4JI5O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 35
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4ji5O00
4B3RO 4DV2O 4DR7O 1HNWO 4GKKO 1XNQO 4DUZO 4DV5O 1IBMO 4JI5O 2FKXA 3J81N 1J5EO 5IT9N 1AB3A 4YHHO 4OPAA 1FJGO 4LF7O 2VQFO 1YZBA 1N34O 2UUBO 4JI4O 5LMUO 4X64O 4DR6O 1N33O 4X66O 4DV3O 4B3MO 4A5UB 1R6TA 1KUQA 2JRIA 1HNZO 3M8AA 3R66A 5BR8O 1HNXO 4JI0O 4NXNO 4JI7O 1FYJA 4DUYO 4B3TO 5FLXN 2Z0AA 2UXDO 3O65A 1IBLO 3JAMN 4JYAO 2F4VO 1NS1A 4LF5O 3SDLA 4LFAO 4JI1O 4JI6O 1HR0O 4NXMO 1G1XB 3T1HO 4JI8O 1XEQA 5LL6Y 5IWAO 4X65O 5BXZA 1I94O 1R1BA 3J7AU 4DR4O 4OPHA 2UXBO 1DK1A 4LFCO 4X62O 5BY1A 4LFBO 4JI2O 1N36O 3F5TA 4DR5O 2UUAO 1XNRO 1N32O 1IBKO 1D2DA 1XMOO 4DV0O 2AGAA 4LF4O 4LF6O 4K0KO 1XMQO 1AILA 5A2QN 4LF9O 5LMNO 4DR2O 2DOSA 4B3SO 4DV6O 3J80N 2LW7A 3T1YO 2DJVA 4GKJO 2UXCO 4DV4O 4JV5O 2E5LO 1FKAO 1F7YA 5H5NA 4DV7O 4DR1O 4LF8O 3OTOO 2UU9O 4DR3O 1A32A 2HHHO 4JI3O 3RT3C 2VQEO 2ZKOA 2N74A 4DV1O 1X59A 4KHPO 4AQYO 2ZM6O 4YY3O 4OX9O 2UUCO
chains in the Genus database with same CATH superfamily
2VWJA 4I4TA 3K79A 2QWOB 2ZINA 1S72V 5B1NA 5IDJA 3CCSV 3J81N 1F51A 5IJ9B 4LF8B 1GM9A 3CMAV 3BAAA 1IXBA 4UVAA 1CPYA 2Q7EA 1P4RA 1KKCA 5L3FA 3KG2A 2ZQMA 5LP6B 3THOA 1P7GA 3AEIA 3RGBA 4FZ0A 3CC4V 4XBFA 3B8NA 1BZKA 1R6NA 4IHJA 4W4LA 2UUBB 2FMLA 2RNBA 4O2BA 3SPIA 1SQPH 4UCUA 1AR1B 4EFBA 3DSQA 4JAUA 1TAEA 3K5NA 3BABA 4LFCO 4WFFA 1YITV 1MNGA 1N36O 2EIKB 5LHGA 4HNAA 3AK3A 3ABLB 4J9ZB 1M5IA 2N04A 4LF9B 1XMQO 5A2QN 4HAMA 3B40A 3T1YO 4K8XA 2UXCO 4TOIA 3H1IH 1XHZA 3OTOB 3P3PA 1TUBA 3CC2V 3ZRWB 1WNSA 4H37A 5KUMA 4UCOA 4WFAV 4GX2A 2OCHA 2BTQA 1NI8A 1PNMA 4DK1A 1V55B 1NKDA 1HNWO 4O4LA 2PTMA 1VQKV 4H33A 2FKXA 4Z2WA 4ASUG 3WFVA 2W0FC 4YHHO 4F6RA 2QR4A 5B1AB 1JJ2U 3A2FA 1YZBA 1E1QG 4NTXA 4B3MO 3ZS8C 3SYCA 5C8YB 5KMGB 1BQZA 3AG3B 4YJ2B 2XNDG 2IW5A 2ADPA 2P22C 2YIDA 3M7MX 4MVOA 3STZC 1KKDA 1I5YA 3T2MA 1FYJA 2CGOA 2EJ7A 4B3TO 3JD4A 4EEQA 1YI2V 3K5MA 4JYAO 5FPOA 3HKCB 3SYAA 2QM7A 3QF7A 1GN6A 2P67A 1I94B 4QNHB 3N2KA 3G6BA 1BT8A 3GVMA 2WLIB 1PKXA 3E89A 4R8CA 4U3JA 4YIPA 4HBNA 1OCRC 3CXHF 1DK1A 3STLC 4ZI7A 1K33A 3TGUH 1LNQA 1KYOF 2UUAO 1KECA 1Q6HA 1Y74A 4O2AA 1M57B 1PL0A 2IM9A 3B2EE 5JVDB 1B3QA 1FAFA 4MTOA 4X1YB 2Q8VA 3GB7C 1DLBA 5LA6B 2Y69B 3OGIB 3FB6C 2OIEA 3CB2A 4DV7O 1N36B 4FZ1A 5EYPA 1K73W 4YJ3A 4X1IA 4NB5A 3EFFK 3ETQA 2ZD9A 2UUCO 1XHXA 3T1YB 3S3WA 1ZL8B 2UXCB 4RUEA 3RN4A 3G67A 3HKBB 4DUZO 1I7FA 5H9CA 5KHKA 4JYYA 5GONB 1X4TA 5F2VO 2E75B 2B5UA 4BW9A 2WLNA 2IU3A 4RQEA 3H01A 5LMUO 5K1XA 3IC9A 4O4HA 3CWBH 2B1GA 2XT9A 4JTDB 1KP2A 2DE0X 1EZJA 1R6TA 1Q81W 5HFMA 3ZN1A 3BCCH 4PELA 1EM1A 2JEUA 1ZAUA 3KCYA 2DQ3A 4PA3A 2JJ2G 4YHHB 4H0LB 2EILC 1NT2B 3WB1A 3VOUA 3JARA 4CC5A 2IJJA 3ABTA 2LW1A 3E8FA 4O2BB 1Y76A 4JI6O 2ZT9B 2LFRA 1NVPD 3T1HO 1VQ9V 5IWAO 4X65O 1QR8A 1SC5B 1OCZB 1SF9A 2LGQA 2ZDIA 2A9HA 4O4JB 3D3IA 2KQXA 4B3TB 4CBCA 2LJ2A 5BY1A 4JYAB 1TVKA 3QNEA 3ICXA 1QVFU 3AG2B 4DV0O 3AK2A 2QSAA 4LF4O 5CBHA 4DV6B 2JGDB 2GSMB 5IJ0A 3RYFB 2VRZA 2PI4A 3DGEA 4YIOA 3U11A 1ZUQA 3HKEA 3A0HZ 4IIJA 2E5LO 5ITZA 4J7KA 3OD4A 4MTFA 1K4DC 3OR6C 1TUBB 2Z5UA 4KHPB 3RW0A 3HKDA 5EZYB 4YY3B 3H1HH 3E8BA 1WAZA 1L0LH 2LQTA 4NKGB 3BPZA 2C2AA 4E2LA 1L8DA 3QO5A 1XNQO 1THZA 1J5EO 5L3EA 4DV7B 2UXXA 4I55B 3E22A 1FPOA 1AB3A 5D5PA 1K9MW 1N33B 2IJIA 3LSSA 1N34O 4K8ZA 4X64O 3CE2A 5TISZ 4F6RB 2Y4TA 4KUMA 2QGNA 2X7RB 5J2TA 3P30A 1KUQA 3W7XA 4FLWA 3ABKC 3UT5B 1S5HC 4DUZB 1NR7A 4X1KB 1D5NA 4TQDA 2UXDO 3CCEV 5LMUB 1Q6UA 1WPBA 3ETGA 4JI8B 2K1EA 1CP9A 4BR6A 2GDSA 3ASOC 3UCSC 2RDCA 3CHXA 2JJ1G 3LSQA 2YIAA 3K06A 2VWKA 1KU9A 4R7CA 3TXSA 3BHPA 5KHGA 4DR4O 3E2EA 1CEZA 3K5OA 4FFBB 2ZR3A 3JALA 4LFBO 2DQ0A 4P2ZA 3K9SA 4Z1MG 1XMOB 4ZI7B 3ZHUA 5DECA 4FLTA 3OMNB 2YIBD 4MVMA 1KBHA 4C7UA 3IAYA 4B3SB 3WB0A 5IWAB 2JS5A 3ZX6A 1EZVH 2Q0AA 5KHJA 5LMNO 4DR2O 3UO2A 2XHBA 3CEIA 1YJ9V 3DXRB 2IH1C 5L3BA 4DR1O 1OCCC 3UO3A 3QVNA 1FXKA 2YS8A 3E86A 3G80A 2KG7B 4LF4B 1JJOA 4PA9A 1LR1A 4KXRA 3R65A 1K34A 4YJ3B 4B3RO 2CK3G 1N0JA 4HYOA 3HR0A 1QBZA 4ZOLB 3VBBA 3AG1B 4WFHA 2E5LB 3H1JH 1UFIA 4FIPC 4DW0A 1SKVA 2XAFA 5DN6G 4JI4O 3AK1A 1W2BU 5LP6C 4PDRA 4DW1A 5KLVH 3ABMC 2CDYA 1XNQB 3RYIA 1EN6A 1J5EB 4QJFB 2XAJA 3ZCCA 5L3CA 2PYJA 2ZXWB 3T1CA 4UCTA 4X64B 3IFXA 4G28B 4PHZA 3SDLA 3JD1A 2JS3A 1SETA 4FFKA 5KAFZ 1H8EG 5JJJB 2B1IA 3JCUZ 2DW4A 2CAZC 5EC2C 2IU0A 2QEXV 4OPHA 4Z1VA 3ABLC 1K4CC 5EBLC 3F5TA 1XNRO 4X20B 4WBNB 3CCVV 2Q4PA 4J80A 4WCEV 1AILA 1NZ6A 2DN9A 4ZHQB 4I0XB 4LF9O 5KA5A 1DTOA 3FFQA 2ILMA 2V1DA 3RVZA 2BSKA 1B06A 4LH7A 3ZMTA 4DRXB 3OE7G 1O9GA 2DWDC 2CE4A 3OTOO 1Q86W 4FM1A 3L70H 1A32A 2RCVA 1SQVH 1KMIZ 2WLLB 4WFBV 1V55C 3G4SV 2LO1A 4DR2B 4RO2A 1QNMA 5B3SC 4JI5B 1M56C 3DC6A 5B1AC 1F4NA 1H38A 3JATB 4OPAA 1YJNV 4F6EA 3E22B 3AG3C 3OW2U 2WLMA 5EIBD 4QIWF 5BMVB 1OCCB 1BHAA 3JD3A 4MW3A 2EIJC 5JCOC 1K7DA 1IVSA 1M90W 4MT8A 5B1OA 4JI7O 2Q0OC 2GUZA 4DUYO 1PD3A 1L0NH 4JI4B 1IBLO 3SYPA 1GN2A 3JAMN 3NXSA 5LOVA 2Q7HA 4TUYA 5JJNB 4NTYA 4FK5C 1MSWD 3MHSC 2P7TC 1AI5A 1ZWIC 1G1XB 3A0BZ 3W7WA 1I94O 3ZMUA 3VQWA 3ABMB 3BRCA 3SR2C 1PL4A 5BZBA 4JI2B 1OJHA 5FNVA 3JASA 2ZNIA 3O9OA 3RVYA 4DR5O 3FKSG 1M57C 1RSOA 3JALB 2CUGA 3ML0A 2O57A 4LNUA 4J7ZA 2QM8A 4J7JA 5CB4B 2Y69C 4FMTA 3CCUV 1FD9A 4DXWA 1AROP 1FXHA 2DJVA 1J95A 4GCZA 4D6TH 1Q7YW 3JD0A 2HVKC 4LWSA 3RBZA 2K9PA 5CA1B 4UV9A 2H8PC 3IGAC 1P49A 1QQCA 3CMEV 3G71V 1XNRB 1AJQA 2F95B 4FM2A 4JI3O 3RT3C 1R3KC 2ZM6B 4FLXA 3CD6V 4WFGA 1YF2A 4DV1O 2YIBA 3L75H 3APQA 2JEXA 2ZIOA 3MD0A 1BCCH 4GKKO 1WA8B 1JR9A 1JFFB 2YEVA 4TV9A 3U0ZA 4FM0A 1DF5A 3K04A 2WLHA 3ZHQA 3LNNA 1FJGO 3CCLV 3OR7C 5H6QA 1I0HA 1IDSA 2ZE8A 2HFEC 5J2UB 1FS0G 5BR8B 1VF6A 4WFEA 4EB6B 2A0LA 1SS3A 2V7QG 4P9PA 4J9YB 1KQSU 2A06H 3FB8C 1GN4A 2QM4A 4JPRA 5FPRA 4JI0O 4NXNO 3Q4HA 4J41A 5B3SB 1ZTEA 4XDJA 2HEPA 3W7TA 1NH2D 1M56B 4NR1A 3LDCA 1URFA 4G27B 2CTPA 1S0VA 4NXMB 2Y48A 1K5QA 3TETA 2OCCB 1OCZC 1BS3A 4PA6A 5JH7B 1GTOA 3H9VA 3CS5A 4JI7B 3J7AU 1BL8A 3CRAA 4I50A 5CN0A 2EIJB 4DUYB 1JX9A 4EFEA 2ITCC 1IBLB 4FVMA 3AG2C 2NN4A 5J9PC 3TK1A 1XL6A 4QPJA 4UCSA 4DV6O 1VQMV 4I9WA 1EN5A 4UCRA 5IY5B 1NVPB 4FJCC 5IYZB 1PNKA 3SPCA 4R6ZA 2BTOA 2WSSG 3VQVA 4DR5B 2YXYA 3K0GA 2XASA 2AW9A 4KHPO 2WLKA 5CA0A 4YY3O 1GAXA 2P5OA 2P90A 3JAWA 4H13B 4GT1A 3RYCA 1XL4A 1YXBA 2HP8A 1KP3A 2R9RB 3K57A 4X88A 3DC5A 1QLEB 1VARA 1R3JC 1K92A 4O4IB 5CMUA 4JI3B 2LFSA 3W7UA 1N33O 4G2KA 4DV1B 3OMIB 2X6CA 1HNXB 3CJHA 4GKKB 5DEDA 5IE9A 4I7ZB 1S3JA 1EBOA 2CH7B 2KSDA 1VQPV 4I4TB 2RQ6A 1FJGB 1NQTA 3L71H 2R9IA 1FFXA 4FLUA 4FPPA 2BOCC 1G6UA 4JZGA 4LF5O 1MG1A 1S5LZ 2DYSB 4LFAO 1WP8A 1H2KA 4JYCA 1O9HA 4TUYB 4JI8O 3FD9A 5EK0A 3CRMA 4ICGA 4JI0B 4NXNB 4YXWG 3ZRSA 1SQXH 4CS3A 1YSCA 4X62O 3SJCC 1N32B 5FNVB 5LGTA 3BFRA 1XMOO 4IHJB 3HPLC 1SQBH 2WLJA 4RWUA 4QE9A 2L6LA 4B3SO 2P4KA 2OTLV 2Q73A 2LW7A 4LCUC 5LXTA 1XILA 1YDXA 3ABUA 1IX9A 2WWWA 1FKAO 3T4DA 2M7WA 2PY5A 3SPGA 4LWSB 4TSFG 3CX5F 1P84F 1Q8IA 3ZRXA 1Y66A 1AP5A 2XAQA 4GYCB 2E74B 1K5SA 4HNAB 1VF5B 3AG1C 1YTFB 1SZTA 4UV8A 3L74H 2BE3A 2Q69A 3I55V 1WB8A 4LP8A 1H2MA 1VIBA 1VQOV 1TGOA 3OUFA 4U3FH 5GW7A 3CC7V 2JK5C 3N27A 2JIZG 4PDVA 1M9NA 1MZFA 4P30A 3ASNB 3M8AA 1R73A 3C3TA 3ETDA 2DYRC 1ZX3A 2BTQB 3OEEG 4ZKIA 2ZXWC 2RMKB 1BGYH 3Q4HB 4O4LB 1QU7A 3BA8A 3O65A 2YICA 4RQFA 5KX5A 2CTQA 3BA9A 1R3IC 1HR0O 3NR7A 1Y4MA 2KB1A 2XUMA 1L1FA 5LL6Y 2QKAA 1NR1A 1NJIW 2OT5A 4J10A 3N2GA 4J42A 3S3XA 2UXBO 5JQGA 1SA0A 4JTAB 2QTSA 2RN9A 5B1BB 3JAKA 2EIMB 4NYKA 4LF5B 1GKFA 3RYHA 4LFAB 4PV1B 2QWRB 2WA3A 2HLDG 1BHBA 2W6IG 2P4VA 3J80N 5IJ9A 3N2KB 4DV4O 4X62B 3QO8A 4U3JB 1GK9A 4CH3A 2NLJC 1D5AA 2IBZH 3T4ZA 3SPJA 4PDMA 4UCVA 3A0RA 1XOUA 2VQEO 4CZZA 4AQYB 5LP6A 3CRQA 1YIJV 4OX9B 3OT7A 1S5JA 4MVSA 3EHBB 3QO7A 2P06A 1GM8A 3FB5C 1Y74B 4W4KA 4O2AB 3ZMSA 4KFMA 2FB5A 4DV5O 4JI5O 1AVMA 1RPRA 3D36C 2EZPA 2XAHA 4PD4F 3WU2Z 1TA8A 1M93A 4A5UB 5EYPB 2OYQA 3E8HA 1HNZO 3LNMB 4X1IB 4PDLA 4FLYA 4AHCA 1JCHA 2FTKA 2ZR2A 4IYIA 3H1LH 1BQ0A 2PUSA 3PN1A 3WG7C 2HVJC 1M1KW 2F4VB 4IT5A 2D3OW 2AHYA 2QWPB 5LBQA 1Q43A 4K35A 1VQ7V 1FXVA 5JJEB 4FLVA 1MOFA 4O4HB 5L3DA 5BXZA 2QWQB 1T5EA 1US6A 1XBLA 1Q90D 3ZRWA 2ZCEA 1JQ0A 3CP1A 2AZ2A 2DYRB 4JI2O 4BAYA 5KHHA 1IBKO 1W59A 4QPKA 3ZIAG 1HR0B 3JARB 3VQYA 3QTCA 4I5SA 2DOSA 2PI5A 4OXSA 1Y76B 1ZLZA 2PF4E 2UXBB 1IZ3A 1EFRG 2YI8A 4CS2A 5LXTB 5H5NA 5L3GA 1YEWA 4DR3B 3MAQA 1F23A 5C8YA 3OUSA 3SJAC 5KMGA 2QJ1A 3MHHC 4YJ2A 1OHHG 3CXCU 1TVKB 3X2QC 2ZM6O 4PA7A 3JCZA 3A8TA 4PA4A 4CH6A 2ARHA 3OTFA 4DV4B 2GBOA 1HWYA 4Q20A 5IJ0B 1HP8A 2YXHA 2YI9A 3HKCA 4LF7B 2AZ0A 5B5EZ 1OCOB 4X66B 3HKEB 4IIJB 1E1RG 4JZ2A 2VQEB 4KL1A 2Z3YA 4AI8A 5ITZB 3OFNG 5LGUA 2QTOA 1S77D 3F7YC 1XI1A 4JGSA 1K8AW 4TT3G 2YUAA 2ZE6A 2YDEA 1JA8A 1LUVA 3HKDB 5BR8O 2QKSA 2B9ZA 4K3AA 4DV5B 1SESA 1SQGA 2F1MA 2MW2B 2RJZA 2QKCA 3UQ8A 3CPWU 2OCCC 2EX3A 4GX1A 3OEHG 4JYBA 4X1YA 4NXMO 1HNZB 1QR9A 5LA6A 3OAAG 1NTZH 2JDIG 5IYCO 4MVUA 5J2TB 2CTRA 4BIUA 2HJDA 1YHQV 1H2GA 5H6RA 2NR5A 2ZNJA 5LYJA 3K0DA 3SYQA 2YSUB 1SA0B 1N0NA 3JAKB 3WG7B 1RM1B 2ADQB 2AGAA 5KA6A 2FL4A 1ZL8A 3ZEDA 3HKBA 4L8JA 5IY5C 1MSDA 5GONA 3HB3B 4GKJO 4BIZA 2Y4UA 3M99B 1BMFG 2UU9B 4MS2A 2HHHB 5EBWC 1W0JG 1IBKB 3EXAA 2F66C 4DV2B 3P32A 1GH6A 2IJKA 3K58A 2HR3A 1IBMO 1QLEC 3ZHVA 2EZOA 1R6KA 2Q6AA 2VQFB 1VEWA 3SJQC 4UVCA 3FAVA 2BOBC 4DV3B 1WB7A 2EJRA 2NNUA 1MABG 1I5XA 3FB7C 3CSXA 2R70A 4BW5A 3CCQV 2EINB 2Q67A 4RAIA 3EVKA 1FXKB 4LC1A 3K9AA 4O4JA 2QWNB 3E35A 1HNXO 3X2QB 1K97A 1K3EA 1Y6XA 2W6JG 4GX5A 2PYLA 1AI7A 2DYSC 2JGDA 2EULA 1AJNA 1SRYA 3RYFA 4L87A 1AR5A 5A9GA 2GTSA 3TXQA 1R1BA 1Q3EA 2CGNA 4MW8A 4IYHA 1W0KG 5CA3A 5KHIA 3RYIB 1DF4A 1RP3B 5KUKA 4LBEC 5EZYA 1H2SB 3AG7A 1PNLA 1R3LC 3B4SA 4UUJC 4LF6B 1N32O 2X6BA 2PGGA 3QG5A 4QE7A 1Z5WA 5EBMC 3PJSK 4I55A 5EC1C 4B7KA 1NTKH 4D7TA 2ETNA 1GO3F 2R9AA 3BY6A 1V9PA 1IURA 3I56V 2ATKC 3UT5A 2Y0IA 4X1KA 4NTWA 4GKJB 1VMGA 4ABMA 1VQ8V 1F4MA 2M6YA 2DWEC 5LHIA 1JPXA 2Q7GA 2BSKB 1Z2GA 2UXNA 5E79Z 5C93A 1DGSA 3ASNC 4IGGA 1BSMA 1VF6C 4JASA 2A79B 4F4LA 3JSNA 4E4EA 4FFBA 4GX0A 2QE7G 1IBMB 1KB9F 1OZ0A 3K3WA 3K08A 1H8HG 2L35A 2Z0AA 1MA1A 4EKWA 2Q5ZA 4JI1O 3CYOA 3G6EV 4MVZA 1VQ6V 2ZE7A 1QLNA 3DXRA 1EN4A 4U7OA 1GMGA 3ZMVA 4LFCB 5B1BC 3OMAB 3SJBC 2EIMC 2EBOA 1AJPA 2GHYA 4TQFA 5GTIZ 3AG4C 2KG7A 2JGUA 2GUZB 4D7SA 2BCCH 4R50A 5LYJB 3W7SA 5AG2A 1XMQB 4CH4A 3BVOA 1OV9A 4ZOLA 4N23A 5LOVB 1XQ8A 4ZBMA 2OTJV 1P7BA 2F23A 4N21A 1RFYA 2XAGA 2XTAA 3I5DA 1VQLV 4UFZA 3JASB 2LP7A 2N74A 1B04A 4LH6A 1V54C 1RSOB 4AQYO 1VQ4V 1S76D 1HNWB 4OX9O 2HG5C 5KAIZ 4GUNA 4LNUB 4DR7O 4I9QA 4XDLA 2XOKG 4CS4A 3GWKC 5IT9N 1Z5VA 1U97A 4DO2A 4B3MB 4CC6A 3L73H 3FAVB 1SQFA 5K1PA 3E83A 5IYDO 3TJTA 3D8CA 3K03A 3R66A 1RPOA 3L9DA 2HJFC 1VP7A 3IC7A 3VQXA 4X20A 4WBNA 5FLXN 2YEVB 4TV9B 3ZMZA 2F4VO 3P3NA 4ZHQA 2R72A 5LHHA 4I0XA 1TUEB 4X89A 5EIBC 1VF7A 1BE3H 2ZE5A 5IYBO 1XEQA 2A7WA 1KD1W 5LGNA 4DRXA 4X8AA 1JVMA 3F7VC 3APOA 3H1KH 3ZBHA 2UUAB 2GTAA 2WLLA 1OCRB 1AP6A 2F43G 4AILC 1AI6A 4JI1B 1NBMG 1YVWA 2V4DA 2YC0A 1Q82W 3ZHTA 2QDOA 3B09A 3LSUA 4Q6GA 1CXZB 4TV8A 1WLEA 2DMXA 2ZDIC 3JATA 3FYEB 1VQ5V 1VQNV 4JV5O 2YXLA 1WP7A 1UPGA 3WB2A 3ZRVA 1F7YA 4I50B 3D36A 3D3QA 5BMVA 3K5LA 4DR3O 2WAMA 4MSWC 3AG4B 3CCJV 3U10A 1H2LA 2H94A 4UB8Z 2UUCB 1WPXA 1ENVA 2CTWA 4JAVA 1M4UA 2PZSA 2X0LA 1N8RW 2G38A 2X6AA 2ZIMA 4NVPA 4DYLA 5FL7G 1OCOC 2D2CB 2HKOA 3SPHA 3SGIA 5CBFA 4IL6Z 2WPDG 4LF7O 4MTGA 4DR6O 2H3OA 2FYUH 4X66O 3DTUB 2AHZA 3KCXA 2IH3C 3K59A 3CCRV 3ZHSA 4DR7B 4OGQB 2JRIA 2F93B 3ZN0A 1WJZA 4RUFA 5CA0B 4MTXA 1V54B 4B08A 3JAWB 1G4YB 1MZEA 1FFTB 3RYCB 1GRJA 1ZSPA 3CCMV 1U96A 2EILB 3IJ4A 1YTFD 3BEHA 1GN3A 3JD2A 5GTHZ 4JI6B 1PV0A 2IJHA 3RFRA 5CB4A 3T1HB 4X9QA 4X65B 1YCIA 1E79G 5CA1A 1I08A 5DM6V 1LUWA 3CJHB 3LDEA 1NTMH 4LR3A 2E3CA 4TWKA 1RM1C 3MDSA 4DV0B 3OM3B 3B77A 1FFXB 4K0KO 1WA8A 1JFFA 1XREA 1G8MA 4JTCB 1XDCA 4DK0A 1IXMA 4BIOA 1PPJH 3FX7A 4LF8O 5J2UA 3L72H 1COWG 1HW7A 3GWOA 2UU9O 1UJWB 2HHHO 1ROPA 4EB6A 1WN7A 2ZKOA 1JOYA 4U7NA 1QHTA 3OGCC 1GM7A 4DV2O 3ETEA 3UM7A 3C3SA 4CH5A 4JV5B 2OWOA 4P9OA 1JMKC 4JAAA 1N34B 4MVQA 2VQFO 2EINC 2UUBO 3E8GA 1FXKC 1SZXA 5JH7A 4DV3O 4B7EA 5B66Z 1MMMA 2WA4A 4KP4A 3F5WC 1AI4A 1Y67A 3CRCA 5JCOA 2VS0A 2E76B 4QGPA 4BWAA 5CBGA 1HDJA 3ABKB 1PP9H 2EIKC 1QVGU 2UXDB 4JF3A 3FYIB 4H44B 2AXTZ 2KKWA 3UKMA 2W0XA 2LGWA 4FLZA 2GV9A 3B8MA 1AR4A 3CRRA 5HFLA 4DR6B 4PI0A 1NS1A 1H2NA 2OIGA 3KKYA 3KZIZ 4MVRA 1SQQH 5H2FZ 3SYOA 2WLIA 5D5QA 4WF9V 4PJ0Z 5IYZA 1SERA 4DR4B 1Q5OA 2QA4V 3ASOB 4HZ3A 1YJWV 5E1AC 1XUQA 1B6QA 4J11A 1PM9A 5JWPA 4LFBB 3JYCA 1QCEA 2Q9LA 2JVDA 2P6JA 4GLXA 4UB6Z 1NU1H 3LUTB 1D2DA 3JSLA 5JVDA 4LF6O 5LMNB 4XDKA 1KC8W 1ORQC 5KX5B 2MK3A 4GZRB 4UVBA 3RWRD 3C90A 4TV8B 2N05A 4O4IA 4DR1B 1Q6IA 2ITDC 3TCUA 3ZJZA 3ZHRA 4ZIBA 4PI2A 4UXNA 3LDDA 1N4CA 3N2GB 2ODMA 5JQGB 4K0KB 1NH2B 2Y0PA 3RYHB 2A3QA 1X59A 4B3RB 2CH7A 2Q68A
chains in the Genus database with same CATH topology
4B3RO 4DV2O 4DR7O 1HNWO 4GKKO 1XNQO 4DUZO 4DV5O 1IBMO 4JI5O 2FKXA 3J81N 1J5EO 5IT9N 1AB3A 4YHHO 4OPAA 1FJGO 4LF7O 2VQFO 1YZBA 1N34O 2UUBO 4JI4O 5LMUO 4X64O 4DR6O 1N33O 4X66O 4DV3O 4B3MO 4A5UB 1R6TA 1KUQA 2JRIA 1HNZO 3M8AA 3R66A 5BR8O 1HNXO 4JI0O 4NXNO 4JI7O 1FYJA 4DUYO 4B3TO 5FLXN 2Z0AA 2UXDO 3O65A 1IBLO 3JAMN 4JYAO 2F4VO 1NS1A 4LF5O 3SDLA 4LFAO 4JI1O 4JI6O 1HR0O 4NXMO 1G1XB 3T1HO 4JI8O 1XEQA 5LL6Y 5IWAO 4X65O 5BXZA 1I94O 1R1BA 3J7AU 4DR4O 4OPHA 2UXBO 1DK1A 4LFCO 4X62O 5BY1A 4LFBO 4JI2O 1N36O 3F5TA 4DR5O 2UUAO 1XNRO 1N32O 1IBKO 1D2DA 1XMOO 4DV0O 2AGAA 4LF4O 4LF6O 4K0KO 1XMQO 1AILA 5A2QN 4LF9O 5LMNO 4DR2O 2DOSA 4B3SO 4DV6O 3J80N 2LW7A 3T1YO 2DJVA 4GKJO 2UXCO 4DV4O 4JV5O 2E5LO 1FKAO 1F7YA 5H5NA 4DV7O 4DR1O 4LF8O 3OTOO 2UU9O 4DR3O 1A32A 2HHHO 4JI3O 3RT3C 2VQEO 2ZKOA 2N74A 4DV1O 1X59A 4KHPO 4AQYO 2ZM6O 4YY3O 4OX9O 2UUCO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3R O;  4DV2 O;  4DR7 O;  1HNW O;  4GKK O;  1XNQ O;  4DUZ O;  4DV5 O;  1IBM O;  4JI5 O;  2FKX A;  3J81 N;  1J5E O;  5IT9 N;  1AB3 A;  4YHH O;  4OPA A;  1FJG O;  4LF7 O;  2VQF O;  1YZB A;  1N34 O;  2UUB O;  4JI4 O;  5LMU O;  4X64 O;  4DR6 O;  1N33 O;  4X66 O;  4DV3 O;  4B3M O;  4A5U B;  1R6T A;  1KUQ A;  2JRI A;  1HNZ O;  3M8A A;  3R66 A;  5BR8 O;  1HNX O;  4JI0 O;  4NXN O;  4JI7 O;  1FYJ A;  4DUY O;  4B3T O;  5FLX N;  2Z0A A;  2UXD O;  3O65 A;  1IBL O;  3JAM N;  4JYA O;  2F4V O;  1NS1 A;  4LF5 O;  3SDL A;  4LFA O;  4JI1 O;  4JI6 O;  1HR0 O;  4NXM O;  1G1X B;  3T1H O;  4JI8 O;  1XEQ A;  5LL6 Y;  5IWA O;  4X65 O;  5BXZ A;  1I94 O;  1R1B A;  3J7A U;  4DR4 O;  4OPH A;  2UXB O;  1DK1 A;  4LFC O;  4X62 O;  5BY1 A;  4LFB O;  4JI2 O;  1N36 O;  3F5T A;  4DR5 O;  2UUA O;  1XNR O;  1N32 O;  1IBK O;  1D2D A;  1XMO O;  4DV0 O;  2AGA A;  4LF4 O;  4LF6 O;  4K0K O;  1XMQ O;  1AIL A;  5A2Q N;  4LF9 O;  5LMN O;  4DR2 O;  2DOS A;  4B3S O;  4DV6 O;  3J80 N;  2LW7 A;  3T1Y O;  2DJV A;  4GKJ O;  2UXC O;  4DV4 O;  4JV5 O;  2E5L O;  1FKA O;  1F7Y A;  5H5N A;  4DV7 O;  4DR1 O;  4LF8 O;  3OTO O;  2UU9 O;  4DR3 O;  1A32 A;  2HHH O;  4JI3 O;  3RT3 C;  2VQE O;  2ZKO A;  2N74 A;  4DV1 O;  1X59 A;  4KHP O;  4AQY O;  2ZM6 O;  4YY3 O;  4OX9 O;  2UUC O; 
#chains in the Genus database with same CATH topology
 2VWJ A;  4I4T A;  3K79 A;  2QWO B;  2ZIN A;  1S72 V;  5B1N A;  5IDJ A;  3CCS V;  3J81 N;  1F51 A;  5IJ9 B;  4LF8 B;  1GM9 A;  3CMA V;  3BAA A;  1IXB A;  4UVA A;  1CPY A;  2Q7E A;  1P4R A;  1KKC A;  5L3F A;  3KG2 A;  2ZQM A;  5LP6 B;  3THO A;  1P7G A;  3AEI A;  3RGB A;  4FZ0 A;  3CC4 V;  4XBF A;  3B8N A;  1BZK A;  1R6N A;  4IHJ A;  4W4L A;  2UUB B;  2FML A;  2RNB A;  4O2B A;  3SPI A;  1SQP H;  4UCU A;  1AR1 B;  4EFB A;  3DSQ A;  4JAU A;  1TAE A;  3K5N A;  3BAB A;  4LFC O;  4WFF A;  1YIT V;  1MNG A;  1N36 O;  2EIK B;  5LHG A;  4HNA A;  3AK3 A;  3ABL B;  4J9Z B;  1M5I A;  2N04 A;  4LF9 B;  1XMQ O;  5A2Q N;  4HAM A;  3B40 A;  3T1Y O;  4K8X A;  2UXC O;  4TOI A;  3H1I H;  1XHZ A;  3OTO B;  3P3P A;  1TUB A;  3CC2 V;  3ZRW B;  1WNS A;  4H37 A;  5KUM A;  4UCO A;  4WFA V;  4GX2 A;  2OCH A;  2BTQ A;  1NI8 A;  1PNM A;  4DK1 A;  1V55 B;  1NKD A;  1HNW O;  4O4L A;  2PTM A;  1VQK V;  4H33 A;  2FKX A;  4Z2W A;  4ASU G;  3WFV A;  2W0F C;  4YHH O;  4F6R A;  2QR4 A;  5B1A B;  1JJ2 U;  3A2F A;  1YZB A;  1E1Q G;  4NTX A;  4B3M O;  3ZS8 C;  3SYC A;  5C8Y B;  5KMG B;  1BQZ A;  3AG3 B;  4YJ2 B;  2XND G;  2IW5 A;  2ADP A;  2P22 C;  2YID A;  3M7M X;  4MVO A;  3STZ C;  1KKD A;  1I5Y A;  3T2M A;  1FYJ A;  2CGO A;  2EJ7 A;  4B3T O;  3JD4 A;  4EEQ A;  1YI2 V;  3K5M A;  4JYA O;  5FPO A;  3HKC B;  3SYA A;  2QM7 A;  3QF7 A;  1GN6 A;  2P67 A;  1I94 B;  4QNH B;  3N2K A;  3G6B A;  1BT8 A;  3GVM A;  2WLI B;  1PKX A;  3E89 A;  4R8C A;  4U3J A;  4YIP A;  4HBN A;  1OCR C;  3CXH F;  1DK1 A;  3STL C;  4ZI7 A;  1K33 A;  3TGU H;  1LNQ A;  1KYO F;  2UUA O;  1KEC A;  1Q6H A;  1Y74 A;  4O2A A;  1M57 B;  1PL0 A;  2IM9 A;  3B2E E;  5JVD B;  1B3Q A;  1FAF A;  4MTO A;  4X1Y B;  2Q8V A;  3GB7 C;  1DLB A;  5LA6 B;  2Y69 B;  3OGI B;  3FB6 C;  2OIE A;  3CB2 A;  4DV7 O;  1N36 B;  4FZ1 A;  5EYP A;  1K73 W;  4YJ3 A;  4X1I A;  4NB5 A;  3EFF K;  3ETQ A;  2ZD9 A;  2UUC O;  1XHX A;  3T1Y B;  3S3W A;  1ZL8 B;  2UXC B;  4RUE A;  3RN4 A;  3G67 A;  3HKB B;  4DUZ O;  1I7F A;  5H9C A;  5KHK A;  4JYY A;  5GON B;  1X4T A;  5F2V O;  2E75 B;  2B5U A;  4BW9 A;  2WLN A;  2IU3 A;  4RQE A;  3H01 A;  5LMU O;  5K1X A;  3IC9 A;  4O4H A;  3CWB H;  2B1G A;  2XT9 A;  4JTD B;  1KP2 A;  2DE0 X;  1EZJ A;  1R6T A;  1Q81 W;  5HFM A;  3ZN1 A;  3BCC H;  4PEL A;  1EM1 A;  2JEU A;  1ZAU A;  3KCY A;  2DQ3 A;  4PA3 A;  2JJ2 G;  4YHH B;  4H0L B;  2EIL C;  1NT2 B;  3WB1 A;  3VOU A;  3JAR A;  4CC5 A;  2IJJ A;  3ABT A;  2LW1 A;  3E8F A;  4O2B B;  1Y76 A;  4JI6 O;  2ZT9 B;  2LFR A;  1NVP D;  3T1H O;  1VQ9 V;  5IWA O;  4X65 O;  1QR8 A;  1SC5 B;  1OCZ B;  1SF9 A;  2LGQ A;  2ZDI A;  2A9H A;  4O4J B;  3D3I A;  2KQX A;  4B3T B;  4CBC A;  2LJ2 A;  5BY1 A;  4JYA B;  1TVK A;  3QNE A;  3ICX A;  1QVF U;  3AG2 B;  4DV0 O;  3AK2 A;  2QSA A;  4LF4 O;  5CBH A;  4DV6 B;  2JGD B;  2GSM B;  5IJ0 A;  3RYF B;  2VRZ A;  2PI4 A;  3DGE A;  4YIO A;  3U11 A;  1ZUQ A;  3HKE A;  3A0H Z;  4IIJ A;  2E5L O;  5ITZ A;  4J7K A;  3OD4 A;  4MTF A;  1K4D C;  3OR6 C;  1TUB B;  2Z5U A;  4KHP B;  3RW0 A;  3HKD A;  5EZY B;  4YY3 B;  3H1H H;  3E8B A;  1WAZ A;  1L0L H;  2LQT A;  4NKG B;  3BPZ A;  2C2A A;  4E2L A;  1L8D A;  3QO5 A;  1XNQ O;  1THZ A;  1J5E O;  5L3E A;  4DV7 B;  2UXX A;  4I55 B;  3E22 A;  1FPO A;  1AB3 A;  5D5P A;  1K9M W;  1N33 B;  2IJI A;  3LSS A;  1N34 O;  4K8Z A;  4X64 O;  3CE2 A;  5TIS Z;  4F6R B;  2Y4T A;  4KUM A;  2QGN A;  2X7R B;  5J2T A;  3P30 A;  1KUQ A;  3W7X A;  4FLW A;  3ABK C;  3UT5 B;  1S5H C;  4DUZ B;  1NR7 A;  4X1K B;  1D5N A;  4TQD A;  2UXD O;  3CCE V;  5LMU B;  1Q6U A;  1WPB A;  3ETG A;  4JI8 B;  2K1E A;  1CP9 A;  4BR6 A;  2GDS A;  3ASO C;  3UCS C;  2RDC A;  3CHX A;  2JJ1 G;  3LSQ A;  2YIA A;  3K06 A;  2VWK A;  1KU9 A;  4R7C A;  3TXS A;  3BHP A;  5KHG A;  4DR4 O;  3E2E A;  1CEZ A;  3K5O A;  4FFB B;  2ZR3 A;  3JAL A;  4LFB O;  2DQ0 A;  4P2Z A;  3K9S A;  4Z1M G;  1XMO B;  4ZI7 B;  3ZHU A;  5DEC A;  4FLT A;  3OMN B;  2YIB D;  4MVM A;  1KBH A;  4C7U A;  3IAY A;  4B3S B;  3WB0 A;  5IWA B;  2JS5 A;  3ZX6 A;  1EZV H;  2Q0A A;  5KHJ A;  5LMN O;  4DR2 O;  3UO2 A;  2XHB A;  3CEI A;  1YJ9 V;  3DXR B;  2IH1 C;  5L3B A;  4DR1 O;  1OCC C;  3UO3 A;  3QVN A;  1FXK A;  2YS8 A;  3E86 A;  3G80 A;  2KG7 B;  4LF4 B;  1JJO A;  4PA9 A;  1LR1 A;  4KXR A;  3R65 A;  1K34 A;  4YJ3 B;  4B3R O;  2CK3 G;  1N0J A;  4HYO A;  3HR0 A;  1QBZ A;  4ZOL B;  3VBB A;  3AG1 B;  4WFH A;  2E5L B;  3H1J H;  1UFI A;  4FIP C;  4DW0 A;  1SKV A;  2XAF A;  5DN6 G;  4JI4 O;  3AK1 A;  1W2B U;  5LP6 C;  4PDR A;  4DW1 A;  5KLV H;  3ABM C;  2CDY A;  1XNQ B;  3RYI A;  1EN6 A;  1J5E B;  4QJF B;  2XAJ A;  3ZCC A;  5L3C A;  2PYJ A;  2ZXW B;  3T1C A;  4UCT A;  4X64 B;  3IFX A;  4G28 B;  4PHZ A;  3SDL A;  3JD1 A;  2JS3 A;  1SET A;  4FFK A;  5KAF Z;  1H8E G;  5JJJ B;  2B1I A;  3JCU Z;  2DW4 A;  2CAZ C;  5EC2 C;  2IU0 A;  2QEX V;  4OPH A;  4Z1V A;  3ABL C;  1K4C C;  5EBL C;  3F5T A;  1XNR O;  4X20 B;  4WBN B;  3CCV V;  2Q4P A;  4J80 A;  4WCE V;  1AIL A;  1NZ6 A;  2DN9 A;  4ZHQ B;  4I0X B;  4LF9 O;  5KA5 A;  1DTO A;  3FFQ A;  2ILM A;  2V1D A;  3RVZ A;  2BSK A;  1B06 A;  4LH7 A;  3ZMT A;  4DRX B;  3OE7 G;  1O9G A;  2DWD C;  2CE4 A;  3OTO O;  1Q86 W;  4FM1 A;  3L70 H;  1A32 A;  2RCV A;  1SQV H;  1KMI Z;  2WLL B;  4WFB V;  1V55 C;  3G4S V;  2LO1 A;  4DR2 B;  4RO2 A;  1QNM A;  5B3S C;  4JI5 B;  1M56 C;  3DC6 A;  5B1A C;  1F4N A;  1H38 A;  3JAT B;  4OPA A;  1YJN V;  4F6E A;  3E22 B;  3AG3 C;  3OW2 U;  2WLM A;  5EIB D;  4QIW F;  5BMV B;  1OCC B;  1BHA A;  3JD3 A;  4MW3 A;  2EIJ C;  5JCO C;  1K7D A;  1IVS A;  1M90 W;  4MT8 A;  5B1O A;  4JI7 O;  2Q0O C;  2GUZ A;  4DUY O;  1PD3 A;  1L0N H;  4JI4 B;  1IBL O;  3SYP A;  1GN2 A;  3JAM N;  3NXS A;  5LOV A;  2Q7H A;  4TUY A;  5JJN B;  4NTY A;  4FK5 C;  1MSW D;  3MHS C;  2P7T C;  1AI5 A;  1ZWI C;  1G1X B;  3A0B Z;  3W7W A;  1I94 O;  3ZMU A;  3VQW A;  3ABM B;  3BRC A;  3SR2 C;  1PL4 A;  5BZB A;  4JI2 B;  1OJH A;  5FNV A;  3JAS A;  2ZNI A;  3O9O A;  3RVY A;  4DR5 O;  3FKS G;  1M57 C;  1RSO A;  3JAL B;  2CUG A;  3ML0 A;  2O57 A;  4LNU A;  4J7Z A;  2QM8 A;  4J7J A;  5CB4 B;  2Y69 C;  4FMT A;  3CCU V;  1FD9 A;  4DXW A;  1ARO P;  1FXH A;  2DJV A;  1J95 A;  4GCZ A;  4D6T H;  1Q7Y W;  3JD0 A;  2HVK C;  4LWS A;  3RBZ A;  2K9P A;  5CA1 B;  4UV9 A;  2H8P C;  3IGA C;  1P49 A;  1QQC A;  3CME V;  3G71 V;  1XNR B;  1AJQ A;  2F95 B;  4FM2 A;  4JI3 O;  3RT3 C;  1R3K C;  2ZM6 B;  4FLX A;  3CD6 V;  4WFG A;  1YF2 A;  4DV1 O;  2YIB A;  3L75 H;  3APQ A;  2JEX A;  2ZIO A;  3MD0 A;  1BCC H;  4GKK O;  1WA8 B;  1JR9 A;  1JFF B;  2YEV A;  4TV9 A;  3U0Z A;  4FM0 A;  1DF5 A;  3K04 A;  2WLH A;  3ZHQ A;  3LNN A;  1FJG O;  3CCL V;  3OR7 C;  5H6Q A;  1I0H A;  1IDS A;  2ZE8 A;  2HFE C;  5J2U B;  1FS0 G;  5BR8 B;  1VF6 A;  4WFE A;  4EB6 B;  2A0L A;  1SS3 A;  2V7Q G;  4P9P A;  4J9Y B;  1KQS U;  2A06 H;  3FB8 C;  1GN4 A;  2QM4 A;  4JPR A;  5FPR A;  4JI0 O;  4NXN O;  3Q4H A;  4J41 A;  5B3S B;  1ZTE A;  4XDJ A;  2HEP A;  3W7T A;  1NH2 D;  1M56 B;  4NR1 A;  3LDC A;  1URF A;  4G27 B;  2CTP A;  1S0V A;  4NXM B;  2Y48 A;  1K5Q A;  3TET A;  2OCC B;  1OCZ C;  1BS3 A;  4PA6 A;  5JH7 B;  1GTO A;  3H9V A;  3CS5 A;  4JI7 B;  3J7A U;  1BL8 A;  3CRA A;  4I50 A;  5CN0 A;  2EIJ B;  4DUY B;  1JX9 A;  4EFE A;  2ITC C;  1IBL B;  4FVM A;  3AG2 C;  2NN4 A;  5J9P C;  3TK1 A;  1XL6 A;  4QPJ A;  4UCS A;  4DV6 O;  1VQM V;  4I9W A;  1EN5 A;  4UCR A;  5IY5 B;  1NVP B;  4FJC C;  5IYZ B;  1PNK A;  3SPC A;  4R6Z A;  2BTO A;  2WSS G;  3VQV A;  4DR5 B;  2YXY A;  3K0G A;  2XAS A;  2AW9 A;  4KHP O;  2WLK A;  5CA0 A;  4YY3 O;  1GAX A;  2P5O A;  2P90 A;  3JAW A;  4H13 B;  4GT1 A;  3RYC A;  1XL4 A;  1YXB A;  2HP8 A;  1KP3 A;  2R9R B;  3K57 A;  4X88 A;  3DC5 A;  1QLE B;  1VAR A;  1R3J C;  1K92 A;  4O4I B;  5CMU A;  4JI3 B;  2LFS A;  3W7U A;  1N33 O;  4G2K A;  4DV1 B;  3OMI B;  2X6C A;  1HNX B;  3CJH A;  4GKK B;  5DED A;  5IE9 A;  4I7Z B;  1S3J A;  1EBO A;  2CH7 B;  2KSD A;  1VQP V;  4I4T B;  2RQ6 A;  1FJG B;  1NQT A;  3L71 H;  2R9I A;  1FFX A;  4FLU A;  4FPP A;  2BOC C;  1G6U A;  4JZG A;  4LF5 O;  1MG1 A;  1S5L Z;  2DYS B;  4LFA O;  1WP8 A;  1H2K A;  4JYC A;  1O9H A;  4TUY B;  4JI8 O;  3FD9 A;  5EK0 A;  3CRM A;  4ICG A;  4JI0 B;  4NXN B;  4YXW G;  3ZRS A;  1SQX H;  4CS3 A;  1YSC A;  4X62 O;  3SJC C;  1N32 B;  5FNV B;  5LGT A;  3BFR A;  1XMO O;  4IHJ B;  3HPL C;  1SQB H;  2WLJ A;  4RWU A;  4QE9 A;  2L6L A;  4B3S O;  2P4K A;  2OTL V;  2Q73 A;  2LW7 A;  4LCU C;  5LXT A;  1XIL A;  1YDX A;  3ABU A;  1IX9 A;  2WWW A;  1FKA O;  3T4D A;  2M7W A;  2PY5 A;  3SPG A;  4LWS B;  4TSF G;  3CX5 F;  1P84 F;  1Q8I A;  3ZRX A;  1Y66 A;  1AP5 A;  2XAQ A;  4GYC B;  2E74 B;  1K5S A;  4HNA B;  1VF5 B;  3AG1 C;  1YTF B;  1SZT A;  4UV8 A;  3L74 H;  2BE3 A;  2Q69 A;  3I55 V;  1WB8 A;  4LP8 A;  1H2M A;  1VIB A;  1VQO V;  1TGO A;  3OUF A;  4U3F H;  5GW7 A;  3CC7 V;  2JK5 C;  3N27 A;  2JIZ G;  4PDV A;  1M9N A;  1MZF A;  4P30 A;  3ASN B;  3M8A A;  1R73 A;  3C3T A;  3ETD A;  2DYR C;  1ZX3 A;  2BTQ B;  3OEE G;  4ZKI A;  2ZXW C;  2RMK B;  1BGY H;  3Q4H B;  4O4L B;  1QU7 A;  3BA8 A;  3O65 A;  2YIC A;  4RQF A;  5KX5 A;  2CTQ A;  3BA9 A;  1R3I C;  1HR0 O;  3NR7 A;  1Y4M A;  2KB1 A;  2XUM A;  1L1F A;  5LL6 Y;  2QKA A;  1NR1 A;  1NJI W;  2OT5 A;  4J10 A;  3N2G A;  4J42 A;  3S3X A;  2UXB O;  5JQG A;  1SA0 A;  4JTA B;  2QTS A;  2RN9 A;  5B1B B;  3JAK A;  2EIM B;  4NYK A;  4LF5 B;  1GKF A;  3RYH A;  4LFA B;  4PV1 B;  2QWR B;  2WA3 A;  2HLD G;  1BHB A;  2W6I G;  2P4V A;  3J80 N;  5IJ9 A;  3N2K B;  4DV4 O;  4X62 B;  3QO8 A;  4U3J B;  1GK9 A;  4CH3 A;  2NLJ C;  1D5A A;  2IBZ H;  3T4Z A;  3SPJ A;  4PDM A;  4UCV A;  3A0R A;  1XOU A;  2VQE O;  4CZZ A;  4AQY B;  5LP6 A;  3CRQ A;  1YIJ V;  4OX9 B;  3OT7 A;  1S5J A;  4MVS A;  3EHB B;  3QO7 A;  2P06 A;  1GM8 A;  3FB5 C;  1Y74 B;  4W4K A;  4O2A B;  3ZMS A;  4KFM A;  2FB5 A;  4DV5 O;  4JI5 O;  1AVM A;  1RPR A;  3D36 C;  2EZP A;  2XAH A;  4PD4 F;  3WU2 Z;  1TA8 A;  1M93 A;  4A5U B;  5EYP B;  2OYQ A;  3E8H A;  1HNZ O;  3LNM B;  4X1I B;  4PDL A;  4FLY A;  4AHC A;  1JCH A;  2FTK A;  2ZR2 A;  4IYI A;  3H1L H;  1BQ0 A;  2PUS A;  3PN1 A;  3WG7 C;  2HVJ C;  1M1K W;  2F4V B;  4IT5 A;  2D3O W;  2AHY A;  2QWP B;  5LBQ A;  1Q43 A;  4K35 A;  1VQ7 V;  1FXV A;  5JJE B;  4FLV A;  1MOF A;  4O4H B;  5L3D A;  5BXZ A;  2QWQ B;  1T5E A;  1US6 A;  1XBL A;  1Q90 D;  3ZRW A;  2ZCE A;  1JQ0 A;  3CP1 A;  2AZ2 A;  2DYR B;  4JI2 O;  4BAY A;  5KHH A;  1IBK O;  1W59 A;  4QPK A;  3ZIA G;  1HR0 B;  3JAR B;  3VQY A;  3QTC A;  4I5S A;  2DOS A;  2PI5 A;  4OXS A;  1Y76 B;  1ZLZ A;  2PF4 E;  2UXB B;  1IZ3 A;  1EFR G;  2YI8 A;  4CS2 A;  5LXT B;  5H5N A;  5L3G A;  1YEW A;  4DR3 B;  3MAQ A;  1F23 A;  5C8Y A;  3OUS A;  3SJA C;  5KMG A;  2QJ1 A;  3MHH C;  4YJ2 A;  1OHH G;  3CXC U;  1TVK B;  3X2Q C;  2ZM6 O;  4PA7 A;  3JCZ A;  3A8T A;  4PA4 A;  4CH6 A;  2ARH A;  3OTF A;  4DV4 B;  2GBO A;  1HWY A;  4Q20 A;  5IJ0 B;  1HP8 A;  2YXH A;  2YI9 A;  3HKC A;  4LF7 B;  2AZ0 A;  5B5E Z;  1OCO B;  4X66 B;  3HKE B;  4IIJ B;  1E1R G;  4JZ2 A;  2VQE B;  4KL1 A;  2Z3Y A;  4AI8 A;  5ITZ B;  3OFN G;  5LGU A;  2QTO A;  1S77 D;  3F7Y C;  1XI1 A;  4JGS A;  1K8A W;  4TT3 G;  2YUA A;  2ZE6 A;  2YDE A;  1JA8 A;  1LUV A;  3HKD B;  5BR8 O;  2QKS A;  2B9Z A;  4K3A A;  4DV5 B;  1SES A;  1SQG A;  2F1M A;  2MW2 B;  2RJZ A;  2QKC A;  3UQ8 A;  3CPW U;  2OCC C;  2EX3 A;  4GX1 A;  3OEH G;  4JYB A;  4X1Y A;  4NXM O;  1HNZ B;  1QR9 A;  5LA6 A;  3OAA G;  1NTZ H;  2JDI G;  5IYC O;  4MVU A;  5J2T B;  2CTR A;  4BIU A;  2HJD A;  1YHQ V;  1H2G A;  5H6R A;  2NR5 A;  2ZNJ A;  5LYJ A;  3K0D A;  3SYQ A;  2YSU B;  1SA0 B;  1N0N A;  3JAK B;  3WG7 B;  1RM1 B;  2ADQ B;  2AGA A;  5KA6 A;  2FL4 A;  1ZL8 A;  3ZED A;  3HKB A;  4L8J A;  5IY5 C;  1MSD A;  5GON A;  3HB3 B;  4GKJ O;  4BIZ A;  2Y4U A;  3M99 B;  1BMF G;  2UU9 B;  4MS2 A;  2HHH B;  5EBW C;  1W0J G;  1IBK B;  3EXA A;  2F66 C;  4DV2 B;  3P32 A;  1GH6 A;  2IJK A;  3K58 A;  2HR3 A;  1IBM O;  1QLE C;  3ZHV A;  2EZO A;  1R6K A;  2Q6A A;  2VQF B;  1VEW A;  3SJQ C;  4UVC A;  3FAV A;  2BOB C;  4DV3 B;  1WB7 A;  2EJR A;  2NNU A;  1MAB G;  1I5X A;  3FB7 C;  3CSX A;  2R70 A;  4BW5 A;  3CCQ V;  2EIN B;  2Q67 A;  4RAI A;  3EVK A;  1FXK B;  4LC1 A;  3K9A A;  4O4J A;  2QWN B;  3E35 A;  1HNX O;  3X2Q B;  1K97 A;  1K3E A;  1Y6X A;  2W6J G;  4GX5 A;  2PYL A;  1AI7 A;  2DYS C;  2JGD A;  2EUL A;  1AJN A;  1SRY A;  3RYF A;  4L87 A;  1AR5 A;  5A9G A;  2GTS A;  3TXQ A;  1R1B A;  1Q3E A;  2CGN A;  4MW8 A;  4IYH A;  1W0K G;  5CA3 A;  5KHI A;  3RYI B;  1DF4 A;  1RP3 B;  5KUK A;  4LBE C;  5EZY A;  1H2S B;  3AG7 A;  1PNL A;  1R3L C;  3B4S A;  4UUJ C;  4LF6 B;  1N32 O;  2X6B A;  2PGG A;  3QG5 A;  4QE7 A;  1Z5W A;  5EBM C;  3PJS K;  4I55 A;  5EC1 C;  4B7K A;  1NTK H;  4D7T A;  2ETN A;  1GO3 F;  2R9A A;  3BY6 A;  1V9P A;  1IUR A;  3I56 V;  2ATK C;  3UT5 A;  2Y0I A;  4X1K A;  4NTW A;  4GKJ B;  1VMG A;  4ABM A;  1VQ8 V;  1F4M A;  2M6Y A;  2DWE C;  5LHI A;  1JPX A;  2Q7G A;  2BSK B;  1Z2G A;  2UXN A;  5E79 Z;  5C93 A;  1DGS A;  3ASN C;  4IGG A;  1BSM A;  1VF6 C;  4JAS A;  2A79 B;  4F4L A;  3JSN A;  4E4E A;  4FFB A;  4GX0 A;  2QE7 G;  1IBM B;  1KB9 F;  1OZ0 A;  3K3W A;  3K08 A;  1H8H G;  2L35 A;  2Z0A A;  1MA1 A;  4EKW A;  2Q5Z A;  4JI1 O;  3CYO A;  3G6E V;  4MVZ A;  1VQ6 V;  2ZE7 A;  1QLN A;  3DXR A;  1EN4 A;  4U7O A;  1GMG A;  3ZMV A;  4LFC B;  5B1B C;  3OMA B;  3SJB C;  2EIM C;  2EBO A;  1AJP A;  2GHY A;  4TQF A;  5GTI Z;  3AG4 C;  2KG7 A;  2JGU A;  2GUZ B;  4D7S A;  2BCC H;  4R50 A;  5LYJ B;  3W7S A;  5AG2 A;  1XMQ B;  4CH4 A;  3BVO A;  1OV9 A;  4ZOL A;  4N23 A;  5LOV B;  1XQ8 A;  4ZBM A;  2OTJ V;  1P7B A;  2F23 A;  4N21 A;  1RFY A;  2XAG A;  2XTA A;  3I5D A;  1VQL V;  4UFZ A;  3JAS B;  2LP7 A;  2N74 A;  1B04 A;  4LH6 A;  1V54 C;  1RSO B;  4AQY O;  1VQ4 V;  1S76 D;  1HNW B;  4OX9 O;  2HG5 C;  5KAI Z;  4GUN A;  4LNU B;  4DR7 O;  4I9Q A;  4XDL A;  2XOK G;  4CS4 A;  3GWK C;  5IT9 N;  1Z5V A;  1U97 A;  4DO2 A;  4B3M B;  4CC6 A;  3L73 H;  3FAV B;  1SQF A;  5K1P A;  3E83 A;  5IYD O;  3TJT A;  3D8C A;  3K03 A;  3R66 A;  1RPO A;  3L9D A;  2HJF C;  1VP7 A;  3IC7 A;  3VQX A;  4X20 A;  4WBN A;  5FLX N;  2YEV B;  4TV9 B;  3ZMZ A;  2F4V O;  3P3N A;  4ZHQ A;  2R72 A;  5LHH A;  4I0X A;  1TUE B;  4X89 A;  5EIB C;  1VF7 A;  1BE3 H;  2ZE5 A;  5IYB O;  1XEQ A;  2A7W A;  1KD1 W;  5LGN A;  4DRX A;  4X8A A;  1JVM A;  3F7V C;  3APO A;  3H1K H;  3ZBH A;  2UUA B;  2GTA A;  2WLL A;  1OCR B;  1AP6 A;  2F43 G;  4AIL C;  1AI6 A;  4JI1 B;  1NBM G;  1YVW A;  2V4D A;  2YC0 A;  1Q82 W;  3ZHT A;  2QDO A;  3B09 A;  3LSU A;  4Q6G A;  1CXZ B;  4TV8 A;  1WLE A;  2DMX A;  2ZDI C;  3JAT A;  3FYE B;  1VQ5 V;  1VQN V;  4JV5 O;  2YXL A;  1WP7 A;  1UPG A;  3WB2 A;  3ZRV A;  1F7Y A;  4I50 B;  3D36 A;  3D3Q A;  5BMV A;  3K5L A;  4DR3 O;  2WAM A;  4MSW C;  3AG4 B;  3CCJ V;  3U10 A;  1H2L A;  2H94 A;  4UB8 Z;  2UUC B;  1WPX A;  1ENV A;  2CTW A;  4JAV A;  1M4U A;  2PZS A;  2X0L A;  1N8R W;  2G38 A;  2X6A A;  2ZIM A;  4NVP A;  4DYL A;  5FL7 G;  1OCO C;  2D2C B;  2HKO A;  3SPH A;  3SGI A;  5CBF A;  4IL6 Z;  2WPD G;  4LF7 O;  4MTG A;  4DR6 O;  2H3O A;  2FYU H;  4X66 O;  3DTU B;  2AHZ A;  3KCX A;  2IH3 C;  3K59 A;  3CCR V;  3ZHS A;  4DR7 B;  4OGQ B;  2JRI A;  2F93 B;  3ZN0 A;  1WJZ A;  4RUF A;  5CA0 B;  4MTX A;  1V54 B;  4B08 A;  3JAW B;  1G4Y B;  1MZE A;  1FFT B;  3RYC B;  1GRJ A;  1ZSP A;  3CCM V;  1U96 A;  2EIL B;  3IJ4 A;  1YTF D;  3BEH A;  1GN3 A;  3JD2 A;  5GTH Z;  4JI6 B;  1PV0 A;  2IJH A;  3RFR A;  5CB4 A;  3T1H B;  4X9Q A;  4X65 B;  1YCI A;  1E79 G;  5CA1 A;  1I08 A;  5DM6 V;  1LUW A;  3CJH B;  3LDE A;  1NTM H;  4LR3 A;  2E3C A;  4TWK A;  1RM1 C;  3MDS A;  4DV0 B;  3OM3 B;  3B77 A;  1FFX B;  4K0K O;  1WA8 A;  1JFF A;  1XRE A;  1G8M A;  4JTC B;  1XDC A;  4DK0 A;  1IXM A;  4BIO A;  1PPJ H;  3FX7 A;  4LF8 O;  5J2U A;  3L72 H;  1COW G;  1HW7 A;  3GWO A;  2UU9 O;  1UJW B;  2HHH O;  1ROP A;  4EB6 A;  1WN7 A;  2ZKO A;  1JOY A;  4U7N A;  1QHT A;  3OGC C;  1GM7 A;  4DV2 O;  3ETE A;  3UM7 A;  3C3S A;  4CH5 A;  4JV5 B;  2OWO A;  4P9O A;  1JMK C;  4JAA A;  1N34 B;  4MVQ A;  2VQF O;  2EIN C;  2UUB O;  3E8G A;  1FXK C;  1SZX A;  5JH7 A;  4DV3 O;  4B7E A;  5B66 Z;  1MMM A;  2WA4 A;  4KP4 A;  3F5W C;  1AI4 A;  1Y67 A;  3CRC A;  5JCO A;  2VS0 A;  2E76 B;  4QGP A;  4BWA A;  5CBG A;  1HDJ A;  3ABK B;  1PP9 H;  2EIK C;  1QVG U;  2UXD B;  4JF3 A;  3FYI B;  4H44 B;  2AXT Z;  2KKW A;  3UKM A;  2W0X A;  2LGW A;  4FLZ A;  2GV9 A;  3B8M A;  1AR4 A;  3CRR A;  5HFL A;  4DR6 B;  4PI0 A;  1NS1 A;  1H2N A;  2OIG A;  3KKY A;  3KZI Z;  4MVR A;  1SQQ H;  5H2F Z;  3SYO A;  2WLI A;  5D5Q A;  4WF9 V;  4PJ0 Z;  5IYZ A;  1SER A;  4DR4 B;  1Q5O A;  2QA4 V;  3ASO B;  4HZ3 A;  1YJW V;  5E1A C;  1XUQ A;  1B6Q A;  4J11 A;  1PM9 A;  5JWP A;  4LFB B;  3JYC A;  1QCE A;  2Q9L A;  2JVD A;  2P6J A;  4GLX A;  4UB6 Z;  1NU1 H;  3LUT B;  1D2D A;  3JSL A;  5JVD A;  4LF6 O;  5LMN B;  4XDK A;  1KC8 W;  1ORQ C;  5KX5 B;  2MK3 A;  4GZR B;  4UVB A;  3RWR D;  3C90 A;  4TV8 B;  2N05 A;  4O4I A;  4DR1 B;  1Q6I A;  2ITD C;  3TCU A;  3ZJZ A;  3ZHR A;  4ZIB A;  4PI2 A;  4UXN A;  3LDD A;  1N4C A;  3N2G B;  2ODM A;  5JQG B;  4K0K B;  1NH2 B;  2Y0P A;  3RYH B;  2A3Q A;  1X59 A;  4B3R B;  2CH7 A;  2Q68 A; 
#chains in the Genus database with same CATH homology
 4B3R O;  4DV2 O;  4DR7 O;  1HNW O;  4GKK O;  1XNQ O;  4DUZ O;  4DV5 O;  1IBM O;  4JI5 O;  2FKX A;  3J81 N;  1J5E O;  5IT9 N;  1AB3 A;  4YHH O;  4OPA A;  1FJG O;  4LF7 O;  2VQF O;  1YZB A;  1N34 O;  2UUB O;  4JI4 O;  5LMU O;  4X64 O;  4DR6 O;  1N33 O;  4X66 O;  4DV3 O;  4B3M O;  4A5U B;  1R6T A;  1KUQ A;  2JRI A;  1HNZ O;  3M8A A;  3R66 A;  5BR8 O;  1HNX O;  4JI0 O;  4NXN O;  4JI7 O;  1FYJ A;  4DUY O;  4B3T O;  5FLX N;  2Z0A A;  2UXD O;  3O65 A;  1IBL O;  3JAM N;  4JYA O;  2F4V O;  1NS1 A;  4LF5 O;  3SDL A;  4LFA O;  4JI1 O;  4JI6 O;  1HR0 O;  4NXM O;  1G1X B;  3T1H O;  4JI8 O;  1XEQ A;  5LL6 Y;  5IWA O;  4X65 O;  5BXZ A;  1I94 O;  1R1B A;  3J7A U;  4DR4 O;  4OPH A;  2UXB O;  1DK1 A;  4LFC O;  4X62 O;  5BY1 A;  4LFB O;  4JI2 O;  1N36 O;  3F5T A;  4DR5 O;  2UUA O;  1XNR O;  1N32 O;  1IBK O;  1D2D A;  1XMO O;  4DV0 O;  2AGA A;  4LF4 O;  4LF6 O;  4K0K O;  1XMQ O;  1AIL A;  5A2Q N;  4LF9 O;  5LMN O;  4DR2 O;  2DOS A;  4B3S O;  4DV6 O;  3J80 N;  2LW7 A;  3T1Y O;  2DJV A;  4GKJ O;  2UXC O;  4DV4 O;  4JV5 O;  2E5L O;  1FKA O;  1F7Y A;  5H5N A;  4DV7 O;  4DR1 O;  4LF8 O;  3OTO O;  2UU9 O;  4DR3 O;  1A32 A;  2HHH O;  4JI3 O;  3RT3 C;  2VQE O;  2ZKO A;  2N74 A;  4DV1 O;  1X59 A;  4KHP O;  4AQY O;  2ZM6 O;  4YY3 O;  4OX9 O;  2UUC O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...