4JI5I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome/antibiotic
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji5I00
3LTOA 2UUCE 2VF3A 1XNRE 2VQEE 1XMQE 2VQFI 1H72C 4DV7E 4JI6E 4USKA 3JAMC 1Z0GA 4LF5E 1HNXI 4LF7I 4DV1I 4DR6E 4JI1E 4B3ME 2UUCI 4DUYE 4JI7I 4JV5E 3V5RA 1HR0E 2BV3A 4URLA 1IBLI 1UEKA 4FWDA 2ZBKB 5BR8I 1Z0EA 2UU9I 1KKHA 5IWAI 4JI4I 4LFBE 4X65I 4DV5I 4LF9I 1N36E 1HNWE 4ED4A 4GKKE 2A2CA 5BR8E 4K0KI 5LMNI 4JI5I 4JYAE 4DUZE 3CWVA 3ZZUA 2UUAE 1N34I 4WUCA 4PU9A 1FKAE 3QT8A 5A2QC 2HHHI 4B3TE 5LL6R 4RPFA 2E1RA 4DPUA 4DV6I 1HNWI 1Z0VA 1HNXE 1N36I 4LF7E 3J81C 4DV5E 3GONA 3QT6A 1H73A 1HR0I 3J80Q 3V2UC 3PYDA 4DR4E 4NXME 1H74A 1VISA 5A2QQ 4WUDA 4YHHI 2UXDI 4EMDA 4DPTA 4DR5E 1IBME 2X36A 5LMUE 2Q2EB 2HKEA 1XMQI 2VQFE 4LFBI 4DV1E 2VQEI 2ZM6E 4HACA 1D6TA 4HY1A 1Z0WA 4DR5I 1MX0A 4YY3I 2BM0A 3WU4A 1NHIA 2J7KA 4DR2E 4X66I 1RREA 1IBKI 4JI2I 4JI8E 1ZM3A 1ZM4A 4DV3I 4DV0E 1ZXMA 1Z5AA 5IWAE 1MU5A 4NXNE 4I3HA 3J81Q 1H7UA 4FWGA 4MYTA 5IT9Q 4LF4I 2X7IA 4DPXA 3T1HE 4Z7CA 1PKPA 4DR7E 2V2QA 3PYEA 4LF9E 4DUZI 1I94E 4JI3E 2GS8A 4KHPI 1NHHA 4GKKI 4AQYI 3PYFA 5GMEA 4JI7E 4B3MI 4LFAI 1XHKA 4ZVIA 4P7AA 3HULA 1XMOE 2WW4A 4JI3I 1Z5BA 1ZM2A 2CZ9A 4DR7I 4FN5A 1N0UA 1FJGI 1A6FA 4HYMA 4UTGA 4XTJA 2F4VI 1N32E 4R1FA 1WUUA 4NXMI 4DV3E 4X64I 1PVGA 1KTVA 1N33I 2BM1A 4DR1I 3T1YE 5FLXQ 1XNQI 5L3JA 4Z7YA 4FWHA 4DV6E 4LF8I 3ZKBA 4B3TI 1J5EI 4HXZA 1MG7A 1FWLA 5IT9C 4DU8A 2HKJA 3ZM7A 1ZM9A 1S4EA 4JI4E 4X65E 2UUBI 4DPWA 4DU7A 4DR6I 3J7AG 4OX9E 4X62I 1IBMI 2V34A 4JI2E 3J7AM 4DV0I 2HFSA 2V2ZA 4B3RI 4JG4A 2UXCE 1NZ0A 4LF4E 4KQVA 1S16A 4LFCI 4JI0I 4JV5I 1HNZE 4GKJI 4DR1E 2UUBE 4P52A 4B3SE 3ZZ0A 2E5LE 4X62E 3B82A 1XNQE 1Z0TA 4HACB 4AQYE 3ZKDA 4DV7I 4LFCE 4MYUA 2ZITA 2DEIA 4LFAE 1BKNA 1Z0CA 1HNZI 4DR3I 4PRVA 4JI6I 4JI5E 1PIEA 1Z59A 3K17A 4JI0E 4DV2I 2HFUA 5FLXC 5GMDA 3D4JA 5LMNE 1ELOA 3WU3A 3F0NA 2OI2A 1U2RA 4OX9I 3Q1QA 3B8HA 4DXLA 1RR9A 2UU9E 1Z5CA 4PRXA 4DR4I 4X66E 3LNUA 4DV4I 4LF8E 2NPFA 2DEJA 3WU5A 4K0KE 1QZRA 4B3SI 5LMUI 4NXNI 1KIJA 4JI1I 2V8PA 1EI1A 4DPYA 2UXBI 4X64E 1IBLE 1N32I 2F4VE 3T1HI 2R42A 4KHPE 2XEXA 4DV2E 1I94I 3WU6A 1B62A 3ZZTA 1XNRI 2LJPA 2UXCI 2HK2A 1KVKA 4B3RE 1J5EE 4YY3E 2UXBE 4LF5I 1XMOI 1FWKA 2E5LI 1EA6A 3OTOE 2EFGA 4YHHE 2V2VA 1FI4A 2UUAI 3QT7A 1N34E 1N0VC 4WUBA 4JYAI 3PYGA 2HHHE 4USMA 2ZM6I 2HK3A 4DR3E 4DV4E 3M6AA 1DARA 3B78A 3J80C 1H7SA 4LF6E 1N33E 1FNMA 3JAMQ 1Z0BA 2AJ4A 3K1JA 3T1YI 4M1KA 1K47A 2R3VA 4UT4A 3OTOI 1NHJA 3H4LA 4GKJE 4DR2I 2UXDE 1B63A 1OJ4A 2A2DA 4JI8I 4FW9A 1ZXNA 1IBKE 4LF6I 3LPSA 4DUYI 3QT5A 1FJGE
chains in the Genus database with same CATH superfamily
3LTOA 2UUCE 2GO4A 2VF3A 4IZKB 1XNRE 2VQEE 1XMQE 2VQFI 1H72C 4DV7E 1Y6ZA 5JEAA 4MU0A 4JI6E 4USKA 3JAMC 4IZKA 1Z0GA 4LF5E 3NZKA 1HNXI 4LF7I 4DV1I 4DR6E 3L7ZA 4FW7A 4JI1E 4B3ME 2UUCI 4DUYE 4JI7I 4BA2A 4LPFA 4JV5E 2C38B 3V5RA 1HR0E 3CDIA 5JEAF 4J3DA 3M85D 2BV3A 4URLA 1IBLI 1UEKA 4FWDA 2ZBKB 5BR8I 1Z0EA 2UU9I 4U3DA 3P3CA 1KKHA 2O1TA 3KRNA 2PO1A 4IFDB 5IWAI 4JI4I 4LFBE 3HJCA 4X65I 4DV5I 4QNKA 4LF9I 2NN6E 1N36E 1HNWE 4ED4A 3PS2A 4GKKE 2A2CA 5BR8E 4K0KI 5LMNI 4MDTA 4JI5I 4JYAE 4DUZE 4OKGA 3ZZUA 4MU3A 1P42A 3CWVA 1Y4SA 2UUAE 1N34I 4WUCA 4PU9A 1FKAE 3QT8A 5A2QC 2HHHI 2IOQA 4B3TE 5LL6R 3PRYA 4RPFA 2E1RA 4DPUA 4DV6I 1HNWI 1Z0VA 1HNXE 1N36I 4LF7E 2BA0G 5C0XD 3J81C 4DV5E 3P76A 3GONA 3QT6A 5DNLA 2JEAB 2PNZB 2NN6B 1H73A 2CG9A 2IOPA 3J80Q 3V2UC 1HR0I 1USVA 3PYDA 4DR4E 2NN6A 4NXME 5C0XB 5C0XC 1H74A 1VISA 5A2QQ 4WUDA 4YHHI 2UXDI 4EMDA 4DPTA 5K36D 4DR5E 4IFDE 5K36C 1IBME 2X36A 3CDJA 2C39A 5LMUE 3Q6NA 2Q2EB 5FWKA 2HKEA 3GCMA 2Z5EA 1XMQI 2VQFE 4LFBI 4DV1E 2VQEI 2ZM6E 4HACA 4N3OA 1D6TA 4HY1A 1Z0WA 4DR5I 1MX0A 4YY3I 2BM0A 3L7ZB 3WU4A 1NHIA 2J7KA 4DR2E 1E3HA 4IFDD 2IERA 5JEAB 5DRPA 4X66I 2VESA 1RREA 1IBKI 4OO1D 4OO1C 4JI2I 2PO1B 5JEAE 4JI8E 1R6LA 1USUA 2Z5CA 1ZM3A 1ZM4A 1YH8A 4DV3I 2GQ0A 4DV0E 1ZXMA 4IZJA 3GMEA 1Z5AA 5IWAE 4U3BA 1MU5A 4NXNE 2JE6B 4I3HA 2BR2A 2J65A 3J81Q 2PO2A 1H7UA 4FWGA 4MU4A 4MYTA 5DROA 5IT9Q 3P3EA 4LF4I 1UDSA 5C0XE 2X7IA 4DPXA 3T1HE 4Z7CA 1PKPA 4DR7E 2BA0D 2V2QA 3PYEA 4LF9E 4DUZI 1I94E 4JI3E 2GS8A 4KHPI 1NHHA 2PO0A 4GKKI 3U1KA 4AQYI 2Z5BB 1HK7A 3PYFA 5GMEA 4JI7E 4B3MI 4LFAI 1XHKA 4ZVIA 1OYPA 5EL9A 2C38A 4P7AA 3HULA 2PO2B 1XMOE 2JE6A 4BA2B 2WW4A 3K85A 3GLLA 1Z5BA 4JI3I 1ZM2A 2CZ9A 4DR7I 4FN5A 1N0UA 1FJGI 4LOMA 4ISAA 4FW4A 1A6FA 4HYMA 4UTGA 4XTJA 2F4VI 1N32E 4R1FA 1WUUA 4NXMI 1R6MA 4DV3E 5C0XF 4X64I 5K36A 4OZEA 1PVGA 1KTVA 1N33I 2BM1A 4LCHA 4DR1I 4IZJD 3T1YE 5FLXQ 1XNQI 5L3JA 4Z7YA 4FWHA 3M7NG 4DV6E 4LF8I 2WNRA 2C37A 3ZKBA 4B3TI 3PS3A 1J5EI 2JEBA 4HXZA 1RHYA 2C39B 1MG7A 1FWLA 4IZJB 5IT9C 2Z5BA 4DU8A 2HKJA 3ZM7A 1ZM9A 1UDNA 1S4EA 3P3GA 5K36B 1UDOA 4JI4E 2BA1D 2IESA 5DRRA 4X65E 2UUBI 4DPWA 4DU7A 3DD6A 4OO1F 3P06A 4DR6I 3J7AG 4OX9E 4X62I 1IBMI 2V34A 4JI2E 2PNZA 3J7AM 4DV0I 4MU1A 2HFSA 2V2ZA 4B3RI 2Z5CB 4JG4A 2UXCE 4FW6A 1NZ0A 4LF4E 4KQVA 1S16A 2JT2A 4LFCI 1E3PA 3M7ND 4JI0I 4JV5I 2WP8A 4IFDC 1HNZE 4MQYA 4GKJI 5JEAC 4DR1E 2UUBE 2PO0B 4P52A 4B3SE 3ZZ0A 2E5LE 4X62E 3B82A 1XNQE 1Z0TA 5C0XA 5K36F 4HACB 4AQYE 2PNLA 3ZKDA 4DV7I 4LFCE 4MYUA 2ZITA 5DNXA 2DEIA 5DRQA 1BKNA 4LFAE 1Z0CA 4FW5A 4IS9A 1HNZI 4DR3I 2BR2B 1OYRA 4PRVA 2JEAA 4JI6I 3PS1A 1YHCA 4JI5E 1PIEA 1Z59A 3K17A 4JI0E 4DV2I 2AE8A 2HFUA 2CGEA 5FLXC 5GMDA 3D4JA 5LMNE 3WU3A 1ELOA 2O1WA 1XXEA 3F0NA 4AIDA 1Y60A 2OI2A 1U2RA 4OX9I 3Q1QA 3B8HA 4DXLA 1RR9A 2UU9E 1Y4UA 1Z5CA 2NN6C 3UHMA 4AM3A 1VI7A 4PRXA 4DR4I 4X66E 3LNUA 4DV4I 4LF8E 2NPFA 2DEJA 3WU5A 5ELWA 4K0KE 1QZRA 4B3SI 2O1VA 2WP8B 5LMUI 4NBQA 4NXNI 1KIJA 4JI1I 2F1DA 2V8PA 1EI1A 2WNRB 4DPYA 2UXBI 2CVEA 4X64E 1IBLE 1N32I 2F4VE 3T1HI 2R42A 4IFDF 1UDQA 4KHPE 2XEXA 4DV2E 1I94I 3WU6A 1B62A 4OO1E 3ZZTA 1XNRI 2LJPA 2UXCI 2HK2A 3U1YA 1KVKA 4B3RE 1J5EE 4YY3E 2UXBE 5JEAD 4QNJA 4LF5I 1XMOI 1FWKA 3B4TA 2O3ZA 2E5LI 1EA6A 2O1UA 2PNMA 3OTOE 1OYSA 1Y5YA 2EFGA 4YHHE 2V2VA 1FI4A 2UUAI 3QT7A 3HKMA 1N34E 1N0VC 4WUBA 4JYAI 3PYGA 4LCGA 4LCFA 2HHHE 4USMA 5K36E 2ZM6I 2HK3A 4DR3E 4IFDA 4DV4E 3M6AA 3Q6MA 4OO1B 4BA1B 4GQUA 1DARA 3B78A 3J80C 1H7SA 4LF6E 4OO1A 1FNMA 1N33E 3JAMQ 1Z0BA 2AJ4A 3K1JA 3T1YI 3H1CA 4M1KA 4AIMA 1K47A 2JEBB 2R3VA 4UT4A 3OTOI 1NHJA 2C37B 3H4LA 2NN6F 3M85G 4GKJE 4DR2I 2UXDE 1B63A 2NN6D 2BA1G 1OJ4A 2A2DA 4JI8I 4FW9A 1ZXNA 4FW3A 1IBKE 4LF6I 5EKWA 3LPSA 2GO3A 4BA1A 4DUYI 3QT5A 1FJGE
chains in the Genus database with same CATH topology
3LTOA 2UUCE 2VF3A 4IZKB 1XNRE 2VQEE 1XMQE 2VQFI 1H72C 4DV7E 1Y6ZA 4JI6E 4USKA 3JAMC 4IZKA 1Z0GA 4LF5E 1HNXI 4LF7I 4DV1I 4DR6E 4JI1E 4B3ME 2UUCI 4DUYE 4JI7I 4JV5E 3V5RA 1HR0E 2BV3A 4URLA 1IBLI 1UEKA 4FWDA 2ZBKB 5BR8I 1Z0EA 2UU9I 1KKHA 2O1TA 5IWAI 4JI4I 4LFBE 3HJCA 4X65I 4DV5I 4LF9I 1N36E 1HNWE 4ED4A 4GKKE 2A2CA 5BR8E 4K0KI 5LMNI 4JI5I 4JYAE 4DUZE 3CWVA 3ZZUA 1Y4SA 2UUAE 1N34I 4WUCA 4PU9A 1FKAE 3QT8A 5A2QC 2HHHI 2IOQA 4B3TE 5LL6R 3PRYA 4RPFA 2E1RA 4DPUA 4DV6I 1HNWI 1Z0VA 1HNXE 1N36I 4LF7E 3J81C 4DV5E 3GONA 3QT6A 1HR0I 1H73A 3J80Q 2CG9A 2IOPA 3V2UC 1USVA 3PYDA 4DR4E 4NXME 1H74A 1VISA 5A2QQ 4WUDA 4YHHI 2UXDI 4EMDA 4DPTA 4DR5E 1IBME 2X36A 5LMUE 3Q6NA 2Q2EB 5FWKA 2HKEA 2Z5EA 1XMQI 2VQFE 4LFBI 4DV1E 2VQEI 2ZM6E 4HACA 4N3OA 1D6TA 4HY1A 1Z0WA 4DR5I 1MX0A 4YY3I 2BM0A 3WU4A 1NHIA 2J7KA 4DR2E 4X66I 1RREA 1IBKI 4JI2I 4JI8E 1USUA 2Z5CA 1ZM3A 1ZM4A 4DV3I 2GQ0A 4DV0E 1ZXMA 4IZJA 1Z5AA 5IWAE 1MU5A 4NXNE 4I3HA 3J81Q 1H7UA 4FWGA 4MYTA 5IT9Q 4LF4I 2X7IA 4DPXA 3T1HE 4Z7CA 1PKPA 4DR7E 2V2QA 3PYEA 4LF9E 4DUZI 1I94E 4JI3E 2GS8A 4KHPI 1NHHA 4GKKI 4AQYI 2Z5BB 1HK7A 3PYFA 5GMEA 4JI7E 4B3MI 4LFAI 1XHKA 4ZVIA 4P7AA 3HULA 1XMOE 2WW4A 3K85A 1Z5BA 4JI3I 1ZM2A 2CZ9A 4DR7I 4FN5A 1N0UA 1FJGI 1A6FA 4HYMA 4UTGA 4XTJA 2F4VI 1N32E 4R1FA 1WUUA 4NXMI 4DV3E 4X64I 1PVGA 1KTVA 1N33I 2BM1A 4DR1I 4IZJD 3T1YE 5FLXQ 1XNQI 5L3JA 4Z7YA 4FWHA 4DV6E 4LF8I 3ZKBA 4B3TI 1J5EI 4HXZA 1MG7A 1FWLA 4IZJB 5IT9C 2Z5BA 4DU8A 2HKJA 3ZM7A 1ZM9A 1S4EA 4JI4E 4X65E 2UUBI 4DPWA 4DU7A 3P06A 4DR6I 3J7AG 4OX9E 4X62I 1IBMI 2V34A 4JI2E 3J7AM 4DV0I 2HFSA 2V2ZA 4B3RI 2Z5CB 4JG4A 2UXCE 1NZ0A 4LF4E 4KQVA 1S16A 4LFCI 4JI0I 4JV5I 1HNZE 4GKJI 4DR1E 2UUBE 4P52A 4B3SE 3ZZ0A 2E5LE 4X62E 3B82A 1XNQE 1Z0TA 4HACB 4AQYE 2PNLA 3ZKDA 4DV7I 4LFCE 4MYUA 2ZITA 2DEIA 4LFAE 1BKNA 1Z0CA 1HNZI 4DR3I 4PRVA 4JI6I 4JI5E 1PIEA 1Z59A 3K17A 4JI0E 4DV2I 2HFUA 2CGEA 5FLXC 5GMDA 3D4JA 5LMNE 1ELOA 2O1WA 3WU3A 3F0NA 2OI2A 1U2RA 4OX9I 3Q1QA 3B8HA 4DXLA 1RR9A 2UU9E 1Y4UA 1Z5CA 4PRXA 4DR4I 4X66E 3LNUA 4DV4I 4LF8E 2NPFA 2DEJA 3WU5A 4K0KE 1QZRA 4B3SI 2O1VA 5LMUI 4NXNI 1KIJA 4JI1I 2V8PA 1EI1A 4DPYA 2UXBI 4X64E 1IBLE 1N32I 2F4VE 3T1HI 2R42A 4KHPE 2XEXA 4DV2E 1I94I 3WU6A 1B62A 3ZZTA 1XNRI 2LJPA 2UXCI 2HK2A 1KVKA 4B3RE 1J5EE 4YY3E 2UXBE 4LF5I 1XMOI 1FWKA 2E5LI 1EA6A 2O1UA 2PNMA 3OTOE 2EFGA 4YHHE 2V2VA 1FI4A 2UUAI 3QT7A 1N34E 1N0VC 4WUBA 4JYAI 3PYGA 2HHHE 4USMA 2ZM6I 2HK3A 4DR3E 4DV4E 3M6AA 3Q6MA 1DARA 3B78A 3J80C 1H7SA 4LF6E 1N33E 1FNMA 3JAMQ 1Z0BA 2AJ4A 3K1JA 3T1YI 4M1KA 1K47A 2R3VA 4UT4A 3OTOI 1NHJA 3H4LA 4GKJE 4DR2I 2UXDE 1B63A 1OJ4A 2A2DA 4JI8I 4FW9A 1ZXNA 1IBKE 4LF6I 3LPSA 4DUYI 3QT5A 1FJGE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LTO A;  2UUC E;  2VF3 A;  1XNR E;  2VQE E;  1XMQ E;  2VQF I;  1H72 C;  4DV7 E;  4JI6 E;  4USK A;  3JAM C;  1Z0G A;  4LF5 E;  1HNX I;  4LF7 I;  4DV1 I;  4DR6 E;  4JI1 E;  4B3M E;  2UUC I;  4DUY E;  4JI7 I;  4JV5 E;  3V5R A;  1HR0 E;  2BV3 A;  4URL A;  1IBL I;  1UEK A;  4FWD A;  2ZBK B;  5BR8 I;  1Z0E A;  2UU9 I;  1KKH A;  5IWA I;  4JI4 I;  4LFB E;  4X65 I;  4DV5 I;  4LF9 I;  1N36 E;  1HNW E;  4ED4 A;  4GKK E;  2A2C A;  5BR8 E;  4K0K I;  5LMN I;  4JI5 I;  4JYA E;  4DUZ E;  3CWV A;  3ZZU A;  2UUA E;  1N34 I;  4WUC A;  4PU9 A;  1FKA E;  3QT8 A;  5A2Q C;  2HHH I;  4B3T E;  5LL6 R;  4RPF A;  2E1R A;  4DPU A;  4DV6 I;  1HNW I;  1Z0V A;  1HNX E;  1N36 I;  4LF7 E;  3J81 C;  4DV5 E;  3GON A;  3QT6 A;  1H73 A;  1HR0 I;  3J80 Q;  3V2U C;  3PYD A;  4DR4 E;  4NXM E;  1H74 A;  1VIS A;  5A2Q Q;  4WUD A;  4YHH I;  2UXD I;  4EMD A;  4DPT A;  4DR5 E;  1IBM E;  2X36 A;  5LMU E;  2Q2E B;  2HKE A;  1XMQ I;  2VQF E;  4LFB I;  4DV1 E;  2VQE I;  2ZM6 E;  4HAC A;  1D6T A;  4HY1 A;  1Z0W A;  4DR5 I;  1MX0 A;  4YY3 I;  2BM0 A;  3WU4 A;  1NHI A;  2J7K A;  4DR2 E;  4X66 I;  1RRE A;  1IBK I;  4JI2 I;  4JI8 E;  1ZM3 A;  1ZM4 A;  4DV3 I;  4DV0 E;  1ZXM A;  1Z5A A;  5IWA E;  1MU5 A;  4NXN E;  4I3H A;  3J81 Q;  1H7U A;  4FWG A;  4MYT A;  5IT9 Q;  4LF4 I;  2X7I A;  4DPX A;  3T1H E;  4Z7C A;  1PKP A;  4DR7 E;  2V2Q A;  3PYE A;  4LF9 E;  4DUZ I;  1I94 E;  4JI3 E;  2GS8 A;  4KHP I;  1NHH A;  4GKK I;  4AQY I;  3PYF A;  5GME A;  4JI7 E;  4B3M I;  4LFA I;  1XHK A;  4ZVI A;  4P7A A;  3HUL A;  1XMO E;  2WW4 A;  4JI3 I;  1Z5B A;  1ZM2 A;  2CZ9 A;  4DR7 I;  4FN5 A;  1N0U A;  1FJG I;  1A6F A;  4HYM A;  4UTG A;  4XTJ A;  2F4V I;  1N32 E;  4R1F A;  1WUU A;  4NXM I;  4DV3 E;  4X64 I;  1PVG A;  1KTV A;  1N33 I;  2BM1 A;  4DR1 I;  3T1Y E;  5FLX Q;  1XNQ I;  5L3J A;  4Z7Y A;  4FWH A;  4DV6 E;  4LF8 I;  3ZKB A;  4B3T I;  1J5E I;  4HXZ A;  1MG7 A;  1FWL A;  5IT9 C;  4DU8 A;  2HKJ A;  3ZM7 A;  1ZM9 A;  1S4E A;  4JI4 E;  4X65 E;  2UUB I;  4DPW A;  4DU7 A;  4DR6 I;  3J7A G;  4OX9 E;  4X62 I;  1IBM I;  2V34 A;  4JI2 E;  3J7A M;  4DV0 I;  2HFS A;  2V2Z A;  4B3R I;  4JG4 A;  2UXC E;  1NZ0 A;  4LF4 E;  4KQV A;  1S16 A;  4LFC I;  4JI0 I;  4JV5 I;  1HNZ E;  4GKJ I;  4DR1 E;  2UUB E;  4P52 A;  4B3S E;  3ZZ0 A;  2E5L E;  4X62 E;  3B82 A;  1XNQ E;  1Z0T A;  4HAC B;  4AQY E;  3ZKD A;  4DV7 I;  4LFC E;  4MYU A;  2ZIT A;  2DEI A;  4LFA E;  1BKN A;  1Z0C A;  1HNZ I;  4DR3 I;  4PRV A;  4JI6 I;  4JI5 E;  1PIE A;  1Z59 A;  3K17 A;  4JI0 E;  4DV2 I;  2HFU A;  5FLX C;  5GMD A;  3D4J A;  5LMN E;  1ELO A;  3WU3 A;  3F0N A;  2OI2 A;  1U2R A;  4OX9 I;  3Q1Q A;  3B8H A;  4DXL A;  1RR9 A;  2UU9 E;  1Z5C A;  4PRX A;  4DR4 I;  4X66 E;  3LNU A;  4DV4 I;  4LF8 E;  2NPF A;  2DEJ A;  3WU5 A;  4K0K E;  1QZR A;  4B3S I;  5LMU I;  4NXN I;  1KIJ A;  4JI1 I;  2V8P A;  1EI1 A;  4DPY A;  2UXB I;  4X64 E;  1IBL E;  1N32 I;  2F4V E;  3T1H I;  2R42 A;  4KHP E;  2XEX A;  4DV2 E;  1I94 I;  3WU6 A;  1B62 A;  3ZZT A;  1XNR I;  2LJP A;  2UXC I;  2HK2 A;  1KVK A;  4B3R E;  1J5E E;  4YY3 E;  2UXB E;  4LF5 I;  1XMO I;  1FWK A;  2E5L I;  1EA6 A;  3OTO E;  2EFG A;  4YHH E;  2V2V A;  1FI4 A;  2UUA I;  3QT7 A;  1N34 E;  1N0V C;  4WUB A;  4JYA I;  3PYG A;  2HHH E;  4USM A;  2ZM6 I;  2HK3 A;  4DR3 E;  4DV4 E;  3M6A A;  1DAR A;  3B78 A;  3J80 C;  1H7S A;  4LF6 E;  1N33 E;  1FNM A;  3JAM Q;  1Z0B A;  2AJ4 A;  3K1J A;  3T1Y I;  4M1K A;  1K47 A;  2R3V A;  4UT4 A;  3OTO I;  1NHJ A;  3H4L A;  4GKJ E;  4DR2 I;  2UXD E;  1B63 A;  1OJ4 A;  2A2D A;  4JI8 I;  4FW9 A;  1ZXN A;  1IBK E;  4LF6 I;  3LPS A;  4DUY I;  3QT5 A;  1FJG E; 
#chains in the Genus database with same CATH topology
 3LTO A;  2UUC E;  2GO4 A;  2VF3 A;  4IZK B;  1XNR E;  2VQE E;  1XMQ E;  2VQF I;  1H72 C;  4DV7 E;  1Y6Z A;  5JEA A;  4MU0 A;  4JI6 E;  4USK A;  3JAM C;  4IZK A;  1Z0G A;  4LF5 E;  3NZK A;  1HNX I;  4LF7 I;  4DV1 I;  4DR6 E;  3L7Z A;  4FW7 A;  4JI1 E;  4B3M E;  2UUC I;  4DUY E;  4JI7 I;  4BA2 A;  4LPF A;  4JV5 E;  2C38 B;  3V5R A;  1HR0 E;  3CDI A;  5JEA F;  4J3D A;  3M85 D;  2BV3 A;  4URL A;  1IBL I;  1UEK A;  4FWD A;  2ZBK B;  5BR8 I;  1Z0E A;  2UU9 I;  4U3D A;  3P3C A;  1KKH A;  2O1T A;  3KRN A;  2PO1 A;  4IFD B;  5IWA I;  4JI4 I;  4LFB E;  3HJC A;  4X65 I;  4DV5 I;  4QNK A;  4LF9 I;  2NN6 E;  1N36 E;  1HNW E;  4ED4 A;  3PS2 A;  4GKK E;  2A2C A;  5BR8 E;  4K0K I;  5LMN I;  4MDT A;  4JI5 I;  4JYA E;  4DUZ E;  4OKG A;  3ZZU A;  4MU3 A;  1P42 A;  3CWV A;  1Y4S A;  2UUA E;  1N34 I;  4WUC A;  4PU9 A;  1FKA E;  3QT8 A;  5A2Q C;  2HHH I;  2IOQ A;  4B3T E;  5LL6 R;  3PRY A;  4RPF A;  2E1R A;  4DPU A;  4DV6 I;  1HNW I;  1Z0V A;  1HNX E;  1N36 I;  4LF7 E;  2BA0 G;  5C0X D;  3J81 C;  4DV5 E;  3P76 A;  3GON A;  3QT6 A;  5DNL A;  2JEA B;  2PNZ B;  2NN6 B;  1H73 A;  2CG9 A;  2IOP A;  3J80 Q;  3V2U C;  1HR0 I;  1USV A;  3PYD A;  4DR4 E;  2NN6 A;  4NXM E;  5C0X B;  5C0X C;  1H74 A;  1VIS A;  5A2Q Q;  4WUD A;  4YHH I;  2UXD I;  4EMD A;  4DPT A;  5K36 D;  4DR5 E;  4IFD E;  5K36 C;  1IBM E;  2X36 A;  3CDJ A;  2C39 A;  5LMU E;  3Q6N A;  2Q2E B;  5FWK A;  2HKE A;  3GCM A;  2Z5E A;  1XMQ I;  2VQF E;  4LFB I;  4DV1 E;  2VQE I;  2ZM6 E;  4HAC A;  4N3O A;  1D6T A;  4HY1 A;  1Z0W A;  4DR5 I;  1MX0 A;  4YY3 I;  2BM0 A;  3L7Z B;  3WU4 A;  1NHI A;  2J7K A;  4DR2 E;  1E3H A;  4IFD D;  2IER A;  5JEA B;  5DRP A;  4X66 I;  2VES A;  1RRE A;  1IBK I;  4OO1 D;  4OO1 C;  4JI2 I;  2PO1 B;  5JEA E;  4JI8 E;  1R6L A;  1USU A;  2Z5C A;  1ZM3 A;  1ZM4 A;  1YH8 A;  4DV3 I;  2GQ0 A;  4DV0 E;  1ZXM A;  4IZJ A;  3GME A;  1Z5A A;  5IWA E;  4U3B A;  1MU5 A;  4NXN E;  2JE6 B;  4I3H A;  2BR2 A;  2J65 A;  3J81 Q;  2PO2 A;  1H7U A;  4FWG A;  4MU4 A;  4MYT A;  5DRO A;  5IT9 Q;  3P3E A;  4LF4 I;  1UDS A;  5C0X E;  2X7I A;  4DPX A;  3T1H E;  4Z7C A;  1PKP A;  4DR7 E;  2BA0 D;  2V2Q A;  3PYE A;  4LF9 E;  4DUZ I;  1I94 E;  4JI3 E;  2GS8 A;  4KHP I;  1NHH A;  2PO0 A;  4GKK I;  3U1K A;  4AQY I;  2Z5B B;  1HK7 A;  3PYF A;  5GME A;  4JI7 E;  4B3M I;  4LFA I;  1XHK A;  4ZVI A;  1OYP A;  5EL9 A;  2C38 A;  4P7A A;  3HUL A;  2PO2 B;  1XMO E;  2JE6 A;  4BA2 B;  2WW4 A;  3K85 A;  3GLL A;  1Z5B A;  4JI3 I;  1ZM2 A;  2CZ9 A;  4DR7 I;  4FN5 A;  1N0U A;  1FJG I;  4LOM A;  4ISA A;  4FW4 A;  1A6F A;  4HYM A;  4UTG A;  4XTJ A;  2F4V I;  1N32 E;  4R1F A;  1WUU A;  4NXM I;  1R6M A;  4DV3 E;  5C0X F;  4X64 I;  5K36 A;  4OZE A;  1PVG A;  1KTV A;  1N33 I;  2BM1 A;  4LCH A;  4DR1 I;  4IZJ D;  3T1Y E;  5FLX Q;  1XNQ I;  5L3J A;  4Z7Y A;  4FWH A;  3M7N G;  4DV6 E;  4LF8 I;  2WNR A;  2C37 A;  3ZKB A;  4B3T I;  3PS3 A;  1J5E I;  2JEB A;  4HXZ A;  1RHY A;  2C39 B;  1MG7 A;  1FWL A;  4IZJ B;  5IT9 C;  2Z5B A;  4DU8 A;  2HKJ A;  3ZM7 A;  1ZM9 A;  1UDN A;  1S4E A;  3P3G A;  5K36 B;  1UDO A;  4JI4 E;  2BA1 D;  2IES A;  5DRR A;  4X65 E;  2UUB I;  4DPW A;  4DU7 A;  3DD6 A;  4OO1 F;  3P06 A;  4DR6 I;  3J7A G;  4OX9 E;  4X62 I;  1IBM I;  2V34 A;  4JI2 E;  2PNZ A;  3J7A M;  4DV0 I;  4MU1 A;  2HFS A;  2V2Z A;  4B3R I;  2Z5C B;  4JG4 A;  2UXC E;  4FW6 A;  1NZ0 A;  4LF4 E;  4KQV A;  1S16 A;  2JT2 A;  4LFC I;  1E3P A;  3M7N D;  4JI0 I;  4JV5 I;  2WP8 A;  4IFD C;  1HNZ E;  4MQY A;  4GKJ I;  5JEA C;  4DR1 E;  2UUB E;  2PO0 B;  4P52 A;  4B3S E;  3ZZ0 A;  2E5L E;  4X62 E;  3B82 A;  1XNQ E;  1Z0T A;  5C0X A;  5K36 F;  4HAC B;  4AQY E;  2PNL A;  3ZKD A;  4DV7 I;  4LFC E;  4MYU A;  2ZIT A;  5DNX A;  2DEI A;  5DRQ A;  1BKN A;  4LFA E;  1Z0C A;  4FW5 A;  4IS9 A;  1HNZ I;  4DR3 I;  2BR2 B;  1OYR A;  4PRV A;  2JEA A;  4JI6 I;  3PS1 A;  1YHC A;  4JI5 E;  1PIE A;  1Z59 A;  3K17 A;  4JI0 E;  4DV2 I;  2AE8 A;  2HFU A;  2CGE A;  5FLX C;  5GMD A;  3D4J A;  5LMN E;  3WU3 A;  1ELO A;  2O1W A;  1XXE A;  3F0N A;  4AID A;  1Y60 A;  2OI2 A;  1U2R A;  4OX9 I;  3Q1Q A;  3B8H A;  4DXL A;  1RR9 A;  2UU9 E;  1Y4U A;  1Z5C A;  2NN6 C;  3UHM A;  4AM3 A;  1VI7 A;  4PRX A;  4DR4 I;  4X66 E;  3LNU A;  4DV4 I;  4LF8 E;  2NPF A;  2DEJ A;  3WU5 A;  5ELW A;  4K0K E;  1QZR A;  4B3S I;  2O1V A;  2WP8 B;  5LMU I;  4NBQ A;  4NXN I;  1KIJ A;  4JI1 I;  2F1D A;  2V8P A;  1EI1 A;  2WNR B;  4DPY A;  2UXB I;  2CVE A;  4X64 E;  1IBL E;  1N32 I;  2F4V E;  3T1H I;  2R42 A;  4IFD F;  1UDQ A;  4KHP E;  2XEX A;  4DV2 E;  1I94 I;  3WU6 A;  1B62 A;  4OO1 E;  3ZZT A;  1XNR I;  2LJP A;  2UXC I;  2HK2 A;  3U1Y A;  1KVK A;  4B3R E;  1J5E E;  4YY3 E;  2UXB E;  5JEA D;  4QNJ A;  4LF5 I;  1XMO I;  1FWK A;  3B4T A;  2O3Z A;  2E5L I;  1EA6 A;  2O1U A;  2PNM A;  3OTO E;  1OYS A;  1Y5Y A;  2EFG A;  4YHH E;  2V2V A;  1FI4 A;  2UUA I;  3QT7 A;  3HKM A;  1N34 E;  1N0V C;  4WUB A;  4JYA I;  3PYG A;  4LCG A;  4LCF A;  2HHH E;  4USM A;  5K36 E;  2ZM6 I;  2HK3 A;  4DR3 E;  4IFD A;  4DV4 E;  3M6A A;  3Q6M A;  4OO1 B;  4BA1 B;  4GQU A;  1DAR A;  3B78 A;  3J80 C;  1H7S A;  4LF6 E;  4OO1 A;  1FNM A;  1N33 E;  3JAM Q;  1Z0B A;  2AJ4 A;  3K1J A;  3T1Y I;  3H1C A;  4M1K A;  4AIM A;  1K47 A;  2JEB B;  2R3V A;  4UT4 A;  3OTO I;  1NHJ A;  2C37 B;  3H4L A;  2NN6 F;  3M85 G;  4GKJ E;  4DR2 I;  2UXD E;  1B63 A;  2NN6 D;  2BA1 G;  1OJ4 A;  2A2D A;  4JI8 I;  4FW9 A;  1ZXN A;  4FW3 A;  1IBK E;  4LF6 I;  5EKW A;  3LPS A;  2GO3 A;  4BA1 A;  4DUY I;  3QT5 A;  1FJG E; 
#chains in the Genus database with same CATH homology
 3LTO A;  2UUC E;  2VF3 A;  4IZK B;  1XNR E;  2VQE E;  1XMQ E;  2VQF I;  1H72 C;  4DV7 E;  1Y6Z A;  4JI6 E;  4USK A;  3JAM C;  4IZK A;  1Z0G A;  4LF5 E;  1HNX I;  4LF7 I;  4DV1 I;  4DR6 E;  4JI1 E;  4B3M E;  2UUC I;  4DUY E;  4JI7 I;  4JV5 E;  3V5R A;  1HR0 E;  2BV3 A;  4URL A;  1IBL I;  1UEK A;  4FWD A;  2ZBK B;  5BR8 I;  1Z0E A;  2UU9 I;  1KKH A;  2O1T A;  5IWA I;  4JI4 I;  4LFB E;  3HJC A;  4X65 I;  4DV5 I;  4LF9 I;  1N36 E;  1HNW E;  4ED4 A;  4GKK E;  2A2C A;  5BR8 E;  4K0K I;  5LMN I;  4JI5 I;  4JYA E;  4DUZ E;  3CWV A;  3ZZU A;  1Y4S A;  2UUA E;  1N34 I;  4WUC A;  4PU9 A;  1FKA E;  3QT8 A;  5A2Q C;  2HHH I;  2IOQ A;  4B3T E;  5LL6 R;  3PRY A;  4RPF A;  2E1R A;  4DPU A;  4DV6 I;  1HNW I;  1Z0V A;  1HNX E;  1N36 I;  4LF7 E;  3J81 C;  4DV5 E;  3GON A;  3QT6 A;  1HR0 I;  1H73 A;  3J80 Q;  2CG9 A;  2IOP A;  3V2U C;  1USV A;  3PYD A;  4DR4 E;  4NXM E;  1H74 A;  1VIS A;  5A2Q Q;  4WUD A;  4YHH I;  2UXD I;  4EMD A;  4DPT A;  4DR5 E;  1IBM E;  2X36 A;  5LMU E;  3Q6N A;  2Q2E B;  5FWK A;  2HKE A;  2Z5E A;  1XMQ I;  2VQF E;  4LFB I;  4DV1 E;  2VQE I;  2ZM6 E;  4HAC A;  4N3O A;  1D6T A;  4HY1 A;  1Z0W A;  4DR5 I;  1MX0 A;  4YY3 I;  2BM0 A;  3WU4 A;  1NHI A;  2J7K A;  4DR2 E;  4X66 I;  1RRE A;  1IBK I;  4JI2 I;  4JI8 E;  1USU A;  2Z5C A;  1ZM3 A;  1ZM4 A;  4DV3 I;  2GQ0 A;  4DV0 E;  1ZXM A;  4IZJ A;  1Z5A A;  5IWA E;  1MU5 A;  4NXN E;  4I3H A;  3J81 Q;  1H7U A;  4FWG A;  4MYT A;  5IT9 Q;  4LF4 I;  2X7I A;  4DPX A;  3T1H E;  4Z7C A;  1PKP A;  4DR7 E;  2V2Q A;  3PYE A;  4LF9 E;  4DUZ I;  1I94 E;  4JI3 E;  2GS8 A;  4KHP I;  1NHH A;  4GKK I;  4AQY I;  2Z5B B;  1HK7 A;  3PYF A;  5GME A;  4JI7 E;  4B3M I;  4LFA I;  1XHK A;  4ZVI A;  4P7A A;  3HUL A;  1XMO E;  2WW4 A;  3K85 A;  1Z5B A;  4JI3 I;  1ZM2 A;  2CZ9 A;  4DR7 I;  4FN5 A;  1N0U A;  1FJG I;  1A6F A;  4HYM A;  4UTG A;  4XTJ A;  2F4V I;  1N32 E;  4R1F A;  1WUU A;  4NXM I;  4DV3 E;  4X64 I;  1PVG A;  1KTV A;  1N33 I;  2BM1 A;  4DR1 I;  4IZJ D;  3T1Y E;  5FLX Q;  1XNQ I;  5L3J A;  4Z7Y A;  4FWH A;  4DV6 E;  4LF8 I;  3ZKB A;  4B3T I;  1J5E I;  4HXZ A;  1MG7 A;  1FWL A;  4IZJ B;  5IT9 C;  2Z5B A;  4DU8 A;  2HKJ A;  3ZM7 A;  1ZM9 A;  1S4E A;  4JI4 E;  4X65 E;  2UUB I;  4DPW A;  4DU7 A;  3P06 A;  4DR6 I;  3J7A G;  4OX9 E;  4X62 I;  1IBM I;  2V34 A;  4JI2 E;  3J7A M;  4DV0 I;  2HFS A;  2V2Z A;  4B3R I;  2Z5C B;  4JG4 A;  2UXC E;  1NZ0 A;  4LF4 E;  4KQV A;  1S16 A;  4LFC I;  4JI0 I;  4JV5 I;  1HNZ E;  4GKJ I;  4DR1 E;  2UUB E;  4P52 A;  4B3S E;  3ZZ0 A;  2E5L E;  4X62 E;  3B82 A;  1XNQ E;  1Z0T A;  4HAC B;  4AQY E;  2PNL A;  3ZKD A;  4DV7 I;  4LFC E;  4MYU A;  2ZIT A;  2DEI A;  4LFA E;  1BKN A;  1Z0C A;  1HNZ I;  4DR3 I;  4PRV A;  4JI6 I;  4JI5 E;  1PIE A;  1Z59 A;  3K17 A;  4JI0 E;  4DV2 I;  2HFU A;  2CGE A;  5FLX C;  5GMD A;  3D4J A;  5LMN E;  1ELO A;  2O1W A;  3WU3 A;  3F0N A;  2OI2 A;  1U2R A;  4OX9 I;  3Q1Q A;  3B8H A;  4DXL A;  1RR9 A;  2UU9 E;  1Y4U A;  1Z5C A;  4PRX A;  4DR4 I;  4X66 E;  3LNU A;  4DV4 I;  4LF8 E;  2NPF A;  2DEJ A;  3WU5 A;  4K0K E;  1QZR A;  4B3S I;  2O1V A;  5LMU I;  4NXN I;  1KIJ A;  4JI1 I;  2V8P A;  1EI1 A;  4DPY A;  2UXB I;  4X64 E;  1IBL E;  1N32 I;  2F4V E;  3T1H I;  2R42 A;  4KHP E;  2XEX A;  4DV2 E;  1I94 I;  3WU6 A;  1B62 A;  3ZZT A;  1XNR I;  2LJP A;  2UXC I;  2HK2 A;  1KVK A;  4B3R E;  1J5E E;  4YY3 E;  2UXB E;  4LF5 I;  1XMO I;  1FWK A;  2E5L I;  1EA6 A;  2O1U A;  2PNM A;  3OTO E;  2EFG A;  4YHH E;  2V2V A;  1FI4 A;  2UUA I;  3QT7 A;  1N34 E;  1N0V C;  4WUB A;  4JYA I;  3PYG A;  2HHH E;  4USM A;  2ZM6 I;  2HK3 A;  4DR3 E;  4DV4 E;  3M6A A;  3Q6M A;  1DAR A;  3B78 A;  3J80 C;  1H7S A;  4LF6 E;  1N33 E;  1FNM A;  3JAM Q;  1Z0B A;  2AJ4 A;  3K1J A;  3T1Y I;  4M1K A;  1K47 A;  2R3V A;  4UT4 A;  3OTO I;  1NHJ A;  3H4L A;  4GKJ E;  4DR2 I;  2UXD E;  1B63 A;  1OJ4 A;  2A2D A;  4JI8 I;  4FW9 A;  1ZXN A;  1IBK E;  4LF6 I;  3LPS A;  4DUY I;  3QT5 A;  1FJG E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...