA 4HTJA 5KG5A 2LA4A 2NUHA 2LEBA 2R7UA 2QIFA 2JDJA 3GFXA 1D1UA 5KFCA 3NMRA 2B5JB 4PG8A 4UY85 2R4FA 1Q7LB 2VFTA 2P9EA 1YVFA 4KR0B 3CULA 3PRDA 2M8HA 4LJMA 4YB7A 3FSIA 2APOA 2DHGA 2JWNA 4CZCA 1R8PA 1FA0A 4QJVA 1K1QA 2LEAA 3DOKA 1S9EA 1SC6A 2YKQA 4A8KA 5T41A 2JL9A 1GXLA 3WZ0A 2W7AA 1IQZA 4TU7A 1HNVB 3HHLA 4LVOP 4HDHA 3N5BA 2XC9A 2QO3A 5IZHA 4NXMF 2KT3A 3CD5A 2DB1A 4IQMA 1SH3A 2E5HA 3DYAB 2XLKA 3POTB 3NRBA 2BYCA 2JFKA 2VBZA 3FZ2A 1ZZNA 1N54B 1SKRA 4DLGA 2ZD1A 3LGNA 2B4VA 3HFKA 2MZSA 1TL1B 2CQBA 5KFLA 3H4DA 2FDNA 4ED0A 3D1HA 1TL4A 4DHVA 4DMZA 5CHCB 3DCAA 4PWUA 5F3TA 5CH7B 1XN9A 4IH6A 1S6PB 2CPEA 3E3XA 4QIVA 2QE5A 2OFHX 4ZS6A 4RLEA 4IH5A 3M6VA 2AX1A 3UR3C 1WTBA 5D4OA 3CCSS 1BQXA 4DR3F 1L3TA 1RJJA 1T95A 1OS5A 1SXLA 4NMLA 1X9WA 3OW2R 3ZZZA 1QJHA 2CQ4A 5BYQA 3TX8A 1FVSA 3R1LA 4IOCQ 3MMBB 3U27A 2LECA 1J5OA 2M4MA 1UJ4A 3BM7A 1ZETA 4F4WA 2DNHA 4KV8B 1JWWA 2W9CB 4EGLA 3EX7B 3CT9A 2MSTA 2QMWA 5L38A 2XY6A 4J5OA 1XTZA 3MD1A 2ZVSA 2V8GA 2FUG9 2OO4A 4N56A 2WAQD 3US5A 1CLFA 2XNRA 1JLBB 4PUOA 1DHMA 4P2SA 2Y1JA 2EG1A 1RA7A 2OMLA 4ECRA 2JVOA 1QSLA 2MHEA 2VG7A 4I2PA 4RBUA 2FY1A 3ICLA 2PMZD 3OXLA 4EWTA 1SBRA 3M30A 2HHPA 1Q53A 2KU7A 3DLEA 4DSKA 2VBWA 4OI0A 2XMKA 4AXJA 1SJFA 2P5VA 2FHJA 4RKUC 4K4UA 2KKHA 2FIUA 2V5HG 1B7FA 3CMAS 3DLHA 1XMBA 5H1SV 2O5DA 3HVAA 3GV7B 1RTJB 1T3NA 2HYIB 4DN0A 2F4VF 3KOAA 5K8PA 3IN5A 4ILMA 2X1FA 4PXCA 3JAMY 3I32A 5LSRA 3D5MA 1KHWA 1NO8A 3CCUS 2Y0SD 3R27A 5J2NB 4HTIA 2DGUA 2J0WA 1BGXT 5HI7A 2NREA 2C3MA 4DFMA 1S1VB 3CCTA 4TQRA 4EYIB 4UOCA 2LDYA 1Q1KA 1REVB 2QLWA 2AYBA 2V9KA 4F2RA 2HNDA 1Q16B 5F8MA 1SJ4P 1T05B 5I42A 2P9GA 1X4CA 3N4WA 1UVMA 5DDPC 3BZQA 3N6LA 2C2EA 3O5TB 5KFBA 1FKPB 3PW0A 1OIAA 1WG1A 4JI3F 2FHOB 3SEOA 1JLGB 3CJ0A 2ZKUA 1TUVA 2ZC4A 4EBDA 3P5TL 2Z2LA 3NAIA 2MZQA 4CT8A 3LP1A 1IKYB 2OTLS 2FC9A 1T7PA 2MQLA 2OPPB 2R8GA 5EUHA 3BGRB 5EHHA 2HGLA 6FD1A 1E6VA 3TANA 5KFIA 1WI8A 3DOLA 3DMJA 1JX4A 3V4IA 3DRPA 2EG2A 4BC9A 2OFGX 2YX1A 6FDRA 3AA8A 2V9WA 3GWCA 2K1RA 2VOPA 1KQSR 2YNFB 4ZOSA 4OLPA 2E5IA 3MFIA 1SJ1A 1S1TA 1QTMA 2OPQA 2M3DA 3FSXA 4ZK7M 2DVIA 2KB2A 5EX3A 3AJ2A 3KLGA 2JRSA 3MEEA 1KD1T 4MYUA 2MJNA 2DK2A 5D4LA 2PA8D 3TRGA 3DU6A 2WK4A 2ZHOA 3O3LA 1R8HA 4IH7A 4U6PA 2C2DA 1N32F 4E8UA 3BGLA 2DH7A 2IRYA 3HZEA 4IFVA 4ECUA 1WEYA 2YWEA 2C42A 3S8SA 2PC6A 1U1OA 1J2VA 1R7IA 3J81Y 5KFWA 2V4QA 1F9FA 3BJYA 2GMHA 4ZKAA 1FK9A 3C6TB 2HW3A 1JIHA 4PCQA 3OVAA 4GKJF 1DFDA 1QAIA 5FDLB 4J9PA 4R25A 4NYZA 3C6UB 4BHQA 3U02A 2ACYA 1S1WB 1H2UX 3GMGA 1FDNA 2CQ0A 4MK8A 4E98A 3K8WA 1UWBA 4JI8F 4NLGA 2L08A 1U4BA 4DL4A 4LSNA 4YOEA 3QJJA 2BRLA 2C2RA 3DNCA 3GG1A 5AXLA 2G9OA 2KRRA 1C0TA 3MM9A 5F8LA 4C8ZA 3H59A 3SI8A 1SL0A 1U7LA 2JH3A 5HN0A 4ECYA 4NX9A 2O3DA 1HWIA 4RU9A 2HWTA 4H4MB 3DXBA 1DTTB 1N88A 4O44B 3CVKA 5KFHA 1VK3A 2LXFA 3MUTP 4DR7F 3C2PA 4HH0A 3K2YA 5DLFA 4WFBQ 2MZ1A 1GTHA 2MHNA 3SV4A 1S0VA 2KVIA 1RWUA 2XEXA 2YNIA 1S1UA 1SV5A 4XIUA 1TFYA 4LMZA 4DV6F 1L3SA 1S48A 4K50A 1UVJA 1HMVA 3H2UB 4KFBA 1N6QB 2OP5A 2G1DA