4JI6D

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
208
structure length
208
Chain Sequence
GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRPSDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRLDNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQLVIEFYSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 59
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00163 Ribosomal_S4 Ribosomal protein S4/S9 N-terminal domain
D PF01479 S4 S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1050.10 Mainly Alpha Orthogonal Bundle Ribosomal Protein S4 Delta 41; Chain A, domain 1 Ribosomal Protein S4 Delta 41; Chain A, domain 1 4ji6D01
3.10.290.10 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A RNA-binding S4 domain 4ji6D02
4JI2D 4DR7D 4OUDA 4YHHD 1J5ED 4B3MD 4X64D 3HP7A 4B3TD 2UXCD 1KSVA 4B3RD 4DV5D 1HR0D 4LFAD 1N34D 1KSKA 1XMOD 4JI6D 4NXND 5IWAD 2ZM6D 4X65D 4DV1D 1HNXD 2E5LD 4LF5D 2JANA 4B3SD 1N36D 4JI1D 4DR5D 1C05A 2UXDD 3T1HD 1JH3A 4JI4D 2VQED 4LFBD 2KTLA 3DH3A 1VIOA 1IBMD 4K0KD 4DR6D 1H3FA 1IBKD 2UU9D 1H3EA 4GKKD 4JI8D 4YY3D 1N32D 1C06A 1FJGD 4DR2D 4DV0D 2UXBD 1KSLA 4DV4D 1P9KA 4LGTA 4NXMD 3KBGA 4DR1D 1I94D 4LF6D 4KHPD 2ISTA 4JI0D 4GKJD 5LMND 4X62D 4DV7D 4LF7D 5LMUD 4DV6D 1HNWD 2K6PA 4JI3D 4LFCD 4DV3D 1FKAD 2VQFD 4DUYD 4LF8D 1XNRD 2HHHD 4X66D 4JI5D 4DR3D 1HNZD 2F4VD 1N33D 2UUCD 2UUAD 4DR4D 4LF9D 4JYAD 4JV5D 4DV2D 3T1YD 3OTOD 1DM9A 2UUBD 4LF4D 4JI7D 1XMQD 1XNQD 4DUZD 1IBLD 4AQYD 4OX9D 5BR8D
chains in the Genus database with same CATH superfamily
2ZTBA 4JI2D 4DR7D 4OUDA 4YHHD 1J5ED 4B3MD 3JAME 4X64D 3FN1A 3HP7A 4B3TD 2UXCD 1KSVA 3CMMA 4B3RD 4DV5D 1HR0D 4LFAD 1N34D 1KSKA 4W5VB 1XMOD 4JI6D 4NXND 5IWAD 2ZM6D 4X65D 4DV1D 1HNXD 2E5LD 4LF5D 2JANA 4B3SD 3ONHA 1N36D 4JI1D 4DR5D 3J81E 5FLXE 3ONGA 1C05A 2UXDD 3T1HD 1JH3A 4JI4D 2VQED 4LFBD 2KTLA 3KYDB 3DH3A 1VIOA 2NVUB 1IBMD 4K0KD 4DR6D 1H3FA 1IBKD 1Y8RB 2UU9D 1H3EA 4GKKD 4JI8D 4YY3D 1N32D 1C06A 1FJGD 4DR2D 5KNLA 4DV0D 1Y8QB 4II3A 2UXBD 1KSLA 3J7AF 4DV4D 1P9KA 4LGTA 3J80E 4NXMD 3KBGA 4DR1D 1I94D 4LF6D 4II2A 4KHPD 2ISTA 4JI0D 4GKJD 4NNJA 5LMND 4X62D 4DV7D 4LF7D 5LMUD 4DV6D 1HNWD 5LL6S 2K6PA 5A2QE 4JI3D 4LFCD 4DV3D 1FKAD 1Y8XB 2VQFD 4DUYD 4LF8D 1XNRD 2HHHD 4X66D 4JI5D 4DR3D 3KYCB 5IT9E 1HNZD 2F4VD 1N33D 2UUCD 2UUAD 4DR4D 4LF9D 4JYAD 4JV5D 4DV2D 3T1YD 2L3NA 3OTOD 1DM9A 2UUBD 4LF4D 4JI7D 1XMQD 2I1SA 1XNQD 4DUZD 1IBLD 2LQ7A 5FQ2B 4AQYD 4OX9D 5BR8D
chains in the Genus database with same CATH topology
4JI2D 4DR7D 4OUDA 4YHHD 1J5ED 4B3MD 4X64D 3HP7A 4B3TD 2UXCD 1KSVA 4B3RD 4DV5D 1HR0D 4LFAD 1N34D 1KSKA 1XMOD 4JI6D 4NXND 5IWAD 2ZM6D 4X65D 4DV1D 1HNXD 2E5LD 4LF5D 2JANA 4B3SD 1N36D 4JI1D 4DR5D 1C05A 2UXDD 3T1HD 1JH3A 4JI4D 2VQED 4LFBD 2KTLA 3DH3A 1VIOA 1IBMD 4K0KD 4DR6D 1H3FA 1IBKD 2UU9D 1H3EA 4GKKD 4JI8D 4YY3D 1N32D 1C06A 1FJGD 4DR2D 4DV0D 2UXBD 1KSLA 4DV4D 1P9KA 4LGTA 4NXMD 3KBGA 4DR1D 1I94D 4LF6D 4KHPD 2ISTA 4JI0D 4GKJD 5LMND 4X62D 4DV7D 4LF7D 5LMUD 4DV6D 1HNWD 2K6PA 4JI3D 4LFCD 4DV3D 1FKAD 2VQFD 4DUYD 4LF8D 1XNRD 2HHHD 4X66D 4JI5D 4DR3D 1HNZD 2F4VD 1N33D 2UUCD 2UUAD 4DR4D 4LF9D 4JYAD 4JV5D 4DV2D 3T1YD 2L3NA 3OTOD 1DM9A 2UUBD 4LF4D 4JI7D 1XMQD 1XNQD 4DUZD 1IBLD 4AQYD 4OX9D 5BR8D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI2 D;  4DR7 D;  4OUD A;  4YHH D;  1J5E D;  4B3M D;  4X64 D;  3HP7 A;  4B3T D;  2UXC D;  1KSV A;  4B3R D;  4DV5 D;  1HR0 D;  4LFA D;  1N34 D;  1KSK A;  1XMO D;  4JI6 D;  4NXN D;  5IWA D;  2ZM6 D;  4X65 D;  4DV1 D;  1HNX D;  2E5L D;  4LF5 D;  2JAN A;  4B3S D;  1N36 D;  4JI1 D;  4DR5 D;  1C05 A;  2UXD D;  3T1H D;  1JH3 A;  4JI4 D;  2VQE D;  4LFB D;  2KTL A;  3DH3 A;  1VIO A;  1IBM D;  4K0K D;  4DR6 D;  1H3F A;  1IBK D;  2UU9 D;  1H3E A;  4GKK D;  4JI8 D;  4YY3 D;  1N32 D;  1C06 A;  1FJG D;  4DR2 D;  4DV0 D;  2UXB D;  1KSL A;  4DV4 D;  1P9K A;  4LGT A;  4NXM D;  3KBG A;  4DR1 D;  1I94 D;  4LF6 D;  4KHP D;  2IST A;  4JI0 D;  4GKJ D;  5LMN D;  4X62 D;  4DV7 D;  4LF7 D;  5LMU D;  4DV6 D;  1HNW D;  2K6P A;  4JI3 D;  4LFC D;  4DV3 D;  1FKA D;  2VQF D;  4DUY D;  4LF8 D;  1XNR D;  2HHH D;  4X66 D;  4JI5 D;  4DR3 D;  1HNZ D;  2F4V D;  1N33 D;  2UUC D;  2UUA D;  4DR4 D;  4LF9 D;  4JYA D;  4JV5 D;  4DV2 D;  3T1Y D;  3OTO D;  1DM9 A;  2UUB D;  4LF4 D;  4JI7 D;  1XMQ D;  1XNQ D;  4DUZ D;  1IBL D;  4AQY D;  4OX9 D;  5BR8 D; 
#chains in the Genus database with same CATH topology
 2ZTB A;  4JI2 D;  4DR7 D;  4OUD A;  4YHH D;  1J5E D;  4B3M D;  3JAM E;  4X64 D;  3FN1 A;  3HP7 A;  4B3T D;  2UXC D;  1KSV A;  3CMM A;  4B3R D;  4DV5 D;  1HR0 D;  4LFA D;  1N34 D;  1KSK A;  4W5V B;  1XMO D;  4JI6 D;  4NXN D;  5IWA D;  2ZM6 D;  4X65 D;  4DV1 D;  1HNX D;  2E5L D;  4LF5 D;  2JAN A;  4B3S D;  3ONH A;  1N36 D;  4JI1 D;  4DR5 D;  3J81 E;  5FLX E;  3ONG A;  1C05 A;  2UXD D;  3T1H D;  1JH3 A;  4JI4 D;  2VQE D;  4LFB D;  2KTL A;  3KYD B;  3DH3 A;  1VIO A;  2NVU B;  1IBM D;  4K0K D;  4DR6 D;  1H3F A;  1IBK D;  1Y8R B;  2UU9 D;  1H3E A;  4GKK D;  4JI8 D;  4YY3 D;  1N32 D;  1C06 A;  1FJG D;  4DR2 D;  5KNL A;  4DV0 D;  1Y8Q B;  4II3 A;  2UXB D;  1KSL A;  3J7A F;  4DV4 D;  1P9K A;  4LGT A;  3J80 E;  4NXM D;  3KBG A;  4DR1 D;  1I94 D;  4LF6 D;  4II2 A;  4KHP D;  2IST A;  4JI0 D;  4GKJ D;  4NNJ A;  5LMN D;  4X62 D;  4DV7 D;  4LF7 D;  5LMU D;  4DV6 D;  1HNW D;  5LL6 S;  2K6P A;  5A2Q E;  4JI3 D;  4LFC D;  4DV3 D;  1FKA D;  1Y8X B;  2VQF D;  4DUY D;  4LF8 D;  1XNR D;  2HHH D;  4X66 D;  4JI5 D;  4DR3 D;  3KYC B;  5IT9 E;  1HNZ D;  2F4V D;  1N33 D;  2UUC D;  2UUA D;  4DR4 D;  4LF9 D;  4JYA D;  4JV5 D;  4DV2 D;  3T1Y D;  2L3N A;  3OTO D;  1DM9 A;  2UUB D;  4LF4 D;  4JI7 D;  1XMQ D;  2I1S A;  1XNQ D;  4DUZ D;  1IBL D;  2LQ7 A;  5FQ2 B;  4AQY D;  4OX9 D;  5BR8 D; 
#chains in the Genus database with same CATH homology
 4JI2 D;  4DR7 D;  4OUD A;  4YHH D;  1J5E D;  4B3M D;  4X64 D;  3HP7 A;  4B3T D;  2UXC D;  1KSV A;  4B3R D;  4DV5 D;  1HR0 D;  4LFA D;  1N34 D;  1KSK A;  1XMO D;  4JI6 D;  4NXN D;  5IWA D;  2ZM6 D;  4X65 D;  4DV1 D;  1HNX D;  2E5L D;  4LF5 D;  2JAN A;  4B3S D;  1N36 D;  4JI1 D;  4DR5 D;  1C05 A;  2UXD D;  3T1H D;  1JH3 A;  4JI4 D;  2VQE D;  4LFB D;  2KTL A;  3DH3 A;  1VIO A;  1IBM D;  4K0K D;  4DR6 D;  1H3F A;  1IBK D;  2UU9 D;  1H3E A;  4GKK D;  4JI8 D;  4YY3 D;  1N32 D;  1C06 A;  1FJG D;  4DR2 D;  4DV0 D;  2UXB D;  1KSL A;  4DV4 D;  1P9K A;  4LGT A;  4NXM D;  3KBG A;  4DR1 D;  1I94 D;  4LF6 D;  4KHP D;  2IST A;  4JI0 D;  4GKJ D;  5LMN D;  4X62 D;  4DV7 D;  4LF7 D;  5LMU D;  4DV6 D;  1HNW D;  2K6P A;  4JI3 D;  4LFC D;  4DV3 D;  1FKA D;  2VQF D;  4DUY D;  4LF8 D;  1XNR D;  2HHH D;  4X66 D;  4JI5 D;  4DR3 D;  1HNZ D;  2F4V D;  1N33 D;  2UUC D;  2UUA D;  4DR4 D;  4LF9 D;  4JYA D;  4JV5 D;  4DV2 D;  3T1Y D;  2L3N A;  3OTO D;  1DM9 A;  2UUB D;  4LF4 D;  4JI7 D;  1XMQ D;  1XNQ D;  4DUZ D;  1IBL D;  4AQY D;  4OX9 D;  5BR8 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...