4JI5I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji5I00
4JI1I 4FWHA 3WU6A 4UTGA 4LF4E 3J80C 5LMNE 3CWVA 4DV0I 2BM0A 4JI6E 1XHKA 4JG4A 2V2VA 4DV1E 4DR6I 1FNMA 1N34I 2DEIA 1MX0A 1FI4A 4OX9E 1H72C 4LF6E 1K47A 2VQFE 4DR7E 4NXMI 2ZM6E 1N36E 4DR4I 4JI0I 1Z5BA 4NXNE 4DV2E 4DV6I 2WW4A 4LF5E 5LMUI 4DV5I 2UU9E 4LFBI 4K0KI 2ZBKB 2HFUA 3ZKDA 1N32I 1ZXNA 4EMDA 4JYAI 4LFAI 1Z0VA 4B3RI 2VQEI 2CZ9A 3QT7A 4ED4A 1ZM3A 4P52A 4B3ME 1HNZE 4DR1I 1I94E 4HY1A 2E5LE 1IBLI 4KHPE 4GKJE 4DXLA 1ZM9A 4JI8E 2HFSA 2UUBE 4LF8E 4XTJA 5LMNI 4JI6I 1MU5A 3QT5A 1PKPA 3K17A 4USKA 4DV1I 2UXCE 2HKJA 3PYEA 4DPTA 4OX9I 1IBME 1ZM4A 4LF6I 2VQFI 4PRVA 4JI3E 2ZITA 4HXZA 3J7AM 2AJ4A 2ZM6I 2HK2A 1DARA 1N36I 3GONA 1N0VC 4X66E 4DV3E 4LFCE 2UXBE 3ZKBA 4DV2I 2F4VE 4LF5I 4DR2I 1HNWE 4LF9E 2UU9I 4JI2E 4M1KA 5IWAE 4JV5E 3J81C 4LF7I 2GS8A 2HK3A 3WU5A 5GMDA 4R1FA 1PIEA 4P7AA 4DPXA 5LL6R 5BR8E 1Z0TA 4X65E 4DR5E 4YY3E 4PRXA 1Z0BA 1H7SA 2DEJA 1I94I 4DV7E 1S4EA 3ZZUA 2E5LI 4KHPI 4GKJI 4MYTA 4JI7E 4DUYE 2UUBI 4GKKE 1ZXMA 1FJGI 4B3TI 1MG7A 1KTVA 1D6TA 3OTOE 1J5EI 1XNRI 2HHHI 2UXCI 3ZM7A 4DU8A 4DUZE 4WUDA 4X64I 1HNXE 3H4LA 1IBMI 4FWDA 5IT9Q 4DR3I 1Z0GA 1VISA 3LPSA 3V2UC 4JI1E 1Z0WA 4X66I 4DV3I 2UXBI 4JI5I 4I3HA 2OI2A 4X62E 1OJ4A 2F4VI 4MYUA 5IT9C 4DR6E 2UXDE 1HNWI 5IWAI 4LF4I 5GMEA 1EA6A 1ELOA 4DU7A 3PYFA 1RR9A 2E1RA 4NXME 3T1HE 3T1YE 1KKHA 3JAMQ 4Z7YA 1S16A 4JI0E 5BR8I 1N33E 4DV6E 4DR7I 4X65I 3WU3A 1A6FA 1RREA 2EFGA 3J7AG 5LMUE 1PVGA 4YY3I 4DV5E 3D4JA 5FLXQ 4LFBE 3B8HA 4DV7I 4NXNI 4JI7I 3QT8A 4DUYI 4GKKI 1KIJA 1XMOE 4URLA 4DPUA 1Z59A 1XMQE 4DUZI 1XNQE 2A2DA 2UUAE 1EI1A 2V2ZA 2LJPA 1NHHA 4JI4E 3QT6A 3PYDA 1FKAE 4B3MI 4FN5A 4AQYE 2R42A 1IBKE 1NHIA 4X62I 1HNZI 2UXDI 2UUCE 4JI8I 4LF8I 1B63A 1WUUA 4HACB 1FWLA 3V5RA 2V2QA 3T1HI 3T1YI 3F0NA 1HR0E 1NZ0A 4DV4E 2HKEA 1NHJA 1N33I 4JI3I 2BM1A 5A2QQ 1Z5AA 1Z5CA 4B3SE 4WUCA 4DR2E 1QZRA 4YHHE 4HYMA 2VF3A 4Z7CA 3B78A 2X36A 3B82A 4KQVA 1N0UA 3WU4A 4LFCI 4DV0E 4RPFA 2J7KA 3PYGA 1B62A 1ZM2A 3ZZ0A 5L3JA 4LF7E 5A2QC 1N34E 3M6AA 2V8PA 1XMOI 4LF9I 4JI2I 1XMQI 1UEKA 1XNQI 2X7IA 2UUAI 1H7UA 4JV5I 4DPYA 3LTOA 1H74A 2BV3A 4DR4E 1BKNA 3K1JA 1FWKA 4JI4I 3Q1QA 4DR5I 1U2RA 1FJGE 4FWGA 4PU9A 4B3TE 2R3VA 4AQYI 1IBKI 4ZVIA 2NPFA 1J5EE 1XNRE 1Z0CA 2HHHE 4K0KE 3JAMC 3LNUA 2UUCI 1Z0EA 4X64E 1N32E 2A2CA 4FW9A 1KVKA 3OTOI 4DR3E 4HACA 4JYAE 4LFAE 2Q2EB 5FLXC 4DPWA 4WUBA 1HR0I 4B3RE 3J80Q 4DV4I 1H73A 4USMA 2VQEE 1HNXI 4UT4A 3ZZTA 4JI5E 2XEXA 3J81Q 2V34A 4DR1E 4B3SI 3HULA 1IBLE 4YHHI
chains in the Genus database with same CATH superfamily
4JI1I 4FWHA 4OO1E 3WU6A 4UTGA 4LF4E 3J80C 5LMNE 3CWVA 4DV0I 2BM0A 4JI6E 1XHKA 2O1WA 4JG4A 1HK7A 2V2VA 4DV1E 1Y4UA 2VESA 4DR6I 4AIDA 1FNMA 1N34I 1XXEA 2PO1B 2DEIA 1MX0A 1FI4A 4OX9E 1H72C 2JT2A 4LF6E 1K47A 4AM3A 2VQFE 4DR7E 4NXMI 2AE8A 2ZM6E 1N36E 3DD6A 4DR4I 2BA0G 2IOQA 4JI0I 1Z5BA 4NXNE 4DV2E 4LOMA 4DV6I 5DRRA 2WW4A 4LF5E 5LMUI 2Z5CA 1R6MA 5C0XA 4DV5I 3GMEA 2UU9E 2C39B 4LFBI 4K0KI 3M85G 2ZBKB 4MU3A 4FW7A 2C38A 4MU4A 2HFUA 4IS9A 2O3ZA 3M7ND 3ZKDA 5K36A 1N32I 5JEAC 1ZXNA 2O1VA 1YHCA 4EMDA 4JYAI 4LFAI 1Z0VA 4B3RI 1OYPA 4OZEA 2VQEI 1UDQA 2CZ9A 5JEAD 3QT7A 4ED4A 1ZM3A 4P52A 4B3ME 2GO3A 1Y6ZA 1HNZE 4DR1I 1I94E 4MU0A 4HY1A 4MDTA 2PO2B 2E5LE 1IBLI 4KHPE 4GKJE 4DXLA 1ZM9A 4J3DA 4JI8E 2HFSA 2UUBE 4LF8E 4XTJA 5JEAB 5LMNI 1UDOA 4JI6I 1MU5A 3QT5A 5EKWA 2Z5EA 1PKPA 3K17A 4USKA 4DV1I 1USVA 2UXCE 1RHYA 2HKJA 3PYEA 4U3BA 4DPTA 3PS3A 4OX9I 1OYRA 1IBME 1ZM4A 4LF6I 2VQFI 4PRVA 4JI3E 2PNZA 2ZITA 4HXZA 3J7AM 2AJ4A 2ZM6I 2HK2A 1DARA 4FW5A 1N36I 3GONA 2BA1D 4FW6A 2NN6F 2NN6D 1Y5YA 4OO1C 1N0VC 4X66E 3B4TA 4DV3E 4LFCE 2UXBE 2NN6E 3ZKBA 4DV2I 2F4VE 4LF5I 1OYSA 4DR2I 1Y60A 4OO1F 2IOPA 4OO1D 1HNWE 4LF9E 2UU9I 4JI2E 3Q6NA 4M1KA 2C39A 2NN6B 5IWAE 4JV5E 4OKGA 3J81C 4LF7I 2GS8A 2HK3A 3WU5A 4OO1B 5GMDA 4R1FA 1PIEA 2PNLA 4P7AA 4DPXA 2IERA 3Q6MA 5LL6R 3GLLA 5BR8E 1Z0TA 2PO0B 3NZKA 4X65E 4DR5E 4BA2A 4YY3E 4PRXA 5DNXA 1Z0BA 1H7SA 2DEJA 4BA1B 1I94I 4IZKB 4DV7E 1S4EA 3ZZUA 2E5LI 2JEBB 4KHPI 4GKJI 4MYTA 2PO2A 4JI7E 2O1UA 4DUYE 2UUBI 4GKKE 1ZXMA 1FJGI 2IESA 3P3CA 4B3TI 5DRQA 5JEAA 1MG7A 1KTVA 1D6TA 3OTOE 1J5EI 1XNRI 4FW4A 2HHHI 2UXCI 2C37B 3ZM7A 4DU8A 4DUZE 4MQYA 4WUDA 5EL9A 1VI7A 4X64I 1HNXE 5FWKA 4ISAA 3H4LA 1IBMI 1P42A 4FWDA 5IT9Q 4DR3I 3HJCA 4LCHA 1Z0GA 1VISA 4IFDC 3LPSA 3V2UC 4JI1E 3P3GA 1Z0WA 3PS1A 4X66I 4DV3I 3P3EA 4JI5I 2UXBI 4I3HA 4IFDF 2OI2A 2CVEA 4IFDD 4X62E 1OJ4A 2F4VI 4MYUA 1YH8A 4U3DA 5IT9C 4DR6E 2UXDE 4IFDE 1HNWI 1UDSA 5ELWA 5IWAI 4LF4I 2GQ0A 2NN6A 5GMEA 1EA6A 1ELOA 4DU7A 2JE6B 3PYFA 4IFDB 1RR9A 2E1RA 2WP8B 4NXME 3CDIA 3T1HE 3T1YE 1KKHA 1E3HA 3JAMQ 5C0XE 2BA0D 4MU1A 4OO1A 2PO1A 4Z7YA 1S16A 3L7ZB 4JI0E 5BR8I 2NN6C 1N33E 4LCFA 4DV6E 4DR7I 2GO4A 5K36F 5K36D 4X65I 2PO0A 3WU3A 1A6FA 1RREA 2EFGA 4GQUA 3J7AG 5LMUE 1PVGA 5K36E 4YY3I 4DV5E 3D4JA 5FLXQ 4LFBE 4BA1A 3B8HA 4DV7I 4IZKA 4NXNI 2JEBA 4JI7I 3QT8A 4DUYI 4GKKI 3UHMA 4N3OA 1KIJA 1XMOE 4URLA 4DPUA 1Z59A 1XMQE 4DUZI 2BR2B 1XNQE 2A2DA 2UUAE 4NBQA 1EI1A 2V2ZA 2LJPA 3M7NG 3PRYA 1NHHA 4JI4E 3QT6A 4IZJD 3PYDA 2Z5BB 1FKAE 4B3MI 4FN5A 2O1TA 4AQYE 3CDJA 2R42A 1IBKE 3GCMA 1NHIA 4X62I 1HNZI 2UXDI 1USUA 2UUCE 4FW3A 4JI8I 4IZJB 4LF8I 1B63A 1WUUA 2PNZB 3K85A 4HACB 1FWLA 3V5RA 2JE6A 4IFDA 2V2QA 3T1HI 3T1YI 2WP8A 3F0NA 1HR0E 2JEAB 5DROA 4LPFA 1NZ0A 4DV4E 2HKEA 1NHJA 2WNRB 3L7ZA 1N33I 4JI3I 2BM1A 5A2QQ 1Z5AA 1Z5CA 4B3SE 3H1CA 4WUCA 4DR2E 1QZRA 4YHHE 3HKMA 2VF3A 4HYMA 2BA1G 4Z7CA 3B78A 2X36A 3B82A 4KQVA 1N0UA 3WU4A 4LFCI 4DV0E 3P76A 4RPFA 1E3PA 2J7KA 3U1KA 1R6LA 3PYGA 1B62A 1ZM2A 3ZZ0A 5L3JA 4LF7E 5A2QC 1N34E 3M6AA 2V8PA 1XMOI 4AIMA 4LF9I 4LCGA 5C0XC 4JI2I 1XMQI 1UEKA 4QNJA 1XNQI 1UDNA 2BR2A 2X7IA 4BA2B 5JEAF 2UUAI 1H7UA 4JV5I 5C0XF 5C0XD 4DPYA 3LTOA 5K36C 5JEAE 2PNMA 1H74A 2BV3A 4DR4E 1BKNA 3K1JA 3P06A 1FWKA 4JI4I 3Q1QA 4DR5I 1U2RA 1FJGE 2Z5CB 4FWGA 4PU9A 4B3TE 5C0XB 2Z5BA 2F1DA 2R3VA 4AQYI 3PS2A 1IBKI 4ZVIA 2NPFA 1J5EE 1XNRE 3M85D 1Z0CA 2HHHE 4K0KE 3JAMC 1Y4SA 2J65A 2C38B 3LNUA 4QNKA 2UUCI 1Z0EA 5DRPA 4X64E 5K36B 4IZJA 3U1YA 1N32E 2A2CA 4FW9A 1KVKA 3OTOI 4DR3E 4HACA 4JYAE 4LFAE 2Q2EB 5FLXC 4DPWA 4WUBA 1HR0I 4B3RE 2C37A 3J80Q 3KRNA 4DV4I 1H73A 5DNLA 4USMA 2VQEE 2JEAA 1HNXI 4UT4A 2CGEA 3ZZTA 2CG9A 4JI5E 2XEXA 3J81Q 2WNRA 2V34A 4DR1E 4B3SI 3HULA 1IBLE 4YHHI
chains in the Genus database with same CATH topology
4JI1I 4FWHA 3WU6A 4UTGA 4LF4E 3J80C 5LMNE 3CWVA 4DV0I 2BM0A 4JI6E 1XHKA 2O1WA 4JG4A 1HK7A 2V2VA 4DV1E 1Y4UA 4DR6I 1FNMA 1N34I 2DEIA 1MX0A 1FI4A 4OX9E 1H72C 4LF6E 1K47A 2VQFE 4DR7E 4NXMI 2ZM6E 1N36E 4DR4I 2IOQA 4JI0I 1Z5BA 4NXNE 4DV2E 4DV6I 2WW4A 4LF5E 5LMUI 2Z5CA 4DV5I 2UU9E 4LFBI 4K0KI 2ZBKB 2HFUA 3ZKDA 1N32I 1ZXNA 2O1VA 4EMDA 4JYAI 4LFAI 1Z0VA 4B3RI 2VQEI 2CZ9A 3QT7A 4ED4A 1ZM3A 4P52A 4B3ME 1Y6ZA 1HNZE 4DR1I 1I94E 4HY1A 2E5LE 1IBLI 4KHPE 4GKJE 4DXLA 1ZM9A 4JI8E 2HFSA 2UUBE 4LF8E 4XTJA 5LMNI 4JI6I 1MU5A 3QT5A 2Z5EA 1PKPA 3K17A 4USKA 4DV1I 1USVA 2UXCE 2HKJA 3PYEA 4DPTA 4OX9I 1IBME 1ZM4A 4LF6I 2VQFI 4PRVA 4JI3E 2ZITA 4HXZA 3J7AM 2AJ4A 2ZM6I 2HK2A 1DARA 1N36I 3GONA 1N0VC 4X66E 4DV3E 4LFCE 2UXBE 3ZKBA 4DV2I 2F4VE 4LF5I 4DR2I 2IOPA 1HNWE 4LF9E 2UU9I 4JI2E 3Q6NA 4M1KA 5IWAE 4JV5E 3J81C 4LF7I 2GS8A 2HK3A 3WU5A 5GMDA 4R1FA 1PIEA 2PNLA 4P7AA 4DPXA 3Q6MA 5LL6R 5BR8E 1Z0TA 4X65E 4DR5E 4YY3E 4PRXA 1Z0BA 1H7SA 2DEJA 1I94I 4IZKB 4DV7E 1S4EA 3ZZUA 2E5LI 4KHPI 4GKJI 4MYTA 4JI7E 2O1UA 4DUYE 2UUBI 4GKKE 1ZXMA 1FJGI 4B3TI 1MG7A 1KTVA 1D6TA 3OTOE 1J5EI 1XNRI 2HHHI 2UXCI 3ZM7A 4DU8A 4DUZE 4WUDA 4X64I 1HNXE 5FWKA 3H4LA 1IBMI 4FWDA 5IT9Q 4DR3I 3HJCA 1Z0GA 1VISA 3LPSA 3V2UC 4JI1E 1Z0WA 4X66I 4DV3I 2UXBI 4JI5I 4I3HA 2OI2A 4X62E 1OJ4A 2F4VI 4MYUA 5IT9C 4DR6E 2UXDE 1HNWI 5IWAI 4LF4I 2GQ0A 5GMEA 1EA6A 1ELOA 4DU7A 3PYFA 1RR9A 2E1RA 4NXME 3T1HE 3T1YE 1KKHA 3JAMQ 4Z7YA 1S16A 4JI0E 5BR8I 1N33E 4DV6E 4DR7I 4X65I 3WU3A 1A6FA 1RREA 2EFGA 3J7AG 5LMUE 1PVGA 4YY3I 4DV5E 3D4JA 5FLXQ 4LFBE 3B8HA 4DV7I 4IZKA 4NXNI 4JI7I 3QT8A 4DUYI 4GKKI 4N3OA 1KIJA 1XMOE 4URLA 4DPUA 1Z59A 1XMQE 4DUZI 1XNQE 2A2DA 2UUAE 1EI1A 2V2ZA 2LJPA 3PRYA 1NHHA 4JI4E 3QT6A 4IZJD 3PYDA 2Z5BB 1FKAE 4B3MI 4FN5A 2O1TA 4AQYE 2R42A 1IBKE 1NHIA 4X62I 1HNZI 2UXDI 1USUA 2UUCE 4JI8I 4IZJB 4LF8I 1B63A 1WUUA 3K85A 4HACB 1FWLA 3V5RA 2V2QA 3T1HI 3T1YI 3F0NA 1HR0E 1NZ0A 4DV4E 2HKEA 1NHJA 1N33I 4JI3I 2BM1A 5A2QQ 1Z5AA 1Z5CA 4B3SE 4WUCA 4DR2E 1QZRA 4YHHE 4HYMA 2VF3A 4Z7CA 3B78A 2X36A 3B82A 4KQVA 1N0UA 3WU4A 4LFCI 4DV0E 4RPFA 2J7KA 3PYGA 1B62A 1ZM2A 3ZZ0A 5L3JA 4LF7E 5A2QC 1N34E 3M6AA 2V8PA 1XMOI 4LF9I 4JI2I 1XMQI 1UEKA 1XNQI 2X7IA 2UUAI 1H7UA 4JV5I 4DPYA 3LTOA 2PNMA 1H74A 2BV3A 4DR4E 1BKNA 3K1JA 3P06A 1FWKA 4JI4I 3Q1QA 4DR5I 1U2RA 1FJGE 2Z5CB 4FWGA 4PU9A 4B3TE 2Z5BA 2R3VA 4AQYI 1IBKI 4ZVIA 2NPFA 1J5EE 1XNRE 1Z0CA 2HHHE 4K0KE 3JAMC 1Y4SA 3LNUA 2UUCI 1Z0EA 4X64E 4IZJA 1N32E 2A2CA 4FW9A 1KVKA 3OTOI 4DR3E 4HACA 4JYAE 4LFAE 2Q2EB 5FLXC 4DPWA 4WUBA 1HR0I 4B3RE 3J80Q 4DV4I 1H73A 4USMA 2VQEE 1HNXI 4UT4A 2CGEA 3ZZTA 2CG9A 4JI5E 2XEXA 3J81Q 2V34A 4DR1E 4B3SI 3HULA 1IBLE 4YHHI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI1 I;  4FWH A;  3WU6 A;  4UTG A;  4LF4 E;  3J80 C;  5LMN E;  3CWV A;  4DV0 I;  2BM0 A;  4JI6 E;  1XHK A;  4JG4 A;  2V2V A;  4DV1 E;  4DR6 I;  1FNM A;  1N34 I;  2DEI A;  1MX0 A;  1FI4 A;  4OX9 E;  1H72 C;  4LF6 E;  1K47 A;  2VQF E;  4DR7 E;  4NXM I;  2ZM6 E;  1N36 E;  4DR4 I;  4JI0 I;  1Z5B A;  4NXN E;  4DV2 E;  4DV6 I;  2WW4 A;  4LF5 E;  5LMU I;  4DV5 I;  2UU9 E;  4LFB I;  4K0K I;  2ZBK B;  2HFU A;  3ZKD A;  1N32 I;  1ZXN A;  4EMD A;  4JYA I;  4LFA I;  1Z0V A;  4B3R I;  2VQE I;  2CZ9 A;  3QT7 A;  4ED4 A;  1ZM3 A;  4P52 A;  4B3M E;  1HNZ E;  4DR1 I;  1I94 E;  4HY1 A;  2E5L E;  1IBL I;  4KHP E;  4GKJ E;  4DXL A;  1ZM9 A;  4JI8 E;  2HFS A;  2UUB E;  4LF8 E;  4XTJ A;  5LMN I;  4JI6 I;  1MU5 A;  3QT5 A;  1PKP A;  3K17 A;  4USK A;  4DV1 I;  2UXC E;  2HKJ A;  3PYE A;  4DPT A;  4OX9 I;  1IBM E;  1ZM4 A;  4LF6 I;  2VQF I;  4PRV A;  4JI3 E;  2ZIT A;  4HXZ A;  3J7A M;  2AJ4 A;  2ZM6 I;  2HK2 A;  1DAR A;  1N36 I;  3GON A;  1N0V C;  4X66 E;  4DV3 E;  4LFC E;  2UXB E;  3ZKB A;  4DV2 I;  2F4V E;  4LF5 I;  4DR2 I;  1HNW E;  4LF9 E;  2UU9 I;  4JI2 E;  4M1K A;  5IWA E;  4JV5 E;  3J81 C;  4LF7 I;  2GS8 A;  2HK3 A;  3WU5 A;  5GMD A;  4R1F A;  1PIE A;  4P7A A;  4DPX A;  5LL6 R;  5BR8 E;  1Z0T A;  4X65 E;  4DR5 E;  4YY3 E;  4PRX A;  1Z0B A;  1H7S A;  2DEJ A;  1I94 I;  4DV7 E;  1S4E A;  3ZZU A;  2E5L I;  4KHP I;  4GKJ I;  4MYT A;  4JI7 E;  4DUY E;  2UUB I;  4GKK E;  1ZXM A;  1FJG I;  4B3T I;  1MG7 A;  1KTV A;  1D6T A;  3OTO E;  1J5E I;  1XNR I;  2HHH I;  2UXC I;  3ZM7 A;  4DU8 A;  4DUZ E;  4WUD A;  4X64 I;  1HNX E;  3H4L A;  1IBM I;  4FWD A;  5IT9 Q;  4DR3 I;  1Z0G A;  1VIS A;  3LPS A;  3V2U C;  4JI1 E;  1Z0W A;  4X66 I;  4DV3 I;  2UXB I;  4JI5 I;  4I3H A;  2OI2 A;  4X62 E;  1OJ4 A;  2F4V I;  4MYU A;  5IT9 C;  4DR6 E;  2UXD E;  1HNW I;  5IWA I;  4LF4 I;  5GME A;  1EA6 A;  1ELO A;  4DU7 A;  3PYF A;  1RR9 A;  2E1R A;  4NXM E;  3T1H E;  3T1Y E;  1KKH A;  3JAM Q;  4Z7Y A;  1S16 A;  4JI0 E;  5BR8 I;  1N33 E;  4DV6 E;  4DR7 I;  4X65 I;  3WU3 A;  1A6F A;  1RRE A;  2EFG A;  3J7A G;  5LMU E;  1PVG A;  4YY3 I;  4DV5 E;  3D4J A;  5FLX Q;  4LFB E;  3B8H A;  4DV7 I;  4NXN I;  4JI7 I;  3QT8 A;  4DUY I;  4GKK I;  1KIJ A;  1XMO E;  4URL A;  4DPU A;  1Z59 A;  1XMQ E;  4DUZ I;  1XNQ E;  2A2D A;  2UUA E;  1EI1 A;  2V2Z A;  2LJP A;  1NHH A;  4JI4 E;  3QT6 A;  3PYD A;  1FKA E;  4B3M I;  4FN5 A;  4AQY E;  2R42 A;  1IBK E;  1NHI A;  4X62 I;  1HNZ I;  2UXD I;  2UUC E;  4JI8 I;  4LF8 I;  1B63 A;  1WUU A;  4HAC B;  1FWL A;  3V5R A;  2V2Q A;  3T1H I;  3T1Y I;  3F0N A;  1HR0 E;  1NZ0 A;  4DV4 E;  2HKE A;  1NHJ A;  1N33 I;  4JI3 I;  2BM1 A;  5A2Q Q;  1Z5A A;  1Z5C A;  4B3S E;  4WUC A;  4DR2 E;  1QZR A;  4YHH E;  4HYM A;  2VF3 A;  4Z7C A;  3B78 A;  2X36 A;  3B82 A;  4KQV A;  1N0U A;  3WU4 A;  4LFC I;  4DV0 E;  4RPF A;  2J7K A;  3PYG A;  1B62 A;  1ZM2 A;  3ZZ0 A;  5L3J A;  4LF7 E;  5A2Q C;  1N34 E;  3M6A A;  2V8P A;  1XMO I;  4LF9 I;  4JI2 I;  1XMQ I;  1UEK A;  1XNQ I;  2X7I A;  2UUA I;  1H7U A;  4JV5 I;  4DPY A;  3LTO A;  1H74 A;  2BV3 A;  4DR4 E;  1BKN A;  3K1J A;  1FWK A;  4JI4 I;  3Q1Q A;  4DR5 I;  1U2R A;  1FJG E;  4FWG A;  4PU9 A;  4B3T E;  2R3V A;  4AQY I;  1IBK I;  4ZVI A;  2NPF A;  1J5E E;  1XNR E;  1Z0C A;  2HHH E;  4K0K E;  3JAM C;  3LNU A;  2UUC I;  1Z0E A;  4X64 E;  1N32 E;  2A2C A;  4FW9 A;  1KVK A;  3OTO I;  4DR3 E;  4HAC A;  4JYA E;  4LFA E;  2Q2E B;  5FLX C;  4DPW A;  4WUB A;  1HR0 I;  4B3R E;  3J80 Q;  4DV4 I;  1H73 A;  4USM A;  2VQE E;  1HNX I;  4UT4 A;  3ZZT A;  4JI5 E;  2XEX A;  3J81 Q;  2V34 A;  4DR1 E;  4B3S I;  3HUL A;  1IBL E;  4YHH I; 
#chains in the Genus database with same CATH topology
 4JI1 I;  4FWH A;  4OO1 E;  3WU6 A;  4UTG A;  4LF4 E;  3J80 C;  5LMN E;  3CWV A;  4DV0 I;  2BM0 A;  4JI6 E;  1XHK A;  2O1W A;  4JG4 A;  1HK7 A;  2V2V A;  4DV1 E;  1Y4U A;  2VES A;  4DR6 I;  4AID A;  1FNM A;  1N34 I;  1XXE A;  2PO1 B;  2DEI A;  1MX0 A;  1FI4 A;  4OX9 E;  1H72 C;  2JT2 A;  4LF6 E;  1K47 A;  4AM3 A;  2VQF E;  4DR7 E;  4NXM I;  2AE8 A;  2ZM6 E;  1N36 E;  3DD6 A;  4DR4 I;  2BA0 G;  2IOQ A;  4JI0 I;  1Z5B A;  4NXN E;  4DV2 E;  4LOM A;  4DV6 I;  5DRR A;  2WW4 A;  4LF5 E;  5LMU I;  2Z5C A;  1R6M A;  5C0X A;  4DV5 I;  3GME A;  2UU9 E;  2C39 B;  4LFB I;  4K0K I;  3M85 G;  2ZBK B;  4MU3 A;  4FW7 A;  2C38 A;  4MU4 A;  2HFU A;  4IS9 A;  2O3Z A;  3M7N D;  3ZKD A;  5K36 A;  1N32 I;  5JEA C;  1ZXN A;  2O1V A;  1YHC A;  4EMD A;  4JYA I;  4LFA I;  1Z0V A;  4B3R I;  1OYP A;  4OZE A;  2VQE I;  1UDQ A;  2CZ9 A;  5JEA D;  3QT7 A;  4ED4 A;  1ZM3 A;  4P52 A;  4B3M E;  2GO3 A;  1Y6Z A;  1HNZ E;  4DR1 I;  1I94 E;  4MU0 A;  4HY1 A;  4MDT A;  2PO2 B;  2E5L E;  1IBL I;  4KHP E;  4GKJ E;  4DXL A;  1ZM9 A;  4J3D A;  4JI8 E;  2HFS A;  2UUB E;  4LF8 E;  4XTJ A;  5JEA B;  5LMN I;  1UDO A;  4JI6 I;  1MU5 A;  3QT5 A;  5EKW A;  2Z5E A;  1PKP A;  3K17 A;  4USK A;  4DV1 I;  1USV A;  2UXC E;  1RHY A;  2HKJ A;  3PYE A;  4U3B A;  4DPT A;  3PS3 A;  4OX9 I;  1OYR A;  1IBM E;  1ZM4 A;  4LF6 I;  2VQF I;  4PRV A;  4JI3 E;  2PNZ A;  2ZIT A;  4HXZ A;  3J7A M;  2AJ4 A;  2ZM6 I;  2HK2 A;  1DAR A;  4FW5 A;  1N36 I;  3GON A;  2BA1 D;  4FW6 A;  2NN6 F;  2NN6 D;  1Y5Y A;  4OO1 C;  1N0V C;  4X66 E;  3B4T A;  4DV3 E;  4LFC E;  2UXB E;  2NN6 E;  3ZKB A;  4DV2 I;  2F4V E;  4LF5 I;  1OYS A;  4DR2 I;  1Y60 A;  4OO1 F;  2IOP A;  4OO1 D;  1HNW E;  4LF9 E;  2UU9 I;  4JI2 E;  3Q6N A;  4M1K A;  2C39 A;  2NN6 B;  5IWA E;  4JV5 E;  4OKG A;  3J81 C;  4LF7 I;  2GS8 A;  2HK3 A;  3WU5 A;  4OO1 B;  5GMD A;  4R1F A;  1PIE A;  2PNL A;  4P7A A;  4DPX A;  2IER A;  3Q6M A;  5LL6 R;  3GLL A;  5BR8 E;  1Z0T A;  2PO0 B;  3NZK A;  4X65 E;  4DR5 E;  4BA2 A;  4YY3 E;  4PRX A;  5DNX A;  1Z0B A;  1H7S A;  2DEJ A;  4BA1 B;  1I94 I;  4IZK B;  4DV7 E;  1S4E A;  3ZZU A;  2E5L I;  2JEB B;  4KHP I;  4GKJ I;  4MYT A;  2PO2 A;  4JI7 E;  2O1U A;  4DUY E;  2UUB I;  4GKK E;  1ZXM A;  1FJG I;  2IES A;  3P3C A;  4B3T I;  5DRQ A;  5JEA A;  1MG7 A;  1KTV A;  1D6T A;  3OTO E;  1J5E I;  1XNR I;  4FW4 A;  2HHH I;  2UXC I;  2C37 B;  3ZM7 A;  4DU8 A;  4DUZ E;  4MQY A;  4WUD A;  5EL9 A;  1VI7 A;  4X64 I;  1HNX E;  5FWK A;  4ISA A;  3H4L A;  1IBM I;  1P42 A;  4FWD A;  5IT9 Q;  4DR3 I;  3HJC A;  4LCH A;  1Z0G A;  1VIS A;  4IFD C;  3LPS A;  3V2U C;  4JI1 E;  3P3G A;  1Z0W A;  3PS1 A;  4X66 I;  4DV3 I;  3P3E A;  4JI5 I;  2UXB I;  4I3H A;  4IFD F;  2OI2 A;  2CVE A;  4IFD D;  4X62 E;  1OJ4 A;  2F4V I;  4MYU A;  1YH8 A;  4U3D A;  5IT9 C;  4DR6 E;  2UXD E;  4IFD E;  1HNW I;  1UDS A;  5ELW A;  5IWA I;  4LF4 I;  2GQ0 A;  2NN6 A;  5GME A;  1EA6 A;  1ELO A;  4DU7 A;  2JE6 B;  3PYF A;  4IFD B;  1RR9 A;  2E1R A;  2WP8 B;  4NXM E;  3CDI A;  3T1H E;  3T1Y E;  1KKH A;  1E3H A;  3JAM Q;  5C0X E;  2BA0 D;  4MU1 A;  4OO1 A;  2PO1 A;  4Z7Y A;  1S16 A;  3L7Z B;  4JI0 E;  5BR8 I;  2NN6 C;  1N33 E;  4LCF A;  4DV6 E;  4DR7 I;  2GO4 A;  5K36 F;  5K36 D;  4X65 I;  2PO0 A;  3WU3 A;  1A6F A;  1RRE A;  2EFG A;  4GQU A;  3J7A G;  5LMU E;  1PVG A;  5K36 E;  4YY3 I;  4DV5 E;  3D4J A;  5FLX Q;  4LFB E;  4BA1 A;  3B8H A;  4DV7 I;  4IZK A;  4NXN I;  2JEB A;  4JI7 I;  3QT8 A;  4DUY I;  4GKK I;  3UHM A;  4N3O A;  1KIJ A;  1XMO E;  4URL A;  4DPU A;  1Z59 A;  1XMQ E;  4DUZ I;  2BR2 B;  1XNQ E;  2A2D A;  2UUA E;  4NBQ A;  1EI1 A;  2V2Z A;  2LJP A;  3M7N G;  3PRY A;  1NHH A;  4JI4 E;  3QT6 A;  4IZJ D;  3PYD A;  2Z5B B;  1FKA E;  4B3M I;  4FN5 A;  2O1T A;  4AQY E;  3CDJ A;  2R42 A;  1IBK E;  3GCM A;  1NHI A;  4X62 I;  1HNZ I;  2UXD I;  1USU A;  2UUC E;  4FW3 A;  4JI8 I;  4IZJ B;  4LF8 I;  1B63 A;  1WUU A;  2PNZ B;  3K85 A;  4HAC B;  1FWL A;  3V5R A;  2JE6 A;  4IFD A;  2V2Q A;  3T1H I;  3T1Y I;  2WP8 A;  3F0N A;  1HR0 E;  2JEA B;  5DRO A;  4LPF A;  1NZ0 A;  4DV4 E;  2HKE A;  1NHJ A;  2WNR B;  3L7Z A;  1N33 I;  4JI3 I;  2BM1 A;  5A2Q Q;  1Z5A A;  1Z5C A;  4B3S E;  3H1C A;  4WUC A;  4DR2 E;  1QZR A;  4YHH E;  3HKM A;  2VF3 A;  4HYM A;  2BA1 G;  4Z7C A;  3B78 A;  2X36 A;  3B82 A;  4KQV A;  1N0U A;  3WU4 A;  4LFC I;  4DV0 E;  3P76 A;  4RPF A;  1E3P A;  2J7K A;  3U1K A;  1R6L A;  3PYG A;  1B62 A;  1ZM2 A;  3ZZ0 A;  5L3J A;  4LF7 E;  5A2Q C;  1N34 E;  3M6A A;  2V8P A;  1XMO I;  4AIM A;  4LF9 I;  4LCG A;  5C0X C;  4JI2 I;  1XMQ I;  1UEK A;  4QNJ A;  1XNQ I;  1UDN A;  2BR2 A;  2X7I A;  4BA2 B;  5JEA F;  2UUA I;  1H7U A;  4JV5 I;  5C0X F;  5C0X D;  4DPY A;  3LTO A;  5K36 C;  5JEA E;  2PNM A;  1H74 A;  2BV3 A;  4DR4 E;  1BKN A;  3K1J A;  3P06 A;  1FWK A;  4JI4 I;  3Q1Q A;  4DR5 I;  1U2R A;  1FJG E;  2Z5C B;  4FWG A;  4PU9 A;  4B3T E;  5C0X B;  2Z5B A;  2F1D A;  2R3V A;  4AQY I;  3PS2 A;  1IBK I;  4ZVI A;  2NPF A;  1J5E E;  1XNR E;  3M85 D;  1Z0C A;  2HHH E;  4K0K E;  3JAM C;  1Y4S A;  2J65 A;  2C38 B;  3LNU A;  4QNK A;  2UUC I;  1Z0E A;  5DRP A;  4X64 E;  5K36 B;  4IZJ A;  3U1Y A;  1N32 E;  2A2C A;  4FW9 A;  1KVK A;  3OTO I;  4DR3 E;  4HAC A;  4JYA E;  4LFA E;  2Q2E B;  5FLX C;  4DPW A;  4WUB A;  1HR0 I;  4B3R E;  2C37 A;  3J80 Q;  3KRN A;  4DV4 I;  1H73 A;  5DNL A;  4USM A;  2VQE E;  2JEA A;  1HNX I;  4UT4 A;  2CGE A;  3ZZT A;  2CG9 A;  4JI5 E;  2XEX A;  3J81 Q;  2WNR A;  2V34 A;  4DR1 E;  4B3S I;  3HUL A;  1IBL E;  4YHH I; 
#chains in the Genus database with same CATH homology
 4JI1 I;  4FWH A;  3WU6 A;  4UTG A;  4LF4 E;  3J80 C;  5LMN E;  3CWV A;  4DV0 I;  2BM0 A;  4JI6 E;  1XHK A;  2O1W A;  4JG4 A;  1HK7 A;  2V2V A;  4DV1 E;  1Y4U A;  4DR6 I;  1FNM A;  1N34 I;  2DEI A;  1MX0 A;  1FI4 A;  4OX9 E;  1H72 C;  4LF6 E;  1K47 A;  2VQF E;  4DR7 E;  4NXM I;  2ZM6 E;  1N36 E;  4DR4 I;  2IOQ A;  4JI0 I;  1Z5B A;  4NXN E;  4DV2 E;  4DV6 I;  2WW4 A;  4LF5 E;  5LMU I;  2Z5C A;  4DV5 I;  2UU9 E;  4LFB I;  4K0K I;  2ZBK B;  2HFU A;  3ZKD A;  1N32 I;  1ZXN A;  2O1V A;  4EMD A;  4JYA I;  4LFA I;  1Z0V A;  4B3R I;  2VQE I;  2CZ9 A;  3QT7 A;  4ED4 A;  1ZM3 A;  4P52 A;  4B3M E;  1Y6Z A;  1HNZ E;  4DR1 I;  1I94 E;  4HY1 A;  2E5L E;  1IBL I;  4KHP E;  4GKJ E;  4DXL A;  1ZM9 A;  4JI8 E;  2HFS A;  2UUB E;  4LF8 E;  4XTJ A;  5LMN I;  4JI6 I;  1MU5 A;  3QT5 A;  2Z5E A;  1PKP A;  3K17 A;  4USK A;  4DV1 I;  1USV A;  2UXC E;  2HKJ A;  3PYE A;  4DPT A;  4OX9 I;  1IBM E;  1ZM4 A;  4LF6 I;  2VQF I;  4PRV A;  4JI3 E;  2ZIT A;  4HXZ A;  3J7A M;  2AJ4 A;  2ZM6 I;  2HK2 A;  1DAR A;  1N36 I;  3GON A;  1N0V C;  4X66 E;  4DV3 E;  4LFC E;  2UXB E;  3ZKB A;  4DV2 I;  2F4V E;  4LF5 I;  4DR2 I;  2IOP A;  1HNW E;  4LF9 E;  2UU9 I;  4JI2 E;  3Q6N A;  4M1K A;  5IWA E;  4JV5 E;  3J81 C;  4LF7 I;  2GS8 A;  2HK3 A;  3WU5 A;  5GMD A;  4R1F A;  1PIE A;  2PNL A;  4P7A A;  4DPX A;  3Q6M A;  5LL6 R;  5BR8 E;  1Z0T A;  4X65 E;  4DR5 E;  4YY3 E;  4PRX A;  1Z0B A;  1H7S A;  2DEJ A;  1I94 I;  4IZK B;  4DV7 E;  1S4E A;  3ZZU A;  2E5L I;  4KHP I;  4GKJ I;  4MYT A;  4JI7 E;  2O1U A;  4DUY E;  2UUB I;  4GKK E;  1ZXM A;  1FJG I;  4B3T I;  1MG7 A;  1KTV A;  1D6T A;  3OTO E;  1J5E I;  1XNR I;  2HHH I;  2UXC I;  3ZM7 A;  4DU8 A;  4DUZ E;  4WUD A;  4X64 I;  1HNX E;  5FWK A;  3H4L A;  1IBM I;  4FWD A;  5IT9 Q;  4DR3 I;  3HJC A;  1Z0G A;  1VIS A;  3LPS A;  3V2U C;  4JI1 E;  1Z0W A;  4X66 I;  4DV3 I;  2UXB I;  4JI5 I;  4I3H A;  2OI2 A;  4X62 E;  1OJ4 A;  2F4V I;  4MYU A;  5IT9 C;  4DR6 E;  2UXD E;  1HNW I;  5IWA I;  4LF4 I;  2GQ0 A;  5GME A;  1EA6 A;  1ELO A;  4DU7 A;  3PYF A;  1RR9 A;  2E1R A;  4NXM E;  3T1H E;  3T1Y E;  1KKH A;  3JAM Q;  4Z7Y A;  1S16 A;  4JI0 E;  5BR8 I;  1N33 E;  4DV6 E;  4DR7 I;  4X65 I;  3WU3 A;  1A6F A;  1RRE A;  2EFG A;  3J7A G;  5LMU E;  1PVG A;  4YY3 I;  4DV5 E;  3D4J A;  5FLX Q;  4LFB E;  3B8H A;  4DV7 I;  4IZK A;  4NXN I;  4JI7 I;  3QT8 A;  4DUY I;  4GKK I;  4N3O A;  1KIJ A;  1XMO E;  4URL A;  4DPU A;  1Z59 A;  1XMQ E;  4DUZ I;  1XNQ E;  2A2D A;  2UUA E;  1EI1 A;  2V2Z A;  2LJP A;  3PRY A;  1NHH A;  4JI4 E;  3QT6 A;  4IZJ D;  3PYD A;  2Z5B B;  1FKA E;  4B3M I;  4FN5 A;  2O1T A;  4AQY E;  2R42 A;  1IBK E;  1NHI A;  4X62 I;  1HNZ I;  2UXD I;  1USU A;  2UUC E;  4JI8 I;  4IZJ B;  4LF8 I;  1B63 A;  1WUU A;  3K85 A;  4HAC B;  1FWL A;  3V5R A;  2V2Q A;  3T1H I;  3T1Y I;  3F0N A;  1HR0 E;  1NZ0 A;  4DV4 E;  2HKE A;  1NHJ A;  1N33 I;  4JI3 I;  2BM1 A;  5A2Q Q;  1Z5A A;  1Z5C A;  4B3S E;  4WUC A;  4DR2 E;  1QZR A;  4YHH E;  4HYM A;  2VF3 A;  4Z7C A;  3B78 A;  2X36 A;  3B82 A;  4KQV A;  1N0U A;  3WU4 A;  4LFC I;  4DV0 E;  4RPF A;  2J7K A;  3PYG A;  1B62 A;  1ZM2 A;  3ZZ0 A;  5L3J A;  4LF7 E;  5A2Q C;  1N34 E;  3M6A A;  2V8P A;  1XMO I;  4LF9 I;  4JI2 I;  1XMQ I;  1UEK A;  1XNQ I;  2X7I A;  2UUA I;  1H7U A;  4JV5 I;  4DPY A;  3LTO A;  2PNM A;  1H74 A;  2BV3 A;  4DR4 E;  1BKN A;  3K1J A;  3P06 A;  1FWK A;  4JI4 I;  3Q1Q A;  4DR5 I;  1U2R A;  1FJG E;  2Z5C B;  4FWG A;  4PU9 A;  4B3T E;  2Z5B A;  2R3V A;  4AQY I;  1IBK I;  4ZVI A;  2NPF A;  1J5E E;  1XNR E;  1Z0C A;  2HHH E;  4K0K E;  3JAM C;  1Y4S A;  3LNU A;  2UUC I;  1Z0E A;  4X64 E;  4IZJ A;  1N32 E;  2A2C A;  4FW9 A;  1KVK A;  3OTO I;  4DR3 E;  4HAC A;  4JYA E;  4LFA E;  2Q2E B;  5FLX C;  4DPW A;  4WUB A;  1HR0 I;  4B3R E;  3J80 Q;  4DV4 I;  1H73 A;  4USM A;  2VQE E;  1HNX I;  4UT4 A;  2CGE A;  3ZZT A;  2CG9 A;  4JI5 E;  2XEX A;  3J81 Q;  2V34 A;  4DR1 E;  4B3S I;  3HUL A;  1IBL E;  4YHH I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...