4JI5O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
87
structure length
87
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 35
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4ji5O00
2LW7A 1IBMO 1HR0O 1N32O 2DOSA 4B3SO 5LMUO 2VQEO 4LF6O 1DK1A 1X59A 3M8AA 4KHPO 3F5TA 1YZBA 1J5EO 4LFAO 4DR4O 4GKJO 1AILA 4DV0O 5A2QN 4JI3O 4X64O 4DV4O 4K0KO 1AB3A 3SDLA 4JV5O 3R66A 4JI2O 1XNQO 4B3RO 4DV6O 2UXBO 4JI1O 1XMQO 2UUAO 1N33O 2ZM6O 1N34O 5FLXN 3O65A 1FJGO 2UU9O 4OPHA 4DR5O 4OX9O 2Z0AA 1R6TA 1XEQA 5LMNO 1FYJA 1G1XB 4DV7O 2UXCO 3J7AU 3RT3C 4OPAA 4NXMO 2ZKOA 4DUZO 4GKKO 4DR2O 2AGAA 4DV1O 4DR3O 1HNWO 1R1BA 4A5UB 5BR8O 1HNXO 4JI6O 3T1YO 2UUBO 4X62O 1HNZO 4AQYO 3OTOO 4JI8O 4YHHO 4DR1O 1IBLO 1KUQA 1A32A 1IBKO 2F4VO 4LF4O 2UXDO 4JI4O 5IWAO 3JAMN 2FKXA 5IT9N 5BY1A 1FKAO 1F7YA 4NXNO 4DV2O 3J81N 4JYAO 4DV5O 4B3MO 1XNRO 2UUCO 1I94O 4LF5O 4LF8O 4DR6O 4X66O 1D2DA 4LFBO 5LL6Y 2DJVA 4X65O 4LFCO 4DR7O 5H5NA 2E5LO 4YY3O 1NS1A 1N36O 4JI7O 1XMOO 2JRIA 4DV3O 4LF9O 2HHHO 4JI0O 2VQFO 2N74A 4DUYO 4JI5O 3J80N 5BXZA 4B3TO 4LF7O 3T1HO
chains in the Genus database with same CATH superfamily
4J7ZA 4DV5B 3T2MA 2B1IA 3STZC 1FXKA 4KHPO 4LFAO 1Q82W 2EILB 3APQA 4G2KA 3RYFB 4ASUG 1WN7A 4I7ZB 2HG5C 1XMOB 2OCHA 5A9GA 1NZ6A 2Q8VA 4DW0A 3OM3B 5B1BB 4JI2O 3EXAA 2JS3A 4R6ZA 4JI1O 3CP1A 4TQDA 3JATB 4LNUA 1S5HC 1EM1A 4JAUA 5EBLC 1S77D 4MTOA 2RDCA 3K03A 5LMNO 4TV8B 2KQXA 4DV7O 3JD3A 1RM1B 1XREA 1P7GA 4QPJA 3QO5A 1B06A 2P22C 3JCUZ 2JIZG 1Q5OA 1D5AA 4AI8A 1N0JA 1HNWO 4J41A 4FLTA 4ZBMA 2Y0IA 2WLKA 3K9AA 4FPPA 1KUQA 1Q6UA 2KSDA 1SRYA 1NQTA 2LQTA 5LOVB 1FKAO 4FLZA 1KKDA 3U11A 3PN1A 4PA3A 2VRZA 4PA7A 5F2VO 4DR3B 4WBNA 1DF4A 1GAXA 1Q6HA 3ABLB 2HFEC 4JI7O 3ML0A 1XDCA 2XTAA 2BTOA 4DK1A 4LWSA 1YVWA 2WPDG 2BCCH 4NYKA 4NTYA 4NXNB 3SYQA 1Y74B 2BTQB 3D3QA 1ZL8B 4OGQB 1AP5A 4O4LB 2QM8A 1HNWB 3R65A 2VWKA 1SESA 2XHBA 2JEUA 4U3FH 1FS0G 3UQ8A 3P3NA 2Y0PA 3D8CA 1WAZA 3U10A 1U97A 1AI5A 5IYZB 1RFYA 3QO8A 3C3TA 3O65A 5J2UA 3RYIA 1VP7A 5CA0A 4D6TH 5KAFZ 5EC2C 4MVZA 2CH7A 1IXBA 1QU7A 4H13B 4K0KB 4JTDB 3KCXA 2EJ7A 4FLYA 4UXNA 4NXMO 4ZIBA 5L3DA 2JEXA 4R50A 4Z1MG 5IJ9A 2L6LA 3BCCH 3ETQA 1CXZB 2FMLA 1HNXO 5LXTB 1WB7A 2YXHA 1GN3A 5L3FA 3CE2A 1SZXA 3K08A 2QWNB 4O2BA 1FXKC 5LHIA 1MG1A 4H0LB 2PZSA 4J42A 5KUMA 4FLXA 2JK5C 3U0ZA 5B66Z 4XDLA 1WJZA 1W0JG 2B5UA 2ITDC 3N2KB 4DR6O 1JOYA 4CS4A 1ENVA 3CC2V 4OXSA 1NS1A 2QTSA 1QHTA 4YHHB 4LF9O 3JAKA 3CXHF 1OZ0A 3JAWA 4MVQA 2AZ2A 4RUEA 3E35A 2F1MA 3RFRA 5CA1B 1MSDA 3CCUV 3AK1A 4LF5B 4LF6O 4I50A 1NTKH 5KLVH 4GKJO 2PF4E 2PGGA 1HNXB 1BS3A 2XAHA 1SS3A 1NKDA 2JVDA 2VS0A 1AROP 2O57A 3A0RA 2BSKB 2OYQA 4YJ2B 4JV5O 3ASNC 2JGUA 4RAIA 1Z5WA 3CCRV 3FB8C 3K5NA 3SGIA 3MHSC 5B5EZ 3SPIA 1K5QA 2X0LA 4CZZA 3G80A 4W4KA 3CRRA 3JCZA 1MOFA 2QWRB 1YTFD 4J9ZB 2EX3A 4FVMA 4F6RA 2NR5A 4FLWA 1JFFA 4LF9B 1WA8A 4FMTA 3UO2A 2PYLA 5LYJA 3JD1A 3B2EE 1RSOB 1QQCA 2Q69A 3UO3A 4DV6B 1GM8A 4E4EA 3CJHA 5B1AC 1SQGA 4N21A 3G6BA 1KECA 1S5LZ 3CSXA 3DC6A 3T1YO 4LF6B 1OV9A 1IX9A 2ATKC 3ZRWA 3JARA 2E3CA 2WLHA 4IIJA 1VQ6V 5IT9N 3BA8A 2X6CA 1G8MA 3F5WC 4GZRB 3WB2A 3ZHUA 4I55A 4PDMA 3PJSK 1VF5B 1ZWIC 2YC0A 4X66O 2GUZA 1TVKB 1I5XA 2UUBB 1ZAUA 1WPBA 2Q0OC 1EN6A 3RYCA 1S72V 1PKXA 2ZXWC 4H33A 2FB5A 3RVYA 1N8RW 3K0DA 1K92A 4EB6B 1MSWD 3P32A 4DUYO 4LF7O 4JYAB 2QWQB 3IGAC 1AR5A 5LMUO 1NR1A 1O9GA 5J2TB 1ORQC 2MK3A 1V54C 3WB0A 4DR4O 3ASOB 2B1GA 2XUMA 5A2QN 3ZBHA 3JD4A 4GYCB 1Q43A 1PPJH 5KMGA 4FM0A 2WLLB 2XT9A 4NVPA 1MABG 4MW3A 1R3KC 3AG2C 3RYFA 4MVMA 4O4IB 1FD9A 5DN6G 2EJRA 5GW7A 1R6NA 3CYOA 3HKEB 2DQ3A 3JATA 3CRMA 4K8ZA 4MW8A 2F66C 4QGPA 4OPAA 2ODMA 4UCVA 3CCSV 3MAQA 2DWDC 2QEXV 3QNEA 2ZCEA 3UCSC 4L8JA 1R1BA 1Z2GA 2E74B 2UU9B 5B3SC 4BIUA 5LMUB 5H9CA 3SJCC 2CTWA 2D3OW 2YICA 1AP6A 1DLBA 1V55C 3ABMB 1SZTA 3K9SA 1A32A 1KBHA 2DYRC 4UB6Z 1VF6A 1Y6XA 1QBZA 4EFEA 5IWAO 4JYBA 2JJ2G 1WP7A 2DMXA 4GT1A 3W7WA 4I4TA 1GRJA 2IU3A 4UV8A 3KKYA 2EINB 4MVRA 4X1IA 4DUZB 4B3MO 3I55V 1I94O 4LF8O 1T5EA 2QTOA 2XAJA 2W6IG 1EBOA 4YXWG 1VQ8V 1B04A 4UV9A 3H1HH 2R9IA 2YXYA 1GH6A 1AI4A 4HNAB 4DYLA 2CGOA 1XL6A 4JGSA 2ZR2A 2PI4A 5KX5B 4RO2A 2RNBA 1IBMO 4O4HA 3SPGA 4WFHA 1K34A 2UXXA 5FPOA 3BFRA 1NVPB 1YZBA 1J5EO 1AILA 4G27B 2QKAA 1XQ8A 3LNMB 3UM7A 1Y74A 4U3JB 2BTQA 2K9PA 1JPXA 1I08A 4GX0A 4O4LA 2CTRA 3SYPA 2FYUH 5EZYB 5DM6V 1N34O 4NTWA 4B3SB 5H6QA 2YEVB 4FFKA 1I94B 3JD2A 2ZT9B 4PDLA 1VQKV 1BHBA 4FFBB 4MSWC 2IH1C 5IYZA 4JZGA 1M56B 1YITV 3A0BZ 3OGIB 1KC8W 1PM9A 2IBZH 1SQQH 2QKCA 1CP9A 2QKSA 3K0GA 4FZ1A 2QE7G 2H94A 2YXLA 3E22B 2AHYA 2WLMA 1IBMB 3AEIA 4JI6O 3B8NA 1VQNV 4DR1O 5LP6B 2OCCC 3AG1B 4XDKA 3BA9A 3HKDA 2QM4A 4UVAA 3ZMZA 3CXCU 1OCZC 3ABKC 2F4VO 2F93B 5K1PA 2FKXA 4TUYB 2CGNA 1IVSA 4YIPA 3RVZA 1AJNA 1VQPV 1Y67A 3OUSA 1AJPA 1QLEB 1H2LA 4DV5O 1M90W 4WFEA 2DJVA 1THZA 1UPGA 1OCOB 5FPRA 5KHIA 1YI2V 1K3EA 3LDDA 3CMAV 1KP3A 1XMOO 2C2AA 3K5LA 5KUKA 5LHHA 2UXDB 3E2EA 5B1BC 3FB6C 3LSUA 1OCCB 2LJ2A 3SYCA 2XAFA 2A7WA 5C93A 3HR0A 3A8TA 3OFNG 3L73H 1L0NH 1QR9A 1G6UA 2YS8A 3THOA 4JI6B 4PA9A 1W2BU 3JASA 1AR1B 1RM1C 1EN4A 1VF6C 1SQBH 5LA6B 3SYAA 2KKWA 3D3IA 4PJ0Z 2CTQA 1I7FA 3NXSA 1MNGA 2ILMA 4YJ2A 2UXCO 3CCMV 3J7AU 5EBMC 3L9DA 1YDXA 4IT5A 1S0VA 4DW1A 1XNQB 1HWYA 3FB5C 2LFSA 4B3RB 3M7MX 1L0LH 5LBQA 1H2SB 1N4CA 1N33B 4DR3O 1WP8A 4JTCB 5KHKA 2LW1A 1SA0A 3B09A 1U96A 1L1FA 3ZCCA 3A0HZ 3ABLC 2AW9A 4MTFA 4X20A 3N2GB 3H1KH 4J10A 3KCYA 3FX7A 1BZKA 4TV9A 4NXNO 4O4JB 2Y69B 4L87A 1J95A 2JS5A 5HFLA 3CEIA 2IJJA 2PTMA 2DWEC 1HNZB 3DSQA 1KMIZ 2CK3G 1SQPH 2UXCB 4LH7A 5GONB 1NH2D 1M1KW 2W0XA 5J9PC 3MD0A 4IL6Z 4ZI7A 1TGOA 2DOSA 4YJ3B 5LGUA 4X89A 3K58A 4UCOA 1VQ7V 4CH6A 1YSCA 4JI0B 5DEDA 4K0KO 1H2NA 1YXBA 2Q9LA 1AB3A 2GHYA 5B1NA 1ZLZA 4EEQA 4ZOLB 1Y76B 3E8FA 3L75H 4PD4F 3ZHSA 3SJBC 1M4UA 4ZKIA 3CS5A 3CC4V 3Q4HB 4D7TA 3I56V 4X64B 2ZIOA 3SJAC 2Q4PA 4JASA 4BIZA 4FZ0A 3LSSA 4B08A 3DXRA 1PNKA 2DQ0A 2GDSA 3CRAA 4YHHO 5IJ0A 4CH5A 1DTOA 3JSNA 1IBKO 3ZX6A 2WAMA 4DRXB 5L3EA 3CRQA 1URFA 3C90A 2F43G 1JQ0A 1WPXA 4AILC 2UUCO 4LF5O 4GX2A 2JGDB 4LFBO 4X65O 2PUSA 4YY3O 4AQYB 3QO7A 4JI8B 1BQZA 3UT5B 4PDVA 4DXWA 3IC9A 3K04A 4RQFA 3VQXA 2XAGA 5JCOA 4O2AA 5C8YB 4JI4B 2ITCC 1AI6A 3OMNB 5EBWC 1YJNV 4P30A 1V9PA 4B3TO 2Q0AA 4X8AA 3AG7A 4QE9A 2ARHA 3MHHC 5CB4B 2ZDIA 3BVOA 2EIKB 3IFXA 3APOA 3WG7B 3H1IH 4J9YB 1Z5VA 2Z3YA 4UCUA 1IBKB 4DV6O 5LHGA 3OAAG 3FYEB 5LGNA 4UUJC 2PYJA 2EIMB 3ZN0A 2L35A 4IHJB 5EYPB 2H8PC 1HR0B 4GUNA 4TWKA 2UUCB 4MVUA 5HFMA 5CBGA 1VARA 4LFBB 1B3QA 4X65B 5JJJB 4YY3B 3L71H 3CPWU 4JI3B 3CCLV 3FAVA 3ZN1A 1MZEA 4PV1B 5EZYA 3UKMA 1WNSA 2IJIA 4C7UA 4GKKO 4B3TB 3VQWA 3OW2U 3CCJV 2K1EA 4FFBA 5JJNB 5FNVB 2UUBO 2QWPB 1NJIW 1E1QG 1JCHA 4WFAV 1VF7A 1RPOA 3QF7A 1GM7A 1TUBA 4FLUA 1GN4A 1YJWV 4JYAO 5KHHA 3BEHA 2GBOA 1JJOA 1KD1W 1XNRO 1AJQA 3L72H 1X4TA 2IJKA 4K35A 5LL6Y 5H5NA 4LNUB 2BOBC 4X1KB 2NNUA 1SQVH 2P06A 1S76D 4DV3O 4TUYA 4FLVA 4X1YA 2Y4TA 3OR7C 1DGSA 3RGBA 3CCQV 2R9RB 3ZJZA 5IYCO 4TSFG 4MS2A 2EZPA 3J80N 1EZVH 3MDSA 4ZHQA 4GKKB 1YIJV 4DR7B 3RWRD 1P7BA 4DV0O 3JALA 2W0FC 3WFVA 2Q7GA 2KG7A 3ZMVA 3R66A 5FL7G 3HKCA 2Q67A 3W7TA 2VQFB 1TUEB 2GTAA 3LSQA 4KUMA 4BWAA 3CC7V 3FKSG 3LUTB 1QLNA 3ZMUA 4J11A 1XNRB 2UU9O 4LC1A 3SR2C 1R73A 1OHHG 1R6TA 1HP8A 4LBEC 5IYBO 3ABMC 3CWBH 4DV4B 4DV3B 5H6RA 5IY5B 2UXBB 1M93A 2ZKOA 4UVCA 3VBBA 4DUZO 1BT8A 1GN6A 2EINC 1Q81W 1JR9A 5JCOC 3ETDA 4RWUA 2OWOA 2QDOA 2ZNJA 4DR5B 4CBCA 2FTKA 2ZD9A 3RBZA 3W7SA 4DV0B 3D36A 1CPYA 5CA3A 1KYOF 2ZDIC 1K4CC 2WLNA 4WFFA 4LH6A 1AR4A 1S5JA 1LUVA 3GWKC 3K59A 2Z5UA 2IJHA 4TV8A 2D2CB 4GX1A 5JH7B 1P84F 2Q6AA 2HVJC 4XBFA 2A79B 5JVDB 4O4JA 2EZOA 1B6QA 2H3OA 1XUQA 4NTXA 4JI5O 4U7OA 2CH7B 1VEWA 3W7XA 3JYCA 1N32O 3HKBB 4B3SO 3ABUA 3BRCA 1X59A 3FFQA 2X7RB 2ZE5A 3OE7G 4HAMA 5GONA 5KA5A 3G4SV 5LOVA 2ADQB 2ZQMA 1NTMH 1IZ3A 2ADPA 1M56C 4O2BB 4ABMA 2KB1A 1VQ5V 2QR4A 4YJ3A 4LP8A 3T1HB 4KXRA 3F7VC 4PDRA 4OPHA 2LGWA 1BCCH 2VQEB 2ZE6A 1M57B 3TGUH 4CS2A 5LP6C 3AG1C 5AG2A 4BR6A 4ZOLA 1H2GA 3JAKB 4P9PA 4JI5B 1ZL8A 1GTOA 1QLEC 5B1OA 3L74H 3Q4HA 2WA4A 1N32B 1V55B 2GV9A 5KHGA 2HJDA 4QNHB 3A2FA 1FPOA 3JD0A 1OCOC 1IBLO 4I50B 2R72A 5EK0A 2UXDO 3SPHA 2R9AA 4QIWF 4I9QA 2MW2B 3J81N 1PL0A 1OCCC 3ZIAG 1LUWA 1KB9F 4TQFA 2Q68A 1KQSU 4NKGB 3OTOB 4DRXA 1VQMV 1UJWB 4KFMA 3B8MA 3ZRXA 1MZFA 4P9OA 1PNMA 4TT3G 1JFFB 2DYSC 1WA8B 2AXTZ 2JGDA 5LYJB 1QNMA 4DV2B 5EIBC 1US6A 5LXTA 1E79G 2AHZA 1LNQA 3AG4B 4F4LA 3OTFA 4LFCB 1IXMA 4G28B 1BL8A 3I5DA 2EILC 1F4NA 1IBLB 2HHHB 2YIBD 2UXNA 3BABA 1XNQO 3OMAB 3ZRWB 3JARB 4Q20A 4CH4A 4B3RO 2QM7A 2P4VA 2YI9A 1XMQO 2WLIB 1N33O 3D36C 3LNNA 3N2KA 4IIJB 1I5YA 4I0XB 3ABTA 3B40A 3SYOA 4FJCC 1M9NA 1JJ2U 3KG2A 1FJGO 2Z0AA 4I55B 1XEQA 2FL4A 2IU0A 1F51A 2P4KA 2P90A 3AK2A 4IYHA 1FYJA 1G1XB 5CBFA 2QWOB 1N0NA 3QTCA 3RYCB 3G67A 1E1RG 2QSAA 3ZEDA 3RW0A 5CA1A 2LFRA 2AGAA 4MVOA 2Y69C 1JA8A 5CN0A 1VQOV 1QVGU 1CEZA 1HNZO 2BSKA 4B7EA 4PI0A 3WU2Z 4D7SA 3W7UA 3BPZA 1SETA 5IYDO 5BY1A 4HZ3A 1HW7A 5BMVB 2N05A 3E83A 4JF3A 1XMQB 2XAQA 5KMGB 4DR2B 2CUGA 4NB5A 2YUAA 5E79Z 2OIGA 1FJGB 4UCSA 3X2QB 5BR8B 3VQVA 4X62B 2R70A 1MA1A 1R3LC 1RSOA 2JRIA 1YTFB 3CD6V 1NBMG 4JI0O 2CDYA 4RQEA 5D5PA 1OCRB 3ZHVA 2EIJB 3P30A 3K5MA 2HVKC 1SKVA 4MVSA 4X1KA 4PHZA 2Y48A 4Z2WA 4GX5A 3BAAA 3F5TA 1N36B 1Q90D 2YIBA 4X64O 3P3PA 2QJ1A 3AG3B 3JSLA 2EBOA 2V7QG 3LDCA 1YHQV 1Y66A 4Q6GA 2P7TC 4I4TB 1TVKA 1GN2A 3ZRVA 1FXHA 5L3CA 4X1IB 1H8HG 4UCTA 4KHPB 3OD4A 4LFAB 4EB6A 1M5IA 2P67A 1HDJA 3RYHB 3N27A 4FM1A 4U7NA 1PP9H 4JI2B 1W0KG 4JYYA 1H2KA 4UFZA 4MT8A 1K9MW 4JI1B 1YEWA 1OJHA 5J2TA 4EFBA 2HEPA 2JJ1G 2DE0X 1PV0A 4DV1O 1XHXA 1K33A 4HBNA 1NVPD 4AHCA 1KU9A 4KP4A 2OTJV 4O4HB 4AQYO 1BSMA 4JPRA 1ZX3A 4JI8O 5LMNB 5L3GA 4DV7B 1BHAA 3CX5F 2WLLA 1NI8A 1FXVA 3CMEV 3HB3B 4JI4O 3E89A 4PELA 3S3XA 3SJQC 1F7YA 2GSMB 1FFXB 3K57A 3BHPA 1BE3H 2DW4A 4O4IA 5L3BA 2CTPA 2N04A 4DK0A 1SQXH 1S3JA 3HKEA 5JQGB 1VQ9V 1PD3A 2EIKC 3WG7C 4JAAA 4YIOA 4H37A 4W4LA 1WB8A 3G6EV 3WB1A 3H9VA 3K79A 4FK5C 5LGTA 1Q7YW 5JH7A 2EIMC 2X6AA 3TK1A 1HR0O 4DV1B 1YF2A 5JVDA 2WLJA 2GTSA 3VOUA 2CE4A 4JI7B 4JI3O 1UFIA 2NLJC 3OUFA 2LP7A 1XILA 1R3IC 4BAYA 1SF9A 1F23A 3HKBA 3HKDB 1SERA 4RUFA 2UUAO 2LGQA 2P5OA 1G4YB 2ZM6O 2E75B 4WCEV 3DC5A 4OX9O 2A3QA 1XOUA 4K3AA 4HNAA 1NU1H 2V4DA 2YIAA 2PY5A 1YCIA 5KX5A 5GTHZ 2Q5ZA 1K8AW 5JWPA 2Q7HA 2ZINA 3B77A 4NR1A 3TXQA 3SPCA 3TCUA 4JZ2A 4P2ZA 3FYIB 1K73W 1DF5A 4CH3A 2Q7EA 4I5SA 2EULA 1NT2B 4U3JA 4HYOA 4LCUC 3K5OA 1RP3B 1EFRG 1GKFA 3JASB 5EIBD 1TAEA 4QJFB 3T4ZA 4NXMB 1VQ4V 4K8XA 1JMKC 2UUAB 2YEVA 2YI8A 1GO3F 4CC5A 2ZM6B 5ITZB 2YDEA 4JTAB 3OT7A 4DR7O 4OX9B 3AK3A 5GTIZ 2E5LO 3OMIB 4J7JA 1FXKB 2HJFC 4FM2A 1KP2A 5EC1C 2VQFO 4UVBA 3E22A 2LW7A 1RPRA 1ZTEA 3IC7A 2BOCC 3SPJA 4B7KA 5LP6A 4DR6B 2OT5A 2NN4A 3K06A 1SA0B 4TOIA 2ZIMA 4UCRA 3ASOC 4DV4O 4Z1VA 3SDLA 3QVNA 1XBLA 2XASA 3CCEV 3FD9A 2UXBO 4X20B 4J80A 5IY5C 4ICGA 2DN9A 2F95B 4WFGA 4TV9B 1VIBA 4DR5O 3GWOA 4GKJB 2WA3A 2E5LB 1XL4A 1KKCA 2HLDG 4N23A 2WLIA 2B9ZA 5TISZ 3RT3C 4I0XA 3ASNB 3ZRSA 4JV5B 1Q8IA 2JDIG 3H1LH 3DTUB 4GCZA 1MMMA 1GK9A 4H44B 1JVMA 3CRCA 4ZI7B 2XNDG 1AVMA 3TJTA 4WBNB 1IDSA 3EHBB 3G71V 2IW5A 4PA4A 3OEHG 3ETEA 2WWWA 2OIEA 4JAVA 5B1AB 5LA6A 2A0LA 4LR3A 3ZS8C 1JX9A 4MTXA 2OTLV 4EKWA 1QVFU 4LWSB 3S3WA 3T1CA 1GMGA 2RMKB 3T1YB 3OEEG 5BMVA 3E86A 2HP8A 4I9WA 2LO1A 1NR7A 1Q3EA 1BQ0A 2N74A 1O9HA 2WSSG 5BXZA 3T1HO 3ETGA 3GB7C 1NTZH 3ZMTA 3QG5A 2VQEO 4X66B 1Q86W 3EFFK 3DXRB 3N2GA 5E1AC 3M99B 2ZXWB 2PI5A 3IJ4A 2X6BA 3K3WA 1M57C 5J2UB 1YJ9V 3RYIB 5KHJA 5CA0B 3DGEA 1P49A 5IJ0B 1R3JC 3O9OA 4KL1A 4IYIA 2XOKG 4DUYB 3E8GA 4LF7B 1SC5B 1XHZA 3F7YC 5K1XA 5FLXN 1V54B 2A06H 4IGGA 4MTGA 4BW9A 4XDJA 4DR4B 5IJ9B 3ZHTA 1P4RA 3E8HA 1ZSPA 3L70H 5KA6A 2HKOA 1NH2B 3NR7A 3AG2B 2HR3A 4O2AB 1L8DA 1XI1A 3CB2A 4J7KA 4A5UB 3RYHA 3OGCC 3OTOO 1F4MA 3FB7C 4BIOA 4FIPC 2A9HA 4E2LA 4BW5A 1Y76A 4LF4O 2V1DA 3JAMN 1K97A 5CBHA 3VQYA 2ZNIA 4DV2O 1TA8A 2F23A 2M6YA 4DO2A 3JAWB 4R7CA 3B4SA 5B3SB 1FAFA 4LFCO 1Q6IA 1W59A 3AG4C 3E8BA 1SQFA 1EZJA 5IDJA 2Y4UA 5D5QA 2HHHO 2DYRB 3H01A 2ZE8A 1FFXA 2YSUB 5IWAB 1H2MA 1K5SA 3STLC 3FAVB 3RN4A 3ZHRA 2BE3A 1H8EG 5KAIZ 5JQGA 4B3MB 3GVMA 4LF8B 3EVKA 3ICXA 1DK1A 3M8AA 1Y4MA 1QCEA 2RCVA 2QGNA 5DECA 2QA4V 5CMUA 5IE9A 4LF4B 2RJZA 4PA6A 4F6RB 2Q73A 5H2FZ 1TUBB 5JJEB 2IH3C 3C3SA 1GM9A 3CCVV 3CJHB 3UT5A 3TETA 4GLXA 3H1JH 1J5EB 2AZ0A 1FFTB 5C8YA 1PNLA 2CAZC 1IURA 1VMGA 4JYCA 1K7DA 1R6KA 4F6EA 1PL4A 4X1YB 3BY6A 3ZMSA 4DR2O 4CC6A 2E76B 1EN5A 5CB4A 1QR8A 5BZBA 3LDEA 4CS3A 1N34B 4PI2A 4ZHQB 1ROPA 5BR8O 4WF9V 4X62O 3X2QC 2G38A 4X88A 1K4DC 1D5NA 2GUZB 1LR1A 2P6JA 1COWG 3TXSA 3JALB 1OCRC 3IAYA 4IHJA 2EIJC 1VQLV 5EYPA 4QE7A 2KG7B 4QPKA 4R8CA 2VWJA 3HKCB 3HPLC 1ZUQA 2RN9A 2IM9A 2ZR3A 1D2DA 3OR6C 2YIDA 2W6JG 3CHXA 3T4DA 1N36O 2OCCB 1BMFG 1BGYH 4WFBV 4DR1B 3ZHQA 3ABKB 1OCZB 2RQ6A 1AI7A 1I0HA 1WLEA 2M7WA 2DYSB 2F4VB 3AG3C 3KZIZ 5ITZA 4X9QA 1H38A 2ZE7A 4UB8Z 5FNVA 2ETNA
chains in the Genus database with same CATH topology
2LW7A 1IBMO 1HR0O 1N32O 2DOSA 4B3SO 5LMUO 2VQEO 4LF6O 1DK1A 1X59A 3M8AA 4KHPO 3F5TA 1YZBA 1J5EO 4LFAO 4DR4O 4GKJO 1AILA 4DV0O 5A2QN 4JI3O 4X64O 4DV4O 4K0KO 1AB3A 3SDLA 4JV5O 3R66A 4JI2O 1XNQO 4B3RO 4DV6O 2UXBO 4JI1O 1XMQO 2UUAO 1N33O 2ZM6O 1N34O 5FLXN 3O65A 1FJGO 2UU9O 4OPHA 4DR5O 4OX9O 2Z0AA 1R6TA 1XEQA 5LMNO 1FYJA 1G1XB 4DV7O 2UXCO 3J7AU 3RT3C 4OPAA 4NXMO 2ZKOA 4DUZO 4GKKO 4DR2O 2AGAA 4DV1O 4DR3O 1HNWO 1R1BA 4A5UB 5BR8O 1HNXO 4JI6O 3T1YO 2UUBO 4X62O 1HNZO 4AQYO 3OTOO 4JI8O 4YHHO 4DR1O 1IBLO 1KUQA 1A32A 1IBKO 2F4VO 4LF4O 2UXDO 4JI4O 5IWAO 3JAMN 2FKXA 5IT9N 5BY1A 1FKAO 1F7YA 4NXNO 4DV2O 3J81N 4JYAO 4DV5O 4B3MO 1XNRO 2UUCO 1I94O 4LF5O 4LF8O 4DR6O 4X66O 1D2DA 4LFBO 5LL6Y 2DJVA 4X65O 4LFCO 4DR7O 5H5NA 2E5LO 4YY3O 1NS1A 1N36O 4JI7O 1XMOO 2JRIA 4DV3O 4LF9O 2HHHO 4JI0O 2VQFO 2N74A 4DUYO 4JI5O 3J80N 5BXZA 4B3TO 4LF7O 3T1HO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LW7 A;  1IBM O;  1HR0 O;  1N32 O;  2DOS A;  4B3S O;  5LMU O;  2VQE O;  4LF6 O;  1DK1 A;  1X59 A;  3M8A A;  4KHP O;  3F5T A;  1YZB A;  1J5E O;  4LFA O;  4DR4 O;  4GKJ O;  1AIL A;  4DV0 O;  5A2Q N;  4JI3 O;  4X64 O;  4DV4 O;  4K0K O;  1AB3 A;  3SDL A;  4JV5 O;  3R66 A;  4JI2 O;  1XNQ O;  4B3R O;  4DV6 O;  2UXB O;  4JI1 O;  1XMQ O;  2UUA O;  1N33 O;  2ZM6 O;  1N34 O;  5FLX N;  3O65 A;  1FJG O;  2UU9 O;  4OPH A;  4DR5 O;  4OX9 O;  2Z0A A;  1R6T A;  1XEQ A;  5LMN O;  1FYJ A;  1G1X B;  4DV7 O;  2UXC O;  3J7A U;  3RT3 C;  4OPA A;  4NXM O;  2ZKO A;  4DUZ O;  4GKK O;  4DR2 O;  2AGA A;  4DV1 O;  4DR3 O;  1HNW O;  1R1B A;  4A5U B;  5BR8 O;  1HNX O;  4JI6 O;  3T1Y O;  2UUB O;  4X62 O;  1HNZ O;  4AQY O;  3OTO O;  4JI8 O;  4YHH O;  4DR1 O;  1IBL O;  1KUQ A;  1A32 A;  1IBK O;  2F4V O;  4LF4 O;  2UXD O;  4JI4 O;  5IWA O;  3JAM N;  2FKX A;  5IT9 N;  5BY1 A;  1FKA O;  1F7Y A;  4NXN O;  4DV2 O;  3J81 N;  4JYA O;  4DV5 O;  4B3M O;  1XNR O;  2UUC O;  1I94 O;  4LF5 O;  4LF8 O;  4DR6 O;  4X66 O;  1D2D A;  4LFB O;  5LL6 Y;  2DJV A;  4X65 O;  4LFC O;  4DR7 O;  5H5N A;  2E5L O;  4YY3 O;  1NS1 A;  1N36 O;  4JI7 O;  1XMO O;  2JRI A;  4DV3 O;  4LF9 O;  2HHH O;  4JI0 O;  2VQF O;  2N74 A;  4DUY O;  4JI5 O;  3J80 N;  5BXZ A;  4B3T O;  4LF7 O;  3T1H O; 
#chains in the Genus database with same CATH topology
 4J7Z A;  4DV5 B;  3T2M A;  2B1I A;  3STZ C;  1FXK A;  4KHP O;  4LFA O;  1Q82 W;  2EIL B;  3APQ A;  4G2K A;  3RYF B;  4ASU G;  1WN7 A;  4I7Z B;  2HG5 C;  1XMO B;  2OCH A;  5A9G A;  1NZ6 A;  2Q8V A;  4DW0 A;  3OM3 B;  5B1B B;  4JI2 O;  3EXA A;  2JS3 A;  4R6Z A;  4JI1 O;  3CP1 A;  4TQD A;  3JAT B;  4LNU A;  1S5H C;  1EM1 A;  4JAU A;  5EBL C;  1S77 D;  4MTO A;  2RDC A;  3K03 A;  5LMN O;  4TV8 B;  2KQX A;  4DV7 O;  3JD3 A;  1RM1 B;  1XRE A;  1P7G A;  4QPJ A;  3QO5 A;  1B06 A;  2P22 C;  3JCU Z;  2JIZ G;  1Q5O A;  1D5A A;  4AI8 A;  1N0J A;  1HNW O;  4J41 A;  4FLT A;  4ZBM A;  2Y0I A;  2WLK A;  3K9A A;  4FPP A;  1KUQ A;  1Q6U A;  2KSD A;  1SRY A;  1NQT A;  2LQT A;  5LOV B;  1FKA O;  4FLZ A;  1KKD A;  3U11 A;  3PN1 A;  4PA3 A;  2VRZ A;  4PA7 A;  5F2V O;  4DR3 B;  4WBN A;  1DF4 A;  1GAX A;  1Q6H A;  3ABL B;  2HFE C;  4JI7 O;  3ML0 A;  1XDC A;  2XTA A;  2BTO A;  4DK1 A;  4LWS A;  1YVW A;  2WPD G;  2BCC H;  4NYK A;  4NTY A;  4NXN B;  3SYQ A;  1Y74 B;  2BTQ B;  3D3Q A;  1ZL8 B;  4OGQ B;  1AP5 A;  4O4L B;  2QM8 A;  1HNW B;  3R65 A;  2VWK A;  1SES A;  2XHB A;  2JEU A;  4U3F H;  1FS0 G;  3UQ8 A;  3P3N A;  2Y0P A;  3D8C A;  1WAZ A;  3U10 A;  1U97 A;  1AI5 A;  5IYZ B;  1RFY A;  3QO8 A;  3C3T A;  3O65 A;  5J2U A;  3RYI A;  1VP7 A;  5CA0 A;  4D6T H;  5KAF Z;  5EC2 C;  4MVZ A;  2CH7 A;  1IXB A;  1QU7 A;  4H13 B;  4K0K B;  4JTD B;  3KCX A;  2EJ7 A;  4FLY A;  4UXN A;  4NXM O;  4ZIB A;  5L3D A;  2JEX A;  4R50 A;  4Z1M G;  5IJ9 A;  2L6L A;  3BCC H;  3ETQ A;  1CXZ B;  2FML A;  1HNX O;  5LXT B;  1WB7 A;  2YXH A;  1GN3 A;  5L3F A;  3CE2 A;  1SZX A;  3K08 A;  2QWN B;  4O2B A;  1FXK C;  5LHI A;  1MG1 A;  4H0L B;  2PZS A;  4J42 A;  5KUM A;  4FLX A;  2JK5 C;  3U0Z A;  5B66 Z;  4XDL A;  1WJZ A;  1W0J G;  2B5U A;  2ITD C;  3N2K B;  4DR6 O;  1JOY A;  4CS4 A;  1ENV A;  3CC2 V;  4OXS A;  1NS1 A;  2QTS A;  1QHT A;  4YHH B;  4LF9 O;  3JAK A;  3CXH F;  1OZ0 A;  3JAW A;  4MVQ A;  2AZ2 A;  4RUE A;  3E35 A;  2F1M A;  3RFR A;  5CA1 B;  1MSD A;  3CCU V;  3AK1 A;  4LF5 B;  4LF6 O;  4I50 A;  1NTK H;  5KLV H;  4GKJ O;  2PF4 E;  2PGG A;  1HNX B;  1BS3 A;  2XAH A;  1SS3 A;  1NKD A;  2JVD A;  2VS0 A;  1ARO P;  2O57 A;  3A0R A;  2BSK B;  2OYQ A;  4YJ2 B;  4JV5 O;  3ASN C;  2JGU A;  4RAI A;  1Z5W A;  3CCR V;  3FB8 C;  3K5N A;  3SGI A;  3MHS C;  5B5E Z;  3SPI A;  1K5Q A;  2X0L A;  4CZZ A;  3G80 A;  4W4K A;  3CRR A;  3JCZ A;  1MOF A;  2QWR B;  1YTF D;  4J9Z B;  2EX3 A;  4FVM A;  4F6R A;  2NR5 A;  4FLW A;  1JFF A;  4LF9 B;  1WA8 A;  4FMT A;  3UO2 A;  2PYL A;  5LYJ A;  3JD1 A;  3B2E E;  1RSO B;  1QQC A;  2Q69 A;  3UO3 A;  4DV6 B;  1GM8 A;  4E4E A;  3CJH A;  5B1A C;  1SQG A;  4N21 A;  3G6B A;  1KEC A;  1S5L Z;  3CSX A;  3DC6 A;  3T1Y O;  4LF6 B;  1OV9 A;  1IX9 A;  2ATK C;  3ZRW A;  3JAR A;  2E3C A;  2WLH A;  4IIJ A;  1VQ6 V;  5IT9 N;  3BA8 A;  2X6C A;  1G8M A;  3F5W C;  4GZR B;  3WB2 A;  3ZHU A;  4I55 A;  4PDM A;  3PJS K;  1VF5 B;  1ZWI C;  2YC0 A;  4X66 O;  2GUZ A;  1TVK B;  1I5X A;  2UUB B;  1ZAU A;  1WPB A;  2Q0O C;  1EN6 A;  3RYC A;  1S72 V;  1PKX A;  2ZXW C;  4H33 A;  2FB5 A;  3RVY A;  1N8R W;  3K0D A;  1K92 A;  4EB6 B;  1MSW D;  3P32 A;  4DUY O;  4LF7 O;  4JYA B;  2QWQ B;  3IGA C;  1AR5 A;  5LMU O;  1NR1 A;  1O9G A;  5J2T B;  1ORQ C;  2MK3 A;  1V54 C;  3WB0 A;  4DR4 O;  3ASO B;  2B1G A;  2XUM A;  5A2Q N;  3ZBH A;  3JD4 A;  4GYC B;  1Q43 A;  1PPJ H;  5KMG A;  4FM0 A;  2WLL B;  2XT9 A;  4NVP A;  1MAB G;  4MW3 A;  1R3K C;  3AG2 C;  3RYF A;  4MVM A;  4O4I B;  1FD9 A;  5DN6 G;  2EJR A;  5GW7 A;  1R6N A;  3CYO A;  3HKE B;  2DQ3 A;  3JAT A;  3CRM A;  4K8Z A;  4MW8 A;  2F66 C;  4QGP A;  4OPA A;  2ODM A;  4UCV A;  3CCS V;  3MAQ A;  2DWD C;  2QEX V;  3QNE A;  2ZCE A;  3UCS C;  4L8J A;  1R1B A;  1Z2G A;  2E74 B;  2UU9 B;  5B3S C;  4BIU A;  5LMU B;  5H9C A;  3SJC C;  2CTW A;  2D3O W;  2YIC A;  1AP6 A;  1DLB A;  1V55 C;  3ABM B;  1SZT A;  3K9S A;  1A32 A;  1KBH A;  2DYR C;  4UB6 Z;  1VF6 A;  1Y6X A;  1QBZ A;  4EFE A;  5IWA O;  4JYB A;  2JJ2 G;  1WP7 A;  2DMX A;  4GT1 A;  3W7W A;  4I4T A;  1GRJ A;  2IU3 A;  4UV8 A;  3KKY A;  2EIN B;  4MVR A;  4X1I A;  4DUZ B;  4B3M O;  3I55 V;  1I94 O;  4LF8 O;  1T5E A;  2QTO A;  2XAJ A;  2W6I G;  1EBO A;  4YXW G;  1VQ8 V;  1B04 A;  4UV9 A;  3H1H H;  2R9I A;  2YXY A;  1GH6 A;  1AI4 A;  4HNA B;  4DYL A;  2CGO A;  1XL6 A;  4JGS A;  2ZR2 A;  2PI4 A;  5KX5 B;  4RO2 A;  2RNB A;  1IBM O;  4O4H A;  3SPG A;  4WFH A;  1K34 A;  2UXX A;  5FPO A;  3BFR A;  1NVP B;  1YZB A;  1J5E O;  1AIL A;  4G27 B;  2QKA A;  1XQ8 A;  3LNM B;  3UM7 A;  1Y74 A;  4U3J B;  2BTQ A;  2K9P A;  1JPX A;  1I08 A;  4GX0 A;  4O4L A;  2CTR A;  3SYP A;  2FYU H;  5EZY B;  5DM6 V;  1N34 O;  4NTW A;  4B3S B;  5H6Q A;  2YEV B;  4FFK A;  1I94 B;  3JD2 A;  2ZT9 B;  4PDL A;  1VQK V;  1BHB A;  4FFB B;  4MSW C;  2IH1 C;  5IYZ A;  4JZG A;  1M56 B;  1YIT V;  3A0B Z;  3OGI B;  1KC8 W;  1PM9 A;  2IBZ H;  1SQQ H;  2QKC A;  1CP9 A;  2QKS A;  3K0G A;  4FZ1 A;  2QE7 G;  2H94 A;  2YXL A;  3E22 B;  2AHY A;  2WLM A;  1IBM B;  3AEI A;  4JI6 O;  3B8N A;  1VQN V;  4DR1 O;  5LP6 B;  2OCC C;  3AG1 B;  4XDK A;  3BA9 A;  3HKD A;  2QM4 A;  4UVA A;  3ZMZ A;  3CXC U;  1OCZ C;  3ABK C;  2F4V O;  2F93 B;  5K1P A;  2FKX A;  4TUY B;  2CGN A;  1IVS A;  4YIP A;  3RVZ A;  1AJN A;  1VQP V;  1Y67 A;  3OUS A;  1AJP A;  1QLE B;  1H2L A;  4DV5 O;  1M90 W;  4WFE A;  2DJV A;  1THZ A;  1UPG A;  1OCO B;  5FPR A;  5KHI A;  1YI2 V;  1K3E A;  3LDD A;  3CMA V;  1KP3 A;  1XMO O;  2C2A A;  3K5L A;  5KUK A;  5LHH A;  2UXD B;  3E2E A;  5B1B C;  3FB6 C;  3LSU A;  1OCC B;  2LJ2 A;  3SYC A;  2XAF A;  2A7W A;  5C93 A;  3HR0 A;  3A8T A;  3OFN G;  3L73 H;  1L0N H;  1QR9 A;  1G6U A;  2YS8 A;  3THO A;  4JI6 B;  4PA9 A;  1W2B U;  3JAS A;  1AR1 B;  1RM1 C;  1EN4 A;  1VF6 C;  1SQB H;  5LA6 B;  3SYA A;  2KKW A;  3D3I A;  4PJ0 Z;  2CTQ A;  1I7F A;  3NXS A;  1MNG A;  2ILM A;  4YJ2 A;  2UXC O;  3CCM V;  3J7A U;  5EBM C;  3L9D A;  1YDX A;  4IT5 A;  1S0V A;  4DW1 A;  1XNQ B;  1HWY A;  3FB5 C;  2LFS A;  4B3R B;  3M7M X;  1L0L H;  5LBQ A;  1H2S B;  1N4C A;  1N33 B;  4DR3 O;  1WP8 A;  4JTC B;  5KHK A;  2LW1 A;  1SA0 A;  3B09 A;  1U96 A;  1L1F A;  3ZCC A;  3A0H Z;  3ABL C;  2AW9 A;  4MTF A;  4X20 A;  3N2G B;  3H1K H;  4J10 A;  3KCY A;  3FX7 A;  1BZK A;  4TV9 A;  4NXN O;  4O4J B;  2Y69 B;  4L87 A;  1J95 A;  2JS5 A;  5HFL A;  3CEI A;  2IJJ A;  2PTM A;  2DWE C;  1HNZ B;  3DSQ A;  1KMI Z;  2CK3 G;  1SQP H;  2UXC B;  4LH7 A;  5GON B;  1NH2 D;  1M1K W;  2W0X A;  5J9P C;  3MD0 A;  4IL6 Z;  4ZI7 A;  1TGO A;  2DOS A;  4YJ3 B;  5LGU A;  4X89 A;  3K58 A;  4UCO A;  1VQ7 V;  4CH6 A;  1YSC A;  4JI0 B;  5DED A;  4K0K O;  1H2N A;  1YXB A;  2Q9L A;  1AB3 A;  2GHY A;  5B1N A;  1ZLZ A;  4EEQ A;  4ZOL B;  1Y76 B;  3E8F A;  3L75 H;  4PD4 F;  3ZHS A;  3SJB C;  1M4U A;  4ZKI A;  3CS5 A;  3CC4 V;  3Q4H B;  4D7T A;  3I56 V;  4X64 B;  2ZIO A;  3SJA C;  2Q4P A;  4JAS A;  4BIZ A;  4FZ0 A;  3LSS A;  4B08 A;  3DXR A;  1PNK A;  2DQ0 A;  2GDS A;  3CRA A;  4YHH O;  5IJ0 A;  4CH5 A;  1DTO A;  3JSN A;  1IBK O;  3ZX6 A;  2WAM A;  4DRX B;  5L3E A;  3CRQ A;  1URF A;  3C90 A;  2F43 G;  1JQ0 A;  1WPX A;  4AIL C;  2UUC O;  4LF5 O;  4GX2 A;  2JGD B;  4LFB O;  4X65 O;  2PUS A;  4YY3 O;  4AQY B;  3QO7 A;  4JI8 B;  1BQZ A;  3UT5 B;  4PDV A;  4DXW A;  3IC9 A;  3K04 A;  4RQF A;  3VQX A;  2XAG A;  5JCO A;  4O2A A;  5C8Y B;  4JI4 B;  2ITC C;  1AI6 A;  3OMN B;  5EBW C;  1YJN V;  4P30 A;  1V9P A;  4B3T O;  2Q0A A;  4X8A A;  3AG7 A;  4QE9 A;  2ARH A;  3MHH C;  5CB4 B;  2ZDI A;  3BVO A;  2EIK B;  3IFX A;  3APO A;  3WG7 B;  3H1I H;  4J9Y B;  1Z5V A;  2Z3Y A;  4UCU A;  1IBK B;  4DV6 O;  5LHG A;  3OAA G;  3FYE B;  5LGN A;  4UUJ C;  2PYJ A;  2EIM B;  3ZN0 A;  2L35 A;  4IHJ B;  5EYP B;  2H8P C;  1HR0 B;  4GUN A;  4TWK A;  2UUC B;  4MVU A;  5HFM A;  5CBG A;  1VAR A;  4LFB B;  1B3Q A;  4X65 B;  5JJJ B;  4YY3 B;  3L71 H;  3CPW U;  4JI3 B;  3CCL V;  3FAV A;  3ZN1 A;  1MZE A;  4PV1 B;  5EZY A;  3UKM A;  1WNS A;  2IJI A;  4C7U A;  4GKK O;  4B3T B;  3VQW A;  3OW2 U;  3CCJ V;  2K1E A;  4FFB A;  5JJN B;  5FNV B;  2UUB O;  2QWP B;  1NJI W;  1E1Q G;  1JCH A;  4WFA V;  1VF7 A;  1RPO A;  3QF7 A;  1GM7 A;  1TUB A;  4FLU A;  1GN4 A;  1YJW V;  4JYA O;  5KHH A;  3BEH A;  2GBO A;  1JJO A;  1KD1 W;  1XNR O;  1AJQ A;  3L72 H;  1X4T A;  2IJK A;  4K35 A;  5LL6 Y;  5H5N A;  4LNU B;  2BOB C;  4X1K B;  2NNU A;  1SQV H;  2P06 A;  1S76 D;  4DV3 O;  4TUY A;  4FLV A;  4X1Y A;  2Y4T A;  3OR7 C;  1DGS A;  3RGB A;  3CCQ V;  2R9R B;  3ZJZ A;  5IYC O;  4TSF G;  4MS2 A;  2EZP A;  3J80 N;  1EZV H;  3MDS A;  4ZHQ A;  4GKK B;  1YIJ V;  4DR7 B;  3RWR D;  1P7B A;  4DV0 O;  3JAL A;  2W0F C;  3WFV A;  2Q7G A;  2KG7 A;  3ZMV A;  3R66 A;  5FL7 G;  3HKC A;  2Q67 A;  3W7T A;  2VQF B;  1TUE B;  2GTA A;  3LSQ A;  4KUM A;  4BWA A;  3CC7 V;  3FKS G;  3LUT B;  1QLN A;  3ZMU A;  4J11 A;  1XNR B;  2UU9 O;  4LC1 A;  3SR2 C;  1R73 A;  1OHH G;  1R6T A;  1HP8 A;  4LBE C;  5IYB O;  3ABM C;  3CWB H;  4DV4 B;  4DV3 B;  5H6R A;  5IY5 B;  2UXB B;  1M93 A;  2ZKO A;  4UVC A;  3VBB A;  4DUZ O;  1BT8 A;  1GN6 A;  2EIN C;  1Q81 W;  1JR9 A;  5JCO C;  3ETD A;  4RWU A;  2OWO A;  2QDO A;  2ZNJ A;  4DR5 B;  4CBC A;  2FTK A;  2ZD9 A;  3RBZ A;  3W7S A;  4DV0 B;  3D36 A;  1CPY A;  5CA3 A;  1KYO F;  2ZDI C;  1K4C C;  2WLN A;  4WFF A;  4LH6 A;  1AR4 A;  1S5J A;  1LUV A;  3GWK C;  3K59 A;  2Z5U A;  2IJH A;  4TV8 A;  2D2C B;  4GX1 A;  5JH7 B;  1P84 F;  2Q6A A;  2HVJ C;  4XBF A;  2A79 B;  5JVD B;  4O4J A;  2EZO A;  1B6Q A;  2H3O A;  1XUQ A;  4NTX A;  4JI5 O;  4U7O A;  2CH7 B;  1VEW A;  3W7X A;  3JYC A;  1N32 O;  3HKB B;  4B3S O;  3ABU A;  3BRC A;  1X59 A;  3FFQ A;  2X7R B;  2ZE5 A;  3OE7 G;  4HAM A;  5GON A;  5KA5 A;  3G4S V;  5LOV A;  2ADQ B;  2ZQM A;  1NTM H;  1IZ3 A;  2ADP A;  1M56 C;  4O2B B;  4ABM A;  2KB1 A;  1VQ5 V;  2QR4 A;  4YJ3 A;  4LP8 A;  3T1H B;  4KXR A;  3F7V C;  4PDR A;  4OPH A;  2LGW A;  1BCC H;  2VQE B;  2ZE6 A;  1M57 B;  3TGU H;  4CS2 A;  5LP6 C;  3AG1 C;  5AG2 A;  4BR6 A;  4ZOL A;  1H2G A;  3JAK B;  4P9P A;  4JI5 B;  1ZL8 A;  1GTO A;  1QLE C;  5B1O A;  3L74 H;  3Q4H A;  2WA4 A;  1N32 B;  1V55 B;  2GV9 A;  5KHG A;  2HJD A;  4QNH B;  3A2F A;  1FPO A;  3JD0 A;  1OCO C;  1IBL O;  4I50 B;  2R72 A;  5EK0 A;  2UXD O;  3SPH A;  2R9A A;  4QIW F;  4I9Q A;  2MW2 B;  3J81 N;  1PL0 A;  1OCC C;  3ZIA G;  1LUW A;  1KB9 F;  4TQF A;  2Q68 A;  1KQS U;  4NKG B;  3OTO B;  4DRX A;  1VQM V;  1UJW B;  4KFM A;  3B8M A;  3ZRX A;  1MZF A;  4P9O A;  1PNM A;  4TT3 G;  1JFF B;  2DYS C;  1WA8 B;  2AXT Z;  2JGD A;  5LYJ B;  1QNM A;  4DV2 B;  5EIB C;  1US6 A;  5LXT A;  1E79 G;  2AHZ A;  1LNQ A;  3AG4 B;  4F4L A;  3OTF A;  4LFC B;  1IXM A;  4G28 B;  1BL8 A;  3I5D A;  2EIL C;  1F4N A;  1IBL B;  2HHH B;  2YIB D;  2UXN A;  3BAB A;  1XNQ O;  3OMA B;  3ZRW B;  3JAR B;  4Q20 A;  4CH4 A;  4B3R O;  2QM7 A;  2P4V A;  2YI9 A;  1XMQ O;  2WLI B;  1N33 O;  3D36 C;  3LNN A;  3N2K A;  4IIJ B;  1I5Y A;  4I0X B;  3ABT A;  3B40 A;  3SYO A;  4FJC C;  1M9N A;  1JJ2 U;  3KG2 A;  1FJG O;  2Z0A A;  4I55 B;  1XEQ A;  2FL4 A;  2IU0 A;  1F51 A;  2P4K A;  2P90 A;  3AK2 A;  4IYH A;  1FYJ A;  1G1X B;  5CBF A;  2QWO B;  1N0N A;  3QTC A;  3RYC B;  3G67 A;  1E1R G;  2QSA A;  3ZED A;  3RW0 A;  5CA1 A;  2LFR A;  2AGA A;  4MVO A;  2Y69 C;  1JA8 A;  5CN0 A;  1VQO V;  1QVG U;  1CEZ A;  1HNZ O;  2BSK A;  4B7E A;  4PI0 A;  3WU2 Z;  4D7S A;  3W7U A;  3BPZ A;  1SET A;  5IYD O;  5BY1 A;  4HZ3 A;  1HW7 A;  5BMV B;  2N05 A;  3E83 A;  4JF3 A;  1XMQ B;  2XAQ A;  5KMG B;  4DR2 B;  2CUG A;  4NB5 A;  2YUA A;  5E79 Z;  2OIG A;  1FJG B;  4UCS A;  3X2Q B;  5BR8 B;  3VQV A;  4X62 B;  2R70 A;  1MA1 A;  1R3L C;  1RSO A;  2JRI A;  1YTF B;  3CD6 V;  1NBM G;  4JI0 O;  2CDY A;  4RQE A;  5D5P A;  1OCR B;  3ZHV A;  2EIJ B;  3P30 A;  3K5M A;  2HVK C;  1SKV A;  4MVS A;  4X1K A;  4PHZ A;  2Y48 A;  4Z2W A;  4GX5 A;  3BAA A;  3F5T A;  1N36 B;  1Q90 D;  2YIB A;  4X64 O;  3P3P A;  2QJ1 A;  3AG3 B;  3JSL A;  2EBO A;  2V7Q G;  3LDC A;  1YHQ V;  1Y66 A;  4Q6G A;  2P7T C;  4I4T B;  1TVK A;  1GN2 A;  3ZRV A;  1FXH A;  5L3C A;  4X1I B;  1H8H G;  4UCT A;  4KHP B;  3OD4 A;  4LFA B;  4EB6 A;  1M5I A;  2P67 A;  1HDJ A;  3RYH B;  3N27 A;  4FM1 A;  4U7N A;  1PP9 H;  4JI2 B;  1W0K G;  4JYY A;  1H2K A;  4UFZ A;  4MT8 A;  1K9M W;  4JI1 B;  1YEW A;  1OJH A;  5J2T A;  4EFB A;  2HEP A;  2JJ1 G;  2DE0 X;  1PV0 A;  4DV1 O;  1XHX A;  1K33 A;  4HBN A;  1NVP D;  4AHC A;  1KU9 A;  4KP4 A;  2OTJ V;  4O4H B;  4AQY O;  1BSM A;  4JPR A;  1ZX3 A;  4JI8 O;  5LMN B;  5L3G A;  4DV7 B;  1BHA A;  3CX5 F;  2WLL A;  1NI8 A;  1FXV A;  3CME V;  3HB3 B;  4JI4 O;  3E89 A;  4PEL A;  3S3X A;  3SJQ C;  1F7Y A;  2GSM B;  1FFX B;  3K57 A;  3BHP A;  1BE3 H;  2DW4 A;  4O4I A;  5L3B A;  2CTP A;  2N04 A;  4DK0 A;  1SQX H;  1S3J A;  3HKE A;  5JQG B;  1VQ9 V;  1PD3 A;  2EIK C;  3WG7 C;  4JAA A;  4YIO A;  4H37 A;  4W4L A;  1WB8 A;  3G6E V;  3WB1 A;  3H9V A;  3K79 A;  4FK5 C;  5LGT A;  1Q7Y W;  5JH7 A;  2EIM C;  2X6A A;  3TK1 A;  1HR0 O;  4DV1 B;  1YF2 A;  5JVD A;  2WLJ A;  2GTS A;  3VOU A;  2CE4 A;  4JI7 B;  4JI3 O;  1UFI A;  2NLJ C;  3OUF A;  2LP7 A;  1XIL A;  1R3I C;  4BAY A;  1SF9 A;  1F23 A;  3HKB A;  3HKD B;  1SER A;  4RUF A;  2UUA O;  2LGQ A;  2P5O A;  1G4Y B;  2ZM6 O;  2E75 B;  4WCE V;  3DC5 A;  4OX9 O;  2A3Q A;  1XOU A;  4K3A A;  4HNA A;  1NU1 H;  2V4D A;  2YIA A;  2PY5 A;  1YCI A;  5KX5 A;  5GTH Z;  2Q5Z A;  1K8A W;  5JWP A;  2Q7H A;  2ZIN A;  3B77 A;  4NR1 A;  3TXQ A;  3SPC A;  3TCU A;  4JZ2 A;  4P2Z A;  3FYI B;  1K73 W;  1DF5 A;  4CH3 A;  2Q7E A;  4I5S A;  2EUL A;  1NT2 B;  4U3J A;  4HYO A;  4LCU C;  3K5O A;  1RP3 B;  1EFR G;  1GKF A;  3JAS B;  5EIB D;  1TAE A;  4QJF B;  3T4Z A;  4NXM B;  1VQ4 V;  4K8X A;  1JMK C;  2UUA B;  2YEV A;  2YI8 A;  1GO3 F;  4CC5 A;  2ZM6 B;  5ITZ B;  2YDE A;  4JTA B;  3OT7 A;  4DR7 O;  4OX9 B;  3AK3 A;  5GTI Z;  2E5L O;  3OMI B;  4J7J A;  1FXK B;  2HJF C;  4FM2 A;  1KP2 A;  5EC1 C;  2VQF O;  4UVB A;  3E22 A;  2LW7 A;  1RPR A;  1ZTE A;  3IC7 A;  2BOC C;  3SPJ A;  4B7K A;  5LP6 A;  4DR6 B;  2OT5 A;  2NN4 A;  3K06 A;  1SA0 B;  4TOI A;  2ZIM A;  4UCR A;  3ASO C;  4DV4 O;  4Z1V A;  3SDL A;  3QVN A;  1XBL A;  2XAS A;  3CCE V;  3FD9 A;  2UXB O;  4X20 B;  4J80 A;  5IY5 C;  4ICG A;  2DN9 A;  2F95 B;  4WFG A;  4TV9 B;  1VIB A;  4DR5 O;  3GWO A;  4GKJ B;  2WA3 A;  2E5L B;  1XL4 A;  1KKC A;  2HLD G;  4N23 A;  2WLI A;  2B9Z A;  5TIS Z;  3RT3 C;  4I0X A;  3ASN B;  3ZRS A;  4JV5 B;  1Q8I A;  2JDI G;  3H1L H;  3DTU B;  4GCZ A;  1MMM A;  1GK9 A;  4H44 B;  1JVM A;  3CRC A;  4ZI7 B;  2XND G;  1AVM A;  3TJT A;  4WBN B;  1IDS A;  3EHB B;  3G71 V;  2IW5 A;  4PA4 A;  3OEH G;  3ETE A;  2WWW A;  2OIE A;  4JAV A;  5B1A B;  5LA6 A;  2A0L A;  4LR3 A;  3ZS8 C;  1JX9 A;  4MTX A;  2OTL V;  4EKW A;  1QVF U;  4LWS B;  3S3W A;  3T1C A;  1GMG A;  2RMK B;  3T1Y B;  3OEE G;  5BMV A;  3E86 A;  2HP8 A;  4I9W A;  2LO1 A;  1NR7 A;  1Q3E A;  1BQ0 A;  2N74 A;  1O9H A;  2WSS G;  5BXZ A;  3T1H O;  3ETG A;  3GB7 C;  1NTZ H;  3ZMT A;  3QG5 A;  2VQE O;  4X66 B;  1Q86 W;  3EFF K;  3DXR B;  3N2G A;  5E1A C;  3M99 B;  2ZXW B;  2PI5 A;  3IJ4 A;  2X6B A;  3K3W A;  1M57 C;  5J2U B;  1YJ9 V;  3RYI B;  5KHJ A;  5CA0 B;  3DGE A;  1P49 A;  5IJ0 B;  1R3J C;  3O9O A;  4KL1 A;  4IYI A;  2XOK G;  4DUY B;  3E8G A;  4LF7 B;  1SC5 B;  1XHZ A;  3F7Y C;  5K1X A;  5FLX N;  1V54 B;  2A06 H;  4IGG A;  4MTG A;  4BW9 A;  4XDJ A;  4DR4 B;  5IJ9 B;  3ZHT A;  1P4R A;  3E8H A;  1ZSP A;  3L70 H;  5KA6 A;  2HKO A;  1NH2 B;  3NR7 A;  3AG2 B;  2HR3 A;  4O2A B;  1L8D A;  1XI1 A;  3CB2 A;  4J7K A;  4A5U B;  3RYH A;  3OGC C;  3OTO O;  1F4M A;  3FB7 C;  4BIO A;  4FIP C;  2A9H A;  4E2L A;  4BW5 A;  1Y76 A;  4LF4 O;  2V1D A;  3JAM N;  1K97 A;  5CBH A;  3VQY A;  2ZNI A;  4DV2 O;  1TA8 A;  2F23 A;  2M6Y A;  4DO2 A;  3JAW B;  4R7C A;  3B4S A;  5B3S B;  1FAF A;  4LFC O;  1Q6I A;  1W59 A;  3AG4 C;  3E8B A;  1SQF A;  1EZJ A;  5IDJ A;  2Y4U A;  5D5Q A;  2HHH O;  2DYR B;  3H01 A;  2ZE8 A;  1FFX A;  2YSU B;  5IWA B;  1H2M A;  1K5S A;  3STL C;  3FAV B;  3RN4 A;  3ZHR A;  2BE3 A;  1H8E G;  5KAI Z;  5JQG A;  4B3M B;  3GVM A;  4LF8 B;  3EVK A;  3ICX A;  1DK1 A;  3M8A A;  1Y4M A;  1QCE A;  2RCV A;  2QGN A;  5DEC A;  2QA4 V;  5CMU A;  5IE9 A;  4LF4 B;  2RJZ A;  4PA6 A;  4F6R B;  2Q73 A;  5H2F Z;  1TUB B;  5JJE B;  2IH3 C;  3C3S A;  1GM9 A;  3CCV V;  3CJH B;  3UT5 A;  3TET A;  4GLX A;  3H1J H;  1J5E B;  2AZ0 A;  1FFT B;  5C8Y A;  1PNL A;  2CAZ C;  1IUR A;  1VMG A;  4JYC A;  1K7D A;  1R6K A;  4F6E A;  1PL4 A;  4X1Y B;  3BY6 A;  3ZMS A;  4DR2 O;  4CC6 A;  2E76 B;  1EN5 A;  5CB4 A;  1QR8 A;  5BZB A;  3LDE A;  4CS3 A;  1N34 B;  4PI2 A;  4ZHQ B;  1ROP A;  5BR8 O;  4WF9 V;  4X62 O;  3X2Q C;  2G38 A;  4X88 A;  1K4D C;  1D5N A;  2GUZ B;  1LR1 A;  2P6J A;  1COW G;  3TXS A;  3JAL B;  1OCR C;  3IAY A;  4IHJ A;  2EIJ C;  1VQL V;  5EYP A;  4QE7 A;  2KG7 B;  4QPK A;  4R8C A;  2VWJ A;  3HKC B;  3HPL C;  1ZUQ A;  2RN9 A;  2IM9 A;  2ZR3 A;  1D2D A;  3OR6 C;  2YID A;  2W6J G;  3CHX A;  3T4D A;  1N36 O;  2OCC B;  1BMF G;  1BGY H;  4WFB V;  4DR1 B;  3ZHQ A;  3ABK B;  1OCZ B;  2RQ6 A;  1AI7 A;  1I0H A;  1WLE A;  2M7W A;  2DYS B;  2F4V B;  3AG3 C;  3KZI Z;  5ITZ A;  4X9Q A;  1H38 A;  2ZE7 A;  4UB8 Z;  5FNV A;  2ETN A; 
#chains in the Genus database with same CATH homology
 2LW7 A;  1IBM O;  1HR0 O;  1N32 O;  2DOS A;  4B3S O;  5LMU O;  2VQE O;  4LF6 O;  1DK1 A;  1X59 A;  3M8A A;  4KHP O;  3F5T A;  1YZB A;  1J5E O;  4LFA O;  4DR4 O;  4GKJ O;  1AIL A;  4DV0 O;  5A2Q N;  4JI3 O;  4X64 O;  4DV4 O;  4K0K O;  1AB3 A;  3SDL A;  4JV5 O;  3R66 A;  4JI2 O;  1XNQ O;  4B3R O;  4DV6 O;  2UXB O;  4JI1 O;  1XMQ O;  2UUA O;  1N33 O;  2ZM6 O;  1N34 O;  5FLX N;  3O65 A;  1FJG O;  2UU9 O;  4OPH A;  4DR5 O;  4OX9 O;  2Z0A A;  1R6T A;  1XEQ A;  5LMN O;  1FYJ A;  1G1X B;  4DV7 O;  2UXC O;  3J7A U;  3RT3 C;  4OPA A;  4NXM O;  2ZKO A;  4DUZ O;  4GKK O;  4DR2 O;  2AGA A;  4DV1 O;  4DR3 O;  1HNW O;  1R1B A;  4A5U B;  5BR8 O;  1HNX O;  4JI6 O;  3T1Y O;  2UUB O;  4X62 O;  1HNZ O;  4AQY O;  3OTO O;  4JI8 O;  4YHH O;  4DR1 O;  1IBL O;  1KUQ A;  1A32 A;  1IBK O;  2F4V O;  4LF4 O;  2UXD O;  4JI4 O;  5IWA O;  3JAM N;  2FKX A;  5IT9 N;  5BY1 A;  1FKA O;  1F7Y A;  4NXN O;  4DV2 O;  3J81 N;  4JYA O;  4DV5 O;  4B3M O;  1XNR O;  2UUC O;  1I94 O;  4LF5 O;  4LF8 O;  4DR6 O;  4X66 O;  1D2D A;  4LFB O;  5LL6 Y;  2DJV A;  4X65 O;  4LFC O;  4DR7 O;  5H5N A;  2E5L O;  4YY3 O;  1NS1 A;  1N36 O;  4JI7 O;  1XMO O;  2JRI A;  4DV3 O;  4LF9 O;  2HHH O;  4JI0 O;  2VQF O;  2N74 A;  4DUY O;  4JI5 O;  3J80 N;  5BXZ A;  4B3T O;  4LF7 O;  3T1H O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...