4JI5O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 35
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4ji5O00
4OPHA 1N36O 3M8AA 2VQEO 1XMQO 1HR0O 4JI4O 4DR7O 1X59A 4JI6O 2LW7A 5BR8O 5BXZA 1D2DA 4LF7O 4X64O 5BY1A 2AGAA 2Z0AA 4JV5O 1IBLO 4X62O 4DR4O 5A2QN 2VQFO 4OPAA 1KUQA 4LF8O 4YHHO 4DV7O 2UXBO 1IBKO 3F5TA 5IT9N 4JI7O 4JI8O 4JI3O 4DV5O 4K0KO 4GKKO 2UUBO 1YZBA 3JAMN 4JI5O 4DV4O 2UUAO 1NS1A 2UU9O 1R1BA 1HNWO 4GKJO 4X66O 4LFAO 4B3MO 4LF6O 4JI1O 4OX9O 5IWAO 2F4VO 1R6TA 4LFBO 1XNQO 2DOSA 3J81N 4LF9O 2ZM6O 4DR3O 2DJVA 4LF5O 4LFCO 4X65O 4B3SO 5LMUO 1I94O 4JI2O 5LL6Y 4NXNO 4DR5O 1DK1A 1FKAO 2E5LO 3J80N 4DV2O 4DUYO 1HNXO 1N33O 4LF4O 1A32A 3RT3C 5FLXN 3OTOO 1FYJA 2UXCO 2FKXA 1FJGO 4DR2O 4DV1O 4AQYO 2HHHO 4DR1O 4JI0O 1IBMO 2UUCO 4NXMO 1AB3A 4JYAO 1HNZO 3SDLA 3T1HO 3T1YO 2JRIA 2ZKOA 1XEQA 4DV6O 1N32O 4B3RO 1F7YA 4DV0O 1N34O 1J5EO 1AILA 2UXDO 3J7AU 1XMOO 1G1XB 1XNRO 4DUZO 2N74A 4YY3O 5H5NA 4A5UB 4DV3O 4B3TO 5LMNO 4DR6O 4KHPO 3R66A 3O65A
chains in the Genus database with same CATH superfamily
1VF7A 3HKBA 1F51A 4FK5C 4HZ3A 5JQGB 5BY1A 4JV5O 3ICXA 2E5LB 5DECA 2V7QG 2VWKA 1R3KC 2YC0A 3FKSG 1SESA 1ZAUA 5EYPB 4CH6A 2GUZB 5GTHZ 4G28B 4HYOA 2CE4A 4JI8O 3B09A 3OM3B 3SYPA 3QG5A 1VARA 1YZBA 2D2CB 1SF9A 1WAZA 3BA8A 1UPGA 5EIBC 2WA4A 5B1AC 1P7BA 3ZRSA 3OW2U 4YIPA 1FXVA 2FYUH 3ZMUA 4PDVA 2HEPA 3KZIZ 3BHPA 1EFRG 5KHJA 4WBNA 2HHHB 1OCOC 3CYOA 2KG7A 4G27B 4I0XB 1GH6A 2QWOB 3QNEA 2RN9A 3IC9A 2P6JA 2QGNA 3ETEA 1Q82W 3W7UA 2QE7G 3H01A 3AEIA 4J41A 1SKVA 3P30A 1DF4A 1WLEA 3CX5F 2K1EA 2P7TC 1WA8B 3D3QA 4P2ZA 4DV1O 2CH7A 3H9VA 1E1QG 3HKDB 5JJJB 3SDLA 5BZBA 5IJ9B 3T1YB 3CRRA 2XUMA 4DV0O 1W0JG 4K0KB 1HR0B 1DGSA 4Q6GA 2LGWA 1AJPA 1G1XB 4ZBMA 4AILC 1SS3A 3IFXA 1KYOF 4A5UB 5LMNB 3AG1B 1JA8A 1O9GA 2UXXA 3K5MA 4LNUA 1NU1H 3P3PA 3ABUA 1D2DA 2IJHA 4X64O 1BQZA 2X6CA 3JYCA 2EIKC 4X62O 1ZSPA 5A2QN 1E79G 3E89A 3RVYA 4OPAA 1Q8IA 2D3OW 5D5QA 5IJ0A 3JALB 3CCRV 5KA5A 3K79A 3SPCA 4LF7B 1QU7A 2IJIA 2UUBO 1N33B 4O4IA 1NQTA 1ZL8B 3ABLB 1RM1C 4MTFA 1TGOA 3ZMSA 3OGCC 4LH7A 4PDLA 3ASOB 4GKJO 4JI1O 3TCUA 1VQ8V 1NH2B 2P22C 4RWUA 3ZHTA 3BCCH 3SYAA 4J11A 2UUBB 2EJ7A 3RYCA 2N05A 2BCCH 4JZGA 3S3WA 4DUZB 1I94O 1YTFB 5LA6B 5B1BC 1QLEC 4DO2A 3LUTB 2OIGA 3CXCU 1HNXO 5KHIA 2LQTA 4CH5A 1QCEA 1OCRC 1LNQA 2LP7A 3VOUA 4OX9B 1RSOB 1I7FA 4PA6A 4YHHB 2EILC 3KCXA 3LSUA 2ARHA 1M5IA 1AVMA 4JAUA 4BW5A 1UJWB 5IYDO 1IZ3A 4DR4B 1HNZO 5IYZB 3F7VC 1EBOA 4O2AA 4BIOA 2ZCEA 1XNQB 4DV0B 1R6KA 3OR6C 3W7WA 1CXZB 3F5WC 1OCCB 4TT3G 1M57C 4Z2WA 3R66A 2P5OA 1N8RW 2UXDB 1NTMH 1HR0O 1QBZA 4PD4F 4NVPA 2CTRA 4Z1MG 4MVUA 5EBLC 1XNRB 1D5NA 4MT8A 3VQYA 1JMKC 2CK3G 3DXRB 4D7TA 5FNVB 5LHGA 4DV7O 3QVNA 2QSAA 3K06A 1Y67A 3E8BA 4JI7B 1TUBB 4X9QA 2R9RB 2CGOA 4MVRA 5L3EA 2DWDC 2IM9A 1O9HA 3BEHA 1N36B 4JAVA 1NVPB 5JH7A 5JCOA 2EBOA 1JCHA 1NS1A 2UU9O 2EIJB 2F4VO 1PM9A 2QDOA 3BABA 1XNQO 2CGNA 4LFBB 4TV8A 5LP6A 1FXKB 5J2UA 4QE7A 1ZWIC 2UXBB 4AI8A 3JALA 3R65A 3UCSC 2E5LO 2ZINA 2WAMA 3A0RA 3DC6A 1WPBA 4UCTA 1EM1A 1AR5A 4UB6Z 5DEDA 2PGGA 2HJFC 2YIBA 2ZXWC 4JI0O 2W6JG 1XMOB 4TOIA 1IBMO 1XHZA 2Z5UA 1F4NA 1KMIZ 3TETA 1GM7A 2ZKOA 4I50B 3OR7C 3C3TA 3BRCA 5B3SC 3LDDA 4KFMA 2JVDA 1SC5B 3SJBC 2UXDO 1XMOO 5J2UB 4AHCA 3DC5A 4DW0A 1M56C 2E3CA 5J9PC 2OCCC 1XOUA 3UKMA 2IW5A 4KHPO 3WG7B 1GN2A 4CS2A 3HKEA 3SGIA 3MDSA 3Q4HA 3SYOA 5EZYA 1IBLO 3SJQC 4H33A 4JYCA 2GHYA 3CSXA 4CBCA 1KUQA 4UCSA 3K58A 1M56B 4J9ZB 1S72V 4BIUA 5H2FZ 2EIMB 1XDCA 1KQSU 4ASUG 2PI5A 1JQ0A 1VQMV 2QM8A 4I50A 4LF4B 2P4KA 2Y4TA 2GTAA 4X20A 4C7UA 4IYHA 2KSDA 2ODMA 4EFEA 4GCZA 3D36A 3ABMB 4UVCA 1KECA 3L75H 2GUZA 4OX9O 4J42A 3UO3A 1MZFA 1IX9A 2Z3YA 3KKYA 3UT5B 4IL6Z 5IYBO 5L3BA 2DMXA 3I5DA 5LGTA 2ZIMA 3QTCA 2Q6AA 5C93A 4H44B 1H38A 4ZI7A 1YIJV 3HKCA 4PHZA 2Y0IA 3J80N 1WJZA 3I55V 1XMQB 2E75B 1A32A 4JI1B 2CTPA 2O57A 1QVGU 4DR1O 4LFCB 3RW0A 1VQ4V 1H2MA 1K3EA 4NR1A 3MHSC 5GTIZ 5LXTB 4X66B 4X1YA 2N74A 2UUAB 4FLVA 1M4UA 1YITV 3ABKB 1RFYA 3JARA 3H1IH 1FXKC 3K03A 1IXMA 4KXRA 2Q8VA 1BCCH 3CS5A 3L70H 1TA8A 1JJOA 3ZMZA 1NI8A 3RYIB 3RGBA 1XI1A 2OYQA 3A0HZ 3X2QC 3ZRXA 1BQ0A 2NR5A 4WFGA 4I5SA 4R7CA 4FJCC 2BSKB 3SR2C 4DV5B 3PJSK 3FAVA 2AXTZ 1WPXA 2ILMA 3K0DA 1VF6A 3CCUV 1SQGA 5IYCO 1R73A 4DYLA 1ZTEA 4KP4A 4DV1B 4I55B 4DR1B 4YJ3A 1V55C 2YIAA 4B3MO 5IE9A 1K5SA 1Q90D 1OCRB 4FLYA 4IIJB 3QO7A 2P06A 2JEUA 1MNGA 5KHGA 2ETNA 1K97A 3ZHQA 1QLNA 1Y6XA 5H9CA 2XOKG 4DV2O 1B6QA 3H1JH 1VQ5V 1EZJA 4JASA 3CPWU 1UFIA 2EULA 1M93A 3X2QB 4FLUA 3L74H 1K5QA 2WWWA 4UVBA 3W7SA 4NXMO 4JTAB 4U3JA 1IXBA 3FB8C 1RP3B 3BFRA 3FB5C 4FIPC 5EZYB 3CXHF 1GAXA 3UM7A 2PUSA 2KG7B 4QE9A 4NXMB 4FPPA 2XT9A 4FM2A 1SA0B 4B3TO 1LUVA 1Z2GA 4X1KB 5J2TB 4DR6O 3JSNA 1Y4MA 1SETA 2DE0X 3FYEB 1S3JA 3CRMA 3EHBB 5LHHA 1EZVH 4DV7B 3T1HB 2FL4A 4U7NA 4FVMA 4MVOA 2B5UA 1GN3A 5IY5C 1Z5VA 1WN7A 2ZR2A 4PI0A 3K0GA 5LHIA 3AG3B 4RQEA 1IBKO 2ZE5A 3BVOA 4PA4A 1VQOV 2HG5C 3A2FA 3CWBH 4X1YB 1N4CA 3FB7C 3CC4V 1BS3A 3FX7A 3D36C 3HR0A 1HP8A 1XBLA 2PTMA 2H94A 1ZL8A 4KL1A 1ZX3A 1HW7A 1PD3A 4JGSA 4YJ3B 1WA8A 1Y66A 5KUMA 1HNZB 3DGEA 1JJ2U 2KQXA 5HFMA 1KKDA 4LF9O 2ZNIA 1NKDA 1YHQV 1PNKA 3VQVA 3ETGA 1B06A 4YJ2A 4CH4A 4E2LA 1L0NH 5CBGA 2Q7GA 4CS4A 2G38A 1KP2A 2ADPA 3AG4B 4MW3A 4L87A 2CAZC 4LWSA 2E74B 1FYJA 1P7GA 1Q43A 1TUEB 2FKXA 1FJGO 3N2GB 4XBFA 1H2KA 1FPOA 1RPOA 1SERA 4AQYO 2Q7HA 2JDIG 4CH3A 2XAHA 4O4LA 4P9OA 1GKFA 3RWRD 3JAWB 5A9GA 2H3OA 3U0ZA 3OTOB 3ZJZA 3N2KA 1R3JC 4JYYA 3ASNB 4B3RO 4IIJA 4JI0B 4RQFA 2CTWA 1L8DA 2Q7EA 3CE2A 3J7AU 2YSUB 5KX5B 1L0LH 4MVMA 2IJKA 4X20B 3GVMA 1URFA 4B3RB 2B1IA 4DR3B 2F1MA 4TV8B 4RO2A 3CJHB 1Q5OA 1XL4A 3HB3B 4JTDB 2Z0AA 2KB1A 4K8XA 3ML0A 2UUCB 2X7RB 2VQFO 2Y69C 1IBMB 1VQ9V 1Q3EA 4F6EA 1JX9A 1H2LA 5C8YA 1VQLV 3G6BA 2BE3A 4IHJB 1N0JA 1BE3H 1VP7A 1AI5A 2ZE6A 2WA3A 2YIBD 4ZOLA 3UT5A 5KLVH 2HVKC 1K34A 1QR9A 4X66O 2YXYA 4CZZA 4TV9B 2EILB 3CCSV 2WLIB 1GN4A 1U97A 2QKSA 4LFBO 2E76B 3JD2A 4TV9A 2FB5A 3CRAA 4GX5A 1AP6A 4NTYA 2Q0AA 1AJQA 2JEXA 3K5NA 4K3AA 4XDLA 5B3SB 5C8YB 3WB1A 5CA1A 2R9AA 3I56V 3HKBB 2EZOA 3PN1A 2HFEC 1WB7A 3FYIB 2EIJC 1QNMA 4Q20A 4UCOA 1AI6A 4LNUB 4GKJB 2ZXWB 3K08A 4WCEV 3FD9A 2HHHO 4JYAO 2JIZG 2OWOA 2RMKB 4UCVA 3JAWA 3STLC 4UCRA 3JARB 4BW9A 1F23A 1J5EO 4JI4B 1BGYH 4MTGA 5EC1C 3MD0A 4I9QA 3SYCA 1XQ8A 5HFLA 2ZNJA 3SJCC 3O65A 1HNXB 4OPHA 1HWYA 4F4LA 1V54C 5B66Z 4JI6O 5CA3A 4DR5B 1FD9A 4JI6B 4LCUC 4JI3B 4FM1A 2JJ1G 4G2KA 2IU0A 2YUAA 3RYHB 3JCZA 2X0LA 4JV5B 5GW7A 4DR4O 3E83A 2YEVA 3ZMTA 1YI2V 1B04A 2CTQA 2QKAA 3T2MA 4ZHQA 4JI3O 1YCIA 5CBHA 4QPKA 4RAIA 4MW8A 4F6RA 2WLMA 4FMTA 2QM7A 1I0HA 4JZ2A 4GZRB 4K35A 1H2SB 3F7YC 1S76D 1AR1B 4DRXB 1R6TA 2CDYA 4WFAV 4RUFA 3Q4HB 3WB2A 1QQCA 3TGUH 5BMVB 1OV9A 4NB5A 1PL4A 3L9DA 5LMUO 2F93B 3RYHA 5ITZB 5LL6Y 3L72H 1FKAO 4LBEC 5KMGA 1Z5WA 2P67A 4JF3A 3JAKB 5ITZA 1M1KW 2HVJC 4J7ZA 2QWQB 3CRCA 1EN6A 1OJHA 1PPJH 4BIZA 4N21A 3JAKA 1H2GA 1Q81W 3RN4A 2F23A 2MW2B 3OMNB 4EEQA 5AG2A 2XAQA 2PF4E 5LMNO 4GUNA 4ZI7B 3OEEG 1N36O 3G80A 2BOBC 1XMQO 4DR7O 1X59A 1RPRA 4DV2B 2LJ2A 5IY5B 3SPIA 5KUKA 4DV5O 4J9YB 4MVQA 1CP9A 4B7KA 3ETQA 4LWSB 1US6A 3FFQA 2QTOA 2QEXV 1AI4A 1OCCC 2Y69B 1I5XA 4X62B 1HNWO 4NTWA 2YS8A 4LC1A 1SQVH 3B4SA 2PZSA 2GTSA 3LSSA 2QJ1A 1VMGA 2DWEC 5EBMC 3ZEDA 4W4LA 4LF5O 5TISZ 4J80A 1SZTA 4X65O 4O4IB 4B3SO 2EZPA 3OFNG 2OTJV 2OCCB 3L71H 3G71V 3C3SA 4NXNO 1JOYA 2GBOA 3EXAA 2W0XA 1THZA 1XL6A 2XAJA 1FFTB 4ZIBA 3CJHA 1H8HG 3W7TA 1X4TA 5FLXN 4UV9A 4QGPA 3LNMB 4DR2B 5LA6A 5KA6A 2UUCO 1M9NA 3RYCB 1V9PA 4QJFB 1H2NA 3T1YO 2JRIA 1N32O 4DV6O 5FNVA 5KHKA 2YXHA 4Z1VA 4R50A 1AILA 4ZOLB 1EN5A 4BAYA 5K1PA 2UXCB 5JWPA 4X89A 3CP1A 1CPYA 1WP7A 2RQ6A 1EN4A 4X8AA 1AP5A 3CCMV 1IDSA 3B8MA 2EIMC 3P3NA 3ZRVA 2R9IA 2YXLA 4LF7O 2V1DA 3B77A 3T4ZA 4RUEA 1MG1A 1GM8A 1YVWA 1JPXA 3FB6C 4R8CA 4LR3A 3VQXA 4TSFG 5B1OA 4PDMA 5L3DA 2ZD9A 1COWG 1YDXA 3A8TA 2Y4UA 3E8HA 1BT8A 5L3GA 4WFFA 4DW1A 5K1XA 4WBNB 4UV8A 2UUAO 4IYIA 3S3XA 2BTQB 4DR6B 4UXNA 2B1GA 1N34B 1W2BU 4MS2A 4KHPB 3JASA 4H13B 3J81N 5KX5A 4DUYB 2EJRA 4L8JA 2WLKA 2WLLA 4HNAB 5LOVA 3E8GA 1QLEB 3IAYA 5CMUA 1KD1W 2CH7B 2Q69A 3AG4C 4WFHA 2QA4V 3CB2A 1R3IC 1H8EG 1MABG 4YIOA 3G67A 3LSQA 2UXCO 5KHHA 5DM6V 4ABMA 3CMAV 3TXQA 1KB9F 5LBQA 3RYFB 1AB3A 1NH2D 1QVFU 2IH3C 1QHTA 4H0LB 3CMEV 1V54B 4ZHQB 4LP8A 4D6TH 3T1HO 3BPZA 3KG2A 4LH6A 5KAFZ 2YDEA 1F7YA 5JCOC 4I9WA 1BZKA 2YIDA 4O4JB 3FAVB 1KC8W 3K04A 3N2KB 4BWAA 4B3TB 3SJAC 3O9OA 5CA0B 3ZX6A 5IDJA 4DV3O 1AI7A 3ZHRA 5IYZA 2ZR3A 4DK1A 1FFXB 3LDCA 1MOFA 2YEVB 3OT7A 3LDEA 5BMVA 1VQ7V 3CCEV 2QM4A 3GWKC 5KMGB 1F4MA 1KU9A 5LYJA 3AK2A 2UXBO 1NBMG 2XNDG 3F5TA 3ZN0A 4JI7O 1W59A 3JATA 3QO5A 3CEIA 1HNWB 3ZBHA 1P4RA 3CCVV 4PJ0Z 3JD0A 2UXNA 1BMFG 1K8AW 4P30A 4LFAO 4DV4B 4LF5B 3ZN1A 2CUGA 4R6ZA 4XDJA 1G6UA 4FLXA 2FMLA 3RFRA 4F6RB 4OGQB 2DJVA 1VQPV 3AG1C 4LF6B 1I08A 3WU2Z 2AZ0A 3QF7A 1GTOA 2WSSG 3A0BZ 1Y74A 3ETDA 3ZIAG 2PYLA 2WLIA 3DTUB 2R70A 3JD4A 2JGUA 4W4KA 3JATB 4PA7A 1NR1A 2PYJA 2F66C 4DR7B 1K4CC 4UCUA 2QR4A 5CN0A 2EIKB 1NZ6A 1FAFA 1YJNV 1Q6HA 4IT5A 2GSMB 1AJNA 4X1IB 1PNLA 2NN4A 3CC7V 4K8ZA 1SQBH 1XEQA 4PI2A 2UU9B 2VWJA 4B7EA 2WPDG 2Q73A 1VEWA 2VQEB 5GONB 4DV3B 3DSQA 4JI2B 2AZ2A 1VIBA 2HLDG 4O4JA 1OCOB 1E1RG 2ZE8A 2ITDC 4JYBA 5B1NA 3ZHVA 5IWAB 1D5AA 3WFVA 3THOA 4JTCB 1IBKB 4KUMA 2LFSA 2JS5A 3TK1A 4FZ0A 1NR7A 1K9MW 5LMUB 4YY3B 4HBNA 3ABLC 5LGUA 5LYJB 1OCZB 3JAMN 2GV9A 2L6LA 4QNHB 2QWRB 2LGQA 4J7JA 2HR3A 3M7MX 4FFBA 5FPOA 2Q9LA 1R1BA 3ZRWA 3CHXA 5IWAO 3WB0A 1BSMA 1AR4A 5EYPA 2PY5A 4JI8B 5IJ0B 2ZDIC 3TJTA 3HPLC 3MAQA 4X1KA 5J2TA 2ZQMA 4DR5O 1N0NA 1OCZC 5B5EZ 3U10A 4YXWG 3D8CA 4JAAA 3ASNC 3GWOA 2HKOA 3K59A 1BL8A 3IC7A 2JGDA 2ZE7A 4O4HB 1XREA 2P90A 2P4VA 1V55B 4B3SB 2IJJA 2F95B 2L35A 4TQDA 2ITCC 2Q5ZA 1CEZA 1PL0A 3HKEB 4IGGA 3WG7C 4X1IA 3ASOC 1SQXH 4J7KA 1NT2B 2WLJA 1S5LZ 5CB4B 1IURA 4JYAB 5H5NA 1YSCA 2LFRA 4JPRA 2ATKC 2Y0PA 2B9ZA 2VS0A 3M8AA 3SPGA 2ZT9B 4CC6A 5CB4A 4JI4O 3OUSA 2DYRB 2F43G 4HNAA 2EINB 1SQPH 4I7ZB 2ZIOA 4O2AB 3CCLV 4H37A 5DN6G 4UFZA 3AG2B 4MSWC 4I4TB 4X88A 1YJ9V 1KP3A 3B8NA 5LP6C 1N32B 1R3LC 1SQQH 4J10A 3CRQA 4NXNB 3E22A 4NYKA 1LR1A 4EFBA 1VQNV 1DF5A 5E1AC 1VF6C 3SPHA 2QTSA 3T4DA 2AW9A 3TXSA 5LOVB 4FFBB 1GRJA 1SZXA 2XAGA 3E8FA 1P84F 5EK0A 1XUQA 4O2BB 4CC5A 2IH1C 2XHBA 5EBWC 2RNBA 4LFCO 1Q7YW 3APQA 4X65B 1YF2A 4UB8Z 1I94B 4PELA 1R6NA 4O2BA 1K92A 3ZCCA 5JH7B 3AK3A 4GKKB 1S77D 1J5EB 2LW1A 1Y74B 3K57A 1VQ6V 3AG7A 3RT3C 4ZKIA 1L1FA 4P9PA 1FS0G 5IJ9A 3VBBA 3JD1A 2EINC 1XHXA 4MTOA 3LNNA 1YTFD 1T5EA 3H1KH 4MTXA 2Q0OC 3BA9A 4MVSA 1FXHA 3JSLA 4YY3O 3K9AA 4AQYB 3MHHC 1G8MA 2JJ2G 2XAFA 1ENVA 1GK9A 1TVKA 2C2AA 1YXBA 2LW7A 5BR8O 1MSWD 4FLZA 1YEWA 3CC2V 1G4YB 4FLWA 3EFFK 2RJZA 3ZRWB 3RVZA 3ZHUA 1K33A 1U96A 1WP8A 4JI5B 2A9HA 4DXWA 4YHHO 1QR8A 4X64B 5L3CA 4K0KO 1TAEA 3NXSA 2KKWA 1K4DC 2F4VB 2RDCA 1SRYA 5D5PA 5H6RA 3CCQV 1MZEA 3K3WA 2OTLV 4UUJC 1AROP 1ZLZA 3D3IA 1FXKA 1NJIW 4PDRA 2YI8A 1TVKB 3EVKA 4MVZA 2ZM6O 4DR3O 4U3JB 1Q86W 4GX1A 1KBHA 1GO3F 2BTQA 1P49A 1B3QA 4FLTA 1RM1B 4I4TA 4TUYA 4FM0A 5GONA 1NTZH 2ADQB 5KAIZ 2MK3A 1N33O 1HDJA 3K5OA 3SYQA 2M6YA 1YJWV 1GN6A 2DQ0A 3OTOO 2WLNA 4DR2O 5JVDA 3APOA 2IBZH 3ZMVA 3OD4A 3QO8A 3OMIB 5E79Z 3OTFA 1OZ0A 4D7SA 3NR7A 1N34O 3N2GA 3ABKC 1WB8A 1MSDA 2QWPB 5JJNB 1S5JA 3N27A 4I0XA 4BR6A 4GYCB 5H6QA 3JD3A 4DRXA 3M99B 3UO2A 2W6IG 2VQEO 4TUYB 2AHYA 2BOCC 3P32A 5FPRA 2X6AA 1Q6UA 3OUFA 1SQFA 3ABTA 4PV1B 2VQFB 4TWKA 1K73W 2M7WA 1JR9A 4LF8O 1ZUQA 3E2EA 2OCHA 4DV6B 3G4SV 3ZS8C 2YICA 1MA1A 4LFAB 4EB6A 3JASB 3BAAA 2OIEA 2QKCA 3K9SA 2DYSB 3K5LA 2JS3A 3AG3C 2Y48A 3OE7G 4XDKA 2ZM6B 4EB6B 3UQ8A 3G6EV 3ZHSA 4LF6O 4QIWF 3W7XA 4WFBV 5F2VO 2EX3A 4CS3A 3CCJV 4FFKA 1NVPD 5B1AB 3L73H 3T1CA 2Q4PA 1BHAA 5B1BB 4LF8B 1GMGA 2RCVA 3IJ4A 3RBZA 4JI2O 3U11A 1JFFA 1FJGB 4O4HA 2N04A 1S5HC 2W0FC 1SA0A 4DUYO 1Q6IA 3OGIB 2NLJC 2A79B 1NTKH 4I55A 2A06H 1DTOA 3E86A 3JCUZ 4U7OA 2OT5A 1BHBA 2ZDIA 1PV0A 3BY6A 2A0LA 3GB7C 1RSOA 5BR8B 4PA3A 5FL7G 3E35A 1JFFB 2DW4A 4LF9B 2BTOA 2Q68A 4GX0A 3HKCB 2HP8A 1XNRO 4GLXA 4DUZO 2DYSC 2LO1A 2NNUA 1Y76A 2H8PC 3CD6V 1JVMA 4EKWA 1DLBA 2R72A 2A3QA 1M90W 3SPJA 3STZC 1MMMA 5BXZA 4N23A 2DYRC 3OMAB 1VF5B 2AGAA 4O4LB 3AK1A 2GDSA 4B3MB 5JVDB 1M57B 1Y76B 2YI9A 2WLLB 4U3FH 5IT9N 1ORQC 4GT1A 5L3FA 2WLHA 1WNSA 4GKKO 3E22B 4YJ2B 3OEHG 1GM9A 4B08A 5LP6B 4JI5O 1W0KG 2FTKA 1ROPA 4DV4O 4TQFA 3AG2C 3H1LH 1TUBA 4DK0A 2IU3A 2K9PA 5CBFA 2PI4A 2BSKA 1LUWA 2A7WA 2XASA 3H1HH 5CA1B 5EIBD 5JJEB 2DOSA 1S0VA 1PNMA 3RYFA 3C90A 3B2EE 2V4DA 4HAMA 4NTXA 4NKGB 1IBLB 2VRZA 2DQ3A 5EC2C 2AHZA 2DN9A 3VQWA 3DXRA 1VQKV 3IGAC 1DK1A 4WFEA 5CA0A 1I5YA 1XILA 1PKXA 4LF4O 5LGNA 5LXTA 2X6BA 3KCYA 3RYIA 2Q67A 4GX2A 1OHHG 2HJDA 3HKDA 1FFXA 3ABMC 2JK5C 4QPJA 4ICGA 2QWNB 4E4EA 1IVSA 3OAAG 5JQGA 1KKCA 1K7DA 4IHJA 2JGDB 2XTAA 4UVAA 4FZ1A 4OXSA 4WF9V 4PA9A 1PP9H 1J95A 3B40A
chains in the Genus database with same CATH topology
4OPHA 1N36O 3M8AA 2VQEO 1XMQO 1HR0O 4JI4O 4DR7O 1X59A 4JI6O 2LW7A 5BR8O 5BXZA 1D2DA 4LF7O 4X64O 5BY1A 2AGAA 2Z0AA 4JV5O 1IBLO 4X62O 4DR4O 5A2QN 2VQFO 4OPAA 1KUQA 4LF8O 4YHHO 4DV7O 2UXBO 1IBKO 3F5TA 5IT9N 4JI7O 4JI8O 4JI3O 4DV5O 4K0KO 4GKKO 2UUBO 1YZBA 3JAMN 4JI5O 4DV4O 2UUAO 1NS1A 2UU9O 1R1BA 1HNWO 4GKJO 4X66O 4LFAO 4B3MO 4LF6O 4JI1O 4OX9O 5IWAO 2F4VO 1R6TA 4LFBO 1XNQO 2DOSA 3J81N 4LF9O 2ZM6O 4DR3O 2DJVA 4LF5O 4LFCO 4X65O 4B3SO 5LMUO 1I94O 4JI2O 5LL6Y 4NXNO 4DR5O 1DK1A 1FKAO 2E5LO 3J80N 4DV2O 4DUYO 1HNXO 1N33O 4LF4O 1A32A 3RT3C 5FLXN 3OTOO 1FYJA 2UXCO 2FKXA 1FJGO 4DR2O 4DV1O 4AQYO 2HHHO 4DR1O 4JI0O 1IBMO 2UUCO 4NXMO 1AB3A 4JYAO 1HNZO 3SDLA 3T1HO 3T1YO 2JRIA 2ZKOA 1XEQA 4DV6O 1N32O 4B3RO 1F7YA 4DV0O 1N34O 1J5EO 1AILA 2UXDO 3J7AU 1XMOO 1G1XB 1XNRO 4DUZO 2N74A 4YY3O 5H5NA 4A5UB 4DV3O 4B3TO 5LMNO 4DR6O 4KHPO 3R66A 3O65A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OPH A;  1N36 O;  3M8A A;  2VQE O;  1XMQ O;  1HR0 O;  4JI4 O;  4DR7 O;  1X59 A;  4JI6 O;  2LW7 A;  5BR8 O;  5BXZ A;  1D2D A;  4LF7 O;  4X64 O;  5BY1 A;  2AGA A;  2Z0A A;  4JV5 O;  1IBL O;  4X62 O;  4DR4 O;  5A2Q N;  2VQF O;  4OPA A;  1KUQ A;  4LF8 O;  4YHH O;  4DV7 O;  2UXB O;  1IBK O;  3F5T A;  5IT9 N;  4JI7 O;  4JI8 O;  4JI3 O;  4DV5 O;  4K0K O;  4GKK O;  2UUB O;  1YZB A;  3JAM N;  4JI5 O;  4DV4 O;  2UUA O;  1NS1 A;  2UU9 O;  1R1B A;  1HNW O;  4GKJ O;  4X66 O;  4LFA O;  4B3M O;  4LF6 O;  4JI1 O;  4OX9 O;  5IWA O;  2F4V O;  1R6T A;  4LFB O;  1XNQ O;  2DOS A;  3J81 N;  4LF9 O;  2ZM6 O;  4DR3 O;  2DJV A;  4LF5 O;  4LFC O;  4X65 O;  4B3S O;  5LMU O;  1I94 O;  4JI2 O;  5LL6 Y;  4NXN O;  4DR5 O;  1DK1 A;  1FKA O;  2E5L O;  3J80 N;  4DV2 O;  4DUY O;  1HNX O;  1N33 O;  4LF4 O;  1A32 A;  3RT3 C;  5FLX N;  3OTO O;  1FYJ A;  2UXC O;  2FKX A;  1FJG O;  4DR2 O;  4DV1 O;  4AQY O;  2HHH O;  4DR1 O;  4JI0 O;  1IBM O;  2UUC O;  4NXM O;  1AB3 A;  4JYA O;  1HNZ O;  3SDL A;  3T1H O;  3T1Y O;  2JRI A;  2ZKO A;  1XEQ A;  4DV6 O;  1N32 O;  4B3R O;  1F7Y A;  4DV0 O;  1N34 O;  1J5E O;  1AIL A;  2UXD O;  3J7A U;  1XMO O;  1G1X B;  1XNR O;  4DUZ O;  2N74 A;  4YY3 O;  5H5N A;  4A5U B;  4DV3 O;  4B3T O;  5LMN O;  4DR6 O;  4KHP O;  3R66 A;  3O65 A; 
#chains in the Genus database with same CATH topology
 1VF7 A;  3HKB A;  1F51 A;  4FK5 C;  4HZ3 A;  5JQG B;  5BY1 A;  4JV5 O;  3ICX A;  2E5L B;  5DEC A;  2V7Q G;  2VWK A;  1R3K C;  2YC0 A;  3FKS G;  1SES A;  1ZAU A;  5EYP B;  4CH6 A;  2GUZ B;  5GTH Z;  4G28 B;  4HYO A;  2CE4 A;  4JI8 O;  3B09 A;  3OM3 B;  3SYP A;  3QG5 A;  1VAR A;  1YZB A;  2D2C B;  1SF9 A;  1WAZ A;  3BA8 A;  1UPG A;  5EIB C;  2WA4 A;  5B1A C;  1P7B A;  3ZRS A;  3OW2 U;  4YIP A;  1FXV A;  2FYU H;  3ZMU A;  4PDV A;  2HEP A;  3KZI Z;  3BHP A;  1EFR G;  5KHJ A;  4WBN A;  2HHH B;  1OCO C;  3CYO A;  2KG7 A;  4G27 B;  4I0X B;  1GH6 A;  2QWO B;  3QNE A;  2RN9 A;  3IC9 A;  2P6J A;  2QGN A;  3ETE A;  1Q82 W;  3W7U A;  2QE7 G;  3H01 A;  3AEI A;  4J41 A;  1SKV A;  3P30 A;  1DF4 A;  1WLE A;  3CX5 F;  2K1E A;  2P7T C;  1WA8 B;  3D3Q A;  4P2Z A;  4DV1 O;  2CH7 A;  3H9V A;  1E1Q G;  3HKD B;  5JJJ B;  3SDL A;  5BZB A;  5IJ9 B;  3T1Y B;  3CRR A;  2XUM A;  4DV0 O;  1W0J G;  4K0K B;  1HR0 B;  1DGS A;  4Q6G A;  2LGW A;  1AJP A;  1G1X B;  4ZBM A;  4AIL C;  1SS3 A;  3IFX A;  1KYO F;  4A5U B;  5LMN B;  3AG1 B;  1JA8 A;  1O9G A;  2UXX A;  3K5M A;  4LNU A;  1NU1 H;  3P3P A;  3ABU A;  1D2D A;  2IJH A;  4X64 O;  1BQZ A;  2X6C A;  3JYC A;  2EIK C;  4X62 O;  1ZSP A;  5A2Q N;  1E79 G;  3E89 A;  3RVY A;  4OPA A;  1Q8I A;  2D3O W;  5D5Q A;  5IJ0 A;  3JAL B;  3CCR V;  5KA5 A;  3K79 A;  3SPC A;  4LF7 B;  1QU7 A;  2IJI A;  2UUB O;  1N33 B;  4O4I A;  1NQT A;  1ZL8 B;  3ABL B;  1RM1 C;  4MTF A;  1TGO A;  3ZMS A;  3OGC C;  4LH7 A;  4PDL A;  3ASO B;  4GKJ O;  4JI1 O;  3TCU A;  1VQ8 V;  1NH2 B;  2P22 C;  4RWU A;  3ZHT A;  3BCC H;  3SYA A;  4J11 A;  2UUB B;  2EJ7 A;  3RYC A;  2N05 A;  2BCC H;  4JZG A;  3S3W A;  4DUZ B;  1I94 O;  1YTF B;  5LA6 B;  5B1B C;  1QLE C;  4DO2 A;  3LUT B;  2OIG A;  3CXC U;  1HNX O;  5KHI A;  2LQT A;  4CH5 A;  1QCE A;  1OCR C;  1LNQ A;  2LP7 A;  3VOU A;  4OX9 B;  1RSO B;  1I7F A;  4PA6 A;  4YHH B;  2EIL C;  3KCX A;  3LSU A;  2ARH A;  1M5I A;  1AVM A;  4JAU A;  4BW5 A;  1UJW B;  5IYD O;  1IZ3 A;  4DR4 B;  1HNZ O;  5IYZ B;  3F7V C;  1EBO A;  4O2A A;  4BIO A;  2ZCE A;  1XNQ B;  4DV0 B;  1R6K A;  3OR6 C;  3W7W A;  1CXZ B;  3F5W C;  1OCC B;  4TT3 G;  1M57 C;  4Z2W A;  3R66 A;  2P5O A;  1N8R W;  2UXD B;  1NTM H;  1HR0 O;  1QBZ A;  4PD4 F;  4NVP A;  2CTR A;  4Z1M G;  4MVU A;  5EBL C;  1XNR B;  1D5N A;  4MT8 A;  3VQY A;  1JMK C;  2CK3 G;  3DXR B;  4D7T A;  5FNV B;  5LHG A;  4DV7 O;  3QVN A;  2QSA A;  3K06 A;  1Y67 A;  3E8B A;  4JI7 B;  1TUB B;  4X9Q A;  2R9R B;  2CGO A;  4MVR A;  5L3E A;  2DWD C;  2IM9 A;  1O9H A;  3BEH A;  1N36 B;  4JAV A;  1NVP B;  5JH7 A;  5JCO A;  2EBO A;  1JCH A;  1NS1 A;  2UU9 O;  2EIJ B;  2F4V O;  1PM9 A;  2QDO A;  3BAB A;  1XNQ O;  2CGN A;  4LFB B;  4TV8 A;  5LP6 A;  1FXK B;  5J2U A;  4QE7 A;  1ZWI C;  2UXB B;  4AI8 A;  3JAL A;  3R65 A;  3UCS C;  2E5L O;  2ZIN A;  2WAM A;  3A0R A;  3DC6 A;  1WPB A;  4UCT A;  1EM1 A;  1AR5 A;  4UB6 Z;  5DED A;  2PGG A;  2HJF C;  2YIB A;  2ZXW C;  4JI0 O;  2W6J G;  1XMO B;  4TOI A;  1IBM O;  1XHZ A;  2Z5U A;  1F4N A;  1KMI Z;  3TET A;  1GM7 A;  2ZKO A;  4I50 B;  3OR7 C;  3C3T A;  3BRC A;  5B3S C;  3LDD A;  4KFM A;  2JVD A;  1SC5 B;  3SJB C;  2UXD O;  1XMO O;  5J2U B;  4AHC A;  3DC5 A;  4DW0 A;  1M56 C;  2E3C A;  5J9P C;  2OCC C;  1XOU A;  3UKM A;  2IW5 A;  4KHP O;  3WG7 B;  1GN2 A;  4CS2 A;  3HKE A;  3SGI A;  3MDS A;  3Q4H A;  3SYO A;  5EZY A;  1IBL O;  3SJQ C;  4H33 A;  4JYC A;  2GHY A;  3CSX A;  4CBC A;  1KUQ A;  4UCS A;  3K58 A;  1M56 B;  4J9Z B;  1S72 V;  4BIU A;  5H2F Z;  2EIM B;  1XDC A;  1KQS U;  4ASU G;  2PI5 A;  1JQ0 A;  1VQM V;  2QM8 A;  4I50 A;  4LF4 B;  2P4K A;  2Y4T A;  2GTA A;  4X20 A;  4C7U A;  4IYH A;  2KSD A;  2ODM A;  4EFE A;  4GCZ A;  3D36 A;  3ABM B;  4UVC A;  1KEC A;  3L75 H;  2GUZ A;  4OX9 O;  4J42 A;  3UO3 A;  1MZF A;  1IX9 A;  2Z3Y A;  3KKY A;  3UT5 B;  4IL6 Z;  5IYB O;  5L3B A;  2DMX A;  3I5D A;  5LGT A;  2ZIM A;  3QTC A;  2Q6A A;  5C93 A;  4H44 B;  1H38 A;  4ZI7 A;  1YIJ V;  3HKC A;  4PHZ A;  2Y0I A;  3J80 N;  1WJZ A;  3I55 V;  1XMQ B;  2E75 B;  1A32 A;  4JI1 B;  2CTP A;  2O57 A;  1QVG U;  4DR1 O;  4LFC B;  3RW0 A;  1VQ4 V;  1H2M A;  1K3E A;  4NR1 A;  3MHS C;  5GTI Z;  5LXT B;  4X66 B;  4X1Y A;  2N74 A;  2UUA B;  4FLV A;  1M4U A;  1YIT V;  3ABK B;  1RFY A;  3JAR A;  3H1I H;  1FXK C;  3K03 A;  1IXM A;  4KXR A;  2Q8V A;  1BCC H;  3CS5 A;  3L70 H;  1TA8 A;  1JJO A;  3ZMZ A;  1NI8 A;  3RYI B;  3RGB A;  1XI1 A;  2OYQ A;  3A0H Z;  3X2Q C;  3ZRX A;  1BQ0 A;  2NR5 A;  4WFG A;  4I5S A;  4R7C A;  4FJC C;  2BSK B;  3SR2 C;  4DV5 B;  3PJS K;  3FAV A;  2AXT Z;  1WPX A;  2ILM A;  3K0D A;  1VF6 A;  3CCU V;  1SQG A;  5IYC O;  1R73 A;  4DYL A;  1ZTE A;  4KP4 A;  4DV1 B;  4I55 B;  4DR1 B;  4YJ3 A;  1V55 C;  2YIA A;  4B3M O;  5IE9 A;  1K5S A;  1Q90 D;  1OCR B;  4FLY A;  4IIJ B;  3QO7 A;  2P06 A;  2JEU A;  1MNG A;  5KHG A;  2ETN A;  1K97 A;  3ZHQ A;  1QLN A;  1Y6X A;  5H9C A;  2XOK G;  4DV2 O;  1B6Q A;  3H1J H;  1VQ5 V;  1EZJ A;  4JAS A;  3CPW U;  1UFI A;  2EUL A;  1M93 A;  3X2Q B;  4FLU A;  3L74 H;  1K5Q A;  2WWW A;  4UVB A;  3W7S A;  4NXM O;  4JTA B;  4U3J A;  1IXB A;  3FB8 C;  1RP3 B;  3BFR A;  3FB5 C;  4FIP C;  5EZY B;  3CXH F;  1GAX A;  3UM7 A;  2PUS A;  2KG7 B;  4QE9 A;  4NXM B;  4FPP A;  2XT9 A;  4FM2 A;  1SA0 B;  4B3T O;  1LUV A;  1Z2G A;  4X1K B;  5J2T B;  4DR6 O;  3JSN A;  1Y4M A;  1SET A;  2DE0 X;  3FYE B;  1S3J A;  3CRM A;  3EHB B;  5LHH A;  1EZV H;  4DV7 B;  3T1H B;  2FL4 A;  4U7N A;  4FVM A;  4MVO A;  2B5U A;  1GN3 A;  5IY5 C;  1Z5V A;  1WN7 A;  2ZR2 A;  4PI0 A;  3K0G A;  5LHI A;  3AG3 B;  4RQE A;  1IBK O;  2ZE5 A;  3BVO A;  4PA4 A;  1VQO V;  2HG5 C;  3A2F A;  3CWB H;  4X1Y B;  1N4C A;  3FB7 C;  3CC4 V;  1BS3 A;  3FX7 A;  3D36 C;  3HR0 A;  1HP8 A;  1XBL A;  2PTM A;  2H94 A;  1ZL8 A;  4KL1 A;  1ZX3 A;  1HW7 A;  1PD3 A;  4JGS A;  4YJ3 B;  1WA8 A;  1Y66 A;  5KUM A;  1HNZ B;  3DGE A;  1JJ2 U;  2KQX A;  5HFM A;  1KKD A;  4LF9 O;  2ZNI A;  1NKD A;  1YHQ V;  1PNK A;  3VQV A;  3ETG A;  1B06 A;  4YJ2 A;  4CH4 A;  4E2L A;  1L0N H;  5CBG A;  2Q7G A;  4CS4 A;  2G38 A;  1KP2 A;  2ADP A;  3AG4 B;  4MW3 A;  4L87 A;  2CAZ C;  4LWS A;  2E74 B;  1FYJ A;  1P7G A;  1Q43 A;  1TUE B;  2FKX A;  1FJG O;  3N2G B;  4XBF A;  1H2K A;  1FPO A;  1RPO A;  1SER A;  4AQY O;  2Q7H A;  2JDI G;  4CH3 A;  2XAH A;  4O4L A;  4P9O A;  1GKF A;  3RWR D;  3JAW B;  5A9G A;  2H3O A;  3U0Z A;  3OTO B;  3ZJZ A;  3N2K A;  1R3J C;  4JYY A;  3ASN B;  4B3R O;  4IIJ A;  4JI0 B;  4RQF A;  2CTW A;  1L8D A;  2Q7E A;  3CE2 A;  3J7A U;  2YSU B;  5KX5 B;  1L0L H;  4MVM A;  2IJK A;  4X20 B;  3GVM A;  1URF A;  4B3R B;  2B1I A;  4DR3 B;  2F1M A;  4TV8 B;  4RO2 A;  3CJH B;  1Q5O A;  1XL4 A;  3HB3 B;  4JTD B;  2Z0A A;  2KB1 A;  4K8X A;  3ML0 A;  2UUC B;  2X7R B;  2VQF O;  2Y69 C;  1IBM B;  1VQ9 V;  1Q3E A;  4F6E A;  1JX9 A;  1H2L A;  5C8Y A;  1VQL V;  3G6B A;  2BE3 A;  4IHJ B;  1N0J A;  1BE3 H;  1VP7 A;  1AI5 A;  2ZE6 A;  2WA3 A;  2YIB D;  4ZOL A;  3UT5 A;  5KLV H;  2HVK C;  1K34 A;  1QR9 A;  4X66 O;  2YXY A;  4CZZ A;  4TV9 B;  2EIL B;  3CCS V;  2WLI B;  1GN4 A;  1U97 A;  2QKS A;  4LFB O;  2E76 B;  3JD2 A;  4TV9 A;  2FB5 A;  3CRA A;  4GX5 A;  1AP6 A;  4NTY A;  2Q0A A;  1AJQ A;  2JEX A;  3K5N A;  4K3A A;  4XDL A;  5B3S B;  5C8Y B;  3WB1 A;  5CA1 A;  2R9A A;  3I56 V;  3HKB B;  2EZO A;  3PN1 A;  2HFE C;  1WB7 A;  3FYI B;  2EIJ C;  1QNM A;  4Q20 A;  4UCO A;  1AI6 A;  4LNU B;  4GKJ B;  2ZXW B;  3K08 A;  4WCE V;  3FD9 A;  2HHH O;  4JYA O;  2JIZ G;  2OWO A;  2RMK B;  4UCV A;  3JAW A;  3STL C;  4UCR A;  3JAR B;  4BW9 A;  1F23 A;  1J5E O;  4JI4 B;  1BGY H;  4MTG A;  5EC1 C;  3MD0 A;  4I9Q A;  3SYC A;  1XQ8 A;  5HFL A;  2ZNJ A;  3SJC C;  3O65 A;  1HNX B;  4OPH A;  1HWY A;  4F4L A;  1V54 C;  5B66 Z;  4JI6 O;  5CA3 A;  4DR5 B;  1FD9 A;  4JI6 B;  4LCU C;  4JI3 B;  4FM1 A;  2JJ1 G;  4G2K A;  2IU0 A;  2YUA A;  3RYH B;  3JCZ A;  2X0L A;  4JV5 B;  5GW7 A;  4DR4 O;  3E83 A;  2YEV A;  3ZMT A;  1YI2 V;  1B04 A;  2CTQ A;  2QKA A;  3T2M A;  4ZHQ A;  4JI3 O;  1YCI A;  5CBH A;  4QPK A;  4RAI A;  4MW8 A;  4F6R A;  2WLM A;  4FMT A;  2QM7 A;  1I0H A;  4JZ2 A;  4GZR B;  4K35 A;  1H2S B;  3F7Y C;  1S76 D;  1AR1 B;  4DRX B;  1R6T A;  2CDY A;  4WFA V;  4RUF A;  3Q4H B;  3WB2 A;  1QQC A;  3TGU H;  5BMV B;  1OV9 A;  4NB5 A;  1PL4 A;  3L9D A;  5LMU O;  2F93 B;  3RYH A;  5ITZ B;  5LL6 Y;  3L72 H;  1FKA O;  4LBE C;  5KMG A;  1Z5W A;  2P67 A;  4JF3 A;  3JAK B;  5ITZ A;  1M1K W;  2HVJ C;  4J7Z A;  2QWQ B;  3CRC A;  1EN6 A;  1OJH A;  1PPJ H;  4BIZ A;  4N21 A;  3JAK A;  1H2G A;  1Q81 W;  3RN4 A;  2F23 A;  2MW2 B;  3OMN B;  4EEQ A;  5AG2 A;  2XAQ A;  2PF4 E;  5LMN O;  4GUN A;  4ZI7 B;  3OEE G;  1N36 O;  3G80 A;  2BOB C;  1XMQ O;  4DR7 O;  1X59 A;  1RPR A;  4DV2 B;  2LJ2 A;  5IY5 B;  3SPI A;  5KUK A;  4DV5 O;  4J9Y B;  4MVQ A;  1CP9 A;  4B7K A;  3ETQ A;  4LWS B;  1US6 A;  3FFQ A;  2QTO A;  2QEX V;  1AI4 A;  1OCC C;  2Y69 B;  1I5X A;  4X62 B;  1HNW O;  4NTW A;  2YS8 A;  4LC1 A;  1SQV H;  3B4S A;  2PZS A;  2GTS A;  3LSS A;  2QJ1 A;  1VMG A;  2DWE C;  5EBM C;  3ZED A;  4W4L A;  4LF5 O;  5TIS Z;  4J80 A;  1SZT A;  4X65 O;  4O4I B;  4B3S O;  2EZP A;  3OFN G;  2OTJ V;  2OCC B;  3L71 H;  3G71 V;  3C3S A;  4NXN O;  1JOY A;  2GBO A;  3EXA A;  2W0X A;  1THZ A;  1XL6 A;  2XAJ A;  1FFT B;  4ZIB A;  3CJH A;  1H8H G;  3W7T A;  1X4T A;  5FLX N;  4UV9 A;  4QGP A;  3LNM B;  4DR2 B;  5LA6 A;  5KA6 A;  2UUC O;  1M9N A;  3RYC B;  1V9P A;  4QJF B;  1H2N A;  3T1Y O;  2JRI A;  1N32 O;  4DV6 O;  5FNV A;  5KHK A;  2YXH A;  4Z1V A;  4R50 A;  1AIL A;  4ZOL B;  1EN5 A;  4BAY A;  5K1P A;  2UXC B;  5JWP A;  4X89 A;  3CP1 A;  1CPY A;  1WP7 A;  2RQ6 A;  1EN4 A;  4X8A A;  1AP5 A;  3CCM V;  1IDS A;  3B8M A;  2EIM C;  3P3N A;  3ZRV A;  2R9I A;  2YXL A;  4LF7 O;  2V1D A;  3B77 A;  3T4Z A;  4RUE A;  1MG1 A;  1GM8 A;  1YVW A;  1JPX A;  3FB6 C;  4R8C A;  4LR3 A;  3VQX A;  4TSF G;  5B1O A;  4PDM A;  5L3D A;  2ZD9 A;  1COW G;  1YDX A;  3A8T A;  2Y4U A;  3E8H A;  1BT8 A;  5L3G A;  4WFF A;  4DW1 A;  5K1X A;  4WBN B;  4UV8 A;  2UUA O;  4IYI A;  3S3X A;  2BTQ B;  4DR6 B;  4UXN A;  2B1G A;  1N34 B;  1W2B U;  4MS2 A;  4KHP B;  3JAS A;  4H13 B;  3J81 N;  5KX5 A;  4DUY B;  2EJR A;  4L8J A;  2WLK A;  2WLL A;  4HNA B;  5LOV A;  3E8G A;  1QLE B;  3IAY A;  5CMU A;  1KD1 W;  2CH7 B;  2Q69 A;  3AG4 C;  4WFH A;  2QA4 V;  3CB2 A;  1R3I C;  1H8E G;  1MAB G;  4YIO A;  3G67 A;  3LSQ A;  2UXC O;  5KHH A;  5DM6 V;  4ABM A;  3CMA V;  3TXQ A;  1KB9 F;  5LBQ A;  3RYF B;  1AB3 A;  1NH2 D;  1QVF U;  2IH3 C;  1QHT A;  4H0L B;  3CME V;  1V54 B;  4ZHQ B;  4LP8 A;  4D6T H;  3T1H O;  3BPZ A;  3KG2 A;  4LH6 A;  5KAF Z;  2YDE A;  1F7Y A;  5JCO C;  4I9W A;  1BZK A;  2YID A;  4O4J B;  3FAV B;  1KC8 W;  3K04 A;  3N2K B;  4BWA A;  4B3T B;  3SJA C;  3O9O A;  5CA0 B;  3ZX6 A;  5IDJ A;  4DV3 O;  1AI7 A;  3ZHR A;  5IYZ A;  2ZR3 A;  4DK1 A;  1FFX B;  3LDC A;  1MOF A;  2YEV B;  3OT7 A;  3LDE A;  5BMV A;  1VQ7 V;  3CCE V;  2QM4 A;  3GWK C;  5KMG B;  1F4M A;  1KU9 A;  5LYJ A;  3AK2 A;  2UXB O;  1NBM G;  2XND G;  3F5T A;  3ZN0 A;  4JI7 O;  1W59 A;  3JAT A;  3QO5 A;  3CEI A;  1HNW B;  3ZBH A;  1P4R A;  3CCV V;  4PJ0 Z;  3JD0 A;  2UXN A;  1BMF G;  1K8A W;  4P30 A;  4LFA O;  4DV4 B;  4LF5 B;  3ZN1 A;  2CUG A;  4R6Z A;  4XDJ A;  1G6U A;  4FLX A;  2FML A;  3RFR A;  4F6R B;  4OGQ B;  2DJV A;  1VQP V;  3AG1 C;  4LF6 B;  1I08 A;  3WU2 Z;  2AZ0 A;  3QF7 A;  1GTO A;  2WSS G;  3A0B Z;  1Y74 A;  3ETD A;  3ZIA G;  2PYL A;  2WLI A;  3DTU B;  2R70 A;  3JD4 A;  2JGU A;  4W4K A;  3JAT B;  4PA7 A;  1NR1 A;  2PYJ A;  2F66 C;  4DR7 B;  1K4C C;  4UCU A;  2QR4 A;  5CN0 A;  2EIK B;  1NZ6 A;  1FAF A;  1YJN V;  1Q6H A;  4IT5 A;  2GSM B;  1AJN A;  4X1I B;  1PNL A;  2NN4 A;  3CC7 V;  4K8Z A;  1SQB H;  1XEQ A;  4PI2 A;  2UU9 B;  2VWJ A;  4B7E A;  2WPD G;  2Q73 A;  1VEW A;  2VQE B;  5GON B;  4DV3 B;  3DSQ A;  4JI2 B;  2AZ2 A;  1VIB A;  2HLD G;  4O4J A;  1OCO B;  1E1R G;  2ZE8 A;  2ITD C;  4JYB A;  5B1N A;  3ZHV A;  5IWA B;  1D5A A;  3WFV A;  3THO A;  4JTC B;  1IBK B;  4KUM A;  2LFS A;  2JS5 A;  3TK1 A;  4FZ0 A;  1NR7 A;  1K9M W;  5LMU B;  4YY3 B;  4HBN A;  3ABL C;  5LGU A;  5LYJ B;  1OCZ B;  3JAM N;  2GV9 A;  2L6L A;  4QNH B;  2QWR B;  2LGQ A;  4J7J A;  2HR3 A;  3M7M X;  4FFB A;  5FPO A;  2Q9L A;  1R1B A;  3ZRW A;  3CHX A;  5IWA O;  3WB0 A;  1BSM A;  1AR4 A;  5EYP A;  2PY5 A;  4JI8 B;  5IJ0 B;  2ZDI C;  3TJT A;  3HPL C;  3MAQ A;  4X1K A;  5J2T A;  2ZQM A;  4DR5 O;  1N0N A;  1OCZ C;  5B5E Z;  3U10 A;  4YXW G;  3D8C A;  4JAA A;  3ASN C;  3GWO A;  2HKO A;  3K59 A;  1BL8 A;  3IC7 A;  2JGD A;  2ZE7 A;  4O4H B;  1XRE A;  2P90 A;  2P4V A;  1V55 B;  4B3S B;  2IJJ A;  2F95 B;  2L35 A;  4TQD A;  2ITC C;  2Q5Z A;  1CEZ A;  1PL0 A;  3HKE B;  4IGG A;  3WG7 C;  4X1I A;  3ASO C;  1SQX H;  4J7K A;  1NT2 B;  2WLJ A;  1S5L Z;  5CB4 B;  1IUR A;  4JYA B;  5H5N A;  1YSC A;  2LFR A;  4JPR A;  2ATK C;  2Y0P A;  2B9Z A;  2VS0 A;  3M8A A;  3SPG A;  2ZT9 B;  4CC6 A;  5CB4 A;  4JI4 O;  3OUS A;  2DYR B;  2F43 G;  4HNA A;  2EIN B;  1SQP H;  4I7Z B;  2ZIO A;  4O2A B;  3CCL V;  4H37 A;  5DN6 G;  4UFZ A;  3AG2 B;  4MSW C;  4I4T B;  4X88 A;  1YJ9 V;  1KP3 A;  3B8N A;  5LP6 C;  1N32 B;  1R3L C;  1SQQ H;  4J10 A;  3CRQ A;  4NXN B;  3E22 A;  4NYK A;  1LR1 A;  4EFB A;  1VQN V;  1DF5 A;  5E1A C;  1VF6 C;  3SPH A;  2QTS A;  3T4D A;  2AW9 A;  3TXS A;  5LOV B;  4FFB B;  1GRJ A;  1SZX A;  2XAG A;  3E8F A;  1P84 F;  5EK0 A;  1XUQ A;  4O2B B;  4CC5 A;  2IH1 C;  2XHB A;  5EBW C;  2RNB A;  4LFC O;  1Q7Y W;  3APQ A;  4X65 B;  1YF2 A;  4UB8 Z;  1I94 B;  4PEL A;  1R6N A;  4O2B A;  1K92 A;  3ZCC A;  5JH7 B;  3AK3 A;  4GKK B;  1S77 D;  1J5E B;  2LW1 A;  1Y74 B;  3K57 A;  1VQ6 V;  3AG7 A;  3RT3 C;  4ZKI A;  1L1F A;  4P9P A;  1FS0 G;  5IJ9 A;  3VBB A;  3JD1 A;  2EIN C;  1XHX A;  4MTO A;  3LNN A;  1YTF D;  1T5E A;  3H1K H;  4MTX A;  2Q0O C;  3BA9 A;  4MVS A;  1FXH A;  3JSL A;  4YY3 O;  3K9A A;  4AQY B;  3MHH C;  1G8M A;  2JJ2 G;  2XAF A;  1ENV A;  1GK9 A;  1TVK A;  2C2A A;  1YXB A;  2LW7 A;  5BR8 O;  1MSW D;  4FLZ A;  1YEW A;  3CC2 V;  1G4Y B;  4FLW A;  3EFF K;  2RJZ A;  3ZRW B;  3RVZ A;  3ZHU A;  1K33 A;  1U96 A;  1WP8 A;  4JI5 B;  2A9H A;  4DXW A;  4YHH O;  1QR8 A;  4X64 B;  5L3C A;  4K0K O;  1TAE A;  3NXS A;  2KKW A;  1K4D C;  2F4V B;  2RDC A;  1SRY A;  5D5P A;  5H6R A;  3CCQ V;  1MZE A;  3K3W A;  2OTL V;  4UUJ C;  1ARO P;  1ZLZ A;  3D3I A;  1FXK A;  1NJI W;  4PDR A;  2YI8 A;  1TVK B;  3EVK A;  4MVZ A;  2ZM6 O;  4DR3 O;  4U3J B;  1Q86 W;  4GX1 A;  1KBH A;  1GO3 F;  2BTQ A;  1P49 A;  1B3Q A;  4FLT A;  1RM1 B;  4I4T A;  4TUY A;  4FM0 A;  5GON A;  1NTZ H;  2ADQ B;  5KAI Z;  2MK3 A;  1N33 O;  1HDJ A;  3K5O A;  3SYQ A;  2M6Y A;  1YJW V;  1GN6 A;  2DQ0 A;  3OTO O;  2WLN A;  4DR2 O;  5JVD A;  3APO A;  2IBZ H;  3ZMV A;  3OD4 A;  3QO8 A;  3OMI B;  5E79 Z;  3OTF A;  1OZ0 A;  4D7S A;  3NR7 A;  1N34 O;  3N2G A;  3ABK C;  1WB8 A;  1MSD A;  2QWP B;  5JJN B;  1S5J A;  3N27 A;  4I0X A;  4BR6 A;  4GYC B;  5H6Q A;  3JD3 A;  4DRX A;  3M99 B;  3UO2 A;  2W6I G;  2VQE O;  4TUY B;  2AHY A;  2BOC C;  3P32 A;  5FPR A;  2X6A A;  1Q6U A;  3OUF A;  1SQF A;  3ABT A;  4PV1 B;  2VQF B;  4TWK A;  1K73 W;  2M7W A;  1JR9 A;  4LF8 O;  1ZUQ A;  3E2E A;  2OCH A;  4DV6 B;  3G4S V;  3ZS8 C;  2YIC A;  1MA1 A;  4LFA B;  4EB6 A;  3JAS B;  3BAA A;  2OIE A;  2QKC A;  3K9S A;  2DYS B;  3K5L A;  2JS3 A;  3AG3 C;  2Y48 A;  3OE7 G;  4XDK A;  2ZM6 B;  4EB6 B;  3UQ8 A;  3G6E V;  3ZHS A;  4LF6 O;  4QIW F;  3W7X A;  4WFB V;  5F2V O;  2EX3 A;  4CS3 A;  3CCJ V;  4FFK A;  1NVP D;  5B1A B;  3L73 H;  3T1C A;  2Q4P A;  1BHA A;  5B1B B;  4LF8 B;  1GMG A;  2RCV A;  3IJ4 A;  3RBZ A;  4JI2 O;  3U11 A;  1JFF A;  1FJG B;  4O4H A;  2N04 A;  1S5H C;  2W0F C;  1SA0 A;  4DUY O;  1Q6I A;  3OGI B;  2NLJ C;  2A79 B;  1NTK H;  4I55 A;  2A06 H;  1DTO A;  3E86 A;  3JCU Z;  4U7O A;  2OT5 A;  1BHB A;  2ZDI A;  1PV0 A;  3BY6 A;  2A0L A;  3GB7 C;  1RSO A;  5BR8 B;  4PA3 A;  5FL7 G;  3E35 A;  1JFF B;  2DW4 A;  4LF9 B;  2BTO A;  2Q68 A;  4GX0 A;  3HKC B;  2HP8 A;  1XNR O;  4GLX A;  4DUZ O;  2DYS C;  2LO1 A;  2NNU A;  1Y76 A;  2H8P C;  3CD6 V;  1JVM A;  4EKW A;  1DLB A;  2R72 A;  2A3Q A;  1M90 W;  3SPJ A;  3STZ C;  1MMM A;  5BXZ A;  4N23 A;  2DYR C;  3OMA B;  1VF5 B;  2AGA A;  4O4L B;  3AK1 A;  2GDS A;  4B3M B;  5JVD B;  1M57 B;  1Y76 B;  2YI9 A;  2WLL B;  4U3F H;  5IT9 N;  1ORQ C;  4GT1 A;  5L3F A;  2WLH A;  1WNS A;  4GKK O;  3E22 B;  4YJ2 B;  3OEH G;  1GM9 A;  4B08 A;  5LP6 B;  4JI5 O;  1W0K G;  2FTK A;  1ROP A;  4DV4 O;  4TQF A;  3AG2 C;  3H1L H;  1TUB A;  4DK0 A;  2IU3 A;  2K9P A;  5CBF A;  2PI4 A;  2BSK A;  1LUW A;  2A7W A;  2XAS A;  3H1H H;  5CA1 B;  5EIB D;  5JJE B;  2DOS A;  1S0V A;  1PNM A;  3RYF A;  3C90 A;  3B2E E;  2V4D A;  4HAM A;  4NTX A;  4NKG B;  1IBL B;  2VRZ A;  2DQ3 A;  5EC2 C;  2AHZ A;  2DN9 A;  3VQW A;  3DXR A;  1VQK V;  3IGA C;  1DK1 A;  4WFE A;  5CA0 A;  1I5Y A;  1XIL A;  1PKX A;  4LF4 O;  5LGN A;  5LXT A;  2X6B A;  3KCY A;  3RYI A;  2Q67 A;  4GX2 A;  1OHH G;  2HJD A;  3HKD A;  1FFX A;  3ABM C;  2JK5 C;  4QPJ A;  4ICG A;  2QWN B;  4E4E A;  1IVS A;  3OAA G;  5JQG A;  1KKC A;  1K7D A;  4IHJ A;  2JGD B;  2XTA A;  4UVA A;  4FZ1 A;  4OXS A;  4WF9 V;  4PA9 A;  1PP9 H;  1J95 A;  3B40 A; 
#chains in the Genus database with same CATH homology
 4OPH A;  1N36 O;  3M8A A;  2VQE O;  1XMQ O;  1HR0 O;  4JI4 O;  4DR7 O;  1X59 A;  4JI6 O;  2LW7 A;  5BR8 O;  5BXZ A;  1D2D A;  4LF7 O;  4X64 O;  5BY1 A;  2AGA A;  2Z0A A;  4JV5 O;  1IBL O;  4X62 O;  4DR4 O;  5A2Q N;  2VQF O;  4OPA A;  1KUQ A;  4LF8 O;  4YHH O;  4DV7 O;  2UXB O;  1IBK O;  3F5T A;  5IT9 N;  4JI7 O;  4JI8 O;  4JI3 O;  4DV5 O;  4K0K O;  4GKK O;  2UUB O;  1YZB A;  3JAM N;  4JI5 O;  4DV4 O;  2UUA O;  1NS1 A;  2UU9 O;  1R1B A;  1HNW O;  4GKJ O;  4X66 O;  4LFA O;  4B3M O;  4LF6 O;  4JI1 O;  4OX9 O;  5IWA O;  2F4V O;  1R6T A;  4LFB O;  1XNQ O;  2DOS A;  3J81 N;  4LF9 O;  2ZM6 O;  4DR3 O;  2DJV A;  4LF5 O;  4LFC O;  4X65 O;  4B3S O;  5LMU O;  1I94 O;  4JI2 O;  5LL6 Y;  4NXN O;  4DR5 O;  1DK1 A;  1FKA O;  2E5L O;  3J80 N;  4DV2 O;  4DUY O;  1HNX O;  1N33 O;  4LF4 O;  1A32 A;  3RT3 C;  5FLX N;  3OTO O;  1FYJ A;  2UXC O;  2FKX A;  1FJG O;  4DR2 O;  4DV1 O;  4AQY O;  2HHH O;  4DR1 O;  4JI0 O;  1IBM O;  2UUC O;  4NXM O;  1AB3 A;  4JYA O;  1HNZ O;  3SDL A;  3T1H O;  3T1Y O;  2JRI A;  2ZKO A;  1XEQ A;  4DV6 O;  1N32 O;  4B3R O;  1F7Y A;  4DV0 O;  1N34 O;  1J5E O;  1AIL A;  2UXD O;  3J7A U;  1XMO O;  1G1X B;  1XNR O;  4DUZ O;  2N74 A;  4YY3 O;  5H5N A;  4A5U B;  4DV3 O;  4B3T O;  5LMN O;  4DR6 O;  4KHP O;  3R66 A;  3O65 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...