4JI5F

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
b'MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 21
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ji5F00
1N36F 4B3SF 4NXNF 4GKKF 1GH8A 4LFAF 2ZM6F 2J5AA 2BXJA 4LF7F 4OX9F 4JI7F 4K0KF 2HHHF 2UUBF 4X64F 1IBKF 4DV0F 4DR4F 4DR6F 1FJGF 4LFCF 4DV1F 4DUYF 4DV2F 1HR0F 4DR7F 4NXMF 3T1HF 1G7CB 4DR2F 1B64A 1IBLF 4X65F 4LF9F 4AQYF 4LF4F 1XMQF 4DV7F 1FKAF 2BVZA 1HNZF 2YY3A 1XNRF 3R3TA 1XMOF 4YHHF 1G1XA 4JI6F 1HNXF 2KJVA 2B7BB 2E5LF 1I94F 1IJEB 4JI0F 2UUAF 4LF6F 4B3TF 4JI5F 4LF5F 4B3RF 2VQEF 2KJWA 4JV5F 4JI3F 2VQFF 4JI1F 5LMUF 2RJZA 4DV3F 1IJFB 4DV5F 1HNWF 4JI4F 3ZZPA 2B7CB 5BR8F 4LFBF 1QJHA 1N32F 1CQNA 3OTOF 4JI2F 1IBMF 4DV4F 2F4VF 1J5EF 2UXCF 4B3MF 4X62F 1VMBA 4JI8F 4YY3F 1N34F 1XNQF 4KHPF 5AJ3F 4GKJF 1LOUA 2UXBF 4DR3F 4DV6F 5IWAF 4DR5F 1F60B 5LMNF 4DR1F 4X66F 4JYAF 2UUCF 2UU9F 1CQMA 1RISA 3T1YF 1N33F 2UXDF 4LF8F 4DUZF
chains in the Genus database with same CATH superfamily
1PBAA 3HT0A 2IM0A 2CQDA 3RR7A 2QC3A 4PXEA 4B08A 3LAKA 3D0GE 2BANA 1UWAA 3VGSA 3RB6A 2XMAA 2DJWA 4CNZA 1TUWA 1HNZF 1QAYA 4K4TA 3ZC4A 2W01A 3W1YC 1WHYA 2D3UA 1CULB 2RKIB 2I5JA 4HDGA 1A7GE 4G1IA 4O0NA 1VQLS 5CHCB 5EX0A 2BW2A 4FNHA 4ECZA 3KJNB 1I5OB 4K5SA 2H3EB 1WORA 2P9CA 2ZZNA 4OJHA 2A1BA 2A0FB 3BREA 3B82A 1DURA 4Y2CA 4F25A 1V9OA 3NOCA 1D9DA 4OYIA 3CCZA 3W7BA 5B08A 2KZZA 1N88A 1R8CA 1OSDA 1HQEA 1NHVA 2Y1RI 4F26A 3W9JA 2L9NA 2L48A 2ZWOA 1M5PC 4KFBB 2YWWA 2WHOA 2QA1A 2XYGB 2MKHA 1HMVA 1KLMA 4CLYA 2P9GA 2E5GA 2ADCA 2EXUA 1T03A 2J5AA 1FNOA 4C3MA 3G96A 3DLBA 4OV6A 4DV0F 2MJUA 4ZVPB 3D7SB 1RWPB 4KGMA 1JX4A 4KHRA 2XS5A 4ZPVR 3W3SA 4CO2A 1M90T 2JEJA 4PXDA 4RW8B 1YLXA 1SI9A 3LP2B 1KRPA 2XMMA 1WF0A 3DM2B 3BJYA 1QAJA 4O3RA 4JV5F 2XMKA 2CJAA 4DPOA 4JI4F 4K4YA 4USWA 3UD4P 5GAHU 2IHR1 1T94A 3IWXA 3BH6B 3MEEA 5F8IA 2I1RA 2RE1A 5KOXA 2CQ2A 2VH7A 3JQKA 2HFNA 2B8QA 3O44A 3HT3A 5FDLA 4AL6A 3BQ2A 4DR1F 2ZZMA 1QUVA 2B6AA 1HBUA 1J2VA 3KJVA 5EHHA 1TKTB 1S1XA 4LFCJ 5DM7Q 2CPZA 2R8HA 2NUUG 2CZ9A 3BKFA 4ZPTR 5F0WA 2C22A 5B09A 2EVZA 2DNOA 4RUHA 2YH0A 2KN4A 3BQ1A 2VDHA 2D3O1 3TANA 3CULA 4RU9A 5DGAA 1QUPA 4B3OA 4A4JA 2CRLA 1N52B 5K8PA 3SCLE 4RBVA 4WFNQ 3M2VB 4DL4A 3MZIA 2XSJB 5AE3A 1U1KA 4YFUA 3QJJA 4NMXA 2GW8A 4AT1B 3V6HA 4X62F 3NMAA 2YWHA 1RAIB 4ZHRB 3OXFA 2C2DA 1U7LA 1KSPA 1PC4A 4DJBA 4GO7X 4X65J 2KFYA 2EK6A 2WSEC 2WZ1A 2DVIA 3MMBB 3GIMA 1UTAA 3M2RA 3DLHA 2CUYA 3T1AA 2DRAA 2NXUA 2WBMA 4GVLA 1QDUB 3THPA 1CULA 2RKIA 2NXJA 1G7CB 2DY1A 2KI2A 2JEGA 2ZD1B 4XIUA 1X5PA 2R2RA 5GVQA 3HSGA 3MGJA 2VQEJ 2EFVA 4LUBA 1Q4RA 3BPSP 3K5MA 5A6WA 2UVWA 4WZMA 2ABYA 2AZ1A 5E3CA 4C2MA 2M88A 4HTJA 1IBMJ 4G3IA 1IKVB 3PYEA 2AF6A 1HNWF 3HSZA 3G71S 2ZFHA 4KFBA 4LBIA 4IRDA 4K4ZA 4N56A 2YVSA 1RKJA 3EPIA 4M5LA 5HMZA 3PHEA 2HVEA 2APOA 5L9XA 1R0BG 4LQ9A 4LF8J 1P9QC 4IRKA 2CAJA 1SPBP 4ZPWR 3SFGA 2O3DA 1DHMA 2LU2A 3Q23A 3ETOA 1P6TA 4ES1A 5A8WB 3LGNA 4LF7J 1OY6A 4LF2A 2MLZA 3MM8B 3SMZA 5FLXY 1QSYA 1S1UA 2AGPA 3DM2A 4AQYJ 3P96A 4AE5A 2DRDA 4WP3A 2MKCA 4ED2A 2BW7A 3H90A 1U1RA 2QMWA 1JJ4A 3RBEA 3DGVA 2CG8A 4MH8A 4WP9A 4J37A 1SKRA 4NLSA 4NLYA 3KLEB 2FVSA 1B7FA 3CE8A 1Z4UA 5J2QB 2FLNA 3OJSA 3BBFA 2VOOA 2J9CA 2QV6A 4JUZA 3M2UA 1VIOA 4ZP9A 4ECWA 7FDRA 3OFFA 2B9YA 1GXTA 4CO5A 1TL4A 4IFYA 2ZC4A 2W8LA 2MGZA 4R5PB 1YZ6A 1SQFA 4O3OA 3PTWA 1TR0A 5D15A 3NBPB 4JYAJ 3GLJA 1W25A 1B0VA 4N8OA 2ASLA 4XK8C 2VF3A 3LGHA 3QO9B 2AU0A 2UXDF 3J7AN 4LBHA 4IOCQ 1U0SA 1I1GA 2W2PP 2KKHA 3ZTPA 4OHXA 1S99A 1R8AA 3RRKA 4NXMJ 1NSQA 4ANEA 2BOAA 2F8MA 2NCKL 5CD4A 3U1MA 5KTQA 1NK5A 2ZH7A 2ASYA 2CNNB 3GZ7A 4X4PA 1LK7A 1V5VA 1C1BA 1V6HA 5DLFA 2DNLA 4F4YA 2BJ8A 4U8VA 1MW7A 1ROFA 4MYTA 3SIPB 3H25A 4C48A 3V5RA 3DMJA 1HBNB 1NJYA 2L9DA 2RS8A 2XGQA 4KC5A 3PW7A 2YH1A 3MEDB 1MU2B 4LR8A 1Q79A 2LDIA 1BUXA 2DPJA 4IQMA 2UVVA 5E3PA 4C97A 3MF5A 3RB0A 2DR6A 4OX8A 4UY85 3FBFA 1KWMA 2M9KA 3CJKB 5C24B 1OYEA 3K2YA 4F4KA 3BGOP 2KH9A 1RLDA 5LMNF 1XTZA 5B0BA 4IDKA 3TA2A 4LQ3A 4UQTA 2DH9A 1WKKA 3HVAA 2W2NP 2D74B 4X64J 1Y5IB 3LP1B 5I4MA 4ANCA 3ITHB 1GMWD 2V0NA 1MMLA 1SV5A 2J7UA 4LRBA 1RYSA 3QT8A 3CDEA 2E7WA 4GRSA 2M2BA 3QBCA 3VHQA 4BWJA 3VGVA 3DRSB 1X4DA 4JI5F 3QSIA 5KFNA 4DR3J 1HWJA 1UA0A 1ZA1B 2W9CB 3OTOJ 4DFPA 3NS6A 3F0NA 2CPYA 2CIMA 1QAXA 2OO4A 1X9MA 2AKWB 4MYUA 3VCDA 1RXOB 2GX8A 3H8YA 3MCSA 5EWFA 1LWCB 5A8WA 4X84A 2YNHB 5D3GB 1RACB 2OPSB 3MM8A 1U1OA 2CVIA 1BLUA 1KC8T 3T1YJ 3RRGA 4X66F 1M5OC 4P6QA 3J80U 1FNMA 3AD8C 3UN3A 5I42A 2QGFB 4X4OA 2B0GA 1OQ6A 4W92B 1EKRA 3PCOB 5JUMA 4ID8A 3IN5A 2CNOB 2M8HA 1S10A 4WE1B 4RNOA 3IRXA 2Z0GA 1XJWB 2LQBA 4HR2A 4R5PA 1U1LA 1QE1B 3NBPA 3SCIE 5L1KA 4DV4J 3GSIA 1M1GA 4YDXA 1S0NA 4K59A 3TOQA 3CMQA 3N6MA 1Q8IA 2CG4A 4RWXA 1JLEB 3QO9A 5KT6A 5FJ4A 4UZBA 1FRXA 5AT1B 2QZ8A 4M1KA 3ETMA 3TRGA 4KGKA 3IRWP 4DV6F 3QGGA 3M32B 4NLTA 4C6AA 2VPZB 2V8GA 1UEKA 2MHEA 4M5JA 2UUTA 2WAQD 4A8KA 4DMZA 2HHWA 5HLFB 2F7VA 4IYQA 1QAIA 2KZMA 1Q86T 2OMOA 2HIYA 1WOOA 3OSPA 5DG9A 5D4PA 4I56A 2M52A 4MTPA 3AA9A 1HBNA 5JVHQ 2CJBA 2VASA 5HO4A 5L1IA 3MEDA 1MU2A 2HHVA 2V9KA 4P2SA 3R2DJ 4LJMA 2XCPA 1T9XA 4Q7AA 2Z57B 2P2CB 4L3NA 5HN0A 4IO1A 4C8LA 1PJ7A 2M3DA 1NKCA 1MROB 3CJKA 4Y2MA 4RPFA 1PYSB 5C24A 5HQMA 2PEHA 2E1MC 3GTYX 4I6WA 2J7WA 2CADA 3AXMA 4KYZA 5F8HA 4B17A 1QSLA 1CJKA 3LP1A 5JMNA 3GYXB 4I2QB 3OXLA 3ITHA 3OFHA 1LWXA 3CF5Q 2B4OA 4CM0A 4N5SA 1E6VA 4PG8A 3I0RB 2DB1A 4ZPAA 2MEWA 3D2WA 1IM6A 3MAQA 4B3SF 2VPXB 3EICA 1RU1A 3IFEA 1SJ3P 2KB2A 1X4EA 2WTFA 1YDLA 3DRSA 4KT0C 2BKPA 4DV1F 3J7YI 1S1WA 2DGTA 1N6QB 3CMES 4AXIA 1L5UA 2H9ZA 1XMQF 2Y0SD 2GQ2A 3M8SA 5H1SV 2VC0A 5B0AA 2E44A 4U96A 1R6VA 1CJVB 2AX0A 2VBWA 4RNMA 3ZZTA 4LF5F 2KTQA 3TUJC 1WHVA 5D3GA 2OPSA 5KAKA 1YRUA 2IMOA 3HZEA 4PYDA 2Y1LB 4Q2LA 4K50A 3C14B 2V8PA 1MSWD 4JI2F 1TKZB 1FFSB 5A8KB 2XG8A 3POTB 3JAMU 1NSPA 5C25B 4F7VA 4RX6A 1ZZNA 3SZ2A 3KYLA 2F4FA 1YJRA 3D0HE 4U95A 4IOAQ 1KVKA 2K8GA 2X3DA 2DNHA 2D9PA 2KL8A 3CIZA 2VODA 3KDNA 4GKKF 4ZLPA 2MQQA 4WE1A 1FRHA 4DQPA 5F8JA 2VQFJ 1ZTTA 4I6AA 2WW8A 4X4SA 1NDCA 2MQNA 2IM3A 4PZVA 4U7UD 4FYVB 4PUOB 3FJ2A 1QE1A 4LF9F 2E9TA 2ATLA 1FKAF 2HQIA 2GV1A 2D9OA 2QL9B 3Q8SB 4NZ6A 1GQEA 1EAYC 1JLEA 2D69A 5ETLA 3HD2A 1R43A 1O6XA 2HQ3A 1PJ5A 2ZBCA 1N5YA 1JLGB 1HI0P 1IQZA 1W7WA 5HLFA 5DQGA 5A76A 2IDEA 3TX0A 5KT4A 4A8XA 1FD8A 3I6PA 3LA0A 1RHQB 4R0EA 4IG3B 2UU9J 1VK3A 1LWEB 1S6UA 1YSJA 1VHFA 3VAKA 1X5SA 3U1LA 2KRBA 4QIEA 4OX9J 2JVOA 2O67A 3GV7B 2NREA 1BWEA 4DPWA 1LW2B 3FSXA 4C98A 1DAXA 2D1CA 2HZAA 3PX6A 4U7CA 2EKYA 4ZITA 4WXWA 3W9HA 2XLIA 2QRRA 1MROA 3CD5A 3N5FA 3Q8UA 3AAWB 3QIPA 1PC5A 2VFUA 3MR7A 4N7TA 4OJ1A 1YJ7A 5IV3A 3S6EA 3GSDA 4P2MA 1VQMS 1S6OA 3M7VA 2NXNA 2MQLA 2C1EB 2B3TB 3UNYA 4I2QA 4DF8A 4IKAA 4PQUA 4XPEA 3I0RA 1XK8A 4P75A 4C7QA 3W63A 4ZN1A 4J9SA 1N34F 1URNA 4BDPA 3EPGA 2RRAA 3OTBA 5E5NA 4CIOA 4HYKA 1UW4A 2IRUA 4C9DA 2OPQB 3FFIA 3JS9A 3DDKA 1NPPA 3K58A 1XR5A 2NPFA 3J7Z5 4DUYJ 2GGPB 3P45B 1CPZA 4TKTA 1HR0J 2V2QA 3B4MA 1CJVA 2ZBPA 2RU9A 2CDQA 2F63A 2GIRA 3QATA 1YBTA 5CA5A 3NGUA 5K9FA 3FMBA 2EG2A 3OR1A 4JI6J 1H2VZ 1I94J 1KS2A 4E98A 2ZWPA 1Q5VA 2QLWA 3BSAA 3C14A 3KK2B 3JSMB 1G1XA 1TV6B 1D3WA 1TKZA 8ATCB 1YJTA 4FPIA 2QSFA 2Q79A 3M8QA 2BYCA 5EN1A 2MTLA 5M2PA 1P8GA 4RUAA 2FY8A 1YK9A 1HARA 1U8WA 2QYGA 3CJRA 2XQCA 4USHA 2VONA 3V81A 4IR1A 3IXQA 4DX5A 2WVBA 2XI3A 2WB4A 1WC5A 3UDLA 1FD2A 2JEIA 1WEXA 3FEXB 4DBQA 4ZIVA 4KH1B 4DZ6A 4PUOA 3F73A 3GYGA 4HI1A 4ICLA 4J91A 3S7RA 1SL0A 2NSBA 4C8NA 1NH7A 3LH2S 3GFYA 3M8PB 1RT5B 1SJFA 4DR4F 3G6ES 5ETVA 3BS9A 3GPAA 5F8MA 3G6YA 4FYDA 3OUYB 1Q7YT 3LQVA 9ATCB 3OJUA 3MM7A 1S1VB 3IG1A 4PWUA 2V2ZA 2ZBQA 1FK9B 2UUAF 4RZRA 3PY8A 4CP5A 2RRNA 5BYSA 4ED3A 2J76E 1HL6A 2RILA 4ECXA 2WVDA 4JI1F 3VF0B 2RQKA 1KN6A 2QLJB 3KOAA 2BE2B 1LWEA 1JJHA 3HZGA 4OI3A 1YG0A 3IM8A 4L76A 3ZTQA 1J5EF 2BX6A 1VQNS 1C4AA 2VG5B 4P71A 1RT4B 3HVWA 1BE4A 4ZJOA 3DLJA 1LW2A 2AEJA 1U4BA 4QIVA 4URSA 3PKYA 1M1HA 2MHNA 2E5IA 3KNAA 4OI1A 5KFVA 4DFJA 3OTCA 2EBGA 4KE5A 5L38A 4QW9A 3PFOA 3FBBA 4M5DB 2DR8A 1U25A 2AJ2A 4F67A 2J0SD 1OQ3A 3RU0A 4DV2F 3CUNA 4OZNA 3PG9A 2E5LJ 1SC1B 3UDVA 3N01A 4I69A 5HANA 4B9LA 4P10A 2DNMA 4ES3A 4JI3J 2ZH5A 2R42A 4AXJA 1SC6A 1BGXT 1ZAWA 4OYPA 5KFXA 2ZJPQ 3UR3C 1EKSA 3TAPA 1JKHA 1IJFB 1DFDA 2AHOB 1HD0A 4ZVTB 3KLGB 2Z30B 2OPQA 4ZCKA 5C7PA 3X3UA 1S48A 3NGSA 1RHUB 5CYMA 3Q8PB 4EZ6A 3N4WA 2AJQA 2W7PA 2Q3PA 4OMFG 5KG5A 1CJTB 5IFMA 3QGHA 1RDRA 1WC0A 3AD9C 2XEXA 2Z4PA 2ZNZA 4I2PB 1JNZB 1WKJA 4O3QA 2R2UA 1N36F 3UCGA 4RU2A 1ZOTA 3AA8A 1K0TA 3KK3B 3JSMA 1TKXB 2HVDA 2BJDA 2V2VA 2VFVA 1PGZA 1N0VC 3TW0A 2DHHA 5HSPA 1U6ZA 2GO8A 1NK6A 5D6GA 2XMVA 2Z2ZA 4TVAB 1SJ4P 4DQSA 1S57A 4EO6A 2IBKA 3DU5A 4PWWA 4GO5X 3UN2A 4LF6F 2MZTA 3I55S 1WEYA 2VBXA 3TJAA 2CQCA 2KXNB 2J9EA 3LP0A 4CH0S 3I0SB 2B7CB 1NB2A 4LFBF 3CJ4A 1UJ6A 4YN3B 4FPRA 1TL3A 2V8DA 2PD1A 4CYUB 1UWBB 2DO0A 2G2YA 1S49A 3K8VA 2R7SA 3X1LB 2HKEA 1S77D 3M8PA 1RT5A 1FF2A 5B0GA 1PBUA 1AFIA 4CDIA 3PYGA 5C5JA 1MLAA 2HBRB 2MPUA 3FRYA 1NLKL 3OUYA 2AW0A 3V6KA 3PDNA 1S1VA 3NGDA 4L3KA 1TTHB 3EX7B 2Y3YA 1DTQB 1UCNA 1WUUA 1X8DA 1B64A 4P7TA 5A6PA 3E01B 1P27B 3TI0A 3D67A 4NRTA 4ZCIA 4F8RA 4ECRA 1TMMA 1CS4A 4ZVUB 4C0OC 2O66A 1TMJA 4GC7A 1S1TA 1NM2A 5F3ZA 1KQGB 1U1MA 4AUKA 2ZVSA 1VIXA 3Q8RB 3RYLA 4ZLLA 2DGVA 4FVCA 3THTA 1H2UX 5A0YB 2DGUA 2RMLA 4OYAA 3G6XA 2DGWA 2IM2A 5L9NA 5J2PB 3EGNA 3H5SA 4K4WA 4D3GA 2HBYB 3M9MB 2YNIB 2MZSA 4PG7A 4M5DA 2HFZA 5KFJA 2M8DB 1FHTA 3LOUA 1SJQA 3UVJA 1GEHA 2BABA 4DCJB 1EB0A 3W60A 1OMSA 2ZJQQ 4U67Q 2HG4A 2XB2D 2L08A 3PYDA 5E0OA 3R9LA 1FTRA 3TEHB 1IBCB 3DCAA 4DS4A 1Q82T 1IQTA 4NCAA 1RA6A 1VYAA 5LSLA 1LQ9A 2C3UA 5IT9U 3CJ2A 3NAIA 3S01A 2KT5A 2FTRA 3KLGA 1EX8A 1GFWB 4YY3J 2PEBA 1S7HA 3R97A 3OT9A 5MAOA 3JTNA 2YKOA 4EMDA 4C11B 4QR2A 3D5MA 3UNGC 2XO7A 3BDEA 3NL0A 4V19X 1VLOA 1WJ9A 1CJTA 1RWMB 3RJMB 4YR3A 1EIYB 1N32F 2XLKA 4I2PA 1XNQF 3BQ0A 2W7AA 3FCHA 3KK3A 3OVAA 4CNYA 4ZS6A 3I82A 2VG7B 3BO2A 3TAQA 1WDTA 4DS5A 4FF3A 3J81U 3QRRA 1H7XA 4ZPBA 4G65A 4PEOA 2GZOA 3KTQA 1KBRA 1LFWA 3EUNA 2VBYA 4Y65A 4WKYA 3FQKA 2IJRA 3LALA 3DOKA 1U49A 4LT6A 3PW2A 4RW4A 4IUFA 3FCWA 2HWHA 4X65F 4H4OA 2XMJA 3I0SA 4EZ9A 1U6FA 3QJPA 2DXEA 1RADB 3N28A 1QD1A 5AE1A 4TU7A 3NGKA 3H5YA 4CYUA 1UWBA 2KJWA 2L9WA 1RAEB 2MJNA 2AIRB 3AJ1A 4N76A 3A8JA 2OEMA 2B56A 1BY9A 2OSRA 5K14A 2COLA 4K8RA 3HKWA 2HHUA 3NGTA 3H59A 4KHPJ 1GMVA 3HLUA 1JLAA 3C2PA 4P9SA 4ID5B 4LRDA 1H6KX 5RUBA 4A8WA 4XDCA 2BOPA 1Q0NA 1DTQA 3IBFB 3M9NB 2WVFA 1RISA 3ZXWA 4WFAQ 2HHSA 1YWXA 3E01A 3DN9A 5DQHA 3DOLA 5HJYA 2NQPA 1X4AA 2JJ4D 2F3JA 1X4BA 2CQIA 4QWEA 2DHXA 3MOZA 3IGVA 5B7WA 3MM5A 4DR7F 1J27A 3FBEA 5HQLA 2BJEA 2BKOA 3BDPA 5KG1A 2IA0A 1VJQA 1KHVA 4MK8A 1RHMB 4AD6A 2X1AA 2CJKA 2VA3A 3OVBA 3KHRA 5SZTA 2R7WA 3M30A 1W26A 2OP5A 1S12A 5J2PA 5F8GA 1ZPVA 2YNIA 2F8HA 4I1TA 2WONB 2O1PA 4ZPDA 3MM9B 2XM3A 2RQCA 4B02A 3TZZA 2K7KA 3DLKB 4F4AA 1HBMB 3SSRA 2ACYA 2MKJA 5DRKA 3EVOA 3PW5A 2XYPB 2ZHOA 1YVFA 2FHKA 2QT7A 4CH1A 3MR5A 5B0CA 1MN9A 2VDIA 2BZ2A 4MK7A 4DG1B 1M5KC 4AL7A 3DLGA 2AGQA 3DLLQ 2W4DA 5LXRA 3QT5A 2FVQA 3OFEA 3OW2R 3M1VB 3MUVP 2FY1A 1TL7B 3P6YC 3DGPB 1FJ7A 3CCJS 2FZKB 2GVDB 3DC2A 2CA9A 1VBXA 4JI0J 2YKNA 4EGLA 2MLXA 1XC9A 3LGMA 2M0GB 3TVKA 2RDIA 3K57A 4JV1A 3PJWA 3LPEA 3QPIA 5HBMA 4OHVA 4OX6A 4DPXA 2EG1A 5G0RB 3WHIA 2QFJA 3MR2A 3PVXA 3KLVA 1P9YA 1SIZA 3RW6A 2C2EA 1HYSB 3SYZA 5G4DA 4H4MB 3ENVA 4Y2AA 1FDDA 4ZK7M 5GAGI 2B5JA 4PRFA 3C16B 4O23A 4DUZJ 1V3SA 2FDNA 5KFFA 5JXSA 4IH7A 3OBIA 4UT4A 2F1FA 4FF2A 3HDSA 1RTHB 5EUHA 3QGIA 3BZQA 4NXNF 4DR6J 3DXBA 4MMOA 2XTJP 5KFIA 1AUSL 1LWFB 3GJTB 3JSYA 1IBLJ 4XTTA 4P73A 4J9RA 2C42A 2ZDPA 1B70B 3ZNUA 4LF4F 1HPZB 1GT8A 2BVZA 1PAEX 3VAGA 4M5NA 3VALA 2ZKTA 5F9NA 3OL7A 2B7BB 2HAFA 1HHSA 2OFHX 3MD3A 1LEOA 3A13A 3JSBA 3HD1A 3WZ0A 4BWMA 5CZXA 3IAM9 3UD5A 5CZVA 5I3PA 1DTTB 2MQ8A 2OIHA 4QR0A 1TK5A 1RT1B 3ZTOA 4K5RA 4OYZA 4TYAA 2C3PA 2C28A 2Z2LA 2W2MP 1TZ0A 1SKSA 4DR3F 3CCMS 1OSCA 5THWA 3IWNC 1NJWA 1XWLA 4NLUA 2WW4A 4I6YA 1ZYQA 3MFHA 1LW0B 1VRUB 2ROEA 1FWKA 2HLUA 5DDOC 1HWKA 1FX4A 4B3RJ 2KHCA 3BEGB 4ECYA 1YRTA 2XY7A 1NHUA 2IMWP 1AZSB 2HW3A 2CJ9A 1HNZJ 4P7VA 1RYRA 2DHGA 2MDAA 5HROB 4ED7A 1WF1A 3UPFA 4WK3A 3HKZD 3MM9A 2XMUA 2KJVA 1NU4A 2HK3A 3VAMA 2AZ3A 1HBMA 4KQZA 4ZVHA 1UW9A 1S79A 4OLPA 4F4WA 2W25A 3T9ZA 3VTIA 5LMUF 3FSYA 3ZTRA 4QU6A 4EYIB 1KQKA 2KXHA 1HBOB 2FZGB 4QPXA 1YBUA 4I7FB 5HVGA 4CO0A 1NUEA 2BRKA 3AQPA 4NCBA 1YJUA 4QJVA 4OHZA 1RAAB 2Z58B 1FDAA 3RBXA 4YR0A 2HNZB 2EC2A 2EWHA 2D41A 1TL7A 3CW2C 4KAIA 2AJ4A 4F4XA 5LT5A 1TVRB 2Y1IA 1RAHB 1RZMA 2DYAA 3KHLA 2GVDA 1KD1T 1MWZA 2G0IA 4DV0J 1Q8KA 3HI9A 5I3UA 3T41A 2V2KA 3KLHB 3HM9A 3TQ1A 1TELA 3SV3A 2HWTA 5BR8J 2PMWA 3RBZA 1FWLA 2AQ4A 2HFVA 1HNXF 3BYPA 3HXMA 1U45A 4JV5J 4NLVA 2CNKB 4PWDB 3HHKA 1ITPA 1RT6A 2O5DA 2XCAA 1NPRA 4JI4J 4NMLA 1HYSA 1K0VA 4H4MA 2YX1A 3MURP 2ILYA 3C16A 3W5XA 1RTJB 1U2CA 5HJXA 2YKMB 5LM7E 5CAAA 2B43A 3A8EA 1RLCL 1RTHA 4K0KJ 1IR2A 2CFXA 4XPCA 3PIOQ 2PGCA 3MPWA 3IAS9 1FXDA 2XS2A 1LNQA 4DR5F 1HI8A 1LWFA 2OTLS 2B4UA 1AXQA 3BR9A 3RTVA 1C1CA 4QYZK 1KVJA 3SQGB 3MUTP 1HPZA 3KDOA 5J1NA 2FJEB 4ED8A 4C8MA 1N48A 2Z2MA 3D6TB 2WSFC 4KY3A 2N3LA 2D3OR 1IKWB 3QWUA 4BHQA 4B9UA 2E5HA 5JVGQ 3QZ7A 3B78A 1WWHA 4ECTA 3I9V9 5A2QY 1XMOF 4FS2A 1UP1A 1Z2LA 1CC7A 1XQIA 3R7NB 1RAJA 4A8FA 2FQQB 3DRRB 3HMJG 2KDOA 4MKVA 1B0PA 4LMZA 3U02A 2GNKA 2QFIA 1RKIA 1SIWB 4DV3F 4TQSA 2DR9A 1RE1B 2J0XA 4MFBA 4X62J 3OQ2A 2XBPA 1HW8A 5C2GA 4DSIA 3FDSA 1FCAA 3UWTA 4D3HA 4JI8F 3I5BA 1LW0A 3FCVA 1VRUA 5E3RA 2EFQA 3PRDA 2WK4A 3SCKE 2PI4A 5KG4A 2LA6A 1PILA 4I64A 1VHIA 1DJ0A 1K44A 2FJVA 1ZM2A 2X1FA 4ILLA 1HMVB 1WG5A 2WOMB 1KLMB 5GAEU 4CCHA 3MI7X 2DKOB 1LV5A 2UUBF 2C3YA 1SL1A 2IVYA 1QLNA 2J0QD 3OSNA 2FIUA 1TFWA 3VGTA 1CJUB 1JLBB 2FC9A 4HHJA 4B9MA 2J7KA 1HBOA 3VVTA 2N4CA 1VBKA 2CPDA 3GIIA 2LYVA 4I7FA 4NI2B 5IQ6A 1SQGA 4OYOA 1RHRB 4O3SA 1HNWJ 2VQFF 4DL5A 1REVA 1AUDA 2FHMA 3V4IB 1UEVA 1RTIB 2V50A 2HNZA 1I6JA 1C0UB 1OIAA 4FKYA 4A46A 1Q5YA 3TX8A 2CYYA 5H9EJ 1NEEA 4IH6A 5J1PA 4ATNA 1Y5LB 3CDBA 3CVKA 4J9NA 2OH2A 2RIJA 3KG4A 3P8BB 2BR0A 1QVFR 3TUZC 4S0MA 1C4CA 4Q0BA 1YJWS 1FT8A 1MG7A 2B6AB 1HBUB 2X3GA 1HWLA 5D0GA 5F8NA 5KG3A 2HRUA 1YGYA 4PXCA 1KTQA 2GJFA 2E66A 2GIQA 4C8ZA 2NR0A 4PWDA 1IKYB 1RB0A 3EGZA 2I38A 4KSEB 2DBBA 4Z7YA 1F5BA 2CQGA 3GR1A 2N7CA 5D4NA 1RTJA 4LRFA 1CC8A 4LVNP 2YKMA 3K5LA 1UFWA 4DWIA 2R8GA 3US5A 3Q86A 5KFQA 3AD7C 2XNQA 3LW5C 2VPYB 1PSDA 1NAQA 3FSIA 2GQCA 2OELA 3SQGA 4ZCMA 2MSTA 1S9GA 4NRUA 2V4RA 1DY3A 1NZ8A 3MR6A 3UQSA 4A47A 4UUWA 5IWAF 2UXDJ 1IKWA 1D9AA 5ETSA 4Q44A 2UUCF 3NS5A 3OTEA 2W9BB 4H4KA 2W24A 3M2RB 3PV8A 5DDRC 1G6BA 4CI0B 1ZS6A 2NZ4A 3ICLA 1GX6A 5KFDA 2H54B 1KDNA 4DXLA 2NS1B 3D9BA 2OLWA 3DRRA 2W2QP 4E8UA 4H4KC 4EO8A 2HGLA 4X4TA 1OS5A 3IO1A 1F9HA 2W9AA 3T5JA 2A2DA 5H9FJ 1NK4A 1F5CA 3G8QA 3KNGA 5LJ3Y 3MMCB 4NEYA 5DETA 2FLPA 4ZVOB 1P1TA 1S0OA 2DH8A 3MECA 4ELVA 4A8QA 1QVGR 2CPEA 2HK2A 4USUA 2FB0A 2DGQA 4ZA1A 5DG8A 2CPIA 2WOMA 3KJFB 1FI4A 4FYYB 2XZWA 2AYEA 4CM2A 1X4HA 3CCRS 2HEKA 3TUPA 2IJFA 2EFPA 1CJUA 1JLBA 2PMZD 1OY9A 5ETNA 2XC9A 5F3TA 5KFOA 4J5OA 1WELA 4TN2A 1Y11A 1L3SA 2NYIA 4NI2A 1S1UB 4G6VB 3PRVA 1BXNA 2Q6CA 4WXOA 3L3CA 5FD1A 2HFOA 3D1QA 1ZZFA 2YQ0A 3GWCA 3WX4A 3DRPB 3V4IA 2LXUA 1RTIA 4J90A 4QPTA 1C0UA 3M4XA 4TQRA 4DL6A 2CXEA 4JI5J 2YY3A 3K17A 2ZOFA 1IJEB 1XEZA 2H5EA 2R7VA 2BV3A 4ITSA 3EVWA 2HBQB 1ACMB 2MY7A 3M8ZA 4CQ1A 1NSKL 3TP2A 1TL1A 1MNEA 3CEDA 4NE9C 1AW0A 5GADI 4LVOP 1SB6A 3VAFA 3M2UB 3EXCX 1NDPA 3GMGA 2AP6A 8RUCA 3T9NA 2KVIA 3VZIA 4IFYB 3DI6B 4RR5A 3K89A 2MGZB 5KFZA 4X66J 1FNXH 2CQPA 2RUGA 3R27A 2G2OA 4NLDA 4OIXA 1B7YB 1ZTWA 2ZE2A 5J2MB 1IKYA 1GMUA 1RWUA 4DCPB 3BV8A 1H0HB 5K8NA 4Y3CA 4X2BA 1VCTA 2RSQA 2GAGC 4ETXA 2YNFA 2VPWB 3KLIB 4QIFA 1NKBA 1ZM4A 1SC4B 4C8OA 2H5IB 3DNCA 1C1BB 2KRRA 3B8HA 5IT0A 3MMAB 4JOUA 2FGCA 3T6BA 1PO6A 4K4XA 1AB8A 1N5QA 1HI1A 4B9VA 3DMJB 4OI6A 3OL9A 2B4VA 2JC1A 2IPOB 3S1TA 5ETOA 3W2WB 2R7OA 1WC1A 2V8VA 1FRJA 3M6XA 2W9BA 4O4GA 4JI7J 2E7XA 4DV6J 3DKDA 4WPAA 3HF5A 4NWBA 1JK9B 5MLCV 2E9ZA 2XZTB 2H4WB 1VFJA 3BBBA 2DGSA 2QTWA 4IDKB 5GAEI 5GMDA 3QFHA 3FVYA 3A3OB 3C19A 3HSJA 3WX8A 1S9EB 5CH7B 2QEXS 3GP9A 1JLFB 2R7RA 6FDRA 2FYXA 1SV5B 4F2SA 4DSKA 3MMCA 2AV5A 3O2IA 2D3ZA 2C3OA 2R7XA 4DR2F 3UI3A 3PR5B 2PI5A 2N3OA 3CNQP 4OI4A 3R3TA 2QYCA 2ACMA 2EK1A 2PC6A 3MAAA 2G0JA 1S0MA 1XBWA 2LP4A 3NKYA 3UR0A 3SQOP 1HFEL 4U7UK 5CQGA 4PG4A 5H9EK 1K9MT 5KFCA 1MWYA 2OEKA 4FNIA 3V4MA 4KV8A 2DCUB 4WF9Q 4OZJA 1UL3A 4ED5A 5KFUA 3BKTA 3H2UB 3D6HB 2UV8G 4B3SJ 3P5TL 4N47A 2XI2A 3D0IE 3DYAA 5CD4H 3DRPA 3A8IA 3SXLA 2AMCB 4JBCA 2C2NA 3AJDA 4I67A 1XMQJ 5I42B 4K4UA 3HPOA 1IN0A 2ASJA 2B8PA 3OTDA 3GU0A 3PEJA 4J9MA 1X5OA 3IRXB 1RHKB 1X31C 2KM8B 3DI6A 3UE2A 3I9ZA 1T9VA 4ANDA 3N6NA 4OHWA 1JXVA 3M6WA 2ZZTA 5DDPC 3NLCA 2LQJA 3L9ZA 5J2MA 2RAQA 3FMWA 4FVMA 3AXKA 1YHQS 2BEFA 1FESA 4J9VA 1S7IA 2K3IA 5GMEA 2JX2A 1XERA 3F56A 3L4BC 5K8OA 3BKUA 2HSEB 3MOJB 4QU7A 2C2KB 1NDLA 5KFBA 1VBYA 1TKDA 2P5VA 3KLIA 4G1QA 4GKKJ 4HL9A 2OHDA 3JB9k 3TVYA 2Z8QA 3VAHA 2ZM6F 3MMAA 2KT2A 4PR6A 1DLOA 2HHHF 2B9XA 3PRBA 4LF9J 1H3DA 1YBAA 3MMJA 3Q83A 4DQQA 2QL7B 2BQUA 3R6LB 4TYBA 4DL7A 2OTJS 2U1AA 2IC3A 2FVCA 2Z2YB 3W2WA 4KPYA 1RJJA 4C8KA 2L3MA 4DL2A 3OXGA 1TL5A 4USMA 3D6MB 4WFXA 1S5ZA 1WKLA 2KYZA 2OAUA 3EM1A 1T3OA 3HFKA 4RNHA 5EX3A 4Q45A 2AD9A 5A8RB 4BC9A 4Y6IA 2GHPA 4ERDA 1CQNA 2MQMA 5K20B 3QAEA 4K7QA 2EFGA 2EEYA 5DG7A 1IM4A 4YY3F 4DDFA 4RJVA 1CJKB 1S9EA 3ET6B 3R5JB 4C0BA 2HLTA 4GKJF 1JLFA 1R0CB 5LSOA 1JQGA 3JTPA 3ULHA 1HKAA 2CJXB 3L09A 1N5VA 1NDKA 2N7YA 4NA2A 1E6VB 2DHSA 4N77A 2BJ3A 3CWJA 2NLWA 3J7A1 2QIFA 4WK1A 4FZVA 4LFAF 2QLBB 1FFGB 5KG6A 1VBZA 4ECVA 3QJLA 4RWWA 2K1RB 2ZOGA 2RT3A 2RVJA 1FJGF 3CC4S 2YX4A 3MXHP 1S1WB 3VVUA 1RI7A 3DLEB 2YWGA 4RLEA 3VAJA 1GTHA 5GAHI 4EBCA 4R25A 3HFZB 2R7UA 5KFTA 3OR2B 4ZKAA 1Q78A 4FYXB 2HNYB 1XNRF 3ZZ0A 4RW7B 3KLFB 3TA1A 2Q66A 4LSZB 2GFFA 1WG4A 1GXUA 2A18A 5B0DA 1TK8A 2DNRA 4ECSA 1X0FA 3N79A 5KFLA 4LR7A 3Q8VA 4DV5F 4C0HA 1T9YA 2ERRA 4U9RA 3C6TA 4P74A 4DLEA 2QA2A 3HHEA 1N5SA 4HI2A 1HD1A 2B51A 1RK8A 1WTFA 3ADAC 3ILLA 1FEEA 2GVZA 3KJQB 1X5TA 4Q8FA 1VQOS 4ZPCA 1VQ8S 1GAOA 3MCMA 4UQGA 1W2IA 3N0VA 4LF1A 1RAOA 2RD5C 1VQYA 3K59A 5KG2A 2LEPA 1N33F 5IT4A 2LEAA 1KQFB 1GH8A 3RGIA 3UDCA 1HQ2A 4J9UE 5DQIA 1VLYA 2X7IA 4CLLA 3ZFVA 2P6TA 3HP6A 3HFVA 1C0TB 1SL2A 4TNOA 1MN7A 4OYWA 1S6PA 2KM8C 3PW0A 3QAUA 1NCLA 4I4BA 4E2FB 1ELOA 3J81j 4HACB 3ZTSA 4TLQA 1T0TV 2X1BA 1N5YB 3SEOA 2ROGA 3CSKA 4M63A 8AT1B 2FUG9 3T5LA 3MAHA 3GCWP 3W2VB 3C3LA 3E3XA 7FD1A 4CWBA 2HS4A 3WC0A 2KFNA 3TO8A 1RTDB 5DO2A 1YJVA 2OI2A 4DR4J 1NHKL 4V1Ak 1X60A 1SH2A 4UZCA 4PXBA 1H2TZ 1FJEB 2KVQE 2V67A 1QM9A 2OGUA 3HULA 2FHJA 2JOQA 3C15B 2V34A 3RRHA 2F4VJ 2UUAJ 5A8RA 3IGNA 1N4LA 2DPIA 3QIPB 5AXLA 1GXLA 5KFEA 2C2OB 4FF1A 3MEGA 3BSOA 4JI1J 4B3TF 1RCOB 2OEJA 1RTZA 4NLPA 4C4WA 1L3VA 3ET6A 5L1LA 2NPIA 1HIYA 2VOPA 3IA0A 2E29A 3P4UB 1J5EJ 3OLAA 4PQUB 1IWGA 1U48A 1U1NA 4DLGA 4Z7CA 4M94A 3TR5A 4KIAA 4Q43A 2LXFA 1NNDA 2NXEA 1WDDA 3Q22A 2P8IA 1DBDA 2G4BA 1Y3KA 4NX9A 4UOFA 2ZKUA 2EFNA 1WOSA 3T3FA 1B3TA 2XYHB 2K1RA 5E2QA 1WHWA 5IM0A 1RSCA 1SJ1A 2A6MA 2AJ1A 3DLEA 3FFIB 4J9OA 3UD3P 1MMNA 4EYHB 4BCAA 4TLRA 5FIIA 5I3QA 3OR2A 5CABA 2HNYA 4HH1A 4DV2J 4RW7A 3KLFA 4QR1A 4J9PA 3OPKA 3SBMA 1YJNS 4DSJA 3G82B 1RWNB 2CZVC 4F0KA 5M2UA 1VC0A 5FLXU 2DH7A 1JMTA 3OR1B 2ZH2A 2JFKA 1VC6A 2ZH1A 1M5VC 2Y8YA 4FYWB 2BQRA 3CGIA 3RB3A 3M8QB 1KNZA 4PCQA 1U2FA 2XHWA 4QIGA 4OL8A 4UW2A 1JJ2R 2WVEA 3P3DA 3I87A 2LVWA 2VV5A 3V81B 2FJBB 3OD2A 3MPUB 1ZBTA 5J1EA 4PYAA 3EZ5A 3BGLA 3NOGA 3O1LA 4RNFA 1X7VA 2M7SA 3H5XA 1D09B 4HKQA 2GA7A 2H65B 1N36J 3JYTB 3NWGA 2ZDOA 2YKQA 4YDDB 3CJTA 1U2RA 1C0TA 4ICLB 2R7QA 3VWSA 3BSNA 1WD6A 2PA8D 2VHGA 2Y0BB 2WBRA 1I51B 3P5BP 1T7PA 3ELHA 4HACA 1B4SA 2NUHA 1TAUA 2GJ2A 1VRTA 5HVHA 5BJRA 3GR0A 4LRAA 3MM7B 3IG1B 4LF6J 2IRXA 4DU7A 3C66A 2ZH4A 4QWDA 3GIRA 2LFVA 1NK8A 4L74A 2KFZA 3CMAS 4QQBA 4ECUA 4OZLA 4B3RF 5F41A 4LFBJ 4L72B 1EETB 1Q8BA 3W2VA 4DSEA 1SBRA 1NK9A 1NSAA 1Q53A 1HQUA 4YB1P 1BQMB 1PKUA 4ED6A 1WI6A 3PJ9A 3IC1A 2DHAA 2PO4A 1X0PA 1RTDA 5HMWA 2X1GA 1CEZA 2R8JA 1UPMB 2CQHA 2M70A 1NK7A 3OHBA 4ZN3A 1TUGB 4CO3A 3LAMA 2IM1A 3BB5A 3GCXP 2DNKA 5D0EA 2XY5A 3IS9B 2NYHA 3C15A 2OUGA 3AHPA 1DARA 3DFEA 1NK0A 1R6YA 2HMIA 2ZH3A 2CPJA 2PIIA 4BLGA 5IC6B 1RWVB 3SCJE 2RNEA 3NXZA 3ILJA 1U1PA 3R7SB 4KB7A 1M5HA 3W64A 3GFZA 4DU8A 1Q95G 3JTOA 3PNIA 3DU6A 2CPFA 3KHHA 2XGPA 3L7UA 4BBYA 1JKHB 1T11A 5BR8F 3TARA 3GONA 4U8YA 4Y2IA 3CJ5A 2J8AA 4QBUA 2YKAA 1K47A 5CYMB 1KLNA 2GCFA 4CT9A 2G13A 2JH3A 2LKZA 1PYOB 3J80Y 3G82A 1RQ0A 3I4PA 1WF2A 2IYIA 3GJQB 3GYNA 1G2EA 3HX9A 3LF0A 4FN5A 2RHSB 1H98A 3LO3A 3W8GA 4Z37A 2ZH6A 2VB6A 4K0KF 3TZWA 5HMYA 1VRQC 1V5IB 3K8WA 2VZ9A 1Q16B 3PW4A 1S59A 1R89A 3M8WA 4WIIA 5T7LB 4FXVA 2YQ1A 1YZ7A 3RR8A 1FERA 1JLCB 3IR5B 2VG6A 3QSYB 1UZDA 2KU7A 2YTCA 4IQXA 4TY8B 4OFZA 2UXBJ 1AFJA 3EZOA 1ZA2B 1N32J 2W7OA 3P49B 4YUDA 1VC5A 3C6UA 3LP0B 2LQ5A 1MMDA 1XR7A 3ZZYA 2VA2A 1KKHA 3D1HA 5D0RA 1XNQJ 2HRTA 5IQQA 1R31A 1X4FA 3JYTA 5LXYA 4B3MF 1TL3B 2AEFA 5KFHA 4CLSA 2KT3A 2H51B 5D4LA 5BYQA 3DXSX 2JNJA 4DPTA 1GNKA 1CBKA 2UP1A 3ISZA 4LR9A 4K4VA 1FO1A 1UPPA 3RW7A 1UVLA 1RT7A 2VUGA 2J6UA 2GC8A 2FJDB 4CLZA 3FGVA 1S9FA 4OYXA 3MPVA 1S0VA 1IBKF 3RAQA 2K3KA 1B0TA 1UA1A 2G1DA 2DIVA 2WCXA 1AT1B 1X9WA 1EETA 4IOBA 1CS4B 1BQMA 3MCNA 4OZ0A 3SI8A 4HTIA 1UETA 1T9TA 5CCMA 1S1TB 5BXIA 2N4DA 3MTKA 1T8EA 2AJ0A 4U6PA 4PAAA 3NY0A 2PFFB 2I2YA 4QWAA 2F9JA 1QSSA 4FP9A 1U0HB 3R5GA 4YP3A 3IS9A 2ILZA 3H98A 1KVIA 2ZH9A 3AFGA 5AJ3F 3WIVA 4ED1A 1X4GA 2XNRA 1OJ4A 3M9OB 2KO1A 1RT3B 3A3NB 3VQTA 3O3LA 3C8YA 3G86A 2ZVIA 5IXUA 3UVJB 4YEAA 2HPUA 4OYBA 3TVZA 2OD6A 4KGVB 2I8EA 4DR7J 1Q1KA 4USKA 5ETKA 4RBUA 1T9UA 4J7CA 4A8MP 3F41A 4DV7F 1L3KA 1WOPA 4M5IA 2BM0A 4YHHF 2JC0A 4RW8A 5ETMA 3LP2A 1R3NA 3BYRA 1WNEA 2Q1LA 2AT1B 1D1UA 1IXKA 2DTJA 4WKRA 2RJZA 3G87A 3JAMY 5ETQA 1H72C 1LXJA 3CCTA 3J7YU 4KRWA 3CXCR 1Q81T 4M5KA 1X4CA 3GG1A 1N0UA 3LTOA 1IR0A 2DEIA 3I56S 3VAIA 4JV0A 3UFCX 2FC8A 4RNNA 5KFRA 1M0SA 2XO6A 1T3NA 4R8UB 1NB7A 2DNGA 4USVA 4DX7A 1U47A 2RQ4A 1QTNB 5T7LA 1TKTA 1FRMA 1O0PA 1JLCA 3A3PB 3DOKB 2I9SA 1JIHA 5SUHA 4ZVGA 4RW4B 1WSVA 3HHLB 4TY8A 1EZZB 3VV2B 4RO0A 1RWOB 1BD6A 4DSLA 1XR6A 4RUBA 1UVIA 4FBTA 1T95A 4NZ7A 2V63A 2KYXA 2RS2A 4H4OB 2E1AA 2PDAA 2CQ1A 4OZ5A 3OVSA 3GJRB 4ELUA 1CLFA 4QYRA 4Q5VA 4YB5A 1A9NB 2BDPA 1U24A 5HP1B 2JWNA 5D78A 3Q89A 3M2VA 1JNRB 2XSJA 2F40A 3D66A 2H4YB 5K14B 4CRJA 4ZHRA 1TU0B 4ZP6A 1JLAB 1HLWA 5ETTA 5IZHA 3H5UA 4IR9A 3IM9A 1NH8A 4DL3A 2RH3A 2E5JA 1RGVA 3MR3A 1TK0A 5E33A 2BJ1A 5K8MA 1N56A 1S72S 4NXNJ 3MMBA 3DRXA 4AFFA 4USIA 3BGRB 3DOLB 2ZUAA 3HHNB 1FEHA 2HWIA 3QIDA 1UMJA 4MJKA 2HVZA 4XDDA 2W2OP 1F3FA 2JLEA 2BJ7A 4ZVFA 3ZZOA 4LF4J 1R8HA 2HS3A 3MM5B 2WRMA 3W66A 2ZD1A 1KOOA 4ZMMA 3N6LA 3JQMA 3OLBA 4N8NA 2OD4A 4Y34A 4K4SA 1NBEB 1S4FA 2PMHA 1U0HA 4KTQA 3KWMA 2MXYA 2K06A 4ED0A 2DNPA 3M30B 1BQNB 2MB0B 1SXLA 3M05A 2V5HG 4NYZA 2DCLA 1LXNA 1REGX 4TY9A 1IKVA 4UF4A 1RT3A 2HVIA 3KUHA 3PYFA 1DRZA 2HQFA 3TYTA 6AT1B 4HLBA 2IBOA 4ZIWA 2BJ9A 5DDQC 3Q2TC 4X4RA 3T1HJ 3RAXA 2DNNA 4UTGA 3I96A 4P72A 4NYOA 3DLGB 4ZVSB 2JRSA 2YWEA 4C3LA 3QZ8A 3TZXA 3E8OA 1U6BA 2UV8A 1V3ZA 1OPZA 3EGWB 1DQ8A 1VI7A 4MIAA 4Y00A 4DN9A 3CJ8A 4LFCF 2KG0A 4F50A 1EQ0A 2OPPB 3LANA 3W8PA 3RAMA 3G9CA 2K7JA 1D0EA 2OKQA 2YKNB 2AGOA 2MKSA 1F9FA 2B9WA 2E1PA 5LMUJ 4F02A 3BO3A 3KLEA 4CH7A 4QWBA 5J2QA 4OZ2A 3CJ3A 2E9RX 5CYJA 3HJVA 2FLLA 4DPUA 1O51A 5HBMB 1A0OB 2YNGB 4R8UA 2Z56B 4WP8A 1BC6A 1YRXA 2RDJA 4EWTA 2ZJRQ 2CDRB 3D3BJ 4NZ0A 1T05B 4FDFA 3G4SS 2ZC3A 2B5JB 3HHLA 2ZBRA 3NCRA 2FVPA 1KOHA 5T41A 1KQSR 4URGA 1YI2S 3NWRA 3T6JA 4EI2A 3BPDA 5F8LA 4DFKA 3LWLA 1JWWA 4FXWA 4DF4A 3HHLC 4JI7F 5KFAA 5HP1A 1RBAA 3B4DA 1WG1A 1HNXJ 2VJUA 4RW6B 3QGPA 4W90B 2GHWA 1SCJB 2LXIA 2VQEF 1V3RA 4CLPA 2G1HA 1KONA 2FHOB 1FE4A 2G9OA 3THVA 3FZBA 2BQ3A 3GJSB 2D7SA 2NSCA 2VD3A 4WTOB 1E6YB 1VQ5S 1IBMF 2RUSA 2VICA 3CD7A 3BGRA 4DR5J 2XWYA 4A8OA 3W65A 5HQ8A 4NPOA 3NG8A 5CYQB 4Q8EA 1RBLA 5KFSA 4M5MA 1RABB 4LF8F 1IWAA 5F9LA 2FLOA 2VC1A 3LWMA 4LF7F 1UFLA 2MSSA 1I3OB 2BE9B 3AT1B 1S76D 3CCWA 4Z2XA 2RF2B 3BM7A 3QFWA 5E7OB 1BQNA 4E0DA 1VQ4S 4LREA 3TWZA 1XMOJ 1OO0B 4AQYF 2RDDA 1GTEA 5KFMA 1FTCA 5M2RA 1LFPA 4KHMA 2GMLA 2PN6A 4ELTA 4RL1A 3NP5A 3FZ2A 1U02A 4NA1A 2J0WA 1N8RT 3MTJA 4DV3J 2XMTA 2BMBA 3TNVA 1ICEB 2ZUGA 2W9CA 3D28A 1R8BA 2MZJA 3EE3A 3CCLS 4WJBA 5AXMA 5KOWA 4JI8J 1PJ6A 4UUXA 1LWCA 5KFYA 4MKBA 4NLRA 2YNHA 3W5ZA 1DQ9A 3CCES 2KHDA 1RWXB 1SH3A 4JYAF 1YKWA 2OPPA 3MCOA 5DGBA 2CKWA 2ZOMA 5KT2A 2UUBJ 1IVZA 3KK1B 5EGYA 1VS3A 5I3UB 2EFOA 3N5BA 1Y10A 4QWCA 3H7HB 3H40A 1UFKA 4CLKA 3V6DB 4F36A 4I0WA 4NXMF 2AYGA 2NXCA 3ILOA 1NMEB 2UXCJ 1APSA 3SDEB 2GMHA 2YNGA 3QLHB 2CZ4A 2LQ9A 1N54B 3AB2B 3MD1A 1RT6B 3GV8B 4UY8T 4EBEA 1SUQB 1T05A 4URQU 1WC4A 4DZDA 5BYRA 3PJXA 2ASDA 3R5BA 2J6TA 3AH6A 2QG9B 2XSFA 1U1QA 4DHVA 4MIWA 1L3UA 2HQDA 3FEYB 5L46A 3NAHA 3KG1A 4JP8A 3GIKA 1WACA 4YOEA 2HVHA 3M32A 2C2RA 4Y0FA 2GO9A 1JJCB 1C1CB 4KO0B 1JLQB 3O6QA 3DHWC 3A1YG 5D77A 4RW6A 5IC4B 2MKIA 2XY6A 4X64F 5AXKA 3NMRA 2YBVA 3TAMB 2ZHAA 2XLJA 4P2FA 1RT2B 3Q8YA 3D4JA 1FXLA 1E6YA 2QJ3A 2R3VA 1LKZA 1F5AA 3Q24A 1EQMA 5LSRA 5L8RC 3L95X 2W4CA 4MKAA 4ZJQA 3W61A 2QLFB 1WSRA 2QA4G 4OJGA 3WQPA 4M5GA 4MFBB 2QLXA 5CYQA 3BBCA 1TFYA 3OTOF 3D54A 4B9TA 5AXNA 3OV7A 2VKZG 3AY0A 4ES2A 5IWAJ 3TJ8A 2JFDA 2RU3A 2UUCJ 2YPZA 3CCVS 1HW9A 3NGRA 2YX7A 2L41A 2RF2A 1Q8LA 2FVRA 3T1YF 3PZPA 1F0XA 1NO8A 3A4TA 2HZCA 1URRA 5EDWA 3NS7B 5IT9Y 1EP4B 2DXDA 4J9QA 9RUBA 3ZZZA 2F5GA 1FJCA 2VFTA 2GS8A 4KR0B 1N6QA 2HHQA 3HJFA 1VR6A 5LOQA 3AJ2A 2CWKA 1R8PA 2BM1A 3AODA 1N5TA 2ZH8A 1AA1B 4ZVQB 2JLGA 1UJ4A 4WYWA 4FF4A 2E7VA 3I5AA 3IWLA 2DK2A 5E3AA 3U1NA 2MMYA 1NJIT 4YMEA 1REVB 1R7IA 1VQSA 2ALZA 4BS2A 2CQBA 3ILIA 2HQGA 4OZ1A 2W4PA 4DV4F 4TXSA 5A8KA 3POTA 5C25A 2V4JB 3IP0A 2OJ3A 3J81Y 3KK1A 3B54A 1VQPS 5ETRA 4OYMA 2PE8A 4Q0BB 3R5DA 1R0AB 4WIQA 3V6DA 2PA3A 4O3PA 2V94A 3HCXA 4PG6A 1NJXA 1UVNA 1IKXB 3SDEA 3ISND 4WFZA 4RBTA 4CTAB 2GJIA 3QLHA 3EDRB 1CG2A 1Z2ZA 2QL5B 3TEGA 2BKNA 3F44A 4ZP8A 4GC6A 4DQIA 1S97A 1SUQA 4NASA 4UOCA 4WU3A 2F9DA 4GMKA 2MQOA 4F3OA 4HH0A 4A48A 4JV2A 4YB7A 2UVUA 3HVTB 2EBEA 2CPXA 2YWKA 1VK8A 2NZCA 3V2UC 2H48B 2AWZA 2HAIA 2J6SA 1FX2A 1WTBA 4DR1J 1DZ5A 4PQAA 2BBEA 3EWGA 4LSNB 1FWPA 5GMKa 1JLGA 3RBDA 4H54A 4KPCA 1YX2A 2F4VF 1MWQA 4X4UA 3PACA 4KO0A 1JLQA 4O4RA 2LLZA 4AYBD 1S9GB 3CB4A 3A8KA 5L1JA 2JZ5A 1JB0C 4IG3A 5E41A 3UDEA 1Q7LB 2HURA 3MDFA 3CIMA 1SH0A 5C42B 2CJQA 4KGZB 3TAMA 3ONQA 2FHJD 3QMQA 3RB4A 4DFMA 3WIUA 4EBDA 5L39A 1RT2A 4Q2MA 4WWSA 3RUBL 3W5YA 3PX0A 2ALYB 3UW1A 4N41A 3LPYA 1IUJA 1SC3B 3AQOA 3I5CA 1NXIA 3KG0A 1P1LA 4RUCA 2IA6A 4A8YA 1FE0A 2W8KA 5D0HA 2H5JB 2FZCB 5IOLA 1VDHA 2V68A 1TAQA 2HS0A 2MZ1A 2FJXA 1ZM9A 2ADBA 4LIWA 2OSQA 4DI6A 3MECB 4CO4A 3GQCA 2MZRA 4WZQA 2JDJA 4QOTA 2JVRA 3BGFA 1YIJS 2VFSA 4RW9B 3TJ9A 3DDNA 2XHCA 2HRYA 3AOCA 1EP4A 5DM6Q 1Y7PA 2F8EX 4IH5A 2Y8WA 4KJIA 4OLOA 4DUTA 1OYDA 5HI7A 1X9SA 2IFXA 3R5AA 2IDLA 4W98A 2DNQA 3EXYA 4ECQA 2GGPA 2UZAA 4DEZA 1KFDA 4O3NA 4DR2J 4G1PA 1PAUB 3FBCA 4WFYA 3T19A 2M4MA 1KEKA 4P2XA 2Y9HA 3KK2A 1Y0HA 1TV6A 3KUGA 3MUMP 1U09A 5IV4A 3OHAA 1VGYA 3QRQA 2V4JA 4NCGB 3CDAA 3QQCD 2QSWA 3GG0A 2DGOA 2POKA 1ZPWX 2ZBIA 1R27B 1TL1B 3GE9A 1TP7A 2P9EA 3ZZRA 2JHEA 1Y5NB 1R0AA 3K5PA 1RUSA 5HATA 3EDQB 3NNCA 1BQXA 1ZM3A 1HHQA 5DLGA 2DR7A 2AJFE 1IKXA 3H20A 4CTAA 2KG1A 3VGUA 2XULA 1QY7A 1OWXA 1GX5A 4HT5A 2QMXA 2JL9A 2ZE2B 3EVMA 4ER8A 2UU9F 2QMUB 3BN7A 1D9FA 4NLGA 2R9LA 5T14A 4ZVEA 3W9IA 3BSCA 5HL7Q 4X4QA 2DO4A 3KFWX 4OX9F 2KXFA 4OX7A 3HVTA 3FC9A 3M6UA 1YTYA 2BA9A 3PXGa 2YNFB 2E1RA 2K2PA 3VQSA 4IG0B 5GAGU 3CJ0A 4LSNA 4YR2A 1VQ9S 1FK9A 5KG0A 5U47A 3ZNJ1 1O8BA 1RU2A 2MQPA 5CXTA 3DOMB 1U8SA 1Y00A 4GVBB 2FD2A 2RRBA 4F2RA 4F4ZA 2BE2A 2HFUA 2JLFA 5C42A 2RQMA 1YQHA 1CVJA 1OY8A 3PM9A 2VG5A 5B0EA 3LUYA 2DY9A 1RT4A 5J2NB 4O4GB 2DIUA 3CC2S 2JSXA 4HVZA 5HAOA 1FVQA 3J7ZT 2IVMA 3HO1A 4ZVRB 3DDIA 3WC2A 2YXLA 3NNAA 3PKMA 4F0HA 5KT7A 2HYIB 1U26A 2CQ3A 3GIJA 3QYYA 4QW8A 1GK8A 4ZDNA 4OQJA 2VFRA 2ZM6J 4B9SA 3Q0AA 2HHHJ 3MHYA 4XO0A 4M5HA 3KKFA 1FVSA 4J9KA 2BXJA 3IBWA 2V6AA 3H4BA 3CJSA 2GMJA 2M5YA 4ED4A 4DUYF 1K73T 1HR0F 2VKRA 3R1LA 4ZLNA 3MWBA 1JXLA 5HVFA 2J8SA 3FK4A 3PEHA 4ZLJA 2DD8S 4JI6F 5HK4A 3MAAB 1I94F 4WTYA 1GMWA 3ENAA 2WSCC 1TQLA 1RHJB 2RHQB 4RW9A 1HNIB 3H2LA 5LMNJ 4EK2A 5D4OA 5ADZA 3A12A 2IAJB 3CT9A 2ROPA 2ZHBA 2BRLA 2V4QA 5IS2A 2HZVA 4GKJJ 1AYEA 1HA1A 4KV8B 4K2JA 4DPYA 2XS7A 2MZQA 3CCQS 3NEKA 3PO4A 4AL5A 2GHVC 2UXBF 2MKKA 4CO1A 3IR6B 3CO0P 2OPRB 3MPYA 2DT9A 2HHPA 3AOAA 4LFAJ 3DYAB 4CLWA 3QRPA 2IY5B 1FJGJ 2R8KA 2HNDB 1H73A 1TKXA 1K8AT 4PABA 1NKEA 3KMSA 2LU1A 4NCGA 3GFXA 3EZUA 1XNRJ 2MKYA 2J9DA 3FNNA 2B4PA 3KHGA 2VU5A 3SSQA 3JQJA 3PFEA 4DV5J 2MLYA 1RAFB 4W4MA 1F9EB 5K5MA 2F65A 1DQAA 1BWVA 3G2XA 3JSRA 3KMQA 5KT5A 3CDUA 2CJYB 1XN9A 4DN0A 5KFPA 4J9LA 1RWWB 4USTA 4TU8A 4WCEQ 2XMWA 4NOHA 3CD6S 5DS7A 1H7WA 3NCPA 1N33J 1UKUA 2WB1D 3R6GB 4G1QB 2AX1A 3RZAA 2A10A 4IG0A 3H0PA 2IVFB 2VL1A 4KBIA 2W1BA 5JJBA 2BE7D 2Q43A 2CQ0A 3AOBA 4QIWD 3O5TB 1DLOB 3M8YA 2R2SA 1WI8A 4HT7A 2CWXA 3DOMA 3H42A 3M6VA 4MKYA 3PX4A 4GVBA 1JXEA 1NRKA 4MIBA 4EUVA 4QYZJ 5LJ5Y 2IC3B 2LEBA 1FA0A 1F1BB 2E5LF 5EWEA 2UVRA 5J2NA 3SSSA 4JI3F 1ZH5A 1S6QB 5A2QU 2QE5A 3BR8A 4K2XA 1HNVB 2JEFA 5A0YA 4NL5A 1QTMA 2C3MA 3GILA 1WC3A 7AT1B 1F6TA 1VMBA 2P6SA 3FQLA 4JB8B 3CJQA 4OJ3A 3FRZA 1KR4A 4DX6A 4Y2KA 4MK9A 3UO0A 2EKNA 1KHWA 2V8HA 1HWIA 3I4HX 1F60B 1ZAVA 2HHTA 1CQMA 2YWFA 1KTVA 3B6BA 2O01C 4CZCA 4HHUA 1K1SA 3CD0A 3CCUS 3MFIA 3V6JA 4UOGA 4WFBQ 1NZAA 4L75A 3T5HA 1HNIA 3ENQA 4IO9Q 2IAJA 2DGXA 3MM6B 4NLQA 4B3TJ 4ILRA 4NLXA 3BH7B 3H4DA 3ZO7A 4KGXB 1WC6A 3RG6A 2A2CA 2DEJA 1XIQA 1O5JA 3HVRA 2CQ4A 4C11A 2PSZA 4FBUA 1SJRA 2ATCB 4NLWA 1VQKS 4F04B 2OPRA 2MYFA 2DISA 3C6TB 4HHHA 2XZDB 3CC7S 3EYZA 2SXLA 1M1KT 3K0JA 3TA0A 1PG5B 2HNDA 4DV1J 2CPHA 2LECA 2GVZB 5DZ6A 2VG7A 3VZHA 2DNZA 1UAWA 1Y4ZB 1M5SA 2QX0A 3Q8QB 5KFGA 2G0CA 1SQEA 1G4CA 3N9UC 3K7RA 2UUWA 3D1OA 4LF5J 3BO4A 3M8RA 2LA4A 4USJC 1VISA 2DNYA 1UVMA 1T02A 1RCXB 1EHWA 4DSFA 1HHTP 3T5KA 4M8LA 1PIEA 5E3QA 4JI2J 4EU0A 4OZ3A 6FD1A 4FXDA 1S4EA 1S6PB 2DRBA 4BC7A 1XMBA 2YQ3A 2EPIA 4YB6A 2EI5A 2I6WA 3R1HA 1FFWB 1AROP 4CLUA 2RB7A 3OL8A 5AE2A 2EC0A 2R7TA 2FJAB 4OI2A 2LDYA 1F2GA 4ID5A 1D8ZA 4WBFA 4ALZA 3WDOA 3QT6A 2OFGX 2BACA 3GFHA 2VBZA 4ENOA 4LIRA 1PCAA 3IR7B 5H9FK 3K5NA 1SKUB 2IYGA 1FDBA 3EMTA 4CLFA 1FRLA 1FRIA 4LRCA 2GIFA 3K5OA 1B99A 3T1HF 1W2BR 1S6QA 1CSJA 2N82B 1RA7A 4IRCA 1UEUA 1HNVA 3BF4A 3SFUA 2R4FA 5C2CA 3MEGB 1BMQB 4I68A 4B9NA 3H2VE 5LL6d 3L7OA 1ZETA 1FXRA 2R8IA 2WVCA 1Y9OA 1TUVA 2WONA 3ZZPA 3TZYA 1UVJA 1A6LA 3DLKA 1EARA 3DHXA 2H1YA 5KT3A 4PG5A 2PFDA 4ZOSA 1F2HA 4ILMA 2FJWA 4PKDB 4DG1A 5IM0B 4OI0A 3UN5A 1UZHA 1RAGB 5D8HB 3MM6A 3MEKA 1YITS 3M1VA 1WHXA 2CVEA 3DGPA 1FKOB 1D8YA 3TUIC 3E51A 3HSDA 2HGMA 1FDNA 2OMLA 4RKUC 3NCQA 4NYPA 2PT0A 1N34J 4PPDA 4L6V3 3G8TA 4DX8H 2R2TA 2B9EA 3U7JA 3IMQJ 4O44B 3FKBA 3D6FB 3C46A 1RWKB 4C8YA 3IBCB 4DQRA 3HHLD 3QWPA 2I0XA 4IFVB 1K1QA 5G0RA 3CPWR 2QA4S 5J1EB 4EFAC 4OHYA 3L7PA 4KHPF 4KKOB 4MAKA 3TQEA 1WEZA 4X4NA 2XWXA 3CCSS 2AYMA 4DL0C 2ZNYA 2YKPA 3I31A 3U27A 5ETPA 1LK5A 5GADU 1HWUA 1J5OB 3OFGA 1ULRA 1FKPB 4X4VA 4CT8A 2AYBA 1RP5A 3CDWA 1VQ6S 2LMIA 4LSLB 2HFSA 4M95A 1IR1A 1C2PA 2C2ZB 2ZEJA 3CO9A 2QO3A 4WU2A 1VRTB 1EJ7L 2A3JA 3ISNC 5HMXA 4EEYA 4FKXA 2LQ8A 3FEZA 3NRBA 4WYLA 2BANB 2HBZB 4HDHA 3S8SA 3G8SA 2DITA 1L3TA 2G2ZA 3QT7A 1SKWA 4CLTA 2HIQA 3BGUA 3VR1A 2LCWA 4HEA9 3CTRA 4B3MJ 4QCLA 1HQUB 1DTTA 1NJZA 1QJHA 1RT1A 2E1CA 3GV5B 4NLOA 5KG7A 3QNWB 2I5JB 5KFKA 1Y3JA 4Y28C 4P52A 3JXOA 1UJ5A 1KFSA 1BHNA 2FPHX 4LBPA 4PPZA 2IRYA 1IBKJ 2ZITA 4MT1A 2HQCA 2HMIB 1OPIA 1HQEB 3AB4B 5F0UA 3UCUP 2DXFA 3W62A 3R5CA 1AZSA 4QZVB 4A8SA 5HROA 3BN4A 3HK2A 3D68A 3R2CJ 2VJVA 4KH0B 1T03B 5CCLA 5DJBA 4JI0F 3PIPQ 4UOHA 1NPKA 2X51A 4FS1A 2DR5A 2IIHA 3ZZUA 2V69A 3NNHA 5EWGA 1YJ9S 3KUEA 3HHDA 3KXDA 3ENWA 2MY8A 3DRYA 1VQ7S 3OL6A 2UXCF 3EGVA 5DZ7A 5AJ3J 4DCOB 1LOUA 4NEZA 1PYTA 1TVRA 4C3KA 1FKOA 1H38A 3UCZP 4O0IA 3MEEB 1KP6A 4DUZF 3G6VA 2U2FA 2Y1JA 3PHTA 2QN6B 3KLHA 1ZAXA 4YQWA 5FDLB 4DR6F 2IJNA 3I32A 4OV1A 2A6OA 4DV7J 3MPDA 3Q2SC 4TU9A 1VOMA 3E2EA 1SVDA 4O44A 1IBLF 4YHHJ 3D3CJ 5B0FA 3R8YA 3KJVB 3O8WA 4DOZA 1H74A 5ITHA 4F3QA 1S1XB 1Z1ZA 2V9WA 1T9WA 2Q6BA 4IFVA 2HHXA 2VG6B 3FUYA 1RBOB 2VIHA 3WBZA 4F3MA 4KKOA 4R0JA 2GQQA 2EW9A 3C6UB 2CNLB 4XAKA 4YS2A 5KFWA 4NA3A 4ETZA 2GAHC 1F3VA 4ZP7A 4L73A 4F0MA 4B3OB 3EJMA 1VJWA 2BUNA 1J5OA 3R7BB 2C2MB 1FKPA 3PO5A 4V19J 1G3OA 2YPYA 2J9DE 2HGNA 4ZCLA 3PR4A 4LSLA 4ZJLA 1FRKA 1UVKA 3SV4A 2FGOA 2AEMA 1RT7B 3GB0A
chains in the Genus database with same CATH topology
3PDNA 1S1VA 1JLQB 3O6QA 3TVYA 3DHWC 3A1YG 5D77A 2Z8QA 3NGDA 2IM0A 2CQDA 4RW6A 3RR7A 3VAHA 2ZM6F 3MMAA 2KT2A 2MKIA 4PR6A 4PXEA 4B08A 3LAKA 3D0GE 2XY6A 1DLOA 2BANA 4X64F 2HHHF 3EX7B 2B9XA 3RB6A 5AXKA 3PRBA 3NMRA 1H3DA 1YBAA 1DTQB 3TAMB 1X8DA 3MMJA 2DJWA 4DQQA 2ZHAA 1B64A 2BQUA 4P7TA 4TYBA 5A6PA 4DL7A 3E01B 2OTJS 1P27B 3TI0A 2U1AA 4NRTA 4CNZA 2IC3A 2FVCA 2XLJA 3W2WA 4ZCIA 1HNZF 1QAYA 4K4TA 4F8RA 4ECRA 4KPYA 1RJJA 1RT2B 3ZC4A 4C0OC 4C8KA 2L3MA 4DL2A 1WHYA 2O66A 1FXLA 1E6YA 3OXGA 2D3UA 1LKZA 2RKIB 4GC7A 1F5AA 1S1TA 1TL5A 3Q24A 5LSRA 5L8RC 2I5JA 3L95X 4HDGA 4WFXA 1A7GE 4G1IA 5F3ZA 1KQGB 1U1MA 2KYZA 2OAUA 2ZVSA 4AUKA 1T3OA 3HFKA 2W4CA 1VIXA 4MKAA 4RNHA 3Q8RB 1VQLS 3RYLA 5CHCB 5EX3A 5EX0A 2BW2A 4FNHA 2DGVA 4FVCA 4ECZA 2QA4G 4K5SA 4OJGA 4Q45A 2AD9A 5A8RB 2P9CA 4BC9A 4Y6IA 2GHPA 1H2UX 2QLXA 4MFBB 5CYQA 3THTA 2ZZNA 5A0YB 4OJHA 1TFYA 4ERDA 1CQNA 3OTOF 3D54A 2DGUA 2A1BA 2MQMA 3BREA 3B82A 1DURA 2RMLA 4Y2CA 3QAEA 4F25A 4B9TA 5AXNA 3OV7A 3G6XA 1V9OA 2EFGA 5DG7A 2DGWA 1IM4A 2VKZG 4YY3F 1D9DA 4DDFA 3AY0A 2IM2A 4ES2A 5L9NA 5J2PB 1S9EA 3EGNA 3H5SA 4K4WA 4C0BA 2HLTA 3CCZA 4D3GA 4GKJF 1JLFA 3W7BA 2JFDA 5LSOA 2RU3A 5B08A 3JTPA 2KZZA 3ULHA 3M9MB 2YNIB 2MZSA 1N88A 1R8CA 3L09A 1OSDA 3CCVS 1HQEA 1HW9A 1N5VA 1NHVA 2Y1RI 2N7YA 2YX7A 4NA2A 4PG7A 2L9NA 2RF2A 4M5DA 4F26A 1E6VB 2HFZA 2L48A 2L41A 2DHSA 1M5PC 4KFBB 5KFJA 2M8DB 1Q8LA 1FHTA 3LOUA 1SJQA 2FVRA 3T1YF 3PZPA 2WHOA 4N77A 2BABA 1F0XA 2QA1A 3CWJA 1NO8A 2NLWA 3J7A1 2MKHA 2QIFA 2HZCA 1HMVA 1URRA 4WK1A 2ZJQQ 5EDWA 1KLMA 4FZVA 4LFAF 2P9GA 2E5GA 4U67Q 2ADCA 1T03A 2HG4A 5IT9Y 2J5AA 1FNOA 5KG6A 4C3MA 3G96A 1VBZA 1EP4B 3DLBA 2XB2D 2L08A 4ECVA 3QJLA 4RWWA 5E0OA 2K1RB 2ZOGA 4DV0F 2RT3A 2RVJA 1FJGF 1FTRA 4J9QA 3CC4S 2YX4A 3ZZZA 2MJUA 3DCAA 3MXHP 4DS4A 1S1WB 2VFTA 1FJCA 4KR0B 1N6QA 1Q82T 1IQTA 4NCAA 1RA6A 1RI7A 3DLEB 4KGMA 1JX4A 2YWGA 4RLEA 5LSLA 3VAJA 2HHQA 4KHRA 1GTHA 1LQ9A 5GAHI 2C3UA 3HJFA 4EBCA 4R25A 3CJ2A 2R7UA 3NAIA 3S01A 2XS5A 3AJ2A 4ZPVR 3W3SA 1R8PA 5KFTA 2BM1A 3OR2B 2KT5A 4ZKAA 2FTRA 1Q78A 3KLGA 1XNRF 2HNYB 4CO2A 1M90T 2JEJA 1N5TA 3ZZ0A 4RW7B 3KLFB 2ZH8A 4PXDA 4RW8B 2JLGA 3TA1A 1UJ4A 4WYWA 1S7HA 1SI9A 3LP2B 1KRPA 4FF4A 2Q66A 2XMMA 3I5AA 3IWLA 1WF0A 2DK2A 3DM2B 5E3AA 3BJYA 2GFFA 1QAJA 1WG4A 5MAOA 3JTNA 3U1NA 4O3RA 2YKOA 2MMYA 4JV5F 1GXUA 1NJIT 4C11B 4YMEA 1REVB 1R7IA 1VQSA 2A18A 5B0DA 2DNRA 4QR2A 3D5MA 4ECSA 2XMKA 3UNGC 2XO7A 3N79A 2CJAA 1X0FA 4BS2A 3BDEA 5KFLA 4DPOA 3NL0A 2CQBA 4V19X 4DV5F 4C0HA 4JI4F 4K4YA 2ERRA 3UD4P 4YR3A 1N32F 4U9RA 2XLKA 4OZ1A 5GAHU 2IHR1 2W4PA 4DV4F 3C6TA 4DLEA 1T94A 2QA2A 3IWXA 3HHEA 4TXSA 5A8KA 3MEEA 4I2PA 1N5SA 2I1RA 2RE1A 3POTA 5F8IA 4HI2A 5C25A 2V4JB 1HD1A 2OJ3A 2B51A 1XNQF 5KOXA 3BQ0A 1RK8A 3J81Y 2W7AA 3KK1A 2CQ2A 3FCHA 2VH7A 1VQPS 1WTFA 2HFNA 1FEEA 3KK3A 3OVAA 4CNYA 1X5TA 3O44A 3HT3A 4ZS6A 4Q8FA 2PE8A 5FDLA 3I82A 3BQ2A 4AL6A 1VQOS 4ZPCA 2VG7B 3BO2A 4DR1F 1GAOA 1VQ8S 2ZZMA 4Q0BB 1QUVA 3R5DA 1W2IA 3N0VA 4UQGA 1R0AB 3TAQA 2RD5C 4DS5A 3V6DA 4FF3A 1VQYA 2PA3A 4O3PA 5KG2A 3K59A 2B6AA 2LEPA 1N33F 1HBUA 1H7XA 4ZPBA 5IT4A 1J2VA 2V94A 2LEAA 3KJVA 4PG6A 5EHHA 1NJXA 3KTQA 1UVNA 1LFWA 3EUNA 2VBYA 1IKXB 1TKTB 4Y65A 1KQFB 1S1XA 3SDEA 1GH8A 3ISND 4WKYA 4WFZA 5DM7Q 3FQKA 2CPZA 4RBTA 4CTAB 2GJIA 3LALA 3QLHA 3UDCA 2R8HA 2NUUG 3DOKA 1U49A 1CG2A 5DQIA 1Z2ZA 4LT6A 3PW2A 4RW4A 4ZPTR 4IUFA 1VLYA 5F0WA 3F44A 4ZP8A 4GC6A 2C22A 3ZFVA 4DQIA 2P6TA 3HP6A 1S97A 1SUQA 2HWHA 4X65F 5B09A 2EVZA 1C0TB 2DNOA 4RUHA 4H4OA 2YH0A 1SL2A 4UOCA 4WU3A 2XMJA 2KN4A 3I0SA 4TNOA 4EZ9A 2F9DA 4GMKA 3BQ1A 1U6FA 2MQOA 3QJPA 4F3OA 4HH0A 1S6PA 3TANA 4A48A 4JV2A 2KM8C 3PW0A 3N28A 3QAUA 5AE1A 3CULA 4RU9A 4I4BA 4TU7A 4YB7A 3NGKA 3H5YA 3HVTB 2UVUA 5DGAA 2EBEA 1UWBA 2CPXA 2YWKA 1QUPA 1VK8A 4B3OA 4A4JA 2CRLA 2KJWA 1ELOA 1N52B 3V2UC 2AWZA 2L9WA 2HAIA 5K8PA 2MJNA 2J6SA 4TLQA 1WTBA 3SCLE 1DZ5A 4PQAA 3AJ1A 2BBEA 4N76A 2X1BA 4RBVA 4LSNB 2B56A 1BY9A 4WFNQ 3M2VB 4DL4A 3MZIA 2XSJB 5AE3A 5GMKa 1JLGA 2OSRA 5K14A 1U1KA 2COLA 4YFUA 1N5YB 3RBDA 3QJJA 4H54A 3SEOA 2GW8A 3HKWA 3V6HA 2F4VF 2ROGA 3CSKA 2HHUA 3H59A 4M63A 4X62F 3NMAA 2YWHA 4X4UA 4ZHRB 2FUG9 3HLUA 1JLAA 3PACA 4KO0A 3C2PA 1JLQA 4O4RA 2LLZA 3OXFA 4AYBD 1S9GB 3CB4A 3T5LA 4ID5B 2C2DA 1H6KX 3MAHA 1U7LA 3W2VB 5L1JA 2JZ5A 1KSPA 1JB0C 4IG3A 5E41A 1PC4A 4A8WA 1Q7LB 3MDFA 4XDCA 3CIMA 3C3LA 1SH0A 2BOPA 5C42B 2CJQA 4DJBA 4GO7X 2KFYA 1DTQA 3E3XA 3TAMA 2EK6A 7FD1A 2WSEC 3ONQA 3M9NB 2FHJD 1RISA 2HS4A 4WFAQ 3MMBB 2DVIA 3GIMA 3WC0A 3QMQA 2HHSA 2KFNA 1YWXA 4DFMA 3E01A 3RB4A 3TO8A 3DN9A 1RTDB 5DQHA 5DO2A 3DOLA 1YJVA 3M2RA 3DLHA 2NQPA 4EBDA 1X4AA 3T1AA 2DRAA 2JJ4D 3JB9k 2NXUA 5L39A 2F3JA 2WBMA 1RT2A 1X4BA 1SH2A 4Q2MA 2CQIA 1H2TZ 4PXBA 1FJEB 3THPA 2RKIA 3PX0A 4QWEA 3UW1A 2DHXA 4N41A 3MOZA 3IGVA 5B7WA 3LPYA 3MM5A 4DR7F 1G7CB 1QM9A 1IUJA 2FHJA 2JOQA 3AQOA 2KI2A 2BJEA 2JEGA 3BDPA 2ZD1B 3RRHA 4XIUA 1X5PA 3I5CA 2R2RA 5KG1A 3KG0A 5GVQA 2IA0A 5A8RA 3IGNA 1N4LA 2DPIA 3QIPB 1P1LA 1GXLA 5AXLA 4RUCA 2IA6A 4A8YA 1FE0A 5KFEA 2W8KA 1KHVA 3MGJA 4MK8A 2EFVA 2X1AA 4FF1A 3MEGA 4LUBA 2CJKA 2VA3A 3OVBA 3BSOA 1Q4RA 3KHRA 5SZTA 4B3TF 2R7WA 3M30A 4NLPA 3K5MA 5A6WA 2OP5A 2UVWA 4WZMA 4C4WA 1TAQA 2ABYA 2HS0A 5J2PA 5E3CA 1L3VA 5F8GA 5L1LA 4C2MA 2MZ1A 2FJXA 2NPIA 1ZM9A 2VOPA 2ADBA 2M88A 3IA0A 4HTJA 2E29A 4G3IA 1ZPVA 2YNIA 1IKVB 2F8HA 2AF6A 2OSQA 4LIWA 3OLAA 1HNWF 3MECB 4PQUB 4I1TA 2WONB 2O1PA 4ZPDA 4CO4A 1U1NA 1U48A 3G71S 2ZFHA 3GQCA 4DLGA 2MZRA 3MM9B 4KFBA 2RQCA 4B02A 4IRDA 4WZQA 4M94A 2K7KA 3DLKB 4K4ZA 1HBMB 4KIAA 3TR5A 4Q43A 2JDJA 2LXFA 1NNDA 4QOTA 4N56A 2JVRA 3SSRA 2YVSA 3BGFA 2ACYA 2MKJA 1YIJS 1RKJA 3Q22A 3EPIA 2VFSA 4RW9B 3DDNA 1DBDA 2G4BA 5DRKA 1Y3KA 3PW5A 4NX9A 5HMZA 3PHEA 2HRYA 4LQ3A 2ZKUA 2ZHOA 2EFNA 1YVFA 2FHKA 1EP4A 2QT7A 5DM6Q 4CH1A 2APOA 1Y7PA 2F8EX 4IH5A 5L9XA 3T3FA 3MR5A 5B0CA 2K1RA 4LQ9A 1P9QC 1WHWA 2BZ2A 4MK7A 5E2QA 4KJIA 5IM0A 4OLOA 1SJ1A 4IRKA 4DG1B 1M5KC 4AL7A 3DLGA 2AJ1A 3DLEA 3FFIB 4ZPWR 3SFGA 2AGQA 2O3DA 1DHMA 2LU2A 3Q23A 4J9OA 3ETOA 1P6TA 4ES1A 5HI7A 1X9SA 5A8WB 3LGNA 2IFXA 3R5AA 3DLLQ 3UD3P 1MMNA 4EYHB 4BCAA 4TLRA 5FIIA 5I3QA 3OR2A 2DNQA 3EXYA 3MM8B 3SMZA 5FLXY 4ECQA 2W4DA 5LXRA 1QSYA 2GGPA 2HNYA 4HH1A 2UZAA 4DEZA 4RW7A 3KLFA 4QR1A 2FVQA 1KFDA 1S1UA 3OFEA 3OW2R 3M1VB 4J9PA 3MUVP 2FY1A 4O3NA 2AGPA 3OPKA 4G1PA 1YJNS 4DSJA 3DM2A 3P6YC 3P96A 4AE5A 2CZVC 5M2UA 1FJ7A 4WFYA 3T19A 3CCJS 2M4MA 1KEKA 1VC0A 2MKCA 4ED2A 3DC2A 2DH7A 1U1RA 2QMWA 1JMTA 3OR1B 1JJ4A 2ZH2A 1VBXA 2YKNA 2JFKA 1VC6A 3RBEA 4EGLA 2ZH1A 1M5VC 4MH8A 4J37A 3KK2A 1Y0HA 1SKRA 2BQRA 1TV6A 4NLSA 3CGIA 3MUMP 1XC9A 3LGMA 1U09A 2M0GB 3TVKA 3OHAA 3RB3A 3M8QB 1VGYA 4NLYA 3KLEB 1KNZA 2V4JA 2RDIA 4NCGB 4PCQA 3CDAA 3K57A 2QSWA 2FVSA 4JV1A 3GG0A 1U2FA 3CE8A 1Z4UA 3PJWA 5J2QB 1B7FA 2XHWA 4QIGA 2FLNA 2DGOA 2POKA 3OJSA 1ZPWX 2ZBIA 4OL8A 4UW2A 1JJ2R 3P3DA 2VOOA 3I87A 1R27B 1TL1B 3QPIA 5HBMA 2J9CA 3GE9A 1TP7A 2P9EA 3ZZRA 2LVWA 2QV6A 2VV5A 4OHVA 2JHEA 4OX6A 1Y5NB 1R0AA 4JUZA 2EG1A 3M2UA 1VIOA 3K5PA 4ZP9A 4ECWA 5G0RB 2QFJA 3V81B 2FJBB 3NNCA 7FDRA 3OFFA 1BQXA 1ZM3A 2B9YA 3MR2A 3PVXA 1GXTA 1ZBTA 1TL4A 4IFYA 4CO5A 5J1EA 5DLGA 3KLVA 3EZ5A 2ZC4A 2DR7A 2W8LA 1SIZA 2AJFE 2MGZA 1IKXA 4R5PB 3RW6A 3H20A 2C2EA 4O3OA 1HYSB 3BGLA 3SYZA 4CTAA 1TR0A 3NBPB 5G4DA 2KG1A 4H4MB 3O1LA 4RNFA 2XULA 1X7VA 1QY7A 1OWXA 2M7SA 1GX5A 3ENVA 4Y2AA 1W25A 1FDDA 1B0VA 4N8OA 4ZK7M 5GAGI 4HT5A 3H5XA 2B5JA 2QMXA 4PRFA 2JL9A 4O23A 2ASLA 4XK8C 2ZE2B 1V3SA 4HKQA 2GA7A 2UU9F 3QO9B 3JYTB 3NWGA 2FDNA 5KFFA 5JXSA 2AU0A 2ZDOA 4IH7A 2YKQA 3OBIA 4YDDB 3BN7A 2UXDF 2F1FA 4FF2A 3HDSA 4K4UA 4IOCQ 1D9FA 1U2RA 4NLGA 1RTHB 2R9LA 1C0TA 4ICLB 5EUHA 3QGIA 5T14A 1I1GA 2R7QA 3BZQA 4ZVEA 2KKHA 3BSCA 4OHXA 3VWSA 4NXNF 3DXBA 4MMOA 5HL7Q 4X4QA 2DO4A 3BSNA 5KFIA 1S99A 1WD6A 2PA8D 3KFWX 1R8AA 3RRKA 4OX9F 2KXFA 4OX7A 2WBRA 3HVTA 2F8MA 1LWFB 3JSYA 3M6UA 1YTYA 2BA9A 3U1MA 5KTQA 4J9RA 1NK5A 3PXGa 1T7PA 2YNFB 2ZH7A 2E1RA 2HYIB 2K2PA 2C42A 3VQSA 2ZDPA 2ASYA 2NUHA 1TAUA 2GJ2A 1VRTA 4IG0B 5GAGU 5BJRA 3CJ0A 3GR0A 4LF4F 1HPZB 3GZ7A 1GT8A