4JI5J

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 16
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4ji5J00
4GKJJ 4OX9J 1N36J 4JI6J 3J80U 4X62J 2F4VJ 5A2QU 4KYZA 4B3TJ 1HNXJ 4JI3J 4NXNJ 4DR6J 2ZM6J 4DV6J 4B3RJ 4DV5J 3J7AN 2HHHJ 4KY3A 3J81U 3T1HJ 4DR2J 4NEYA 4YHHJ 4JV5J 5LMNJ 3OTOJ 4AQYJ 2UUBJ 2UXDJ 1HR0J 4LFBJ 1FJGJ 4B3SJ 3IMQJ 4JI2J 4RJVA 4DR1J 2MTLA 4LFAJ 3R2CJ 1IBKJ 4LF7J 4DR7J 2MQ8A 4K0KJ 2MEWA 4HHUA 4DUZJ 1XNQJ 1N32J 4JI5J 4JI8J 2UXBJ 1N33J 4NEZA 1J5EJ 2KL8A 4DUYJ 4B3MJ 2UUAJ 3JAMU 5FLXU 4JYAJ 4DV4J 4LF9J 3D3CJ 4DV1J 3W1YC 2VQEJ 5LM7E 4DV0J 5BR8J 4KHPJ 2UUCJ 5IT9U 4DR4J 2VQFJ 4X65J 4GKKJ 4JI0J 5LMUJ 2KVQE 4V1Ak 4LF5J 4NXMJ 2UU9J 4DR3J 4LF4J 1N34J 3R2DJ 4JI7J 4DV7J 4DV3J 4LF6J 4JI1J 3D3BJ 4DR5J 1HNZJ 4DV2J 3T1YJ 4LFCJ 1HNWJ 1IBMJ 4JI4J 4PWWA 1IBLJ 1XMQJ 2UXCJ 5IWAJ 1I94J 4X64J 1XNRJ 4YY3J 4X66J 2E5LJ 4LF8J 1XMOJ 5AJ3J
chains in the Genus database with same CATH superfamily
3G2XA 4OZ0A 3NG8A 5C42A 3KLEB 5EUHA 2UVRA 2HBQB 4X84A 4DLEA 3TZWA 2HEKA 2O3DA 3LP1B 3POTB 2BJ1A 2CWKA 1V3SA 5CYQA 4HLBA 2BRKA 3DHXA 3N79A 3UCGA 1LK7A 3NCPA 3CULA 4KGMA 1RCXB 2HMIB 2F8HA 4DHVA 4WE1B 4XIUA 2W8KA 3CC7S 4JI6F 3K57A 1T3NA 3DXBA 3PTWA 4IO1A 1D09B 3HP6A 1NPKA 2C2RA 2QL7B 1EKRA 5BJRA 3TP2A 2W9BA 1RU2A 3G6XA 2M7SA 3OXFA 1NJZA 4DCOB 4ECYA 4DQSA 1WEYA 3IP0A 5F41A 1RWWB 3I4PA 1X5SA 4DL3A 2HHHJ 3PIOQ 3CJQA 4M5KA 5H1SV 1RHUB 2KFNA 3PIPQ 1YX2A 4H54A 5F3ZA 3IR5B 3BB5A 1N34F 4NEYA 3U27A 3AJ1A 4LF8F 3MR2A 1S1TA 2RD5C 4L75A 2AJQA 1LWXA 3N6LA 2BXJA 2HQDA 3ZTPA 5KAKA 2DK2A 5D4NA 1N4LA 4DU7A 1HBNA 4C0OC 1CS4B 4DOZA 5J2NB 4CZCA 4EZ9A 3CCES 4RJVA 1ZPVA 4ECQA 4LR7A 3NS7B 2GJFA 1NDKA 1I1GA 2IDEA 3QT6A 3UD5A 1R0CB 2ZOFA 1FF2A 2FB0A 2ZKUA 3ZZUA 1NSPA 1HNVA 2WW4A 3HSDA 4F67A 2MJNA 3TA2A 3KLHB 4FN5A 1VLYA 4D3HA 3EYZA 2ZH3A 2MSTA 1FFGB 1SVDA 1U25A 1RWOB 2QLBB 3CDEA 3KXDA 2HZCA 5I3QA 3NGSA 2E5IA 2V8DA 3MGJA 1BQNA 4U7UK 4F36A 4F3QA 1S97A 3FGVA 4ZPAA 4DG1B 3RJMB 3SI8A 3JAMY 1JJ2R 2FVQA 5KFMA 2W4CA 3MM7A 3U7JA 4FXVA 4RBVA 1YRXA 2XMAA 1I51B 3M6VA 3MPDA 2FY8A 2F40A 1KDNA 2W2QP 2VOOA 1VBZA 4AD6A 5HAOA 4ICLB 3IAM9 4KRWA 2R7WA 4OI0A 3CWJA 4M5JA 1EP4A 3D0GE 3NS5A 5FIIA 2CVIA 2BUNA 5HATA 1S5ZA 3PX4A 3MOZA 1UA1A 1KC8T 2GMHA 4OHXA 3HULA 2COLA 2IRXA 3ISND 3M8SA 1HBUB 4K4XA 4OL8A 1QE1A 4BS2A 1SKRA 4WWSA 3IRXA 1FX2A 3QT7A 1XNQF 2Z2ZA 3DOKB 1YWXA 1HBMA 1M5PC 2FHJD 4OZ1A 3MECA 2NXEA 3BR8A 3D67A 4MYTA 5F8HA 5GAGI 1RKJA 4ANEA 2VONA 4ILMA 1G7CB 4QR1A 4E2FB 3DOLA 3FRYA 3PJWA 4LFCJ 1VCTA 1KLNA 1TL3A 2J6TA 2HGNA 2X1GA 3QIDA 4WYLA 2E7VA 4ZCMA 3CPWR 3V6DB 2PDAA 4H4MB 3O5TB 4J90A 3MR3A 4B3MF 3NLCA 4OYOA 1JXEA 4OI2A 5GAEU 4W4MA 1VIOA 3EX7B 2HRUA 1TAUA 2DO4A 1DAXA 4Z2XA 4C8KA 3LGNA 1T94A 4MJKA 5GAGU 4P10A 4Y28C 2CKWA 5D0RA 5LSRA 4NWBA 3QNWB 3QPIA 3MEKA 5A8KB 1PSDA 1BQMA 2OMLA 2C3UA 5BYRA 3OL9A 5E3RA 2HZAA 1SJRA 1GQEA 3KLFB 1WUUA 4ED3A 3TUJC 1JLBA 4Q44A 4DFMA 2XNQA 2F63A 2ZEJA 2IRYA 4QIWD 2N3OA 3J80U 1JLEA 2L41A 1ICEB 1R8AA 3TA0A 2N7CA 1HBOA 1Y00A 4DJBA 3VF0B 2KG0A 4NLXA 3MPYA 2MY8A 3HHLD 3PDNA 4LREA 3BGFA 1QD1A 4ZOSA 1SL2A 2XY5A 3HD2A 2ZD1A 1HBOB 2MQLA 2J8SA 4S0MA 1M5KC 3NNHA 3FSIA 1WC0A 5IV3A 1IQTA 4MKVA 4MK7A 2DGQA 1RAEB 4LT6A 4YB7A 4CDIA 1QY7A 4HH0A 3CCVS 1B3TA 4LSNB 1EQMA 3US5A 1RHKB 3MHYA 3HLUA 4OJHA 4FF1A 1P1TA 3MM8A 4ILRA 4AQYJ 5CAAA 3DM2A 3W9IA 2AIRB 3AB2B 4ECWA 2KJWA 3DLKB 2BJ7A 3QGHA 3FC9A 4FPRA 3ZTQA 4R8UB 1UJ5A 1OWXA 2AMCB 5HQMA 2CPIA 3KG4A 1PJ7A 3RW6A 3H5XA 2F3JA 2H1YA 2XMKA 1V5VA 1HFEL 1UP1A 2CG4A 4J9VA 4KR0B 4NLQA 1LWCB 3KHLA 1R89A 3PCOB 4FYXB 2ILYA 4CH0S 5SZTA 2MQ8A 4PXBA 4J9RA 5J2QB 4CNYA 4DUZJ 4L74A 1TK0A 1N32J 3NEKA 5AE3A 4DPTA 2VJUA 4KHPF 2B9WA 2HWIA 2OH2A 3L7UA 2E5GA 1HBMB 4LVOP 4WXWA 1REGX 2WK4A 2ZVIA 2HK3A 4USVA 2UUAJ 3SFGA 2QA1A 1U1NA 1TKXA 3PRDA 1XJWB 1QE1B 1S1WB 5L1KA 3G86A 5L39A 1T03A 3BBCA 5LOQA 3CW2C 4HL9A 2ZH1A 1UZHA 2BOPA 1RT7A 1G3OA 1S9EB 1BQXA 2MGZB 2B56A 4DN9A 2SXLA 3CCQS 2MB0B 3R5AA 4MKAA 2VQEJ 1C1CB 2N7YA 3IR7B 3MMBA 2DEIA 2Q79A 4UUWA 1CBKA 4ZP7A 4DR4J 2ZD1B 1SQEA 4FP9A 2CJKA 1NK4A 1VDHA 2CG8A 2EKNA 2IM3A 1TELA 4WU2A 5E5NA 2DNOA 5FDLA 4U9RA 4U7UD 1Y4ZB 2FYXA 4V1Ak 1AYEA 1BE4A 3ENQA 3M2RA 3HHDA 1LWFB 1WOPA 4AYBD 1EJ7L 1RJJA 2UUTA 3GCWP 1UFKA 3DLGA 3ZO7A 5MAOA 3ET6A 3CJ8A 3TVYA 2DVIA 1AT1B 1JLBB 1X4CA 5B7WA 4DR5J 3PW4A 4QCLA 2MQMA 3T1AA 4A46A 2VG6B 1KP6A 4LRDA 4OV6A 2AV5A 3PYGA 5A8KA 2E1CA 1NKBA 2KN4A 1IBLJ 1TQLA 2H5IB 2XQCA 1VK8A 4DSLA 1ZH5A 1EETA 3EZOA 1V9OA 3CSKA 5AXLA 4C3LA 5KG6A 5KFPA 1B4SA 4DL2A 2QN6B 2QIFA 4F2RA 7AT1B 2KHDA 1U2CA 2B43A 1QTNB 1YRTA 2LXFA 3EJMA 3EZUA 2LA6A 1Y5NB 3OR1B 1BUXA 3PFOA 4EU0A 2ZBPA 1CSJA 1Z2LA 5HK4A 1KFDA 2DR8A 4E8UA 4C8OA 3EVWA 1M5SA 4QZVB 3DOLB 2QT7A 5CHCB 3MUMP 2ZJPQ 3C6UA 5A0YA 1MWYA 1S6UA 5DG9A 1YI2S 1R7IA 4CH7A 3ADAC 2XLJA 1YKWA 3LA0A 2KHCA 3AY0A 1KLMB 2I0XA 1TTHB 2JVOA 2XSFA 3SCIE 3IS9B 3VAHA 4DV6F 3GFZA 3T1YF 4YQWA 3CJ4A 4LFCF 4K4VA 2GW8A 3TX0A 3CEDA 1S6PA 2E5HA 2LXUA 2UV8G 2OSQA 3W64A 2VICA 4JI1F 4ECSA 4KGVB 4DV7F 4TN2A 3PW5A 4DV5J 3M9MB 3H59A 3R7NB 4YR2A 3GIMA 2E5JA 2W9BB 1GMUA 1NSAA 4HT5A 4ZPTR 3MUVP 1WG1A 1NM2A 3CB4A 3CIMA 4J7CA 2NUHA 3NWRA 4X66F 3MD1A 2J0XA 1JLAA 1WF1A 5K14B 3LQVA 5IWAF 3JQKA 3H8YA 4ELTA 4FDFA 3QQCD 9RUBA 4UW2A 2VB6A 2V34A 3IG1B 3CJKA 3R5GA 3UQSA 3K5MA 5DS7A 3OTOJ 3D2WA 2KT5A 3LP1A 5FD1A 4GRSA 5KT5A 2YX4A 2V94A 3HX9A 4JI7F 1AA1B 2VASA 4I4BA 1FJGJ 3OL7A 1UA0A 1XR6A 2CVEA 2DXEA 4DS5A 1A7GE 4NXMF 2CNNB 2NXNA 2XZDB 2XHCA 4M5GA 5KFDA 5T14A 3MEGB 4U67Q 4V19X 5F8GA 3DRSA 1VR6A 2KU7A 1YJ7A 3L7PA 4M5DB 1JX4A 1S9FA 1IKWA 4JOUA 4QU7A 3A3NB 1X4AA 1W26A 4NASA 3A3PB 3Q8YA 2V0NA 3I82A 1I6JA 1UVIA 1NU4A 1ZOTA 4NRTA 4YDXA 5KFYA 3SFUA 1RTZA 2Y0SD 1FD2A 3JQMA 1RB0A 4ILLA 4MFBB 1A0OB 4OX8A 1MROA 5H9FJ 2VIHA 4K4UA 4OYBA 4X65F 1CVJA 2OPSB 2YPYA 3ENVA 3JS9A 1T8EA 2W1BA 4CLFA 1FDNA 1HW9A 3W65A 2NXJA 4PYDA 4DL6A 3M8YA 4H4KC 1YITS 2VKZG 4KH1B 4NLTA 3G71S 3KJVA 4ATNA 4WKYA 4LF9F 3CO9A 4PZVA 2LMIA 1FJGF 4WTOB 1MU2A 5GMKa 2WB1D 3R7BB 1KQKA 3ZZYA 4L76A 2XY6A 4ED1A 1FERA 1KTQA 1KVKA 2O67A 2VG5A 3GJQB 4O3QA 2G2ZA 4KGKA 4DCPB 1HNIA 1DQAA 1IBCB 1NCLA 4RU9A 4QJVA 4N8NA 3J80Y 1U6FA 1HA1A 2IC3B 2RQ4A 3VV2B 4N7TA 4KHRA 4QR0A 1F5CA 4KPCA 2DD8S 1AXQA 4P7TA 4C97A 2AGPA 1JLGA 1R0AB 2LEBA 4CYUA 5HROA 2Y1IA 2DGSA 1IUJA 2DKOB 3AOBA 3C2PA 1FKPB 3HHLA 2QSWA 1NEEA 1HWLA 3OR2A 1M5VC 2CPDA 3LALA 1NZ8A 3NY0A 2UUBF 2FUG9 2QGFB 2EKYA 4NYZA 1RXOB 1VRTA 5KFFA 2GHPA 3CCUS 1RT6A 1T0TV 2D3O1 1KVIA 1F9EB 1TL1A 3D54A 1IBMJ 4OHZA 3UO0A 2F4VF 3I31A 2AEFA 1VQ6S 1CJVB 2QL5B 3KKFA 4MT1A 2XB2D 4IG0B 2RILA 5ETPA 2EBEA 3B78A 3TR5A 4CRJA 1TK5A 1UVJA 5IQQA 1NK0A 2QTWA 4DX6A 2RDIA 4WP9A 1RTDA 3DLHA 1FTRA 4X66J 3MM6B 4OYXA 2BRLA 3MAHA 1X0PA 2B8PA 2M88A 5KG4A 3EPIA 2P9EA 1YBUA 2QA4G 2RNEA 4KAIA 2XS2A 1EHWA 1Q8IA 1Y10A 2DY9A 4Z7CA 2WOMB 4X4OA 3OJUA 2F4VJ 3QJLA 3MWBA 1ZTTA 2Z2YB 4RLEA 2BOAA 5DQIA 1UEUA 3J81Y 4NCAA 2MKKA 2MYFA 5ETQA 2GQQA 3GJRB 1VGYA 3HHLB 2P2CB 1VQMS 4HI2A 2IM2A 3TJ9A 4FF2A 3R3TA 3HJFA 4I6WA 3GYNA 5HROB 4H4OA 2E5LF 4E0DA 1NRKA 1FKAF 2ZC4A 2JSXA 4NXNJ 4BC7A 5HVHA 2J9DE 1MWQA 1YRUA 1V3ZA 4ECVA 4N56A 1FWLA 5H9EK 2DR9A 2BJ3A 5I3PA 1I94F 4DPOA 4C6AA 4YUDA 1PJ6A 2C3PA 3EGWB 3LTOA 5LSLA 1XQIA 1N6QB 3TVKA 2KVIA 2VJVA 4FNHA 3C66A 1F9FA 4MIAA 4X4QA 1LXJA 3A13A 2CUYA 2RE1A 3KNGA 4ZLNA 1S10A 1YK9A 1MU2B 4DSKA 4NCBA 2ZWOA 4DL7A 5GMEA 3E2EA 2ALZA 1HQUB 4WZQA 1EARA 2MQPA 1XEZA 2G2OA 3HSGA 3ZZZA 4ZLJA 4JV5J 4HT7A 2GJIA 1CC7A 5FLXY 1X4BA 2VC1A 3I6PA 2H9ZA 1RT2B 2MZ1A 3NGTA 2EFPA 3CC2S 3RRHA 1AW0A 4RBUA 4TVAB 5LMUF 1N5YA 3D9BA 2DHSA 1HL6A 4RW6A 4MFBA 5B0DA 2A6OA 1H7WA 1KOOA 1R6YA 1LW2A 4OX6A 5LM7E 2QRRA 3TJAA 1U48A 1TK8A 4F02A 5KFGA 2K7KA 2M52A 3RGIA 3SCJE 3KLIA 1S0OA 1WHYA 1IKWB 1KFSA 1X9MA 1X5TA 3M4XA 2CAJA 2VG6A 1C0TB 1X4HA 4K5RA 4EEYA 3RBDA 2Y8WA 4QYZJ 1H7XA 2VODA 2MPUA 2KL8A 3AD9C 3M8QA 4IKAA 5K8OA 1TUWA 5L1IA 2F7VA 1XERA 2CZVC 2LU1A 3M6UA 3PJXA 1R8PA 2QE5A 2MSSA 3DLGB 2KT3A 5IM0B 3PV8A 2VV5A 3RBEA 4B9LA 1N33F 3THVA 2FVSA 4CLUA 3U1MA 4W92B 4WXOA 4ZK7M 1PAEX 5LJ5Y 2I6WA 1LKZA 3BSCA 3CNQP 5D77A 4ANCA 5AXNA 2Q66A 2FHMA 1RLDA 3BBFA 1VFJA 4LRAA 4IRDA 1REVA 4MK9A 2GQCA 3ELHA 5CXTA 1S1UA 3I96A 3MR7A 2JOQA 5ETMA 3SEOA 3IBWA 4ZCKA 5I3UB 3LGHA 4OV1A 3WC2A 4LF5F 3IGVA 3V6HA 1RT7B 4CM2A 2HS0A 3TAMB 1F60B 4BWJA 4B3OB 1T03B 2RB7A 4EBCA 1QDUB 1Y11A 2H5EA 2PGCA 3N5FA 4TY8A 2O66A 4C98A 3DRPB 5K8MA 4O0IA 1TKXB 1KLMA 1YDLA 2YQ1A 1VQ7S 4FYWB 2HLUA 5L46A 1U7LA 1IN0A 3I5CA 5KFKA 4K0KF 4DR7F 3D3BJ 1RWXB 6AT1B 1NZAA 1IXKA 2FJVA 2QFIA 2R8GA 2KXNB 1AUDA 1WC3A 3P96A 5B0BA 2D69A 4QW9A 5IC6B 3PW7A 3MOJB 1YZ6A 4P73A 2R7UA 1NHUA 1XMQJ 3QJPA 5C2CA 1IJFB 4QU6A 2CPJA 2GHVC 1L5UA 1UWBB 4PEOA 1WC5A 2R2SA 1Q86T 4FYDA 3JYTA 1D9FA 2FLOA 2FZGB 2OFHX 2WVEA 1CJUB 4WFYA 4ZP9A 1YIJS 3CMES 2J0WA 4IR9A 1S6OA 3DM2B 5K5MA 4HYKA 4P2SA 3PXGa 3V6KA 5DG8A 1PCAA 1CJKB 3AD8C 2KYXA 2PEHA 3DLEA 5A2QU 4DF4A 2IAJA 3MTJA 3KK3B 2DNNA 4LIRA 4JUZA 1U6BA 2B6AA 1HHTP 2DR6A 1TZ0A 2XZTB 1YSJA 3PO5A 4J9NA 3BSAA 3U1NA 1DHMA 3CCTA 2VDHA 3EE3A 3ICLA 4IOCQ 1VOMA 1TKDA 3M2RB 3MI7X 5J2MA 1F3FA 2JJ4D 3A12A 4TLRA 3QLHA 3T9ZA 4F4YA 2D3OR 2OIHA 4QPTA 1JKHA 3KNAA 3E8OA 1UEVA 2FD2A 3QJJA 2YNGB 2HNDB 3KHHA 4WIQA 3B4MA 4B17A 1OYEA 2YH1A 4K5SA 1NHKL 3AA9A 1YJNS 2AEJA 4YR3A 2M9KA 3GIRA 3I9ZA 1M5HA 4ZVPB 2R8KA 5KFOA 2LLZA 2H65B 1QAYA 3H98A 5B08A 2BM0A 2MGZA 3J81U 3W3SA 1FVSA 3AJDA 1VLOA 3EM1A 4GVBA 4NMLA 4RWXA 5KG3A 4JI4F 3VALA 1U4BA 4IQXA 4YP3A 1BQMB 3PHTA 4OZLA 4KKOA 3HKWA 2UXDJ 5F8IA 1TKZB 1WSRA 5H9EJ 1PYTA 2RH3A 1IWGA 1K1QA 1UCNA 1LXNA 2DCUB 3MPUB 2UU9F 2HHWA 2P6SA 2IPOB 2MKCA 2WBRA 2VKRA 2GGPA 5JMNA 3PR4A 3H4DA 5EWEA 1L3TA 2W9CA 1XMBA 1XIQA 3NNCA 2A2DA 4OHWA 2B4UA 3DDIA 5J2QA 2ZITA 4DFJA 3TAQA 1NB7A 3C14A 4EYHB 2RDDA 1LWCA 1TL3B 1Y9OA 2AYMA 2B7BB 2GQ2A 2VF3A 4ZIVA 1H74A 3S6EA 5KT3A 4EBEA 2CA9A 2V4JA 1TL7B 5D4PA 5C25B 1N33J 4FNIA 4JI5F 4RW9B 2UXBJ 4NEZA 1C0UA 2HBZB 4DV0F 2OD6A 1FA0A 3M9NB 5D78A 3H25A 2XYHB 1BGXT 2XEXA 2PI5A 1G2EA 3ONQA 5KFJA 2XLIA 5DLFA 3DRPA 1JLCA 5K8NA 3JAMU 2Q6CA 1PG5B 1HBUA 1TKTA 2QEXS 3HK2A 1CEZA 4JYAJ 4B3OA 1NPPA 4F2SA 4P74A 4RNHA 2ROGA 2VBWA 3FSXA 5HN0A 1ULRA 2FPHX 3LP2B 3M2VB 4ZVRB 2HNYA 1GMWA 5A6PA 2DEJA 5I3UA 3V4IB 2GMLA 1WI8A 3HJVA 4NI2A 4LRBA 3V6JA 2GA7A 2FDNA 2NS1B 2YNFA 2LA4A 1YZ7A 3DC2A 4USJC 1FXDA 1JNRB 2EBGA 1RAFB 2LQ9A 2RF2B 2VFUA 3GSIA 3MM7B 3FEXB 1S59A 5L9XA 1NK9A 2ZKTA 1KWMA 2PN6A 1HYSB 4DG1A 4OI6A 2X3DA 4NXMJ 2Y1RI 3MCNA 3EMTA 3GIKA 2UU9J 1DLOB 2JEJA 2IJRA 3T6JA 1YBAA 4CO3A 1SQFA 2Z58B 3OSNA 1ZZNA 2LEAA 1DTTB 1P1LA 1RP5A 2QLXA 3CJ2A 3FFIA 3L9ZA 3ETMA 4C8MA 3CD5A 1I3OB 5G4DA 2DYAA 4DV2J 3T1YJ 1U1PA 2J7UA 4FXDA 4TKTA 3W9JA 4C48A 2DBBA 2P9CA 1ZAWA 3F56A 5E33A 3T1HF 1L3UA 3UDVA 4C3KA 3ITHA 5CCMA 3L7OA 3KLIB 1I94J 1CQNA 4YB6A 1IQZA 2ZM6F 4RR5A 1VISA 2C2OB 2GVZA 2JH3A 4ES1A 1KKHA 4DFPA 3Q2TC 3CJTA 3Q8UA 2V9KA 2V50A 2HWHA 4JV0A 2R8JA 1RAOA 3W8PA 4V19J 5AJ3J 3P49B 4C4WA 3JXOA 4RW6B 1OPIA 4Q8FA 4WFXA 2F1FA 1PIEA 3MDFA 4OZJA 3G8SA 1VRUA 3MMJA 1S1TB 4KSEB 4ES2A 5F9LA 3R5BA 1IR2A 3PW2A 4C11A 3OBIA 1P8GA 1HQUA 5EHHA 2NCKL 3VAFA 2B9YA 2KI2A 3DOKA 5A8RA 5E41A 2CYYA 4A8OA 2WHOA 4LF2A 5HMZA 5IZHA 3VZIA 2YWWA 1XC9A 5F8MA 3AH6A 3HM9A 4AL7A 2RHQB 4EFAC 3PR5B 4DR6J 3G6VA 2ZM6J 1VC5A 2P6TA 1T95A 3IA0A 3LO3A 1TAQA 5KG7A 2E1PA 1IM6A 4C2MA 1IKXB 1VQSA 4NA1A 1HHSA 2NPIA 4KY3A 2XMVA 3KG0A 1SC3B 5A2QY 3UDLA 4J9SA 1F1BB 2ZBCA 1IBLF 3TW0A 2WSEC 5DJBA 1X8DA 4B9VA 2C2ZB 3I0RB 1VS3A 3KHRA 3SYZA 2JFKA 2NLWA 1XNRF 1EKSA 1FK9A 1N0UA 2I8EA 2WOMA 3UN5A 5KFXA 1SJFA 1SKWA 2IDLA 3MR6A 3GTYX 2VG7A 3CJRA 4DPUA 4MKYA 1E6YA 2JC0A 2B7CB 5HJXA 2M8DB 2WSCC 4USTA 3DGVA 4B3SJ 1JLFB 4DLGA 1NJWA 8ATCB 4TYAA 2C2DA 1HNWF 2V4RA 3QRRA 1Q7YT 1RHMB 1RTDB 2N82B 4HTIA 1RWNB 3B54A 5J1NA 3CXCR 2JX2A 4C0HA 2H3EB 1HNVB 4IG0A 3KOAA 4F4XA 5HP1B 1CJVA 1CULA 1SC4B 1GTHA 4CLPA 3A8JA 4ERDA 3NMRA 3AAWB 3LUYA 3WIUA 2HLTA 3NGKA 1ZBTA 2ZHAA 2WSFC 3MM5B 1LW0B 2FLPA 4PRFA 1VQPS 2OD4A 1HBNB 1RBOB 3VVTA 3OHBA 4PPDA 1O51A 2HVDA 4I0WA 4EK2A 3IN5A 4BWMA 2A18A 1MN9A 5KG0A 3DU6A 1JJ4A 3H5UA 2J9CA 4ZVOB 3MEEA 4KV8B 1PYSB 1OQ6A 4J91A 5L8RC 2IC3A 4R5PA 2F65A 1YGYA 3KDOA 3D6FB 2CQ0A 1RTJB 4F50A 4Y34A 5EDWA 4DF8A 1URNA 4P2FA 2J0SD 2AJ2A 3SDEA 3R1HA 3PKMA 3T5HA 1PILA 1N32F 2RT3A 4K7QA 4PG6A 4U7CA 2Q1LA 1RTIB 1HMVB 2C2MB 4NA3A 3CO0P 2BKNA 2GVDB 5HBMB 2KVQE 3UPFA 3KJVB 3RRGA 4LF8J 4CLLA 1N48A 2MKJA 2VBXA 2LYVA 2HQGA 1D1UA 4U96A 2UXBF 2DRAA 2OPSA 1UW4A 1KVJA 1FRMA 1H2UX 1IM4A 3ZZRA 1S1XA 1T9YA 2DNHA 2WTFA 1N34J 1IR1A 1RE1B 3QO9A 1H2TZ 3BREA 5C2GA 2HMIA 3B82A 2CQCA 3MMCB 3Q22A 1RWUA 2LDIA 1NDLA 4G1QA 1OPZA 4M5IA 5ETSA 4N47A 3POTA 5CYQB 2ASDA 4GKJF 2FJWA 4QQBA 2DNMA 2X3GA 3VQSA 4YR0A 4LFBF 4ZPDA 3SMZA 5C42B 1WF0A 5M2RA 2DNYA 3MMAA 1RAGB 5EWFA 2QX0A 3BH7B 3KLEA 3VAJA 2QL9B 3SV4A 3TAPA 3MEGA 2R7TA 5DETA 1RQ0A 1PAUB 1FI4A 2BE2B 3HSZA 3TZYA 4X4UA 1DTQB 3MUTP 3QWPA 4GKJJ 4JI6J 2F4FA 3HT0A 3CGIA 2FLNA 1FD8A 1VIXA 2K8GA 3E51A 1HIYA 3UVJA 2AKWB 1P9YA 3ENWA 2AX0A 4Y65A 5HI7A 3M7VA 2G2YA 2GC8A 2OHDA 3KK2B 2V4QA 4F4ZA 4IO9Q 2BANA 3R1LA 3CJKB 1S4EA 2E1RA 2VUGA 4ANDA 4CLWA 3ZXWA 2KJVA 2CJXB 3CJSA 3TZZA 2L9DA 4PXCA 3MEDA 3DGPA 4Y3CA 3GPAA 4DX8H 2GO9A 2XZWA 2BA9A 3MAQA 3OUYA 2FJXA 2EC0A 1JLAB 1IKYB 5JVHQ 1RADB 1FTCA 4J9OA 4RKUC 2OELA 3NOGA 3EUNA 4ED4A 1KD1T 4KIAA 2YKNB 1X0FA 5DDOC 3OVSA 1NPRA 4OJ1A 2RQMA 2MKHA 2OLWA 2E29A 2LFVA 5D4LA 4OYWA 1S6PB 2X1AA 4WTYA 1JLQB 4NLYA 2HURA 2VPXB 3ZC4A 2QFJA 1Y5LB 5L38A 5B0AA 4P6QA 3A8KA 3R27A 3BZQA 3UR3C 2XYGB 2ZDOA 3D68A 3W2WB 4PQUA 2AJ0A 3JQJA 2G0IA 2BZ2A 2VFVA 1C4CA 3MM9B 3BO3A 5LMNJ 4A8WA 3PW0A 2KTQA 5A8WA 5CYMA 5HANA 1WC6A 4DCJB 3P4UB 3K59A 3QT5A 1DURA 4KHMA 1RT4B 5GAHU 2WVDA 2WVFA 1J5OA 3M8ZA 1TUVA 1WF2A 2BKOA 3Q23A 3LAKA 3VGUA 3GCXP 3KUEA 2MTLA 2KXFA 4FS1A 5EX0A 4X4PA 1NNDA 2ZC3A 3BSOA 4LF7J 1X9WA 3N28A 3PZPA 2XTJP 4P71A 3VAIA 1SL0A 4ES3A 1RI7A 1UAWA 2FJBB 2R2TA 2DHAA 4M5MA 1S12A 3QMQA 2WAQD 4OJGA 5GAHI 3V81B 4ZHRA 2OMOA 3VHQA 1N88A 5E2QA 4GC7A 2MZTA 2Q43A 1J5OB 2VBZA 3W62A 4K8RA 1XBWA 2OPPB 1SUQB 4QWCA 3G8TA 1HI0P 2LVWA 5D8HB 3AOAA 3H0PA 4UF4A 4Z37A 5M2PA 4QIGA 4Q0BB 2ZH6A 1JIHA 2XMWA 5FDLB 4XPCA 1DJ0A 3QFHA 5RUBA 1HR0F 1FCAA 4FS2A 1LK5A 4Y2AA 3L3CA 4ZVGA 3BO2A 4DUYF 1UTAA 2M70A 5BR8J 5I42B 1OSDA 5G0RA 1KTVA 1C1CA 3MMBB 3M1VA 1RWVB 4K59A 1FKOA 1TVRB 3OTEA 3T6BA 4KO0A 4OFZA 4BBYA 4NMXA 1N5QA 2WB4A 1UPMB 4Y6IA 4BCAA 5HO4A 5LMUJ 4ID8A 5EN1A 1XWLA 1Q1KA 3NAHA 1KHVA 1S1WA 2XGPA 5LSOA 3R6LB 3LWLA 4DR3J 1T02A 4XAKA 3MFHA 2ZVSA 1EQ0A 3Q8SB 5GAEI 3MZIA 1HQEA 2ZHBA 2UV8A 4DU8A 1UVKA 4DZDA 3S1TA 2V67A 1UWAA 2Y1LB 3KK2A 4FKYA 1VQ8S 2HZVA 4P7VA 2PFDA 4ER8A 4I7FA 4ZVTB 4AUKA 5IXUA 1AZSA 2I5JA 2K2PA 2HQFA 5F3TA 5L1LA 2LQ8A 3CDBA 3LPEA 2ZBQA 1GEHA 3CIZA 3T41A 2AX1A 1HI1A 5HJYA 4K4ZA 1OY9A 1HD0A 4LF1A 4K4TA 2E5LJ 2F9DA 1XR5A 3PEJA 4QOTA 3DLKA 2J76E 4YB1P 1RBAA 3HHNB 4WZMA 2HRTA 3MAAA 4OX9F 4A8SA 4B9MA 4CWBA 1HWUA 4IOAQ 4TU7A 3ZZPA 3PYEA 2AGQA 2IM1A 3N0VA 1LEOA 5F0UA 6FDRA 2R7VA 1RAAB 3CD6S 3RRKA 4QPXA 2EI5A 2J8AA 3NL0A 1BWVA 1M1GA 1PKUA 5ETOA 3J7A1 3TWZA 2W4PA 2HWTA 3NKYA 3P5TL 1RYSA 1WHXA 3UWTA 1GNKA 5F8JA 4B3TJ 2ABYA 2FJDB 5KFIA 4X4RA 4UQGA 3HD1A 1U1QA 3BN4A 3P3DA 1ZM3A 4ZKAA 3CD7A 1AROP 3E3XA 3LANA 3QIPA 1H98A 2U2FA 3J7ZT 3FKBA 4GO7X 4UY85 4ELUA 1V6HA 1O0PA 1QUVA 4ZVQB 1OJ4A 1QVFR 3W5XA 1WOOA 2QLFB 2DHHA 1H72C 2ASLA 4ED0A 2V2VA 3D0HE 3TUIC 1VBYA 1H0HB 2MQNA 3LGMA 3I55S 2GAGC 2AWZA 3K89A 4TLQA 5DGBA 4U8VA 5E3PA 3BO4A 4UTGA 3KLFA 5GADU 4NL5A 2ZE2A 3M8PA 3OV7A 1F2GA 3H42A 3HT3A 1DY3A 2KRRA 2WONA 1VC0A 3CTRA 2G4BA 4DX5A 3ZTSA 1QM9A 2IA0A 3I56S 1HNXF 4NLOA 1GH8A 3SQGB 4M94A 4EBDA 1QAXA 3Q8QB 5GADI 2A10A 1P6TA 1KQGB 2B4VA 2H4YB 2CZ9A 2MLYA 2YKPA 3HCXA 3R9LA 2FC9A 3V6DA 5HP1A 4URSA 2C2NA 2A6MA 2DH9A 2MEWA 4NLWA 4PG8A 2AT1B 1AFIA 4I2PA 3TI0A 2Y8YA 2R7OA 1KR4A 1WOSA 1YJTA 4M63A 2QYGA 4OZNA 4JI8F 1X31C 3KJFB 2VQEF 3IGNA 1JLFA 2KZMA 2HQ3A 2I1RA 2X51A 3M32B 3QZ8A 4PG7A 3QGGA 5E3QA 3W2VB 1X7VA 4IRCA 2DCLA 2VD3A 3K5OA 4URGA 1YJ9S 2XM3A 2HG4A 3SSRA 4USKA 2VU5A 2QLWA 3FCHA 3V5RA 5C24B 4J9MA 2HHVA 1A6LA 4CT9A 3I0RA 1FDBA 1RAJA 1D9AA 2LEPA 2PFFB 3UR0A 4WJBA 3G82B 4LF7F 3G6ES 3DYAA 1VI7A 3IBFB 2QC3A 4QBUA 3GIIA 4AQYF 3O44A 1SI9A 4U8YA 2P8IA 2YKMB 4L72B 2A3JA 4ECXA 3BM7A 3AQOA 4O44B 4CTAB 3L95X 1SC1B 3M6XA 4Y2IA 4DFKA 2UVVA 1SC6A 4OZ2A 1JB0C 1B7YB 3TYTA 5KFUA 1FVQA 3LOUA 4JI0J 3TUPA 4A8FA 3FUYA 2KKHA 2V8GA 1H6KX 3D1HA 4TYBA 2DGWA 2XMMA 2KRBA 3JSRA 2F5GA 3N6NA 2EG1A 1J27A 1Y3KA 3P5BP 4EZ6A 3QRPA 5HQ8A 1OS5A 1FE4A 3W2VA 3M32A 3ENAA 4HI1A 2PMWA 2BKPA 3DMJB 1U0HB 1ZA1B 4TNOA 4DV3J 4LF6J 1K0VA 1NJIT 4RW4B 4USHA 4G65A 2OAUA 4RNNA 1OY8A 1VQNS 3HVAA 3IAS9 1HI8A 4DR2F 3AOCA 2EK6A 2MHNA 1S7IA 2YKQA 2ZBIA 3K5PA 2O5DA 4B3RF 2CPZA 2ZBRA 3BKUA 2V8PA 3DN9A 2DY1A 4I6YA 1T9TA 2FGCA 3W5ZA 3SQGA 4NLPA 1W25A 1C2PA 2R2RA 1CS4A 5JUMA 3W8GA 4DBQA 1UETA 2W01A 1RT3B 2CQBA 1H38A 2ACYA 3CCSS 3TOQA 3KLVA 5AJ3F 1VBKA 5SUHA 2H54B 5KFCA 4DR6F 1N54B 2E1MC 3IBCB 3OD2A 1T9UA 4NXNF 2YH0A 4RW4A 3MD3A 2R8IA 1AB8A 2JLFA 3FFIB 2X1BA 3FZ2A 3GJTB 4PXDA 1SH2A 4X2BA 4PABA 2VFRA 1LQ9A 3BR9A 1Q7LB 1ZZFA 3M2UA 4AXJA 1N36F 1GXLA 1JJCB 3DOMB 2B8QA 2DNPA 4BLGA 3BF4A 1TUGB 4DI6A 8AT1B 5H9FK 3PVXA 1NXIA 3LF0A 2ZH8A 1WKKA 3GB0A 3QT8A 2ZOGA 4DV6J 3ZTRA 1Q81T 3KUHA 4RZRA 4AE5A 5K20B 2QO3A 1SIZA 2YXLA 4DR3F 3Q0AA 3L09A 4Q2LA 2YNFB 3FNNA 3DLJA 1UVMA 4U95A 1ZTWA 3QSYB 1IWAA 1PBAA 3PFEA 3V4IA 4YS2A 2ZZNA 2MHEA 3C8YA 4MTPA 4NZ0A 2B5JB 4K2JA 1KBRA 1GMVA 1H73A 1U6ZA 4WE1A 5KT4A 4OHVA 3BH6B 3L4BC 1PYOB 4PR6A 4KB7A 3SQOP 3THTA 1Q5YA 1S72S 3MCOA 1TKTB 2DNKA 5MLCV 4I6AA 3BKFA 4CQ1A 2IMOA 4C8LA 2IA6A 2Q6BA 5JJBA 4QYRA 5DM6Q 1HR0J 2P5VA 4RW8B 1DBDA 1RA7A 2MZSA 5F8LA 4A8QA 3CMAS 2C3OA 1DZ5A 3OFFA 4HDGA 1C0UB 4QW8A 5C25A 2QYCA 1VQYA 1EB0A 2BJ8A 4RL1A 1CC8A 2XY7A 4OYZA 3M30B 1NK7A 4LR9A 3DRXA 1SIWB 2OI2A 2VC0A 1NJYA 2DO0A 4LJMA 2N3LA 3Q89A 3QSIA 5AXKA 2XI2A 1GX5A 1KRPA 1U2FA 4ITSA 3WZ0A 4B9SA 1QAJA 1Q78A 3KWMA 1S4FA 4I56A 2MLZA 2XSJB 4DUYJ 1WELA 1GT8A 2AJ1A 4YN3B 5F8NA 1HQ2A 2CJ9A 2D74B 2V63A 1GMWD 1FRKA 3TA1A 4C8NA 2B4OA 2PE8A 3SCKE 3WDOA 2CQ1A 1M90T 2B9EA 2VPWB 4IDKA 3W63A 2RS2A 2E1AA 2RKIA 5KG5A 2ZZTA 3KFWX 2O1PA 3PX0A 3EGZA 2CJYB 4GVBB 1K8AT 1RT5A 2GO8A 2MDAA 5KFNA 3BYPA 2ATCB 4KO0B 2U1AA 1X4DA 5IT0A 4DV4J 2C1EB 4FYVB 4KTQA 2IYIA 1IKVA 4HHHA 4UQTA 3VGVA 4OYIA 1K47A 4U6PA 3SXLA 5I42A 5IT9U 6FD1A 4QR2A 4F4WA 4ETZA 4JB8B 3GZ7A 2N4DA 2OPQA 3DNCA 3UD3P 1S0NA 1VQ9S 2CWXA 5KFRA 2B4PA 1TFWA 3RYLA 5J1EB 4I2QB 4ZPCA 1MLAA 1Q8LA 2MKYA 3ZZOA 2HW3A 2JC1A 4MAKA 1T05B 2AJFE 1O5JA 3QIPB 2J6UA 4FZVA 2EWHA 4IFVB 2EG2A 4Y2MA 2OPPA 2AYEA 4IYQA 1T3OA 2BX6A 3KDNA 3Q24A 4LF4J 2ZUGA 5KFLA 5HLFA 1FJCA 2B6AB 1VRQC 3M6WA 1Z2ZA 4TQSA 1U26A 2DJWA 3OTDA 5BYQA 3NP5A 2K1RA 3IWXA 1C1BA 2H48B 3LAMA 2RJZA 3HHLC 3LP0A 3OPKA 3SBMA 2J7KA 4A8XA 3J7Z5 2V9WA 4LQ3A 2E9TA 2EFGA 2JZ5A 4IG3B 1B0TA 2OP5A 2UXCJ 1HWIA 3WC0A 3EXCX 4HH1A 4RUHA 4F3OA 4M5LA 4WFBQ 3WIVA 2B0GA 4J9KA 1WHVA 4YHHF 2BQRA 4P2MA 4DS4A 3CC4S 3SZ2A 3JSYA 4B3TF 4X4NA 1SBRA 1AZSB 2I5JB 2YQ3A 3KJQB 4PG5A 1PO6A 5DQGA 2XS7A 5ETRA 1XTZA 5KT7A 3PX6A 1T05A 3MM9A 4K4WA 1L3KA 4ZPWR 5E7OB 2HRYA 2AW0A 2JNJA 3W2WA 2CNOB 1R3NA 3Q83A 1UW9A 5DDPC 1NKEA 4PYAA 1NH7A 1FESA 3CJ5A 5ETNA 1E6VB 5DGAA 1MMLA 3ZNJ1 1CQMA 5U47A 1N5VA 5M2UA 2AZ3A 3QZ7A 2UXCF 2F8EX 2HQCA 3H90A 2W8LA 1TVRA 1Z4UA 1S9GA 1KNZA 4WBFA 2BM1A 3FBBA 4CP5A 2V6AA 1F6TA 2AZ1A 1U8SA 3W66A 4KC5A 4EO8A 3H4BA 2B3TB 2AEMA 2AQ4A 1Q8BA 2E44A 1WDTA 3GG0A 4UY8T 5KFHA 2XO7A 2BMBA 2DNQA 1Q82T 2MY7A 2JVRA 4DR2J 3OT9A 3D6HB 1S79A 4W90B 1H2VZ 3BPDA 3IRWP 4B9NA 4GMKA 4ZPVR 1SUQA 1APSA 2BVZA 4DR5F 4PPZA 5J2PB 2CQPA 3G87A 2W4DA 4KH0B 5ETTA 1JXVA 3KMSA 1IBMF 3M8QB 2J6SA 4JV1A 1RTHB 2MLXA 3NBPB 3C16A 3E01B 4DV2F 3OFEA 3P6YC 4WPAA 5F9NA 3F73A 4DV1F 3MURP 3KYLA 4UOFA 2G1HA 3HVTB 2XHWA 4M5HA 5BYSA 4DN0A 5K9FA 4JYAF 4HDHA 5E0OA 4JP8A 4ED2A 2XWYA 2JDJA 3Q86A 2DB1A 2YWHA 3C16B 2PD1A 3HI9A 3UFCX 5KFBA 3TARA 3MXHP 3ETOA 4NLGA 1RT2A 1S6QB 4LSLA 1QUPA 5CZXA 4F0KA 4C7QA 4F3MA 3VAKA 4NPOA 1QAIA 2C3YA 4EWTA 4J5OA 4I2QA 5J1EA 2V2ZA 2GVDA 3TNVA 1NDPA 1K73T 1HMVA 5HBMA 2CRLA 3GFHA 2DGTA 4DXLA 2GX8A 2DNZA 4O4GB 3VTIA 2YNHB 4LF9J 1J5EF 1UKUA 3VAGA 4KHPJ 1MN7A 3O8WA 1OO0B 4CLTA 2ZH5A 4FPIA 4ZA1A 1IKVB 3RU0A 3JSMB 1SV5B 1HD1A 4A8MP 3FK4A 4CO2A 1R8BA 1W2BR 4KV8A 1Y0HA 2R7SA 1KEKA 2FVPA 1Q16B 4M5NA 2FGOA 3KHGA 3FJ2A 5IC4B 1A9NB 1RHJB 1FE0A 1E6VA 1TL5A 3GFYA 4ZVSB 4LF5J 1JWWA 4AL5A 1PC4A 1D3WA 1KS2A 2AHOB 1N0VC 2Z57B 1UL3A 3MEDB 3VR1A 4J9QA 2E9ZA 1MG7A 2Z8QA 4KPYA 2CPFA 2XSJA 1MMDA 2EK1A 2HQIA 1FXRA 1OSCA 2WW8A 5DZ6A 2HHHF 1P9QC 4DR1F 3KJNB 1LNQA 3CDAA 3H7HB 2ZHOA 4AT1B 4I69A 5LL6d 4C3MA 5DQHA 1EAYC 1SJ4P 2HHTA 2DPJA 4CT8A 4XDCA 4C8YA 1K1SA 1DTQA 4LR8A 3MM6A 4WFZA 5ETVA 1NAQA 2XG8A 2NYIA 2YNIA 2MJUA 3WHIA 2DNGA 4OYAA 4DPXA 4QWAA 4USMA 2QA4S 3DFEA 2GHWA 2UZAA 1HW8A 3ISNC 3MMAB 4PG4A 2DRBA 2RHSB 4IG3A 2VG7B 4AXIA 4X62J 3HVRA 2HGMA 1TL1B 3CCWA 2W9AA 1UPPA 4YEAA 1JNZB 1WKLA 2DNRA 2LU2A 5CZVA 2D3UA 1VRTB 4F25A 3EZ5A 2R7RA 1WORA 1N8RT 4CLZA 5B0FA 2E9RX 2UP1A 2IY5B 3OW2R 2WVBA 1SJ1A 2OPRA 2L9WA 3GR0A 3OTBA 1FX4A 4UZCA 3PG9A 1F3VA 4I64A 1JLGB 2ASYA 1R0AA 2C2KB 4LBHA 1LWEB 3NGUA 4LUBA 4B3RJ 1YG0A 2W2PP 4WCEQ 1GXTA 4ZJQA 5EX3A 5KOXA 3JTPA 3J7AN 4UOCA 5D15A 4BC9A 1HNIB 3FQKA 3PNIA 3T19A 1XMOF 2CJAA 1GK8A 1XN9A 3NNAA 5KFWA 2M0GB 4CI0B 1GX6A 2KXHA 2YWFA 2HBRB 4GC6A 3R6GB 4USUA 4X62F 1SH0A 2CQ3A 2D7SA 2HAFA 3T1HJ 3OJSA 3CT9A 1Q53A 3IR6B 2RKIB 4LRCA 4C11B 4HACB 1F9HA 2KDOA 2R7XA 1R8CA 2ZJRQ 2XBPA 5THWA 2GZOA 5ITHA 4A48A 2KB2A 4DV4F 2CQ2A 2BR0A 4GKKF 3QRQA 5KTQA 1NK8A 2HVHA 1LW0A 4DX7A 2NYHA 2ZOMA 2PT0A 1SKUB 4NZ6A 2NZ4A 1F5BA 1TP7A 3SSSA 2BJDA 4RNOA 2IVFB 4UZBA 4Q8EA 2ADCA 5GMDA 4NLRA 4OI1A 2B51A 3ITHB 4PUOB 4DQPA 2BE7D 2ZZMA 3UE2A 2G13A 2PA8D 4DQIA 5B09A 2KM8B 5L1JA 1BMQB 2E7XA 3DRSB 3FCVA 5HSPA 4B9UA 1KOHA 1VYAA 3NS6A 4KJIA 2QMXA 1UJ6A 3DI6B 2W25A 5LJ3Y 1RK8A 1N56A 5ETLA 2ZFHA 1JQGA 3FBCA 4R0JA 4B3MJ 1E6YB 2APOA 1FRJA 3M05A 2VL1A 1NDCA 3GV5B 2XNRA 1WI6A 2FHOB 1EX8A 3J7YI 3RAQA 2MKSA 3UCUP 5B0EA 2HGLA 5FLXU 3W9HA 3ZNUA 2WBMA 2CXEA 4CO0A 1UMJA 5KG2A 2RF2A 3A8EA 2GV1A 3GQCA 1VQOS 2B5JA 3V2UC 2CQHA 1FDDA 4CTAA 2HBYB 5K14A 4LFAF 3CD0A 4IOBA 2CQIA 3U1LA 1CPZA 1UVLA 1R27B 1GAOA 2P9GA 2VQFJ 1O8BA 3EXYA 3BGRA 4RUBA 4F0HA 4FYYB 2HYIB 3LP2A 4ZJLA 4A8YA 2HNZA 4HKQA 3CVKA 4W98A 3TEHB 3V4MA 3NOCA 1DQ9A 2CPYA 3EGNA 3RG6A 1RABB 3EWGA 5JXSA 3N9UC 4G1PA 4RU2A 1W2IA 2AGOA 1FRLA 1C4AA 5A8RB 2KG1A 4DL0C 1UZDA 3CF5Q 4DV5F 4JI7J 4TU9A 3M8WA 2KH9A 2NXUA 1SQGA 4OIXA 2MKIA 2UXDF 3FEZA 1WTBA 1O6XA 1IBKF 2XCAA 3OVBA 3OTOF 4CNZA 1PC5A 5A0YB 1TL7A 2BYCA 4WP8A 3GWCA 5IS2A 1HNZJ 5EGYA 2K3IA 1FRHA 1HNWJ 2DGVA 4OYMA 1X60A 2FZCB 1FFWB 3IM9A 3MF5A 3RBXA 4WFAQ 1YJRA 5J1PA 1U1MA 4WP3A 4PUOA 1UVNA 4K4SA 2H4WB 3W61A 3GP9A 2JEIA 2HHSA 2L3MA 4AL6A 1U49A 2GGPB 2R3VA 4ZVFA 3O6QA 1JXLA 3G9CA 3DRYA 1XMOJ 2OTLS 2EVZA 3HO1A 3JTOA 3O3LA 4DPWA 1FEHA 2BQUA 4LQ9A 2RRAA 3GILA 2ZJQQ 4DL5A 2UVUA 2CQDA 4KKOB 2HHQA 4O3SA 5D3GA 2Y1JA 1RSCA 1ZAVA 5HL7Q 5DLGA 1CLFA 3H2LA 2L48A 1JK9B 2OEJA 2R4FA 1N52B 4OX9J 5JVGQ 3RTVA 1SL1A 1DLOA 4UUXA 2HS3A 5C5JA 3BQ0A 3VGTA 3UDEA 2FJAB 1DQ8A 5LXYA 1X5OA 1S77D 1R31A 5IQ6A 1M5OC 4IUFA 4ZIWA 4UOGA 1ACMB 2LDYA 2YNGA 2VFSA 2MQOA 1FNXH 4TY9A 2N4CA 3QLHB 5EWGA 3AD7C 3BGRB 1RZMA 4MH8A 1X9SA 4OYPA 1XK8A 4A8KA 1GXUA 2C3MA 4RUCA 4YFUA 2QMWA 1G4CA 4X4TA 2Z4PA 4FBUA 4YOEA 2HNYB 2WCXA 2OPRB 3JTNA 3M2VA 3ULHA 1FWPA 3DDKA 5LT5A 2XGQA 5DM7Q 3AA8A 1RCOB 2YWKA 2FHKA 4MIBA 2D41A 4NE9C 3TO8A 3G96A 3GONA 1U1OA 2RAQA 3D66A 3GFXA 3OXLA 4MYUA 5AT1B 3J7YU 5D0HA 2PC6A 3LPYA 2BBEA 5T7LB 5AE2A 4NLDA 4ZP8A 2ZNZA 1PBUA 4M8LA 1S76D 2RSQA 3MAAB 4PWDB 4B02A 2MXYA 1MMNA 3DI6A 2HVIA 5HMWA 1X4FA 2NPFA 1S1VA 3UW1A 3JYTB 4ED7A 2UUCF 1YQHA 2BW2A 2V4JB 2ASJA 2JEGA 1WTFA 4I2PB 4C9DA 1VBXA 1IBKJ 2X1FA 1Y3JA 2M5YA 4LRFA 3C14B 4KBIA 2ILZA 2MZRA 2BW7A 3K8WA 4G6VB 3BBBA 2HAIA 2C22A 4BHQA 3R97A 2C28A 2DTJA 4O23A 2DGXA 4NYPA 1B64A 2ZH2A 4LIWA 4FF4A 4IH5A 5KFSA 2LKZA 4CLKA 2V5HG 4EUVA 2QJ3A 1TKZA 3H5SA 4J37A 4RX6A 3NGRA 2VQFF 2X7IA 4OZ3A 2XCPA 3EDRB 1LOUA 4HR2A 4LSNA 5CQGA 2OJ3A 2CQGA 2LQ5A 3A1YG 3TAMA 3A8IA 2ROEA 1RACB 2HFVA 3RB4A 4RPFA 3CCZA 1FJEB 1SJQA 2RS8A 5DDRC 1WC1A 5KFQA 3CE8A 3UI3A 3WBZA 2QV6A 5HVGA 4F8RA 1SB6A 1U0SA 4NCGA 4O4RA 1NKCA 3OLAA 4F7VA 2CNLB 4L3NA 2M2BA 4N77A 1KQFB 3OL6A 2G0CA 1AFJA 3PM9A 3HFZB 3AHPA 1SKSA 3GE9A 4DQQA 1LFWA 3I0SA 3A3OB 4RNMA 1FRXA 3D7SB 3F41A 2V68A 4LBIA 4OI3A 4RNFA 1J2VA 3DRRA 4MIWA 4F04B 2VFTA 1U47A 1S6QA 4LSLB 7FDRA 3C46A 5C7PA 3T3FA 3AQPA 5ADZA 3NAIA 1WHWA 2PSZA 2RQCA 1X5PA 4M1KA 2C42A 2DRDA 4ZHRB 3TX8A 4EGLA 1CJKA 2PEBA 3MR5A 2PMHA 4OLOA 5HQLA 2QLJB 3R5CA 2CADA 4WYWA 3EVMA 2HKEA 1LV5A 2MMYA 3DHWC 3SCLE 2IVYA 3ZZ0A 1CJUA 3I5AA 3KK1B 3IFEA 3F44A 4O3OA 4EI2A 4Y0FA 3OSPA 2YNIB 2IVMA 3FQLA 3WX8A 2NSCA 3D4JA 1SCJB 1X4GA 1RT4A 3T5KA 5J2PA 2G0JA 5CYMB 3S8SA 2AYBA 5CABA 2CQ4A 3K17A 3N5BA 2Y3YA 4RW7A 1MSWD 2IJNA 3PY8A 2VPZB 3N4WA 3GV8B 5CD4A 1S0MA 1T9WA 1W7WA 2OGUA 2XWXA 4WF9Q 3EVOA 1NK6A 1RT1A 2DR5A 1FNOA 1JLQA 4OQJA 2BV3A 2HIQA 3GJSB 3PRVA 2MQQA 3K58A 1D0EA 3D6MB 5AXMA 1S9GB 3VVUA 2W2NP 1M1HA 2DHXA 4RBTA 5BXIA 3T9NA 4L6V3 2RVJA 1VQLS 2FLLA 2CJBA 1EP4B 3JSMA 2EFNA 4Q43A 5G0RB 4Y2CA 4DSFA 2IMWP 3GSDA 1RAIB 4ZPBA 1RT1B 1WEXA 1RA6A 3TANA 2YNHA 2KFYA 4O4GA 1EZZB 2L9NA 3HMJG 1WNEA 2PI4A 1Q5VA 1YBTA 1FNMA 3C3LA 3FMWA 1GTEA 4XTTA 4RW7B 3TQEA 1Q4RA 1VHIA 1MWZA 4XDDA 2H5JB 3TQ1A 1EIYB 2UUBJ 2ROPA 4A47A 2J0QD 2ZH9A 1I5OB 4NLVA 1U24A 2F8MA 2C2EA 2CIMA 2IM0A 2FJEB 2KM8C 2KO1A 1S0VA 1BLUA 3KLHA 3IWLA 4ECTA 3K2YA 1UJ4A 3KK1A 3ZTOA 4ZCLA 2D9OA 4MMOA 3FCWA 5DO2A 5A76A 4K0KJ 3H40A 2CJQA 1RYRA 3H2UB 1T9VA 1RT6B 1V5IB 2OEMA 4G1QB 5GVQA 4JI5J 4Z7YA 4Q0BA 5IT9Y 1X4EA 5CD4H 2XMUA 1RTHA 3NBPA 2V69A 4NZ7A 4XPEA 3Q8RB 2RU9A 5J2NA 2BDPA 1U2RA 2UUAF 4MK8A 4O3PA 2EC2A 4F4AA 2I38A 2DHGA 3DRRB 2RRNA 4IFVA 1DRZA 1YTYA 1ZA2B 3OXGA 3I0SB 3OLBA 2DITA 5CYJA 2VHGA 4UT4A 1T11A 2HS4A 3O1LA 2JRSA 4DV1J 1DARA 4YDDB 3TRGA 4DDFA 2EFQA 4Q45A 1M1KT 2VG5B 1FDAA 2RDJA 4NCGB 1L3SA 2UUCJ 1RTJA 1SJ3P 5LXRA 3QGIA 4O3NA 1TL4A 1OIAA 4NYOA 2GJ2A 2ZUAA 1IJEB 4ZDNA 1D8ZA 2W7AA 3BKTA 3R5DA 2Y9HA 2JFDA 1RISA 4ED5A 4ZN3A 1IKYA 3BDEA 3FDSA 5KT2A 3OUYB 1OQ3A 2EXUA 1NO8A 1HHQA 3KG1A 4NX9A 1MROB 2CFXA 3NWGA 3FMBA 4F0MA 1KHWA 4DV7J 4DSIA 5DRKA 4OHYA 1RLCL 1MW7A 5HMXA 1WJ9A 2HFOA 3O2IA 3UNGC 1KN6A 2BANB 4L3KA 2BABA 4RWWA 2H51B 2EPIA 4O0NA 3UVJB 1CULB 2HIYA 2DPIA 4M5DA 5IWAJ 2HFZA 1NK5A 2ATLA 3M30A 4X64J 1QTMA 1NSKL 4YB5A 2BQ3A 2CPHA 4PXEA 4ZITA 4ZLPA 2XLKA 1S1VB 1NMEB 1YJVA 1FEEA 2GFFA 2J5AA 1HLWA 4NOHA 1GFWB 3IWNC 4PWDA 5C24A 3SV3A 1K0TA 3GV7B 3VAMA 5T7LA 3QBCA 4DPYA 5D3GB 2K1RB 1UEKA 3MMCA 3EDQB 4ECUA 4LSZB 1B7FA 5HMYA 2RQKA 2HVZA 3RBZA 3RB0A 3QO9B 5HLFB 1FKPA 4TU8A 2VDIA 4CO1A 2JEFA 1NLKL 4KQZA 4ZLLA 1QSYA 4FBTA 1FHTA 2D1CA 4A4JA 5FJ4A 2ZNYA 2ERRA 4DL4A 2OPQB 4ID5B 5KFVA 2GIQA 4PQUB 2Z0GA 2W2OP 1S57A 1S7HA 5HVFA 1R0BG 2J9EA 3SDEB 4YY3F 4QYZK 1WD6A 4TQRA 1F0XA 3QWUA 3B8HA 1RT5B 3HHEA 2EEYA 3MEEB 3PJ9A 3DDNA 3RAMA 1FRIA 4NRUA 2OO4A 3UCZP 4O3RA 1M0SA 1TV6B 3FVYA 3C6UB 4IDKB 1VRUB 2YX7A 3ILJA 5ETKA 2J7WA 3WX4A 4ALZA 5E3CA 1F2HA 3X3UA 1BY9A 3FZBA 1CG2A 3UD4P 3GMGA 4URQU 4DV3F 1WG4A 2QG9B 4LF6F 1HKAA 2DIUA 1RHRB 4K4YA 5KFEA 7FD1A 3WQPA 3BSNA 3LH2S 1HARA 1U8WA 3MM5A 1PGZA 1F5AA 4B08A 4N5SA 2GVZB 4LFAJ 3K7RA 4KFBA 2DGUA 1EETB 2XMJA 3UN2A 2RU3A 4Q7AA 4ED8A 4JV2A 2BEFA 1Q79A 4PQAA 3TZXA 4B9TA 1XNQJ 3TUZC 1FJ7A 2DR7A 5CA5A 3SSQA 4P75A 2G9OA 5F0WA 3CCLS 4DR4F 4PKDB 1MNEA 3B6BA 2GCFA 2YX1A 4ETXA 5IV4A 2VOPA 1U0HA 4IFYB 1RWKB 2A2CA 2EFOA 2GNKA 3AB4B 4P2XA 4WIIA 1IVZA 2KT2A 4RW8A 3ET6B 1D8YA 2IYGA 2JWNA 1S48A 4IQMA 2XI3A 2UVWA 3DLLQ 4LMZA 1FK9B 4F26A 3GIJA 3KTQA 1ZM9A 3KLGB 2R2UA 3IG1A 1KSPA 3C15B 4GVLA 4OMFG 1VQ4S 2CPXA 1R8HA 2M3DA 3GU0A 2HNZB 2IJFA 2LQJA 1Q0NA 3HSJA 3PEHA 5D0GA 3CJ0A 2NZCA 1CJTA 2GIRA 2VZ9A 5KOWA 4NI2B 2HFNA 3RB3A 3K8VA 1IKXA 1YJUA 3PRBA 4JBCA 3PYFA 3K5LA 2UUWA 3G82A 1ZYQA 5A6WA 3HF5A 1G6BA 1TR0A 4OZ5A 5D0EA 3GYGA 2RUGA 3FEYB 1B70B 3OFGA 3VGSA 3IS9A 1XR7A 1U1KA 3BS9A 3DOMA 1G1XA 3M2UB 2NXCA 2JLEA 4WKRA 1SXLA 1YLXA 4WK1A 2A1BA 3D5MA 3VZHA 4R25A 4Y2KA 4X4VA 3PACA 4RW9A 2QZ8A 1RBLA 1Y7PA 1JMTA 2YQ0A 3G8QA 3HKZD 1BD6A 4P9SA 4ENOA 4ZN1A 1U45A 3W60A 4CLSA 4Q2MA 1L3VA 4HHJA 3X1LB 3TVZA 1URRA 4RO0A 2OTJS 1RT3A 3OR1A 1P27B 1Q8KA 1RDRA 1YHQS 2R8HA 4PWUA 3ILOA 1ZPWX 3GG1A 1HPZA 3ILIA 4YY3J 3P45B 3QFWA 4J9UE 2PMZD 2GMJA 4R8UA 3ZFVA 5DG7A 4DWIA 4DSEA 2CPEA 4QIFA 1N36J 1N5SA 5IOLA 2LP4A 2WONB 5D6GA 3R7SB 3PO4A 1VJQA 3HDSA 2JL9A 2YBVA 1YVFA 2AJ4A 2IBKA 3MM8B 3RR8A 1WACA 4HACA 3OL8A 1U09A 2Y0BB 1VQ5S 2YKAA 2ZE2B 3M8PB 1BXNA 1DTTA 2PIIA 3DMJA 3NXZA 3TEGA 3LW5C 2CDRB 4R0EA 2J9DA 2ZH4A 3AJ2A 1SPBP 2FZKB 2NSBA 3AFGA 3DXSX 2BE9B 1LWFA 1RWMB 2CNKB 3U02A 2W2MP 5CH7B 3BQ1A 4JI3J 1HYSA 3HXMA 3Q8VA 4DZ6A 5KFAA 2OUGA 2K3KA 2YWGA 3HHKA 2O01C 3RAXA 1IR0A 1VC6A 1RKIA 4I67A 1JKHB 3KUGA 1VK3A 3NGDA 2DXFA 2M4MA 3HFKA 1LWEA 1R6VA 3PYDA 4O44A 4CO4A 5AE1A 5J2MB 2YKMA 3BPSP 1JLEB 1ITPA 1VJWA 3M9OB 4D3GA 3FBEA 5L9NA 4CO5A 3KMQA 3DYAB 4FXWA 4WK3A 1S9EA 2V2KA 3MCMA 5B0GA 4HEA9 2AP6A 1RHQB 3KK3A 2IAJB 2DH8A 1LFPA 3DKDA 3DLEB 4NA2A 2XC9A 2CZ4A 2AYGA 2OSRA 2FC8A 1JLCB 1SH3A 3IC1A 1OMSA 3I4HX 4TXSA 3AXKA 4XK8C 2Z30B 3UNYA 4CLYA 2OEKA 1VQKS 5KG1A 2HPUA 4DEZA 5IFMA 2ADBA 3AXMA 2HHUA 3D28A 3QATA 1VHFA 3HVWA 4FVCA 4CIOA 4LFBJ 2EW9A 3AT1B 1UFLA 3IMQJ 4DSJA 2FQQB 5D4OA 3S01A 4JI2J 4DR1J 1QSLA 2NQPA 1UWBA 2IRUA 2FVCA 3MPVA 3MTKA 1QSSA 3R2CJ 4IH7A 3QAEA 3R5JB 3JB9k 1U1RA 3HZEA 2HFUA 2GIFA 2G1DA 2IBOA 4KT0C 4E98A 1D9DA 4DR7J 3M8RA 5T41A 1B0VA 4HHUA 2W9CB 1QJHA 3BGOP 3BV8A 3Q2SC 3THPA 1N6QA 4FF3A 4K2XA 5BR8F 3N6MA 3OHAA 2RUSA 3G6YA 1AUSL 1HWKA 3R8YA 3RW7A 2FVRA 4QWDA 3OTCA 5K8PA 3K0JA 3CCMS 3RR7A 3IRXB 4Y00A 4TY8B 2CDQA 1B99A 1Q95G 4DMZA 2QSFA 1TU0B 4DUZF 5E3AA 3G4SS 3NCQA 4F4KA 2V8VA 2ZDPA 4DUTA 3H5YA 4OX7A 1ZS6A 1SV5A 3D3CJ 3W1YC 3M1VB 4DV0J 2IHR1 4G1IA 4CCHA 1S1UB 5LMNF 2R42A 4ICLA 1RU1A 5KT6A 3T5JA 2YY3A 1REVB 3OVAA 2KZZA 2HNDA 1ZETA 2K06A 3BN7A 2ZWPA 3EGVA 1NHVA 4KGZB 4KGXB 3S7RA 3HPOA 2VA2A 2PO4A 2JLGA 2FIUA 4OJ3A 4IR1A 2DT9A 1S49A 3IO1A 1T7PA 1QLNA 2WVCA 3D0IE 3OQ2A 1RWPB 2E66A 2VPYB 4IH6A 3CUNA 1QVGR 1NJXA 2KFZA 3I87A 2OFGX 3DLBA 3R2DJ 3BGLA 2IIHA 1N5TA 4OI4A 4JI1J 2XS5A 1BHNA 3OFHA 2Z2MA 5DDQC 3V81A 1T9XA 2HFSA 1OY6A 2QA2A 2YPZA 4ZS6A 4JI3F 1TMJA 3MFIA 3W5YA 1V3RA 1OYDA 4B3SF 4JI4J 4PWWA 1FXLA 1TMMA 3HVTA 2VH7A 2DGOA 2GS8A 4RUAA 3GYXB 3SIPB 1FWKA 3BJYA 5B0CA 4N76A 4X4SA 2JHEA 3TJ8A 1HPZB 1XNRJ 4JV5F 3E01A 4Q5VA 3NMAA 3ZZTA 3CMQA 1HWJA 3ISZA 1H3DA 2A0FB 4H4MA 1FT8A 4KFBB 4ZVHA 2DNLA 4I7FB 4ED6A 3CDWA 5CCLA 2I2YA 2YWEA 2W24A 3HFVA 4G3IA 4ZVUB 3FSYA 1NH8A 3MECB 2YKOA 2W7PA 2HVEA 1HQEB 1XMQF 4FKXA 1KQSR 1ELOA 3MCSA 1NB2A 4K50A 4KYZA 4HTJA 4XO0A 1HNXJ 3VWSA 3B4DA 2M8HA 3DU5A 4MKBA 4N41A 2NR0A 2LCWA 4WFNQ 4N8OA 1NBEB 4QIVA 4X64F 4CH1A 3VCDA 1BC6A 4I1TA 4QWEA 1RGVA 1FKOB 1Z1ZA 2F9JA 1NUEA 2YKNA 3UDCA 1WEZA 2RMLA 4USIA 3CCRS 3JSBA 3T5LA 4EMDA 1NSQA 3PKYA 1HNZF 2R9LA 1CJTB 3VQTA 4H4OB 3RUBL 4J9LA 3UN3A 3FBFA 4L73A 2GAHC 4ZP6A 1RAHB 1S99A 4JI0F 2NREA 4LF4F 4PCQA 4UOHA 3C15A 4YHHJ 2IFXA 3QYYA 5I4MA 3KLGA 4KE5A 3BQ2A 1BQNB 2LXIA 2FY1A 4IRKA 4C0BA 3FRZA 5IM0A 5IT4A 1DFDA 4EYIB 2FHJA 4IFYA 2VBYA 4BDPA 1WDDA 8RUCA 3QGPA 5KFZA 2HHPA 1C0TA 3I5BA 1RUSA 2BJEA 3AODA 1WKJA 2W7OA 2XO6A 3C19A 5DZ7A 2R7QA 4EO6A 1TFYA 3CJ3A 1WG5A 4M95A 1JJHA 2OKQA 1ZAXA 1R43A 2RRBA 2XMTA 2EFVA 2D3ZA 1U02A 3EICA 3H2VE 1C1BB 1ROFA 3LP0B 2ALYB 3NCRA 3I9V9 1FO1A 4JI8J 3GR1A 1LW2B 4ECRA 1J5EJ 3IM8A 1ZM2A 3OR2B 4HVZA 2Z2LA 2RIJA 4ZJOA 1N5YB 3BGUA 1S1XB 4CM0A 4C8ZA 2E7WA 3QAUA 4YMEA 5A8WB 2LECA 1WC4A 2Z56B 4CYUB 2YTCA 1TV6A 3D1OA 3P8BB 2D9PA 4FVMA 2V8HA 5KFTA 2AF6A 4QWBA 4P72A 1YJWS 4J9PA 2LQBA 4ZMMA 3D1QA 3H20A 3RZAA 1RTIA 3K5NA 2AD9A 3F0NA 1U1LA 2DH7A 2HHXA 2L08A 4USWA 1WSVA 2QMUB 3C6TA 2WRMA 3D6TB 3HZGA 1Y5IB 2ACMA 2YVSA 2I9SA 3PHEA 4NLUA 4WU3A 3N01A 4JI2F 3C6TB 4X65J 1UFWA 4ID5A 4GKKJ 2HSEB 4R5PB 3DCAA 2HK2A 2WZ1A 4ECZA 3LWMA 2AU0A 3W7BA 9ATCB 2POKA 2B9XA 4AFFA 2NUUG 3GLJA 4ZVEA 2DISA 3MPWA 3EPGA 2VA3A 1BWEA 4I68A 2MZQA 2V2QA 4NLSA 2Q3PA 3A4TA 3BEGB 3DGPB 2K7JA 3I32A 4QIEA 4DQRA 2XULA 1B0PA 1WWHA 3IXQA 2BACA 2XYPB 1FFSB 4LBPA 1K9MT 2PA3A 4GO5X 3CCJS 4ELVA 1PJ5A 3BYRA 4ZCIA 4OLPA 1ZM4A 2DXDA 2DIVA 2FTRA 1KONA 2BJ9A 2KYZA 1K44A 2MZJA 3NRBA 1VMBA 4H4KA 3CDUA 4P52A 4PAAA 3J81j 3Q8PB 4LVNP 3ILLA 2BE2A 3RB6A 3BDPA 2ZH7A
chains in the Genus database with same CATH topology
4GKJJ 4OX9J 1N36J 4JI6J 3J80U 4X62J 2F4VJ 5A2QU 4KYZA 4B3TJ 1HNXJ 4JI3J 4NXNJ 4DR6J 2ZM6J 4DV6J 4B3RJ 4DV5J 3J7AN 2HHHJ 4KY3A 3J81U 3T1HJ 4DR2J 4NEYA 4YHHJ 4JV5J 5LMNJ 3OTOJ 4AQYJ 2UUBJ 2UXDJ 1HR0J 4LFBJ 1FJGJ 4B3SJ 3IMQJ 4JI2J 4RJVA 4DR1J 2MTLA 4LFAJ 3R2CJ 1IBKJ 4LF7J 4DR7J 2MQ8A 4K0KJ 2MEWA 4HHUA 4DUZJ 1XNQJ 1N32J 4JI5J 4JI8J 2UXBJ 1N33J 4NEZA 1J5EJ 2KL8A 4DUYJ 4B3MJ 2UUAJ 3JAMU 5FLXU 4JYAJ 4DV4J 4LF9J 3D3CJ 4DV1J 3W1YC 2VQEJ 5LM7E 4DV0J 5BR8J 4KHPJ 2UUCJ 5IT9U 4DR4J 2VQFJ 4X65J 4GKKJ 4JI0J 5LMUJ 2KVQE 4V1Ak 4LF5J 4NXMJ 2UU9J 4DR3J 4LF4J 1N34J 3R2DJ 4JI7J 4DV7J 4DV3J 4LF6J 4JI1J 3D3BJ 4DR5J 1HNZJ 4DV2J 3T1YJ 4LFCJ 1HNWJ 1IBMJ 4JI4J 4PWWA 1IBLJ 1XMQJ 2UXCJ 5IWAJ 1I94J 4X64J 1XNRJ 4YY3J 4X66J 2E5LJ 4LF8J 1XMOJ 5AJ3J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKJ J;  4OX9 J;  1N36 J;  4JI6 J;  3J80 U;  4X62 J;  2F4V J;  5A2Q U;  4KYZ A;  4B3T J;  1HNX J;  4JI3 J;  4NXN J;  4DR6 J;  2ZM6 J;  4DV6 J;  4B3R J;  4DV5 J;  3J7A N;  2HHH J;  4KY3 A;  3J81 U;  3T1H J;  4DR2 J;  4NEY A;  4YHH J;  4JV5 J;  5LMN J;  3OTO J;  4AQY J;  2UUB J;  2UXD J;  1HR0 J;  4LFB J;  1FJG J;  4B3S J;  3IMQ J;  4JI2 J;  4RJV A;  4DR1 J;  2MTL A;  4LFA J;  3R2C J;  1IBK J;  4LF7 J;  4DR7 J;  2MQ8 A;  4K0K J;  2MEW A;  4HHU A;  4DUZ J;  1XNQ J;  1N32 J;  4JI5 J;  4JI8 J;  2UXB J;  1N33 J;  4NEZ A;  1J5E J;  2KL8 A;  4DUY J;  4B3M J;  2UUA J;  3JAM U;  5FLX U;  4JYA J;  4DV4 J;  4LF9 J;  3D3C J;  4DV1 J;  3W1Y C;  2VQE J;  5LM7 E;  4DV0 J;  5BR8 J;  4KHP J;  2UUC J;  5IT9 U;  4DR4 J;  2VQF J;  4X65 J;  4GKK J;  4JI0 J;  5LMU J;  2KVQ E;  4V1A k;  4LF5 J;  4NXM J;  2UU9 J;  4DR3 J;  4LF4 J;  1N34 J;  3R2D J;  4JI7 J;  4DV7 J;  4DV3 J;  4LF6 J;  4JI1 J;  3D3B J;  4DR5 J;  1HNZ J;  4DV2 J;  3T1Y J;  4LFC J;  1HNW J;  1IBM J;  4JI4 J;  4PWW A;  1IBL J;  1XMQ J;  2UXC J;  5IWA J;  1I94 J;  4X64 J;  1XNR J;  4YY3 J;  4X66 J;  2E5L J;  4LF8 J;  1XMO J;  5AJ3 J; 
#chains in the Genus database with same CATH topology
 3G2X A;  4OZ0 A;  3NG8 A;  5C42 A;  3KLE B;  5EUH A;  2UVR A;  2HBQ B;  4X84 A;  4DLE A;  3TZW A;  2HEK A;  2O3D A;  3LP1 B;  3POT B;  2BJ1 A;  2CWK A;  1V3S A;  5CYQ A;  4HLB A;  2BRK A;  3DHX A;  3N79 A;  3UCG A;  1LK7 A;  3NCP A;  3CUL A;  4KGM A;  1RCX B;  2HMI B;  2F8H A;  4DHV A;  4WE1 B;  4XIU A;  2W8K A;  3CC7 S;  4JI6 F;  3K57 A;  1T3N A;  3DXB A;  3PTW A;  4IO1 A;  1D09 B;  3HP6 A;  1NPK A;  2C2R A;  2QL7 B;  1EKR A;  5BJR A;  3TP2 A;  2W9B A;  1RU2 A;  3G6X A;  2M7S A;  3OXF A;  1NJZ A;  4DCO B;  4ECY A;  4DQS A;  1WEY A;  3IP0 A;  5F41 A;  1RWW B;  3I4P A;  1X5S A;  4DL3 A;  2HHH J;  3PIO Q;  3CJQ A;  4M5K A;  5H1S V;  1RHU B;  2KFN A;  3PIP Q;  1YX2 A;  4H54 A;  5F3Z A;  3IR5 B;  3BB5 A;  1N34 F;  4NEY A;  3U27 A;  3AJ1 A;  4LF8 F;  3MR2 A;  1S1T A;  2RD5 C;  4L75 A;  2AJQ A;  1LWX A;  3N6L A;  2BXJ A;  2HQD A;  3ZTP A;  5KAK A;  2DK2 A;  5D4N A;  1N4L A;  4DU7 A;  1HBN A;  4C0O C;  1CS4 B;  4DOZ A;  5J2N B;  4CZC A;  4EZ9 A;  3CCE S;  4RJV A;  1ZPV A;  4ECQ A;  4LR7 A;  3NS7 B;  2GJF A;  1NDK A;  1I1G A;  2IDE A;  3QT6 A;  3UD5 A;  1R0C B;  2ZOF A;  1FF2 A;  2FB0 A;  2ZKU A;  3ZZU A;  1NSP A;  1HNV A;  2WW4 A;  3HSD A;  4F67 A;  2MJN A;  3TA2 A;  3KLH B;  4FN5 A;  1VLY A;  4D3H A;  3EYZ A;  2ZH3 A;  2MST A;  1FFG B;  1SVD A;  1U25 A;  1RWO B;  2QLB B;  3CDE A;  3KXD A;  2HZC A;  5I3Q A;  3NGS A;  2E5I A;  2V8D A;  3MGJ A;  1BQN A;  4U7U K;  4F36 A;  4F3Q A;  1S97 A;  3FGV A;  4ZPA A;  4DG1 B;  3RJM B;  3SI8 A;  3JAM Y;  1JJ2 R;  2FVQ A;  5KFM A;  2W4C A;  3MM7 A;  3U7J A;  4FXV A;  4RBV A;  1YRX A;  2XMA A;  1I51 B;  3M6V A;  3MPD A;  2FY8 A;  2F40 A;  1KDN A;  2W2Q P;  2VOO A;  1VBZ A;  4AD6 A;  5HAO A;  4ICL B;  3IAM 9;  4KRW A;  2R7W A;  4OI0 A;  3CWJ A;  4M5J A;  1EP4 A;  3D0G E;  3NS5 A;  5FII A;  2CVI A;  2BUN A;  5HAT A;  1S5Z A;  3PX4 A;  3MOZ A;  1UA1 A;  1KC8 T;  2GMH A;  4OHX A;  3HUL A;  2COL A;  2IRX A;  3ISN D;  3M8S A;  1HBU B;  4K4X A;  4OL8 A;  1QE1 A;  4BS2 A;  1SKR A;  4WWS A;  3IRX A;  1FX2 A;  3QT7 A;  1XNQ F;  2Z2Z A;  3DOK B;  1YWX A;  1HBM A;  1M5P C;  2FHJ D;  4OZ1 A;  3MEC A;  2NXE A;  3BR8 A;  3D67 A;  4MYT A;  5F8H A;  5GAG I;  1RKJ A;  4ANE A;  2VON A;  4ILM A;  1G7C B;  4QR1 A;  4E2F B;  3DOL A;  3FRY A;  3PJW A;  4LFC J;  1VCT A;  1KLN A;  1TL3 A;  2J6T A;  2HGN A;  2X1G A;  3QID A;  4WYL A;  2E7V A;  4ZCM A;  3CPW R;  3V6D B;  2PDA A;  4H4M B;  3O5T B;  4J90 A;  3MR3 A;  4B3M F;  3NLC A;  4OYO A;  1JXE A;  4OI2 A;  5GAE U;  4W4M A;  1VIO A;  3EX7 B;  2HRU A;  1TAU A;  2DO4 A;  1DAX A;  4Z2X A;  4C8K A;  3LGN A;  1T94 A;  4MJK A;  5GAG U;  4P10 A;  4Y28 C;  2CKW A;  5D0R A;  5LSR A;  4NWB A;  3QNW B;  3QPI A;  3MEK A;  5A8K B;  1PSD A;  1BQM A;  2OML A;  2C3U A;  5BYR A;  3OL9 A;  5E3R A;  2HZA A;  1SJR A;  1GQE A;  3KLF B;  1WUU A;  4ED3 A;  3TUJ C;  1JLB A;  4Q44 A;  4DFM A;  2XNQ A;  2F63 A;  2ZEJ A;  2IRY A;  4QIW D;  2N3O A;  3J80 U;  1JLE A;  2L41 A;  1ICE B;  1R8A A;  3TA0 A;  2N7C A;  1HBO A;  1Y00 A;  4DJB A;  3VF0 B;  2KG0 A;  4NLX A;  3MPY A;  2MY8 A;  3HHL D;  3PDN A;  4LRE A;  3BGF A;  1QD1 A;  4ZOS A;  1SL2 A;  2XY5 A;  3HD2 A;  2ZD1 A;  1HBO B;  2MQL A;  2J8S A;  4S0M A;  1M5K C;  3NNH A;  3FSI A;  1WC0 A;  5IV3 A;  1IQT A;  4MKV A;  4MK7 A;  2DGQ A;  1RAE B;  4LT6 A;  4YB7 A;  4CDI A;  1QY7 A;  4HH0 A;  3CCV S;  1B3T A;  4LSN B;  1EQM A;  3US5 A;  1RHK B;  3MHY A;  3HLU A;  4OJH A;  4FF1 A;  1P1T A;  3MM8 A;  4ILR A;  4AQY J;  5CAA A;  3DM2 A;  3W9I A;  2AIR B;  3AB2 B;  4ECW A;  2KJW A;  3DLK B;  2BJ7 A;  3QGH A;  3FC9 A;  4FPR A;  3ZTQ A;  4R8U B;  1UJ5 A;  1OWX A;  2AMC B;  5HQM A;  2CPI A;  3KG4 A;  1PJ7 A;  3RW6 A;  3H5X A;  2F3J A;  2H1Y A;  2XMK A;  1V5V A;  1HFE L;  1UP1 A;  2CG4 A;  4J9V A;  4KR0 B;  4NLQ A;  1LWC B;  3KHL A;  1R89 A;  3PCO B;  4FYX B;  2ILY A;  4CH0 S;  5SZT A;  2MQ8 A;  4PXB A;  4J9R A;  5J2Q B;  4CNY A;  4DUZ J;  4L74 A;  1TK0 A;  1N32 J;  3NEK A;  5AE3 A;  4DPT A;  2VJU A;  4KHP F;  2B9W A;  2HWI A;  2OH2 A;  3L7U A;  2E5G A;  1HBM B;  4LVO P;  4WXW A;  1REG X;  2WK4 A;  2ZVI A;  2HK3 A;  4USV A;  2UUA J;  3SFG A;  2QA1 A;  1U1N A;  1TKX A;  3PRD A;  1XJW B;  1QE1 B;  1S1W B;  5L1K A;  3G86 A;  5L39 A;  1T03 A;  3BBC A;  5LOQ A;  3CW2 C;  4HL9 A;  2ZH1 A;  1UZH A;  2BOP A;  1RT7 A;  1G3O A;  1S9E B;  1BQX A;  2MGZ B;  2B56 A;  4DN9 A;  2SXL A;  3CCQ S;  2MB0 B;  3R5A A;  4MKA A;  2VQE J;  1C1C B;  2N7Y A;  3IR7 B;  3MMB A;  2DEI A;  2Q79 A;  4UUW A;  1CBK A;  4ZP7 A;  4DR4 J;  2ZD1 B;  1SQE A;  4FP9 A;  2CJK A;  1NK4 A;  1VDH A;  2CG8 A;  2EKN A;  2IM3 A;  1TEL A;  4WU2 A;  5E5N A;  2DNO A;  5FDL A;  4U9R A;  4U7U D;  1Y4Z B;  2FYX A;  4V1A k;  1AYE A;  1BE4 A;  3ENQ A;  3M2R A;  3HHD A;  1LWF B;  1WOP A;  4AYB D;  1EJ7 L;  1RJJ A;  2UUT A;  3GCW P;  1UFK A;  3DLG A;  3ZO7 A;  5MAO A;  3ET6 A;  3CJ8 A;  3TVY A;  2DVI A;  1AT1 B;  1JLB B;  1X4C A;  5B7W A;  4DR5 J;  3PW4 A;  4QCL A;  2MQM A;  3T1A A;  4A46 A;  2VG6 B;  1KP6 A;  4LRD A;  4OV6 A;  2AV5 A;  3PYG A;  5A8K A;  2E1C A;  1NKB A;  2KN4 A;  1IBL J;  1TQL A;  2H5I B;  2XQC A;  1VK8 A;  4DSL A;  1ZH5 A;  1EET A;  3EZO A;  1V9O A;  3CSK A;  5AXL A;  4C3L A;  5KG6 A;  5KFP A;  1B4S A;  4DL2 A;  2QN6 B;  2QIF A;  4F2R A;  7AT1 B;  2KHD A;  1U2C A;  2B43 A;  1QTN B;  1YRT A;  2LXF A;  3EJM A;  3EZU A;  2LA6 A;  1Y5N B;  3OR1 B;  1BUX A;  3PFO A;  4EU0 A;  2ZBP A;  1CSJ A;  1Z2L A;  5HK4 A;  1KFD A;  2DR8 A;  4E8U A;  4C8O A;  3EVW A;  1M5S A;  4QZV B;  3DOL B;  2QT7 A;  5CHC B;  3MUM P;  2ZJP Q;  3C6U A;  5A0Y A;  1MWY A;  1S6U A;  5DG9 A;  1YI2 S;  1R7I A;  4CH7 A;  3ADA C;  2XLJ A;  1YKW A;  3LA0 A;  2KHC A;  3AY0 A;  1KLM B;  2I0X A;  1TTH B;  2JVO A;  2XSF A;  3SCI E;  3IS9 B;  3VAH A;  4DV6 F;  3GFZ A;  3T1Y F;  4YQW A;  3CJ4 A;  4LFC F;  4K4V A;  2GW8 A;  3TX0 A;  3CED A;  1S6P A;  2E5H A;  2LXU A;  2UV8 G;  2OSQ A;  3W64 A;  2VIC A;  4JI1 F;  4ECS A;  4KGV B;  4DV7 F;  4TN2 A;  3PW5 A;  4DV5 J;  3M9M B;  3H59 A;  3R7N B;  4YR2 A;  3GIM A;  2E5J A;  2W9B B;  1GMU A;  1NSA A;  4HT5 A;  4ZPT R;  3MUV P;  1WG1 A;  1NM2 A;  3CB4 A;  3CIM A;  4J7C A;  2NUH A;  3NWR A;  4X66 F;  3MD1 A;  2J0X A;  1JLA A;  1WF1 A;  5K14 B;  3LQV A;  5IWA F;  3JQK A;  3H8Y A;  4ELT A;  4FDF A;  3QQC D;  9RUB A;  4UW2 A;  2VB6 A;  2V34 A;  3IG1 B;  3CJK A;  3R5G A;  3UQS A;  3K5M A;  5DS7 A;  3OTO J;  3D2W A;  2KT5 A;  3LP1 A;  5FD1 A;  4GRS A;  5KT5 A;  2YX4 A;  2V94 A;  3HX9 A;  4JI7 F;  1AA1 B;  2VAS A;  4I4B A;  1FJG J;  3OL7 A;  1UA0 A;  1XR6 A;  2CVE A;  2DXE A;  4DS5 A;  1A7G E;  4NXM F;  2CNN B;  2NXN A;  2XZD B;  2XHC A;  4M5G A;  5KFD A;  5T14 A;  3MEG B;  4U67 Q;  4V19 X;  5F8G A;  3DRS A;  1VR6 A;  2KU7 A;  1YJ7 A;  3L7P A;  4M5D B;  1JX4 A;  1S9F A;  1IKW A;  4JOU A;  4QU7 A;  3A3N B;  1X4A A;  1W26 A;  4NAS A;  3A3P B;  3Q8Y A;  2V0N A;  3I82 A;  1I6J A;  1UVI A;  1NU4 A;  1ZOT A;  4NRT A;  4YDX A;  5KFY A;  3SFU A;  1RTZ A;  2Y0S D;  1FD2 A;  3JQM A;  1RB0 A;  4ILL A;  4MFB B;  1A0O B;  4OX8 A;  1MRO A;  5H9F J;  2VIH A;  4K4U A;  4OYB A;  4X65 F;  1CVJ A;  2OPS B;  2YPY A;  3ENV A;  3JS9 A;  1T8E A;  2W1B A;  4CLF A;  1FDN A;  1HW9 A;  3W65 A;  2NXJ A;  4PYD A;  4DL6 A;  3M8Y A;  4H4K C;  1YIT S;  2VKZ G;  4KH1 B;  4NLT A;  3G71 S;  3KJV A;  4ATN A;  4WKY A;  4LF9 F;  3CO9 A;  4PZV A;  2LMI A;  1FJG F;  4WTO B;  1MU2 A;  5GMK a;  2WB1 D;  3R7B B;  1KQK A;  3ZZY A;  4L76 A;  2XY6 A;  4ED1 A;  1FER A;  1KTQ A;  1KVK A;  2O67 A;  2VG5 A;  3GJQ B;  4O3Q A;  2G2Z A;  4KGK A;  4DCP B;  1HNI A;  1DQA A;  1IBC B;  1NCL A;  4RU9 A;  4QJV A;  4N8N A;  3J80 Y;  1U6F A;  1HA1 A;  2IC3 B;  2RQ4 A;  3VV2 B;  4N7T A;  4KHR A;  4QR0 A;  1F5C A;  4KPC A;  2DD8 S;  1AXQ A;  4P7T A;  4C97 A;  2AGP A;  1JLG A;  1R0A B;  2LEB A;  4CYU A;  5HRO A;  2Y1I A;  2DGS A;  1IUJ A;  2DKO B;  3AOB A;  3C2P A;  1FKP B;  3HHL A;  2QSW A;  1NEE A;  1HWL A;  3OR2 A;  1M5V C;  2CPD A;  3LAL A;  1NZ8 A;  3NY0 A;  2UUB F;  2FUG 9;  2QGF B;  2EKY A;  4NYZ A;  1RXO B;  1VRT A;  5KFF A;  2GHP A;  3CCU S;  1RT6 A;  1T0T V;  2D3O 1;  1KVI A;  1F9E B;  1TL1 A;  3D54 A;  1IBM J;  4OHZ A;  3UO0 A;  2F4V F;  3I31 A;  2AEF A;  1VQ6 S;  1CJV B;  2QL5 B;  3KKF A;  4MT1 A;  2XB2 D;  4IG0 B;  2RIL A;  5ETP A;  2EBE A;  3B78 A;  3TR5 A;  4CRJ A;  1TK5 A;  1UVJ A;  5IQQ A;  1NK0 A;  2QTW A;  4DX6 A;  2RDI A;  4WP9 A;  1RTD A;  3DLH A;  1FTR A;  4X66 J;  3MM6 B;  4OYX A;  2BRL A;  3MAH A;  1X0P A;  2B8P A;  2M88 A;  5KG4 A;  3EPI A;  2P9E A;  1YBU A;  2QA4 G;  2RNE A;  4KAI A;  2XS2 A;  1EHW A;  1Q8I A;  1Y10 A;  2DY9 A;  4Z7C A;  2WOM B;  4X4O A;  3OJU A;  2F4V J;  3QJL A;  3MWB A;  1ZTT A;  2Z2Y B;  4RLE A;  2BOA A;  5DQI A;  1UEU A;  3J81 Y;  4NCA A;  2MKK A;  2MYF A;  5ETQ A;  2GQQ A;  3GJR B;  1VGY A;  3HHL B;  2P2C B;  1VQM S;  4HI2 A;  2IM2 A;  3TJ9 A;  4FF2 A;  3R3T A;  3HJF A;  4I6W A;  3GYN A;  5HRO B;  4H4O A;  2E5L F;  4E0D A;  1NRK A;  1FKA F;  2ZC4 A;  2JSX A;  4NXN J;  4BC7 A;  5HVH A;  2J9D E;  1MWQ A;  1YRU A;  1V3Z A;  4ECV A;  4N56 A;  1FWL A;  5H9E K;  2DR9 A;  2BJ3 A;  5I3P A;  1I94 F;  4DPO A;  4C6A A;  4YUD A;  1PJ6 A;  2C3P A;  3EGW B;  3LTO A;  5LSL A;  1XQI A;  1N6Q B;  3TVK A;  2KVI A;  2VJV A;  4FNH A;  3C66 A;  1F9F A;  4MIA A;  4X4Q A;  1LXJ A;  3A13 A;  2CUY A;  2RE1 A;  3KNG A;  4ZLN A;  1S10 A;  1YK9 A;  1MU2 B;  4DSK A;  4NCB A;  2ZWO A;  4DL7 A;  5GME A;  3E2E A;  2ALZ A;  1HQU B;  4WZQ A;  1EAR A;  2MQP A;  1XEZ A;  2G2O A;  3HSG A;  3ZZZ A;  4ZLJ A;  4JV5 J;  4HT7 A;  2GJI A;  1CC7 A;  5FLX Y;  1X4B A;  2VC1 A;  3I6P A;  2H9Z A;  1RT2 B;  2MZ1 A;  3NGT A;  2EFP A;  3CC2 S;  3RRH A;  1AW0 A;  4RBU A;  4TVA B;  5LMU F;  1N5Y A;  3D9B A;  2DHS A;  1HL6 A;  4RW6 A;  4MFB A;  5B0D A;  2A6O A;  1H7W A;  1KOO A;  1R6Y A;  1LW2 A;  4OX6 A;  5LM7 E;  2QRR A;  3TJA A;  1U48 A;  1TK8 A;  4F02 A;  5KFG A;  2K7K A;  2M52 A;  3RGI A;  3SCJ E;  3KLI A;  1S0O A;  1WHY A;  1IKW B;  1KFS A;  1X9M A;  1X5T A;  3M4X A;  2CAJ A;  2VG6 A;  1C0T B;  1X4H A;  4K5R A;  4EEY A;  3RBD A;  2Y8W A;  4QYZ J;  1H7X A;  2VOD A;  2MPU A;  2KL8 A;  3AD9 C;  3M8Q A;  4IKA A;  5K8O A;  1TUW A;  5L1I A;  2F7V A;  1XER A;  2CZV C;  2LU1 A;  3M6U A;  3PJX A;  1R8P A;  2QE5 A;  2MSS A;  3DLG B;  2KT3 A;  5IM0 B;  3PV8 A;  2VV5 A;  3RBE A;  4B9L A;  1N33 F;  3THV A;  2FVS A;  4CLU A;  3U1M A;  4W92 B;  4WXO A;  4ZK7 M;  1PAE X;  5LJ5 Y;  2I6W A;  1LKZ A;  3BSC A;  3CNQ P;  5D77 A;  4ANC A;  5AXN A;  2Q66 A;  2FHM A;  1RLD A;  3BBF A;  1VFJ A;  4LRA A;  4IRD A;  1REV A;  4MK9 A;  2GQC A;  3ELH A;  5CXT A;  1S1U A;  3I96 A;  3MR7 A;  2JOQ A;  5ETM A;  3SEO A;  3IBW A;  4ZCK A;  5I3U B;  3LGH A;  4OV1 A;  3WC2 A;  4LF5 F;  3IGV A;  3V6H A;  1RT7 B;  4CM2 A;  2HS0 A;  3TAM B;  1F60 B;  4BWJ A;  4B3O B;  1T03 B;  2RB7 A;  4EBC A;  1QDU B;  1Y11 A;  2H5E A;  2PGC A;  3N5F A;  4TY8 A;  2O66 A;  4C98 A;  3DRP B;  5K8M A;  4O0I A;  1TKX B;  1KLM A;  1YDL A;  2YQ1 A;  1VQ7 S;  4FYW B;  2HLU A;  5L46 A;  1U7L A;  1IN0 A;  3I5C A;  5KFK A;  4K0K F;  4DR7 F;  3D3B J;  1RWX B;  6AT1 B;  1NZA A;  1IXK A;  2FJV A;  2QFI A;  2R8G A;  2KXN B;  1AUD A;  1WC3 A;  3P96 A;  5B0B A;  2D69 A;  4QW9 A;  5IC6 B;  3PW7 A;  3MOJ B;  1YZ6 A;  4P73 A;  2R7U A;  1NHU A;  1XMQ J;  3QJP A;  5C2C A;  1IJF B;  4QU6 A;  2CPJ A;  2GHV C;  1L5U A;  1UWB B;  4PEO A;  1WC5 A;  2R2S A;  1Q86 T;  4FYD A;  3JYT A;  1D9F A;  2FLO A;  2FZG B;  2OFH X;  2WVE A;  1CJU B;  4WFY A;  4ZP9 A;  1YIJ S;  3CME S;  2J0W A;  4IR9 A;  1S6O A;  3DM2 B;  5K5M A;  4HYK A;  4P2S A;  3PXG a;  3V6K A;  5DG8 A;  1PCA A;  1CJK B;  3AD8 C;  2KYX A;  2PEH A;  3DLE A;  5A2Q U;  4DF4 A;  2IAJ A;  3MTJ A;  3KK3 B;  2DNN A;  4LIR A;  4JUZ A;  1U6B A;  2B6A A;  1HHT P;  2DR6 A;  1TZ0 A;  2XZT B;  1YSJ A;  3PO5 A;  4J9N A;  3BSA A;  3U1N A;  1DHM A;  3CCT A;  2VDH A;  3EE3 A;  3ICL A;  4IOC Q;  1VOM A;  1TKD A;  3M2R B;  3MI7 X;  5J2M A;  1F3F A;  2JJ4 D;  3A12 A;  4TLR A;  3QLH A;  3T9Z A;  4F4Y A;  2D3O R;  2OIH A;  4QPT A;  1JKH A;  3KNA A;  3E8O A;  1UEV A;  2FD2 A;  3QJJ A;  2YNG B;  2HND B;  3KHH A;  4WIQ A;  3B4M A;  4B17 A;  1OYE A;  2YH1 A;  4K5S A;  1NHK L;  3AA9 A;  1YJN S;  2AEJ A;  4YR3 A;  2M9K A;  3GIR A;  3I9Z A;  1M5H A;  4ZVP B;  2R8K A;  5KFO A;  2LLZ A;  2H65 B;  1QAY A;  3H98 A;  5B08 A;  2BM0 A;  2MGZ A;  3J81 U;  3W3S A;  1FVS A;  3AJD A;  1VLO A;  3EM1 A;  4GVB A;  4NML A;  4RWX A;  5KG3 A;  4JI4 F;  3VAL A;  1U4B A;  4IQX A;  4YP3 A;  1BQM B;  3PHT A;  4OZL A;  4KKO A;  3HKW A;  2UXD J;  5F8I A;  1TKZ B;  1WSR A;  5H9E J;  1PYT A;  2RH3 A;  1IWG A;  1K1Q A;  1UCN A;  1LXN A;  2DCU B;  3MPU B;  2UU9 F;  2HHW A;  2P6S A;  2IPO B;  2MKC A;  2WBR A;  2VKR A;  2GGP A;  5JMN A;  3PR4 A;  3H4D A;  5EWE A;  1L3T A;  2W9C A;  1XMB A;  1XIQ A;  3NNC A;  2A2D A;  4OHW A;  2B4U A;  3DDI A;  5J2Q A;  2ZIT A;  4DFJ A;  3TAQ A;  1NB7 A;  3C14 A;  4EYH B;  2RDD A;  1LWC A;  1TL3 B;  1Y9O A;  2AYM A;  2B7B B;  2GQ2 A;  2VF3 A;  4ZIV A;  1H74 A;  3S6E A;  5KT3 A;  4EBE A;  2CA9 A;  2V4J A;  1TL7 B;  5D4P A;  5C25 B;  1N33 J;  4FNI A;  4JI5 F;  4RW9 B;  2UXB J;  4NEZ A;  1C0U A;  2HBZ B;  4DV0 F;  2OD6 A;  1FA0 A;  3M9N B;  5D78 A;  3H25 A;  2XYH B;  1BGX T;  2XEX A;  2PI5 A;  1G2E A;  3ONQ A;  5KFJ A;  2XLI A;  5DLF A;  3DRP A;  1JLC A;  5K8N A;  3JAM U;  2Q6C A;  1PG5 B;  1HBU A;  1TKT A;  2QEX S;  3HK2 A;  1CEZ A;  4JYA J;  4B3O A;  1NPP A;  4F2S A;  4P74 A;  4RNH A;  2ROG A;  2VBW A;  3FSX A;  5HN0 A;  1ULR A;  2FPH X;  3LP2 B;  3M2V B;  4ZVR B;  2HNY A;  1GMW A;  5A6P A;  2DEJ A;  5I3U A;  3V4I B;  2GML A;  1WI8 A;  3HJV A;  4NI2 A;  4LRB A;  3V6J A;  2GA7 A;  2FDN A;  2NS1 B;  2YNF A;  2LA4 A;  1YZ7 A;  3DC2 A;  4USJ C;  1FXD A;  1JNR B;  2EBG A;  1RAF B;  2LQ9 A;  2RF2 B;  2VFU A;  3GSI A;  3MM7 B;  3FEX B;  1S59 A;  5L9X A;  1NK9 A;  2ZKT A;  1KWM A;  2PN6 A;  1HYS B;  4DG1 A;  4OI6 A;  2X3D A;  4NXM J;  2Y1R I;  3MCN A;  3EMT A;  3GIK A;  2UU9 J;  1DLO B;  2JEJ A;  2IJR A;  3T6J A;  1YBA A;  4CO3 A;  1SQF A;  2Z58 B;  3OSN A;  1ZZN A;  2LEA A;  1DTT B;  1P1L A;  1RP5 A;  2QLX A;  3CJ2 A;  3FFI A;  3L9Z A;  3ETM A;  4C8M A;  3CD5 A;  1I3O B;  5G4D A;  2DYA A;  4DV2 J;  3T1Y J;  1U1P A;  2J7U A;  4FXD A;  4TKT A;  3W9J A;  4C48 A;  2DBB A;  2P9C A;  1ZAW A;  3F56 A;  5E33 A;  3T1H F;  1L3U A;  3UDV A;  4C3K A;  3ITH A;  5CCM A;  3L7O A;  3KLI B;  1I94 J;  1CQN A;  4YB6 A;  1IQZ A;  2ZM6 F;  4RR5 A;  1VIS A;  2C2O B;  2GVZ A;  2JH3 A;  4ES1 A;  1KKH A;  4DFP A;  3Q2T C;  3CJT A;  3Q8U A;  2V9K A;  2V50 A;  2HWH A;  4JV0 A;  2R8J A;  1RAO A;  3W8P A;  4V19 J;  5AJ3 J;  3P49 B;  4C4W A;  3JXO A;  4RW6 B;  1OPI A;  4Q8F A;  4WFX A;  2F1F A;  1PIE A;  3MDF A;  4OZJ A;  3G8S A;  1VRU A;  3MMJ A;  1S1T B;  4KSE B;  4ES2 A;  5F9L A;  3R5B A;  1IR2 A;  3PW2 A;  4C11 A;  3OBI A;  1P8G A;  1HQU A;  5EHH A;  2NCK L;  3VAF A;  2B9Y A;  2KI2 A;  3DOK A;  5A8R A;  5E41 A;  2CYY A;  4A8O A;  2WHO A;  4LF2 A;  5HMZ A;  5IZH A;  3VZI A;  2YWW A;  1XC9 A;  5F8M A;  3AH6 A;  3HM9 A;  4AL7 A;  2RHQ B;  4EFA C;  3PR5 B;  4DR6 J;  3G6V A;  2ZM6 J;  1VC5 A;  2P6T A;  1T95 A;  3IA0 A;  3LO3 A;  1TAQ A;  5KG7 A;  2E1P A;  1IM6 A;  4C2M A;  1IKX B;  1VQS A;  4NA1 A;  1HHS A;  2NPI A;  4KY3 A;  2XMV A;  3KG0 A;  1SC3 B;  5A2Q Y;  3UDL A;  4J9S A;  1F1B B;  2ZBC A;  1IBL F;  3TW0 A;  2WSE C;  5DJB A;  1X8D A;  4B9V A;  2C2Z B;  3I0R B;  1VS3 A;  3KHR A;  3SYZ A;  2JFK A;  2NLW A;  1XNR F;  1EKS A;  1FK9 A;  1N0U A;  2I8E A;  2WOM A;  3UN5 A;  5KFX A;  1SJF A;  1SKW A;  2IDL A;  3MR6 A;  3GTY X;  2VG7 A;  3CJR A;  4DPU A;  4MKY A;  1E6Y A;  2JC0 A;  2B7C B;  5HJX A;  2M8D B;  2WSC C;  4UST A;  3DGV A;  4B3S J;  1JLF B;  4DLG A;  1NJW A;  8ATC B;  4TYA A;  2C2D A;  1HNW F;  2V4R A;  3QRR A;  1Q7Y T;  1RHM B;  1RTD B;  2N82 B;  4HTI A;  1RWN B;  3B54 A;  5J1N A;  3CXC R;  2JX2 A;  4C0H A;  2H3E B;  1HNV B;  4IG0 A;  3KOA A;  4F4X A;  5HP1 B;  1CJV A;  1CUL A;  1SC4 B;  1GTH A;  4CLP A;  3A8J A;  4ERD A;  3NMR A;  3AAW B;  3LUY A;  3WIU A;  2HLT A;  3NGK A;  1ZBT A;  2ZHA A;  2WSF C;  3MM5 B;  1LW0 B;  2FLP A;  4PRF A;  1VQP S;  2OD4 A;  1HBN B;  1RBO B;  3VVT A;  3OHB A;  4PPD A;  1O51 A;  2HVD A;  4I0W A;  4EK2 A;  3IN5 A;  4BWM A;  2A18 A;  1MN9 A;  5KG0 A;  3DU6 A;  1JJ4 A;  3H5U A;  2J9C A;  4ZVO B;  3MEE A;  4KV8 B;  1PYS B;  1OQ6 A;  4J91 A;  5L8R C;  2IC3 A;  4R5P A;  2F65 A;  1YGY A;  3KDO A;  3D6F B;  2CQ0 A;  1RTJ B;  4F50 A;  4Y34 A;  5EDW A;  4DF8 A;  1URN A;  4P2F A;  2J0S D;  2AJ2 A;  3SDE A;  3R1H A;  3PKM A;  3T5H A;  1PIL A;  1N32 F;  2RT3 A;  4K7Q A;  4PG6 A;  4U7C A;  2Q1L A;  1RTI B;  1HMV B;  2C2M B;  4NA3 A;  3CO0 P;  2BKN A;  2GVD B;  5HBM B;  2KVQ E;  3UPF A;  3KJV B;  3RRG A;  4LF8 J;  4CLL A;  1N48 A;  2MKJ A;  2VBX A;  2LYV A;  2HQG A;  1D1U A;  4U96 A;  2UXB F;  2DRA A;  2OPS A;  1UW4 A;  1KVJ A;  1FRM A;  1H2U X;  1IM4 A;  3ZZR A;  1S1X A;  1T9Y A;  2DNH A;  2WTF A;  1N34 J;  1IR1 A;  1RE1 B;  3QO9 A;  1H2T Z;  3BRE A;  5C2G A;  2HMI A;  3B82 A;  2CQC A;  3MMC B;  3Q22 A;  1RWU A;  2LDI A;  1NDL A;  4G1Q A;  1OPZ A;  4M5I A;  5ETS A;  4N47 A;  3POT A;  5CYQ B;  2ASD A;  4GKJ F;  2FJW A;  4QQB A;  2DNM A;  2X3G A;  3VQS A;  4YR0 A;  4LFB F;  4ZPD A;  3SMZ A;  5C42 B;  1WF0 A;  5M2R A;  2DNY A;  3MMA A;  1RAG B;  5EWF A;  2QX0 A;  3BH7 B;  3KLE A;  3VAJ A;  2QL9 B;  3SV4 A;  3TAP A;  3MEG A;  2R7T A;  5DET A;  1RQ0 A;  1PAU B;  1FI4 A;  2BE2 B;  3HSZ A;  3TZY A;  4X4U A;  1DTQ B;  3MUT P;  3QWP A;  4GKJ J;  4JI6 J;  2F4F A;  3HT0 A;  3CGI A;  2FLN A;  1FD8 A;  1VIX A;  2K8G A;  3E51 A;  1HIY A;  3UVJ A;  2AKW B;  1P9Y A;  3ENW A;  2AX0 A;  4Y65 A;  5HI7 A;  3M7V A;  2G2Y A;  2GC8 A;  2OHD A;  3KK2 B;  2V4Q A;  4F4Z A;  4IO9 Q;  2BAN A;  3R1L A;  3CJK B;  1S4E A;  2E1R A;  2VUG A;  4AND A;  4CLW A;  3ZXW A;  2KJV A;  2CJX B;  3CJS A;  3TZZ A;  2L9D A;  4PXC A;  3MED A;  3DGP A;  4Y3C A;  3GPA A;  4DX8 H;  2GO9 A;  2XZW A;  2BA9 A;  3MAQ A;  3OUY A;  2FJX A;  2EC0 A;  1JLA B;  1IKY B;  5JVH Q;  1RAD B;  1FTC A;  4J9O A;  4RKU C;  2OEL A;  3NOG A;  3EUN A;  4ED4 A;  1KD1 T;  4KIA A;  2YKN B;  1X0F A;  5DDO C;  3OVS A;  1NPR A;  4OJ1 A;  2RQM A;  2MKH A;  2OLW A;  2E29 A;  2LFV A;  5D4L A;  4OYW A;  1S6P B;  2X1A A;  4WTY A;  1JLQ B;  4NLY A;  2HUR A;  2VPX B;  3ZC4 A;  2QFJ A;  1Y5L B;  5L38 A;  5B0A A;  4P6Q A;  3A8K A;  3R27 A;  3BZQ A;  3UR3 C;  2XYG B;  2ZDO A;  3D68 A;  3W2W B;  4PQU A;  2AJ0 A;  3JQJ A;  2G0I A;  2BZ2 A;  2VFV A;  1C4C A;  3MM9 B;  3BO3 A;  5LMN J;  4A8W A;  3PW0 A;  2KTQ A;  5A8W A;  5CYM A;  5HAN A;  1WC6 A;  4DCJ B;  3P4U B;  3K59 A;  3QT5 A;  1DUR A;  4KHM A;  1RT4 B;  5GAH U;  2WVD A;  2WVF A;  1J5O A;  3M8Z A;  1TUV A;  1WF2 A;  2BKO A;  3Q23 A;  3LAK A;  3VGU A;  3GCX P;  3KUE A;  2MTL A;  2KXF A;  4FS1 A;  5EX0 A;  4X4P A;  1NND A;  2ZC3 A;  3BSO A;  4LF7 J;  1X9W A;  3N28 A;  3PZP A;  2XTJ P;  4P71 A;  3VAI A;  1SL0 A;  4ES3 A;  1RI7 A;  1UAW A;  2FJB B;  2R2T A;  2DHA A;  4M5M A;  1S12 A;  3QMQ A;  2WAQ D;  4OJG A;  5GAH I;  3V81 B;  4ZHR A;  2OMO A;  3VHQ A;  1N88 A;  5E2Q A;  4GC7 A;  2MZT A;  2Q43 A;  1J5O B;  2VBZ A;  3W62 A;  4K8R A;  1XBW A;  2OPP B;  1SUQ B;  4QWC A;  3G8T A;  1HI0 P;  2LVW A;  5D8H B;  3AOA A;  3H0P A;  4UF4 A;  4Z37 A;  5M2P A;  4QIG A;  4Q0B B;  2ZH6 A;  1JIH A;  2XMW A;  5FDL B;  4XPC A;  1DJ0 A;  3QFH A;  5RUB A;  1HR0 F;  1FCA A;  4FS2 A;  1LK5 A;  4Y2A A;  3L3C A;  4ZVG A;  3BO2 A;  4DUY F;  1UTA A;  2M70 A;  5BR8 J;  5I42 B;  1OSD A;  5G0R A;  1KTV A;  1C1C A;  3MMB B;  3M1V A;  1RWV B;  4K59 A;  1FKO A;  1TVR B;  3OTE A;  3T6B A;  4KO0 A;  4OFZ A;  4BBY A;  4NMX A;  1N5Q A;  2WB4 A;  1UPM B;  4Y6I A;  4BCA A;  5HO4 A;  5LMU J;  4ID8 A;  5EN1 A;  1XWL A;  1Q1K A;  3NAH A;  1KHV A;  1S1W A;  2XGP A;  5LSO A;  3R6L B;  3LWL A;  4DR3 J;  1T02 A;  4XAK A;  3MFH A;  2ZVS A;  1EQ0 A;  3Q8S B;  5GAE I;  3MZI A;  1HQE A;  2ZHB A;  2UV8 A;  4DU8 A;  1UVK A;  4DZD A;  3S1T A;  2V67 A;  1UWA A;  2Y1L B;  3KK2 A;  4FKY A;  1VQ8 S;  2HZV A;  4P7V A;  2PFD A;  4ER8 A;  4I7F A;  4ZVT B;  4AUK A;  5IXU A;  1AZS A;  2I5J A;  2K2P A;  2HQF A;  5F3T A;  5L1L A;  2LQ8 A;  3CDB A;  3LPE A;  2ZBQ A;  1GEH A;  3CIZ A;  3T41 A;  2AX1 A;  1HI1 A;  5HJY A;  4K4Z A;  1OY9 A;  1HD0 A;  4LF1 A;  4K4T A;  2E5L J;  2F9D A;  1XR5 A;  3PEJ A;  4QOT A;  3DLK A;  2J76 E;  4YB1 P;  1RBA A;  3HHN B;  4WZM A;  2HRT A;  3MAA A;  4OX9 F;  4A8S A;  4B9M A;  4CWB A;  1HWU A;  4IOA Q;  4TU7 A;  3ZZP A;  3PYE A;  2AGQ A;  2IM1 A;  3N0V A;  1LEO A;  5F0U A;  6FDR A;  2R7V A;  1RAA B;  3CD6 S;  3RRK A;  4QPX A;  2EI5 A;  2J8A A;  3NL0 A;  1BWV A;  1M1G A;  1PKU A;  5ETO A;  3J7A 1;  3TWZ A;  2W4P A;  2HWT A;  3NKY A;  3P5T L;  1RYS A;  1WHX A;  3UWT A;  1GNK A;  5F8J A;  4B3T J;  2ABY A;  2FJD B;  5KFI A;  4X4R A;  4UQG A;  3HD1 A;  1U1Q A;  3BN4 A;  3P3D A;  1ZM3 A;  4ZKA A;  3CD7 A;  1ARO P;  3E3X A;  3LAN A;  3QIP A;  1H98 A;  2U2F A;  3J7Z T;  3FKB A;  4GO7 X;  4UY8 5;  4ELU A;  1V6H A;  1O0P A;  1QUV A;  4ZVQ B;  1OJ4 A;  1QVF R;  3W5X A;  1WOO A;  2QLF B;  2DHH A;  1H72 C;  2ASL A;  4ED0 A;  2V2V A;  3D0H E;  3TUI C;  1VBY A;  1H0H B;  2MQN A;  3LGM A;  3I55 S;  2GAG C;  2AWZ A;  3K89 A;  4TLQ A;  5DGB A;  4U8V A;  5E3P A;  3BO4 A;  4UTG A;  3KLF A;  5GAD U;  4NL5 A;  2ZE2 A;  3M8P A;  3OV7 A;  1F2G A;  3H42 A;  3HT3 A;  1DY3 A;  2KRR A;  2WON A;  1VC0 A;  3CTR A;  2G4B A;  4DX5 A;  3ZTS A;  1QM9 A;  2IA0 A;  3I56 S;  1HNX F;  4NLO A;  1GH8 A;  3SQG B;  4M94 A;  4EBD A;  1QAX A;  3Q8Q B;  5GAD I;  2A10 A;  1P6T A;  1KQG B;  2B4V A;  2H4Y B;  2CZ9 A;  2MLY A;  2YKP A;  3HCX A;  3R9L A;  2FC9 A;  3V6D A;  5HP1 A;  4URS A;  2C2N A;  2A6M A;  2DH9 A;  2MEW A;  4NLW A;  4PG8 A;  2AT1 B;  1AFI A;  4I2P A;  3TI0 A;  2Y8Y A;  2R7O A;  1KR4 A;  1WOS A;  1YJT A;  4M63 A;  2QYG A;  4OZN A;  4JI8 F;  1X31 C;  3KJF B;  2VQE F;  3IGN A;  1JLF A;  2KZM A;  2HQ3 A;  2I1R A;  2X51 A;  3M32 B;  3QZ8 A;  4PG7 A;  3QGG A;  5E3Q A;  3W2V B;  1X7V A;  4IRC A;  2DCL A;  2VD3 A;  3K5O A;  4URG A;  1YJ9 S;  2XM3 A;  2HG4 A;  3SSR A;  4USK A;  2VU5 A;  2QLW A;  3FCH A;  3V5R A;  5C24 B;  4J9M A;  2HHV A;  1A6L A;  4CT9 A;  3I0R A;  1FDB A;  1RAJ A;  1D9A A;  2LEP A;  2PFF B;  3UR0 A;  4WJB A;  3G82 B;  4LF7 F;  3G6E S;  3DYA A;  1VI7 A;  3IBF B;  2QC3 A;  4QBU A;  3GII A;  4AQY F;  3O44 A;  1SI9 A;  4U8Y A;  2P8I A;  2YKM B;  4L72 B;  2A3J A;  4ECX A;  3BM7 A;  3AQO A;  4O44 B;  4CTA B;  3L95 X;  1SC1 B;  3M6X A;  4Y2I A;  4DFK A;  2UVV A;  1SC6 A;  4OZ2 A;  1JB0 C;  1B7Y B;  3TYT A;  5KFU A;  1FVQ A;  3LOU A;  4JI0 J;  3TUP A;  4A8F A;  3FUY A;  2KKH A;  2V8G A;  1H6K X;  3D1H A;  4TYB A;  2DGW A;  2XMM A;  2KRB A;  3JSR A;  2F5G A;  3N6N A;  2EG1 A;  1J27 A;  1Y3K A;  3P5B P;  4EZ6 A;  3QRP A;  5HQ8 A;  1OS5 A;  1FE4 A;  3W2V A;  3M32 A;  3ENA A;  4HI1 A;  2PMW A;  2BKP A;  3DMJ B;  1U0H B;  1ZA1 B;  4TNO A;  4DV3 J;  4LF6 J;  1K0V A;  1NJI T;  4RW4 B;  4USH A;  4G65 A;  2OAU A;  4RNN A;  1OY8 A;  1VQN S;  3HVA A;  3IAS 9;  1HI8 A;  4DR2 F;  3AOC A;  2EK6 A;  2MHN A;  1S7I A;  2YKQ A;  2ZBI A;  3K5P A;  2O5D A;  4B3R F;  2CPZ A;  2ZBR A;  3BKU A;  2V8P A;  3DN9 A;  2DY1 A;  4I6Y A;  1T9T A;  2FGC A;  3W5Z A;  3SQG A;  4NLP A;  1W25 A;  1C2P A;  2R2R A;  1CS4 A;  5JUM A;  3W8G A;  4DBQ A;  1UET A;  2W01 A;  1RT3 B;  2CQB A;  1H38 A;  2ACY A;  3CCS S;  3TOQ A;  3KLV A;  5AJ3 F;  1VBK A;  5SUH A;  2H54 B;  5KFC A;  4DR6 F;  1N54 B;  2E1M C;  3IBC B;  3OD2 A;  1T9U A;  4NXN F;  2YH0 A;  4RW4 A;  3MD3 A;  2R8I A;  1AB8 A;  2JLF A;  3FFI B;  2X1B A;  3FZ2 A;  3GJT B;  4PXD A;  1SH2 A;  4X2B A;  4PAB A;  2VFR A;  1LQ9 A;  3BR9 A;  1Q7L B;  1ZZF A;  3M2U A;  4AXJ A;  1N36 F;  1GXL A;  1JJC B;  3DOM B;  2B8Q A;  2DNP A;  4BLG A;  3BF4 A;  1TUG B;  4DI6 A;  8AT1 B;  5H9F K;  3PVX A;  1NXI A;  3LF0 A;  2ZH8 A;  1WKK A;  3GB0 A;  3QT8 A;  2ZOG A;  4DV6 J;  3ZTR A;  1Q81 T;  3KUH A;  4RZR A;  4AE5 A;  5K20 B;  2QO3 A;  1SIZ A;  2YXL A;  4DR3 F;  3Q0A A;  3L09 A;  4Q2L A;  2YNF B;  3FNN A;  3DLJ A;  1UVM A;  4U95 A;  1ZTW A;  3QSY B;  1IWA A;  1PBA A;  3PFE A;  3V4I A;  4YS2 A;  2ZZN A;  2MHE A;  3C8Y A;  4MTP A;  4NZ0 A;  2B5J B;  4K2J A;  1KBR A;  1GMV A;  1H73 A;  1U6Z A;  4WE1 A;  5KT4 A;  4OHV A;  3BH6 B;  3L4B C;  1PYO B;  4PR6 A;  4KB7 A;  3SQO P;  3THT A;  1Q5Y A;  1S72 S;  3MCO A;  1TKT B;  2DNK A;  5MLC V;  4I6A A;  3BKF A;  4CQ1 A;  2IMO A;  4C8L A;  2IA6 A;  2Q6B A;  5JJB A;  4QYR A;  5DM6 Q;  1HR0 J;  2P5V A;  4RW8 B;  1DBD A;  1RA7 A;  2MZS A;  5F8L A;  4A8Q A;  3CMA S;  2C3O A;  1DZ5 A;  3OFF A;  4HDG A;  1C0U B;  4QW8 A;  5C25 A;  2QYC A;  1VQY A;  1EB0 A;  2BJ8 A;  4RL1 A;  1CC8 A;  2XY7 A;  4OYZ A;  3M30 B;  1NK7 A;  4LR9 A;  3DRX A;  1SIW B;  2OI2 A;  2VC0 A;  1NJY A;  2DO0 A;  4LJM A;  2N3L A;  3Q89 A;  3QSI A;  5AXK A;  2XI2 A;  1GX5 A;  1KRP A;  1U2F A;  4ITS A;  3WZ0 A;  4B9S A;  1QAJ A;  1Q78 A;  3KWM A;  1S4F A;  4I56 A;  2MLZ A;  2XSJ B;  4DUY J;  1WEL A;  1GT8 A;  2AJ1 A;  4YN3 B;  5F8N A;  1HQ2 A;  2CJ9 A;  2D74 B;  2V63 A;  1GMW D;  1FRK A;  3TA1 A;  4C8N A;  2B4O A;  2PE8 A;  3SCK E;  3WDO A;  2CQ1 A;  1M90 T;  2B9E A;  2VPW B;  4IDK A;  3W63 A;  2RS2 A;  2E1A A;  2RKI A;  5KG5 A;  2ZZT A;  3KFW X;  2O1P A;  3PX0 A;  3EGZ A;  2CJY B;  4GVB B;  1K8A T;  1RT5 A;  2GO8 A;  2MDA A;  5KFN A;  3BYP A;  2ATC B;  4KO0 B;  2U1A A;  1X4D A;  5IT0 A;  4DV4 J;  2C1E B;  4FYV B;  4KTQ A;  2IYI A;  1IKV A;  4HHH A;  4UQT A;  3VGV A;  4OYI A;  1K47 A;  4U6P A;  3SXL A;  5I42 A;  5IT9 U;  6FD1 A;  4QR2 A;  4F4W A;  4ETZ A;  4JB8 B;  3GZ7 A;  2N4D A;  2OPQ A;  3DNC A;  3UD3 P;  1S0N A;  1VQ9 S;  2CWX A;  5KFR A;  2B4P A;  1TFW A;  3RYL A;  5J1E B;  4I2Q B;  4ZPC A;  1MLA A;  1Q8L A;  2MKY A;  3ZZO A;  2HW3 A;  2JC1 A;  4MAK A;  1T05 B;  2AJF E;  1O5J A;  3QIP B;  2J6U A;  4FZV A;  2EWH A;  4IFV B;  2EG2 A;  4Y2M A;  2OPP A;  2AYE A;  4IYQ A;  1T3O A;  2BX6 A;  3KDN A;  3Q24 A;  4LF4 J;  2ZUG A;  5KFL A;  5HLF A;  1FJC A;  2B6A B;  1VRQ C;  3M6W A;  1Z2Z A;  4TQS A;  1U26 A;  2DJW A;  3OTD A;  5BYQ A;  3NP5 A;  2K1R A;  3IWX A;  1C1B A;  2H48 B;  3LAM A;  2RJZ A;  3HHL C;  3LP0 A;  3OPK A;  3SBM A;  2J7K A;  4A8X A;  3J7Z 5;  2V9W A;  4LQ3 A;  2E9T A;  2EFG A;  2JZ5 A;  4IG3 B;  1B0T A;  2OP5 A;  2UXC J;  1HWI A;  3WC0 A;  3EXC X;  4HH1 A;  4RUH A;  4F3O A;  4M5L A;  4WFB Q;  3WIV A;  2B0G A;  4J9K A;  1WHV A;  4YHH F;  2BQR A;  4P2M A;  4DS4 A;  3CC4 S;  3SZ2 A;  3JSY A;  4B3T F;  4X4N A;  1SBR A;  1AZS B;  2I5J B;  2YQ3 A;  3KJQ B;  4PG5 A;  1PO6 A;  5DQG A;  2XS7 A;  5ETR A;  1XTZ A;  5KT7 A;  3PX6 A;  1T05 A;  3MM9 A;  4K4W A;  1L3K A;  4ZPW R;  5E7O B;  2HRY A;  2AW0 A;  2JNJ A;  3W2W A;  2CNO B;  1R3N A;  3Q83 A;  1UW9 A;  5DDP C;  1NKE A;  4PYA A;  1NH7 A;  1FES A;  3CJ5 A;  5ETN A;  1E6V B;  5DGA A;  1MML A;  3ZNJ 1;  1CQM A;  5U47 A;  1N5V A;  5M2U A;  2AZ3 A;  3QZ7 A;  2UXC F;  2F8E X;  2HQC A;  3H90 A;  2W8L A;  1TVR A;  1Z4U A;  1S9G A;  1KNZ A;  4WBF A;  2BM1 A;  3FBB A;  4CP5 A;  2V6A A;  1F6T A;  2AZ1 A;  1U8S A;  3W66 A;  4KC5 A;  4EO8 A;  3H4B A;  2B3T B;  2AEM A;  2AQ4 A;  1Q8B A;  2E44 A;  1WDT A;  3GG0 A;  4UY8 T;  5KFH A;  2XO7 A;  2BMB A;  2DNQ A;  1Q82 T;  2MY7 A;  2JVR A;  4DR2 J;  3OT9 A;  3D6H B;  1S79 A;  4W90 B;  1H2V Z;  3BPD A;  3IRW P;  4B9N A;  4GMK A;  4ZPV R;  1SUQ A;  1APS A;  2BVZ A;  4DR5 F;  4PPZ A;  5J2P B;  2CQP A;  3G87 A;  2W4D A;  4KH0 B;  5ETT A;  1JXV A;  3KMS A;  1IBM F;  3M8Q B;  2J6S A;  4JV1 A;  1RTH B;  2MLX A;  3NBP B;  3C16 A;  3E01 B;  4DV2 F;  3OFE A;  3P6Y C;  4WPA A;  5F9N A;  3F73 A;  4DV1 F;  3MUR P;  3KYL A;  4UOF A;  2G1H A;  3HVT B;  2XHW A;  4M5H A;  5BYS A;  4DN0 A;  5K9F A;  4JYA F;  4HDH A;  5E0O A;  4JP8 A;  4ED2 A;  2XWY A;  2JDJ A;  3Q86 A;  2DB1 A;  2YWH A;  3C16 B;  2PD1 A;  3HI9 A;  3UFC X;  5KFB A;  3TAR A;  3MXH P;  3ETO A;  4NLG A;  1RT2 A;  1S6Q B;  4LSL A;  1QUP A;  5CZX A;  4F0K A;  4C7Q A;  4F3M A;  3VAK A;  4NPO A;  1QAI A;  2C3Y A;  4EWT A;  4J5O A;  4I2Q A;  5J1E A;  2V2Z A;  2GVD A;  3TNV A;  1NDP A;  1K73 T;  1HMV A;  5HBM A;  2CRL A;  3GFH A;  2DGT A;  4DXL A;  2GX8 A;  2DNZ A;  4O4G B;  3VTI A;  2YNH B;  4LF9 J;  1J5E F;  1UKU A;  3VAG A;  4KHP J;  1MN7 A;  3O8W A;  1OO0 B;  4CLT A;  2ZH5 A;  4FPI A;  4ZA1 A;  1IKV B;  3RU0 A;  3JSM B;  1SV5 B;  1HD1 A;  4A8M P;  3FK4 A;  4CO2 A;  1R8B A;  1W2B R;  4KV8 A;  1Y0H A;  2R7S A;  1KEK A;  2FVP A;  1Q16 B;  4M5N A;  2FGO A;  3KHG A;  3FJ2 A;  5IC4 B;  1A9N B;  1RHJ B;  1FE0 A;  1E6V A;  1TL5 A;  3GFY A;  4ZVS B;  4LF5 J;  1JWW A;  4AL5 A;  1PC4 A;  1D3W A;  1KS2 A;  2AHO B;  1N0V C;  2Z57 B;  1UL3 A;  3MED B;  3VR1 A;  4J9Q A;  2E9Z A;  1MG7 A;  2Z8Q A;  4KPY A;  2CPF A;  2XSJ A;  1MMD A;  2EK1 A;  2HQI A;  1FXR A;  1OSC A;  2WW8 A;  5DZ6 A;  2HHH F;  1P9Q C;  4DR1 F;  3KJN B;  1LNQ A;  3CDA A;  3H7H B;  2ZHO A;  4AT1 B;  4I69 A;  5LL6 d;  4C3M A;  5DQH A;  1EAY C;  1SJ4 P;  2HHT A;  2DPJ A;  4CT8 A;  4XDC A;  4C8Y A;  1K1S A;  1DTQ A;  4LR8 A;  3MM6 A;  4WFZ A;  5ETV A;  1NAQ A;  2XG8 A;  2NYI A;  2YNI A;  2MJU A;  3WHI A;  2DNG A;  4OYA A;  4DPX A;  4QWA A;  4USM A;  2QA4 S;  3DFE A;  2GHW A;  2UZA A;  1HW8 A;  3ISN C;  3MMA B;  4PG4 A;  2DRB A;  2RHS B;  4IG3 A;  2VG7 B;  4AXI A;  4X62 J;  3HVR A;  2HGM A;  1TL1 B;  3CCW A;  2W9A A;  1UPP A;  4YEA A;  1JNZ B;  1WKL A;  2DNR A;  2LU2 A;  5CZV A;  2D3U A;  1VRT B;  4F25 A;  3EZ5 A;  2R7R A;  1WOR A;  1N8R T;  4CLZ A;  5B0F A;  2E9R X;  2UP1 A;  2IY5 B;  3OW2 R;  2WVB A;  1SJ1 A;  2OPR A;  2L9W A;  3GR0 A;  3OTB A;  1FX4 A;  4UZC A;  3PG9 A;  1F3V A;  4I64 A;  1JLG B;  2ASY A;  1R0A A;  2C2K B;  4LBH A;  1LWE B;  3NGU A;  4LUB A;  4B3R J;  1YG0 A;  2W2P P;  4WCE Q;  1GXT A;  4ZJQ A;  5EX3 A;  5KOX A;  3JTP A;  3J7A N;  4UOC A;  5D15 A;  4BC9 A;  1HNI B;  3FQK A;  3PNI A;  3T19 A;  1XMO F;  2CJA A;  1GK8 A;  1XN9 A;  3NNA A;  5KFW A;  2M0G B;  4CI0 B;  1GX6 A;  2KXH A;  2YWF A;  2HBR B;  4GC6 A;  3R6G B;  4USU A;  4X62 F;  1SH0 A;  2CQ3 A;  2D7S A;  2HAF A;  3T1H J;  3OJS A;  3CT9 A;  1Q53 A;  3IR6 B;  2RKI B;  4LRC A;  4C11 B;  4HAC B;  1F9H A;  2KDO A;  2R7X A;  1R8C A;  2ZJR Q;  2XBP A;  5THW A;  2GZO A;  5ITH A;  4A48 A;  2KB2 A;  4DV4 F;  2CQ2 A;  2BR0 A;  4GKK F;  3QRQ A;  5KTQ A;  1NK8 A;  2HVH A;  1LW0 A;  4DX7 A;  2NYH A;  2ZOM A;  2PT0 A;  1SKU B;  4NZ6 A;  2NZ4 A;  1F5B A;  1TP7 A;  3SSS A;  2BJD A;  4RNO A;  2IVF B;  4UZB A;  4Q8E A;  2ADC A;  5GMD A;  4NLR A;  4OI1 A;  2B51 A;  3ITH B;  4PUO B;  4DQP A;  2BE7 D;  2ZZM A;  3UE2 A;  2G13 A;  2PA8 D;  4DQI A;  5B09 A;  2KM8 B;  5L1J A;  1BMQ B;  2E7X A;  3DRS B;  3FCV A;  5HSP A;  4B9U A;  1KOH A;  1VYA A;  3NS6 A;  4KJI A;  2QMX A;  1UJ6 A;  3DI6 B;  2W25 A;  5LJ3 Y;  1RK8 A;  1N56 A;  5ETL A;  2ZFH A;  1JQG A;  3FBC A;  4R0J A;  4B3M J;  1E6Y B;  2APO A;  1FRJ A;  3M05 A;  2VL1 A;  1NDC A;  3GV5 B;  2XNR A;  1WI6 A;  2FHO B;  1EX8 A;  3J7Y I;  3RAQ A;  2MKS A;  3UCU P;  5B0E A;  2HGL A;  5FLX U;  3W9H A;  3ZNU A;  2WBM A;  2CXE A;  4CO0 A;  1UMJ A;  5KG2 A;  2RF2 A;  3A8E A;  2GV1 A;  3GQC A;  1VQO S;  2B5J A;  3V2U C;  2CQH A;  1FDD A;  4CTA A;  2HBY B;  5K14 A;  4LFA F;  3CD0 A;  4IOB A;  2CQI A;  3U1L A;  1CPZ A;  1UVL A;  1R27 B;  1GAO A;  2P9G A;  2VQF J;  1O8B A;  3EXY A;  3BGR A;  4RUB A;  4F0H A;  4FYY B;  2HYI B;  3LP2 A;  4ZJL A;  4A8Y A;  2HNZ A;  4HKQ A;  3CVK A;  4W98 A;  3TEH B;  3V4M A;  3NOC A;  1DQ9 A;  2CPY A;  3EGN A;  3RG6 A;  1RAB B;  3EWG A;  5JXS A;  3N9U C;  4G1P A;  4RU2 A;  1W2I A;  2AGO A;  1FRL A;  1C4A A;  5A8R B;  2KG1 A;  4DL0 C;  1UZD A;  3CF5 Q;  4DV5 F;  4JI7 J;  4TU9 A;  3M8W A;  2KH9 A;  2NXU A;  1SQG A;  4OIX A;  2MKI A;  2UXD F;  3FEZ A;  1WTB A;  1O6X A;  1IBK F;  2XCA A;  3OVB A;  3OTO F;  4CNZ A;  1PC5 A;  5A0Y B;  1TL7 A;  2BYC A;  4WP8 A;  3GWC A;  5IS2 A;  1HNZ J;  5EGY A;  2K3I A;  1FRH A;  1HNW J;  2DGV A;  4OYM A;  1X60 A;  2FZC B;  1FFW B;  3IM9 A;  3MF5 A;  3RBX A;  4WFA Q;  1YJR A;  5J1P A;  1U1M A;  4WP3 A;  4PUO A;  1UVN A;  4K4S A;  2H4W B;  3W61 A;  3GP9 A;  2JEI A;  2HHS A;  2L3M A;  4AL6 A;  1U49 A;  2GGP B;  2R3V A;  4ZVF A;  3O6Q A;  1JXL A;  3G9C A;  3DRY A;  1XMO J;  2OTL S;  2EVZ A;  3HO1 A;  3JTO A;  3O3L A;  4DPW A;  1FEH A;  2BQU A;  4LQ9 A;  2RRA A;  3GIL A;  2ZJQ Q;  4DL5 A;  2UVU A;  2CQD A;  4KKO B;  2HHQ A;  4O3S A;  5D3G A;  2Y1J A;  1RSC A;  1ZAV A;  5HL7 Q;  5DLG A;  1CLF A;  3H2L A;  2L48 A;  1JK9 B;  2OEJ A;  2R4F A;  1N52 B;  4OX9 J;  5JVG Q;  3RTV A;  1SL1 A;  1DLO A;  4UUX A;  2HS3 A;  5C5J A;  3BQ0 A;  3VGT A;  3UDE A;  2FJA B;  1DQ8 A;  5LXY A;  1X5O A;  1S77 D;  1R31 A;  5IQ6 A;  1M5O C;  4IUF A;  4ZIW A;  4UOG A;  1ACM B;  2LDY A;  2YNG A;  2VFS A;  2MQO A;  1FNX H;  4TY9 A;  2N4C A;  3QLH B;  5EWG A;  3AD7 C;  3BGR B;  1RZM A;  4MH8 A;  1X9S A;  4OYP A;  1XK8 A;  4A8K A;  1GXU A;  2C3M A;  4RUC A;  4YFU A;  2QMW A;  1G4C A;  4X4T A;  2Z4P A;  4FBU A;  4YOE A;  2HNY B;  2WCX A;  2OPR B;  3JTN A;  3M2V A;  3ULH A;  1FWP A;  3DDK A;  5LT5 A;  2XGQ A;  5DM7 Q;  3AA8 A;  1RCO B;  2YWK A;  2FHK A;  4MIB A;  2D41 A;  4NE9 C;  3TO8 A;  3G96 A;  3GON A;  1U1O A;  2RAQ A;  3D66 A;  3GFX A;  3OXL A;  4MYU A;  5AT1 B;  3J7Y U;  5D0H A;  2PC6 A;  3LPY A;  2BBE A;  5T7L B;  5AE2 A;  4NLD A;  4ZP8 A;  2ZNZ A;  1PBU A;  4M8L A;  1S76 D;  2RSQ A;  3MAA B;  4PWD B;  4B02 A;  2MXY A;  1MMN A;  3DI6 A;  2HVI A;  5HMW A;  1X4F A;  2NPF A;  1S1V A;  3UW1 A;  3JYT B;  4ED7 A;  2UUC F;  1YQH A;  2BW2 A;  2V4J B;  2ASJ A;  2JEG A;  1WTF A;  4I2P B;  4C9D A;  1VBX A;  1IBK J;  2X1F A;  1Y3J A;  2M5Y A;  4LRF A;  3C14 B;  4KBI A;  2ILZ A;  2MZR A;  2BW7 A;  3K8W A;  4G6V B;  3BBB A;  2HAI A;  2C22 A;  4BHQ A;  3R97 A;  2C28 A;  2DTJ A;  4O23 A;  2DGX A;  4NYP A;  1B64 A;  2ZH2 A;  4LIW A;  4FF4 A;  4IH5 A;  5KFS A;  2LKZ A;  4CLK A;  2V5H G;  4EUV A;  2QJ3 A;  1TKZ A;  3H5S A;  4J37 A;  4RX6 A;  3NGR A;  2VQF F;  2X7I A;  4OZ3 A;  2XCP A;  3EDR B;  1LOU A;  4HR2 A;  4LSN A;  5CQG A;  2OJ3 A;  2CQG A;  2LQ5 A;  3A1Y G;  3TAM A;  3A8I A;  2ROE A;  1RAC B;  2HFV A;  3RB4 A;  4RPF A;  3CCZ A;  1FJE B;  1SJQ A;  2RS8 A;  5DDR C;  1WC1 A;  5KFQ A;  3CE8 A;  3UI3 A;  3WBZ A;  2QV6 A;  5HVG A;  4F8R A;  1SB6 A;  1U0S A;  4NCG A;  4O4R A;  1NKC A;  3OLA A;  4F7V A;  2CNL B;  4L3N A;  2M2B A;  4N77 A;  1KQF B;  3OL6 A;  2G0C A;  1AFJ A;  3PM9 A;  3HFZ B;  3AHP A;  1SKS A;  3GE9 A;  4DQQ A;  1LFW A;  3I0S A;  3A3O B;  4RNM A;  1FRX A;  3D7S B;  3F41 A;  2V68 A;  4LBI A;  4OI3 A;  4RNF A;  1J2V A;  3DRR A;  4MIW A;  4F04 B;  2VFT A;  1U47 A;  1S6Q A;  4LSL B;  7FDR A;  3C46 A;  5C7P A;  3T3F A;  3AQP A;  5ADZ A;  3NAI A;  1WHW A;  2PSZ A;  2RQC A;  1X5P A;  4M1K A;  2C42 A;  2DRD A;  4ZHR B;  3TX8 A;  4EGL A;  1CJK A;  2PEB A;  3MR5 A;  2PMH A;  4OLO A;  5HQL A;  2QLJ B;  3R5C A;  2CAD A;  4WYW A;  3EVM A;  2HKE A;  1LV5 A;  2MMY A;  3DHW C;  3SCL E;  2IVY A;  3ZZ0 A;  1CJU A;  3I5A A;  3KK1 B;  3IFE A;  3F44 A;  4O3O A;  4EI2 A;  4Y0F A;  3OSP A;  2YNI B;  2IVM A;  3FQL A;  3WX8 A;  2NSC A;  3D4J A;  1SCJ B;  1X4G A;  1RT4 A;  3T5K A;  5J2P A;  2G0J A;  5CYM B;  3S8S A;  2AYB A;  5CAB A;  2CQ4 A;  3K17 A;  3N5B A;  2Y3Y A;  4RW7 A;  1MSW D;  2IJN A;  3PY8 A;  2VPZ B;  3N4W A;  3GV8 B;  5CD4 A;  1S0M A;  1T9W A;  1W7W A;  2OGU A;  2XWX A;  4WF9 Q;  3EVO A;  1NK6 A;  1RT1 A;  2DR5 A;  1FNO A;  1JLQ A;  4OQJ A;  2BV3 A;  2HIQ A;  3GJS B;  3PRV A;  2MQQ A;  3K58 A;  1D0E A;  3D6M B;  5AXM A;  1S9G B;  3VVU A;  2W2N P;  1M1H A;  2DHX A;  4RBT A;  5BXI A;  3T9N A;  4L6V 3;  2RVJ A;  1VQL S;  2FLL A;  2CJB A;  1EP4 B;  3JSM A;  2EFN A;  4Q43 A;  5G0R B;  4Y2C A;  4DSF A;  2IMW P;  3GSD A;  1RAI B;  4ZPB A;  1RT1 B;  1WEX A;  1RA6 A;  3TAN A;  2YNH A;  2KFY A;  4O4G A;  1EZZ B;  2L9N A;  3HMJ G;  1WNE A;  2PI4 A;  1Q5V A;  1YBT A;  1FNM A;  3C3L A;  3FMW A;  1GTE A;  4XTT A;  4RW7 B;  3TQE A;  1Q4R A;  1VHI A;  1MWZ A;  4XDD A;  2H5J B;  3TQ1 A;  1EIY B;  2UUB J;  2ROP A;  4A47 A;  2J0Q D;  2ZH9 A;  1I5O B;  4NLV A;  1U24 A;  2F8M A;  2C2E A;  2CIM A;  2IM0 A;  2FJE B;  2KM8 C;  2KO1 A;  1S0V A;  1BLU A;  3KLH A;  3IWL A;  4ECT A;  3K2Y A;  1UJ4 A;  3KK1 A;  3ZTO A;  4ZCL A;  2D9O A;  4MMO A;  3FCW A;  5DO2 A;  5A76 A;  4K0K J;  3H40 A;  2CJQ A;  1RYR A;  3H2U B;  1T9V A;  1RT6 B;  1V5I B;  2OEM A;  4G1Q B;  5GVQ A;  4JI5 J;  4Z7Y A;  4Q0B A;  5IT9 Y;  1X4E A;  5CD4 H;  2XMU A;  1RTH A;  3NBP A;  2V69 A;  4NZ7 A;  4XPE A;  3Q8R B;  2RU9 A;  5J2N A;  2BDP A;  1U2R A;  2UUA F;  4MK8 A;  4O3P A;  2EC2 A;  4F4A A;  2I38 A;  2DHG A;  3DRR B;  2RRN A;  4IFV A;  1DRZ A;  1YTY A;  1ZA2 B;  3OXG A;  3I0S B;  3OLB A;  2DIT A;  5CYJ A;  2VHG A;  4UT4 A;  1T11 A;  2HS4 A;  3O1L A;  2JRS A;  4DV1 J;  1DAR A;  4YDD B;  3TRG A;  4DDF A;  2EFQ A;  4Q45 A;  1M1K T;  2VG5 B;  1FDA A;  2RDJ A;  4NCG B;  1L3S A;  2UUC J;  1RTJ A;  1SJ3 P;  5LXR A;  3QGI A;  4O3N A;  1TL4 A;  1OIA A;  4NYO A;  2GJ2 A;  2ZUA A;  1IJE B;  4ZDN A;  1D8Z A;  2W7A A;  3BKT A;  3R5D A;  2Y9H A;  2JFD A;  1RIS A;  4ED5 A;  4ZN3 A;  1IKY A;  3BDE A;  3FDS A;  5KT2 A;  3OUY B;  1OQ3 A;  2EXU A;  1NO8 A;  1HHQ A;  3KG1 A;  4NX9 A;  1MRO B;  2CFX A;  3NWG A;  3FMB A;  4F0M A;  1KHW A;  4DV7 J;  4DSI A;  5DRK A;  4OHY A;  1RLC L;  1MW7 A;  5HMX A;  1WJ9 A;  2HFO A;  3O2I A;  3UNG C;  1KN6 A;  2BAN B;  4L3K A;  2BAB A;  4RWW A;  2H51 B;  2EPI A;  4O0N A;  3UVJ B;  1CUL B;  2HIY A;  2DPI A;  4M5D A;  5IWA J;  2HFZ A;  1NK5 A;  2ATL A;  3M30 A;  4X64 J;  1QTM A;  1NSK L;  4YB5 A;  2BQ3 A;  2CPH A;  4PXE A;  4ZIT A;  4ZLP A;  2XLK A;  1S1V B;  1NME B;  1YJV A;  1FEE A;  2GFF A;  2J5A A;  1HLW A;  4NOH A;  1GFW B;  3IWN C;  4PWD A;  5C24 A;  3SV3 A;  1K0T A;  3GV7 B;  3VAM A;  5T7L A;  3QBC A;  4DPY A;  5D3G B;  2K1R B;  1UEK A;  3MMC A;  3EDQ B;  4ECU A;  4LSZ B;  1B7F A;  5HMY A;  2RQK A;  2HVZ A;  3RBZ A;  3RB0 A;  3QO9 B;  5HLF B;  1FKP A;  4TU8 A;  2VDI A;  4CO1 A;  2JEF A;  1NLK L;  4KQZ A;  4ZLL A;  1QSY A;  4FBT A;  1FHT A;  2D1C A;  4A4J A;  5FJ4 A;  2ZNY A;  2ERR A;  4DL4 A;  2OPQ B;  4ID5 B;  5KFV A;  2GIQ A;  4PQU B;  2Z0G A;  2W2O P;  1S57 A;  1S7H A;  5HVF A;  1R0B G;  2J9E A;  3SDE B;  4YY3 F;  4QYZ K;  1WD6 A;  4TQR A;  1F0X A;  3QWU A;  3B8H A;  1RT5 B;  3HHE A;  2EEY A;  3MEE B;  3PJ9 A;  3DDN A;  3RAM A;  1FRI A;  4NRU A;  2OO4 A;  3UCZ P;  4O3R A;  1M0S A;  1TV6 B;  3FVY A;  3C6U B;  4IDK B;  1VRU B;  2YX7 A;  3ILJ A;  5ETK A;  2J7W A;  3WX4 A;  4ALZ A;  5E3C A;  1F2H A;  3X3U A;  1BY9 A;  3FZB A;  1CG2 A;  3UD4 P;  3GMG A;  4URQ U;  4DV3 F;  1WG4 A;  2QG9 B;  4LF6 F;  1HKA A;  2DIU A;  1RHR B;  4K4Y A;  5KFE A;  7FD1 A;  3WQP A;  3BSN A;  3LH2 S;  1HAR A;  1U8W A;  3MM5 A;  1PGZ A;  1F5A A;  4B08 A;  4N5S A;  2GVZ B;  4LFA J;  3K7R A;  4KFB A;  2DGU A;  1EET B;  2XMJ A;  3UN2 A;  2RU3 A;  4Q7A A;  4ED8 A;  4JV2 A;  2BEF A;  1Q79 A;  4PQA A;  3TZX A;  4B9T A;  1XNQ J;  3TUZ C;  1FJ7 A;  2DR7 A;  5CA5 A;  3SSQ A;  4P75 A;  2G9O A;  5F0W A;  3CCL S;  4DR4 F;  4PKD B;  1MNE A;  3B6B A;  2GCF A;  2YX1 A;  4ETX A;  5IV4 A;  2VOP A;  1U0H A;  4IFY B;  1RWK B;  2A2C A;  2EFO A;  2GNK A;  3AB4 B;  4P2X A;  4WII A;  1IVZ A;  2KT2 A;  4RW8 A;  3ET6 B;  1D8Y A;  2IYG A;  2JWN A;  1S48 A;  4IQM A;  2XI3 A;  2UVW A;  3DLL Q;  4LMZ A;  1FK9 B;  4F26 A;  3GIJ A;  3KTQ A;  1ZM9 A;  3KLG B;  2R2U A;  3IG1 A;  1KSP A;  3C15 B;  4GVL A;  4OMF G;  1VQ4 S;  2CPX A;  1R8H A;  2M3D A;  3GU0 A;  2HNZ B;  2IJF A;  2LQJ A;  1Q0N A;  3HSJ A;  3PEH A;  5D0G A;  3CJ0 A;  2NZC A;  1CJT A;  2GIR A;  2VZ9 A;  5KOW A;  4NI2 B;  2HFN A;  3RB3 A;  3K8V A;  1IKX A;  1YJU A;  3PRB A;  4JBC A;  3PYF A;  3K5L A;  2UUW A;  3G82 A;  1ZYQ A;  5A6W A;  3HF5 A;  1G6B A;  1TR0 A;  4OZ5 A;  5D0E A;  3GYG A;  2RUG A;  3FEY B;  1B70 B;  3OFG A;  3VGS A;  3IS9 A;  1XR7 A;  1U1K A;  3BS9 A;  3DOM A;  1G1X A;  3M2U B;  2NXC A;  2JLE A;  4WKR A;  1SXL A;  1YLX A;  4WK1 A;  2A1B A;  3D5M A;  3VZH A;  4R25 A;  4Y2K A;  4X4V A;  3PAC A;  4RW9 A;  2QZ8 A;  1RBL A;  1Y7P A;  1JMT A;  2YQ0 A;  3G8Q A;  3HKZ D;  1BD6 A;  4P9S A;  4ENO A;  4ZN1 A;  1U45 A;  3W60 A;  4CLS A;  4Q2M A;  1L3V A;  4HHJ A;  3X1L B;  3TVZ A;  1URR A;  4RO0 A;  2OTJ S;  1RT3 A;  3OR1 A;  1P27 B;  1Q8K A;  1RDR A;  1YHQ S;  2R8H A;  4PWU A;  3ILO A;  1ZPW X;  3GG1 A;  1HPZ A;  3ILI A;  4YY3 J;  3P45 B;  3QFW A;  4J9U E;  2PMZ D;  2GMJ A;  4R8U A;  3ZFV A;  5DG7 A;  4DWI A;  4DSE A;  2CPE A;  4QIF A;  1N36 J;  1N5S A;  5IOL A;  2LP4 A;  2WON B;  5D6G A;  3R7S B;  3PO4 A;  1VJQ A;  3HDS A;  2JL9 A;  2YBV A;  1YVF A;  2AJ4 A;  2IBK A;  3MM8 B;  3RR8 A;  1WAC A;  4HAC A;  3OL8 A;  1U09 A;  2Y0B B;  1VQ5 S;  2YKA A;  2ZE2 B;  3M8P B;  1BXN A;  1DTT A;  2PII A;  3DMJ A;  3NXZ A;  3TEG A;  3LW5 C;  2CDR B;  4R0E A;  2J9D A;  2ZH4 A;  3AJ2 A;  1SPB P;  2FZK B;  2NSB A;  3AFG A;  3DXS X;  2BE9 B;  1LWF A;  1RWM B;  2CNK B;  3U02 A;  2W2M P;  5CH7 B;  3BQ1 A;  4JI3 J;  1HYS A;  3HXM A;  3Q8V A;  4DZ6 A;  5KFA A;  2OUG A;  2K3K A;  2YWG A;  3HHK A;  2O01 C;  3RAX A;  1IR0 A;  1VC6 A;  1RKI A;  4I67 A;  1JKH B;  3KUG A;  1VK3 A;  3NGD A;  2DXF A;  2M4M A;  3HFK A;  1LWE A;  1R6V A;  3PYD A;  4O44 A;  4CO4 A;  5AE1 A;  5J2M B;  2YKM A;  3BPS P;  1JLE B;  1ITP A;  1VJW A;  3M9O B;  4D3G A;  3FBE A;  5L9N A;  4CO5 A;  3KMQ A;  3DYA B;  4FXW A;  4WK3 A;  1S9E A;  2V2K A;  3MCM A;  5B0G A;  4HEA 9;  2AP6 A;  1RHQ B;  3KK3 A;  2IAJ B;  2DH8 A;  1LFP A;  3DKD A;  3DLE B;  4NA2 A;  2XC9 A;  2CZ4 A;  2AYG A;  2OSR A;  2FC8 A;  1JLC B;  1SH3 A;  3IC1 A;  1OMS A;  3I4H X;  4TXS A;  3AXK A;  4XK8 C;  2Z30 B;  3UNY A;  4CLY A;  2OEK A;  1VQK S;  5KG1 A;  2HPU A;  4DEZ A;  5IFM A;  2ADB A;  3AXM A;  2HHU A;  3D28 A;  3QAT A;  1VHF A;  3HVW A;  4FVC A;  4CIO A;  4LFB J;  2EW9 A;  3AT1 B;  1UFL A;  3IMQ J;  4DSJ A;  2FQQ B;  5D4O A;  3S01 A;  4JI2 J;  4DR1 J;  1QSL A;  2NQP A;  1UWB A;  2IRU A;  2FVC A;  3MPV A;  3MTK A;  1QSS A;  3R2C J;  4IH7 A;  3QAE A;  3R5J B;  3JB9 k;  1U1R A;  3HZE A;  2HFU A;  2GIF A;  2G1D A;  2IBO A;  4KT0 C;  4E98 A;  1D9D A;  4DR7 J;  3M8R A;  5T41 A;  1B0V A;  4HHU A;  2W9C B;  1QJH A;  3BGO P;  3BV8 A;  3Q2S C;  3THP A;  1N6Q A;  4FF3 A;  4K2X A;  5BR8 F;  3N6M A;  3OHA A;  2RUS A;  3G6Y A;  1AUS L;  1HWK A;  3R8Y A;  3RW7 A;  2FVR A;  4QWD A;  3OTC A;  5K8P A;  3K0J A;  3CCM S;  3RR7 A;  3IRX B;  4Y00 A;  4TY8 B;  2CDQ A;  1B99 A;  1Q95 G;  4DMZ A;  2QSF A;  1TU0 B;  4DUZ F;  5E3A A;  3G4S S;  3NCQ A;  4F4K A;  2V8V A;  2ZDP A;  4DUT A;  3H5Y A;  4OX7 A;  1ZS6 A;  1SV5 A;  3D3C J;  3W1Y C;  3M1V B;  4DV0 J;  2IHR 1;  4G1I A;  4CCH A;  1S1U B;  5LMN F;  2R42 A;  4ICL A;  1RU1 A;  5KT6 A;  3T5J A;  2YY3 A;  1REV B;  3OVA A;  2KZZ A;  2HND A;  1ZET A;  2K06 A;  3BN7 A;  2ZWP A;  3EGV A;  1NHV A;  4KGZ B;  4KGX B;  3S7R A;  3HPO A;  2VA2 A;  2PO4 A;  2JLG A;  2FIU A;  4OJ3 A;  4IR1 A;  2DT9 A;  1S49 A;  3IO1 A;  1T7P A;  1QLN A;  2WVC A;  3D0I E;  3OQ2 A;  1RWP B;  2E66 A;  2VPY B;  4IH6 A;  3CUN A;  1QVG R;  1NJX A;  2KFZ A;  3I87 A;  2OFG X;  3DLB A;  3R2D J;  3BGL A;  2IIH A;  1N5T A;  4OI4 A;  4JI1 J;  2XS5 A;  1BHN A;  3OFH A;  2Z2M A;  5DDQ C;  3V81 A;  1T9X A;  2HFS A;  1OY6 A;  2QA2 A;  2YPZ A;  4ZS6 A;  4JI3 F;  1TMJ A;  3MFI A;  3W5Y A;  1V3R A;  1OYD A;  4B3S F;  4JI4 J;  4PWW A;  1FXL A;  1TMM A;  3HVT A;  2VH7 A;  2DGO A;  2GS8 A;  4RUA A;  3GYX B;  3SIP B;  1FWK A;  3BJY A;  5B0C A;  4N76 A;  4X4S A;  2JHE A;  3TJ8 A;  1HPZ B;  1XNR J;  4JV5 F;  3E01 A;  4Q5V A;  3NMA A;  3ZZT A;  3CMQ A;  1HWJ A;  3ISZ A;  1H3D A;  2A0F B;  4H4M A;  1FT8 A;  4KFB B;  4ZVH A;  2DNL A;  4I7F B;  4ED6 A;  3CDW A;  5CCL A;  2I2Y A;  2YWE A;  2W24 A;  3HFV A;  4G3I A;  4ZVU B;  3FSY A;  1NH8 A;  3MEC B;  2YKO A;  2W7P A;  2HVE A;  1HQE B;  1XMQ F;  4FKX A;  1KQS R;  1ELO A;  3MCS A;  1NB2 A;  4K50 A;  4KYZ A;  4HTJ A;  4XO0 A;  1HNX J;  3VWS A;  3B4D A;  2M8H A;  3DU5 A;  4MKB A;  4N41 A;  2NR0 A;  2LCW A;  4WFN Q;  4N8O A;  1NBE B;  4QIV A;  4X64 F;  4CH1 A;  3VCD A;  1BC6 A;  4I1T A;  4QWE A;  1RGV A;  1FKO B;  1Z1Z A;  2F9J A;  1NUE A;  2YKN A;  3UDC A;  1WEZ A;  2RML A;  4USI A;  3CCR S;  3JSB A;  3T5L A;  4EMD A;  1NSQ A;  3PKY A;  1HNZ F;  2R9L A;  1CJT B;  3VQT A;  4H4O B;  3RUB L;  4J9L A;  3UN3 A;  3FBF A;  4L73 A;  2GAH C;  4ZP6 A;  1RAH B;  1S99 A;  4JI0 F;  2NRE A;  4LF4 F;  4PCQ A;  4UOH A;  3C15 A;  4YHH J;  2IFX A;  3QYY A;  5I4M A;  3KLG A;  4KE5 A;  3BQ2 A;  1BQN B;  2LXI A;  2FY1 A;  4IRK A;  4C0B A;  3FRZ A;  5IM0 A;  5IT4 A;  1DFD A;  4EYI B;  2FHJ A;  4IFY A;  2VBY A;  4BDP A;  1WDD A;  8RUC A;  3QGP A;  5KFZ A;  2HHP A;  1C0T A;  3I5B A;  1RUS A;  2BJE A;  3AOD A;  1WKJ A;  2W7O A;  2XO6 A;  3C19 A;  5DZ7 A;  2R7Q A;  4EO6 A;  1TFY A;  3CJ3 A;  1WG5 A;  4M95 A;  1JJH A;  2OKQ A;  1ZAX A;  1R43 A;  2RRB A;  2XMT A;  2EFV A;  2D3Z A;  1U02 A;  3EIC A;  3H2V E;  1C1B B;  1ROF A;  3LP0 B;  2ALY B;  3NCR A;  3I9V 9;  1FO1 A;  4JI8 J;  3GR1 A;  1LW2 B;  4ECR A;  1J5E J;  3IM8 A;  1ZM2 A;  3OR2 B;  4HVZ A;  2Z2L A;  2RIJ A;  4ZJO A;  1N5Y B;  3BGU A;  1S1X B;  4CM0 A;  4C8Z A;  2E7W A;  3QAU A;  4YME A;  5A8W B;  2LEC A;  1WC4 A;  2Z56 B;  4CYU B;  2YTC A;  1TV6 A;  3D1O A;  3P8B B;  2D9P A;  4FVM A;  2V8H A;  5KFT A;  2AF6 A;  4QWB A;  4P72 A;  1YJW S;  4J9P A;  2LQB A;  4ZMM A;  3D1Q A;  3H20 A;  3RZA A;  1RTI A;  3K5N A;  2AD9 A;  3F0N A;  1U1L A;  2DH7 A;  2HHX A;  2L08 A;  4USW A;  1WSV A;  2QMU B;  3C6T A;  2WRM A;  3D6T B;  3HZG A;  1Y5I B;  2ACM A;  2YVS A;  2I9S A;  3PHE A;  4NLU A;  4WU3 A;  3N01 A;  4JI2 F;  3C6T B;  4X65 J;  1UFW A;  4ID5 A;  4GKK J;  2HSE B;  4R5P B;  3DCA A;  2HK2 A;  2WZ1 A;  4ECZ A;  3LWM A;  2AU0 A;  3W7B A;  9ATC B;  2POK A;  2B9X A;  4AFF A;  2NUU G;  3GLJ A;  4ZVE A;  2DIS A;  3MPW A;  3EPG A;  2VA3 A;  1BWE A;  4I68 A;  2MZQ A;  2V2Q A;  4NLS A;  2Q3P A;  3A4T A;  3BEG B;  3DGP B;  2K7J A;  3I32 A;  4QIE A;  4DQR A;  2XUL A;  1B0P A;  1WWH A;  3IXQ A;  2BAC A;  2XYP B;  1FFS B;  4LBP A;  1K9M T;  2PA3 A;  4GO5 X;  3CCJ S;  4ELV A;  1PJ5 A;  3BYR A;  4ZCI A;  4OLP A;  1ZM4 A;  2DXD A;  2DIV A;  2FTR A;  1KON A;  2BJ9 A;  2KYZ A;  1K44 A;  2MZJ A;  3NRB A;  1VMB A;  4H4K A;  3CDU A;  4P52 A;  4PAA A;  3J81 j;  3Q8P B;  4LVN P;  3ILL A;  2BE2 A;  3RB6 A;  3BDP A;  2ZH7 A; 
#chains in the Genus database with same CATH homology
 4GKJ J;  4OX9 J;  1N36 J;  4JI6 J;  3J80 U;  4X62 J;  2F4V J;  5A2Q U;  4KYZ A;  4B3T J;  1HNX J;  4JI3 J;  4NXN J;  4DR6 J;  2ZM6 J;  4DV6 J;  4B3R J;  4DV5 J;  3J7A N;  2HHH J;  4KY3 A;  3J81 U;  3T1H J;  4DR2 J;  4NEY A;  4YHH J;  4JV5 J;  5LMN J;  3OTO J;  4AQY J;  2UUB J;  2UXD J;  1HR0 J;  4LFB J;  1FJG J;  4B3S J;  3IMQ J;  4JI2 J;  4RJV A;  4DR1 J;  2MTL A;  4LFA J;  3R2C J;  1IBK J;  4LF7 J;  4DR7 J;  2MQ8 A;  4K0K J;  2MEW A;  4HHU A;  4DUZ J;  1XNQ J;  1N32 J;  4JI5 J;  4JI8 J;  2UXB J;  1N33 J;  4NEZ A;  1J5E J;  2KL8 A;  4DUY J;  4B3M J;  2UUA J;  3JAM U;  5FLX U;  4JYA J;  4DV4 J;  4LF9 J;  3D3C J;  4DV1 J;  3W1Y C;  2VQE J;  5LM7 E;  4DV0 J;  5BR8 J;  4KHP J;  2UUC J;  5IT9 U;  4DR4 J;  2VQF J;  4X65 J;  4GKK J;  4JI0 J;  5LMU J;  2KVQ E;  4V1A k;  4LF5 J;  4NXM J;  2UU9 J;  4DR3 J;  4LF4 J;  1N34 J;  3R2D J;  4JI7 J;  4DV7 J;  4DV3 J;  4LF6 J;  4JI1 J;  3D3B J;  4DR5 J;  1HNZ J;  4DV2 J;  3T1Y J;  4LFC J;  1HNW J;  1IBM J;  4JI4 J;  4PWW A;  1IBL J;  1XMQ J;  2UXC J;  5IWA J;  1I94 J;  4X64 J;  1XNR J;  4YY3 J;  4X66 J;  2E5L J;  4LF8 J;  1XMO J;  5AJ3 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...